ELF( 4N4 ( q"q""BBY!"\\@0 6QQ O @@( @0 fH!@P@Q?H3}Р -L⸁N/c,e@bcmain() returnedc   ! X(@@T @@ 0/ccT (/// P--Nd@b@-@PL00S @0080 0 0 0 iЍXbBBT >P/00S 000/XbdA-@MpzP @ލ0s ᢆPP ʣ0 00`V ]z h@  0R(0R gOoBr >edAu >\ 4S/0!8 00 (   !/@b@d`ddd@-dziP|僬0 !!X0T0P0H000, !  ! > >@b@d`dddG-bM0SpPpP7P y厭ЍG输 kl@T yPy s  P 'gPP 00 B4R  04!@a0C0 NlT k@ >lP@ ?lyP yP yP P kyP|yPlyPP zyPwy 8$ 0@ @d >>8dr > > > > >@-<@yP^y$yPy@ U>>>@-l00: SLT 88S!~W0YԺ@* 00 Rc@B@-0@0PS@!@/ 4Sʀ0! 0    !B? SO:0 !! HD}<z80u\cd-@b@d`ddd@>b>>@B> P00  /$@$0P  000/dPd<0 P0/S/0CQ/cs@-A0S<`P`tP. tP, tP P0000 8CPЍp@ǵxtP`h@0: SR P0RЍp@M@P8P0Ѝpb>>>p@Xb>c` @ @O-Mh`&pP{ ?WMZ!7GR  Eu~P00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0̸@6>tP L "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<S$1)0C$1a0!10C0PU0S 9#9S  @P :$1I)0C*$1,`1,!p1c001 1 @P :|5*$10C$1` 1 @P :$1Du*0C$1`0! 10C01 @ P:$1t*0C$1`0! 10C01 @ P:$1t*0C$1`0! 10C01 @ P:$1lt*0C$1`0! 10C01 @ Ps:$1*0C$1v`1! 10C11 @ Pa:$1)0C$1d`P#Hq㰃 uHW#H#Hx#xHp#pH$p`3`` \3!XT3 0C 0p 0H! 0I 0I H": H": Ht: H\: H0p09 H 0p0 :HXp!sI!p0 ?H<!L$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/x?B, 1I0II010! ,1,! (1(!h$~)B! 1"xLF Ѝ>@> 0 DSBOcdᆳb>pcAiPb)i?dc`>>cccccccLc`c@tccc,e BBcԍbc@b(b $b @bp @- @0 )PЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ sTTU   ,0PP<0P 008:q@P`\  0<0 0^*0 00 \S 0 >O-0`(Pp (X@ nP XPPP00 iyP 0 0tayP PP0 0@SyPp  p@?P 2>8>>>G- @3`Pd1.0\\$p0PfGpU' 0SI 00P(0P pW4 pGW=f/r 0<0 06003/fFP000( 0 0# yP  xP8S P9P f/r$06P`  `ЍC>WEVZ>o>A-` 0pd 0@h 0Pl0`S X, P I/ 0V 048<S Q PU nP0 R P  0`PU0 0 0` 04 8 <0A>0(UPXá R  $  (3/O-@M`Pp 8](0P  P0<0((S 2<0T0Q00 0 0@4pI08(`S,P 0@P P00 PPX0  80@@!b30X0U{P㰉,  0 0)0#@P 8!G0<Ѝ谁30 06{P[ 1   0 0v P9XP 0J0 D=U 00 < P @@bcx@D c >@-@p,M `P%](4I@0(`S00,PP 00S00 0|!000F,Ѝ t@-0@-@pP0 0 000@p@-0M`Ps@qҦP00 0 0000 0`P 0Ѝp@(Pm0(@400800@00D00H00L00P0@s0 00 0P\00T0  0 0(00< ,00 c0Ѝp>>>       >+,00 SP/o/cA-P0@Q`0p$ 7/0 V0`08$ A#8/p@-0@P0` 6/05`8 p@#8/p@-h0P@ TT0pH00 S /o" p@Spcbc` s@-`P>s`0@0廦 qsPB 00,R P, 305/PP Ѝp@a`0 SrP {\0@X0Ѝp@ @0R Ѝp>>@>ccb` @-@,`P/o@"S$5cp@-`PL`@Pp  E$00Spp p@:$5cp@-P``@PpIFU  ' p@"  $5cL0 H0R/p@-P4_@Pp&U p@ c` $5cp@-P<_@,_P  Tp p@$5cp@-P<_@,_P Tp p@$5c@-@_P @ $5cP0 L0R/p@-P`8_@Pp /op@"c` $5c80 40R/@-@ |_P @c` $5c0 0R/A-i_PP 003/X@  ` 08#8A/`` 0 8/̶ Ao0 0c` $5cp@-3_P/_@Pp0 0`6/,P0``6/0 0P5/,p0`p@/$5c0 0R/p@-_P_U@ 0$ 0`6/3>$ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/c` $5cp@-d^PT^U@ $ ``06/Tp0`$ p@/$5c/p@-0 P T@``06/0 ``6/`0p@ /p@-P@Nq@0 T000S 0d00h00p0x0h0x0p@] S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` c( A-0PST@ Sq p PBu 00 `0*b6/`P p  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@>->@bp@-P0 ` T@003/U U 0Ȣ  p 003/pS> @-00 s Ѝ 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddA-0`@TP Vp V hl00 3/P0T00 T0 `@4/A0T0 `@3s>|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~->@-@00 S @0 DP@oЍc@-0 00  0 0 0ЍA-PS@`p q P PAW    P UAp>>p@-P`oP0|P@0@SP}`00 P0@   I0 0p>bA-p`\PP 0S  W000V0000 @1 #W  R0 W00S 0$2V  R0 0#V00S0 At5cb@-@w\0P Rl T0@0@000@0#3T  R0 0#T00S0 @@L5cb@-@O\0P Rh T0000  "!0"T00S0 T  R @%5cb@-@(\0P Rh T0 0 000 02 #T  R0 T00S0@ 5cb 0o/c/0@-0M P@ 0ZP 000 ^Ѝ0(2 p@-0@Tp@t ڡ㥫$0dP 5/0 dP5/00 0p@c%>A-(MPn@D1P<4]0100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍA菡05p`WV xxp 9Pd~ 'W0 0@0 0yY(ЍcD>cbF>pA5 [>02 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`ddd@-@;A-0@TANA0P`dp 7/U 劯UA蒯僯UU U 0dP5/w0dP 5/0 4P5/ c}>p@-0@TxP\AΠpPP0 4P5/ 0 4P5/P= ;9c>C-1M@TiA⨠Ѝpb0` dP5/ 0dP5/P pPP p d09/0 49/ 0 49/ 0 49/PU 0 dP5/0?<#c>A-1@T P<P0` dp7/ 0dp7/ 嬮媮嵮㭱0dp 7/0 4P5/ 㜱0 4P5/ 0 4P5/P儮c>O-,1P@`(唭,呭0厭4勭0p,(04^\ g _@P0 S X(O T(X P[P0Q B ( ,04OT?c0S@- S S@@X嘟>0 @o/c@-ݴ@PЍG-@Ђ2PRp`0CRdh2R 3C7CR0 0 $ G,,2RW 3C7CR008#8S800 06 &6004004 0(0L00P0  , Q  !% b ,R!X , % , h0l0& d  '!00 !11  0P008#8S308#8S0x`0 p6 p(`8p<600500``5008#8Ss308#8SmSW HdHd>> >@-@`kPh @5`0`` 0X 0P0` P00Z04 4yP⾞Ѝp,>bH>pm,bh? ? @-ok륳@-hk@ᑳ00: S/凱c,>b00@o/c` @-\@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gy2RS 3C7CR008#8S800 05 &51414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011,P008#8S308#8S0x`0 p5 h(`8p<5151``5008#8Sy308#8SsSW HdHd|>> >@-@`jP@d `0`` 0X 0P0` P00Y04 4wP⼝Ѝp>b>pm,XbpC C @-mjv@-fj@j0 0R/  Yc` >xbp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f@-@/4/@-@/@-@/@-@/@-@/@-@/@-@/A-PpX`$0@ 2/ p 0S0@0 @0000@A-P M@`e0 0 0  p7/0P   p*7/0P  娜 Ѝ "( p7/ P\ 000 00@001 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd  C+|000040J> 0 0000Ȅ 8/0$@0\0`  (啜>>>6>[>c > 0 /c/$ R/P//C-p0MS *P`  7 @dP 001Q0000!T0    *40 00 d6/00@PPЍ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0"" //@- tdo>@-@ 00 S@@cQA-P@@@DT@ 0S 0S`T p` 00  `T@T@A-@1hP@尛`0p0```p0P0 PTX0x PhN0X P@D04 PA9>>cM xM >M M @-g@A@-g@@-g@ |0 0@-g0 0@r0 0@l0P/fc@-<0@TP [0 0 @Sc0P/QJcp@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  ppcRW SW 0o/c///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S @P0T00S,0upG-M`0g@P2`0p嫚봂 XPB ^B0* Rp "Sk pd2d P00 000!h8" p-PP:0x0$rP(0SHP㰑0SKP 1@اP 1@ЧP h1@ȧP H1@@10S h ,00h0 01@0b0! VdЍ0!p P_ a` P0p 0P0qw 0* R t0@ყP S T0@c>cS ` >bS >O S O b bbD,4>bW \W @-ef//G-s@dVʀ 0! $"0""   !P 0x P0S P0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y ȧ ߧ ʪ0S ֧ P0p P ,0S -0S (05#0x ៧ᶧP0p ƧP Q 0R(0l0 S$00 S YX0S`P\ d'$0PX0 0 0?c@ 0!D d08 0   !@@b@d`dddcbgfffp@-T0P@0`0\00`X0`0s X 0\00p<c'@-@0@P @-0 @o/c//0000/QR R / /@-MP`@pT0 P0 S0 P @0S*0 TQ 0R @Ѝ`@VUUU'800: S/@-@@"c// 0!< 04 0 (   !/@b@d`dddO-`@3P 另o勦x0pS㘀|P xPW PL t0S 0S ʌr P00 0SӀ0.X01 S5p,`LP< [ p0S7Zy0S2W 1x0: SR1!0?Ac4?Sڀ tPpS9PipX c 0&h0W00 S00S Z W  0x|0S+ p0 |PŏX 'Sd d C 00PECF 0 0C|0`  0 pX0 I ЍO;P0 ЍX>cbgfff:h>Q@-Mpd`@ p嚗>4P N?> G? p10: SRZ e0s(b_\@  1@  1P0P0P 00P0@` 0@Y 0@R 0@K|0x 0t00 0@SP <@00>ЍH>j>^ ^ c^ _ ` Pbf#b@-@-@<0 @0>b@-7@-0@P1 㒝p00200 ≝p0000 0000000000 op000 Ѝ0\ P/0 !8 00 (  , !/@b@d`dddp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000@>E>T>0 @o/c@-)J@P0%@-s@-P`b@oP0F.0 P05/PP Ѝp@軕# p0@#m )֣ H0@)c dP,05/Ѝp@q>>`@>b c @-//s@-P`EbP@ 10: S)Q00夣塣@ 0.P|+ 0@00D00<@H00L00P0埼0P \|奢0|0Ѝp00!00xu0 P,Ѝp@?cDf >c e |e de >>@-圣P@-喣o@- 00* R | S喣Q@ a H&000* R S剣c` >@-@奣p@-C9!: ^SpP3 @4T004 0040606L00L0pp @bb0l4/@-@, B$0 0Z?oЍdf H>G-P0 VPU0p`,@T qp YX噓!Q0S@p Y@P \姑HXH|@׌ ῇ@l@cX>r>>A-` f`V@lPp@T 0Q`H0|밌 ᩇ@Ew cG-`0000@pM0PU t0(60\ (0S Z00@P, @\@ R"cP//0@-M@P 0 P @  0nh@Ѝ00@-M@P 0 P @  0eh@Ѝ0@-P0M000@R4`pa0S0 P@ 00 0`0Jh@0 0@P@Ѝbtc e0@-M@P 0 ]P@  0Qh@Ѝ0@-@0 HP @  [h@pЍ P@- R c0/cp@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !pc@b@d`dddp@-HP0PSp P@ `6/0  0p@/cp@-x`0SplPP@00C00SP )0 `6/T 000pp@PpcbG-pP`P@ P" P PV `FPE@P P #P`T00Y0S<4 `@>>>>/@-0,\ @T 4/Ѝc00S/ R//c00S/ R//cp@-@P. \.0p@80/c 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/bA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 bq q 0  )?)/ 0  )?)/^/@-@q dLQ0P0CDq 8? q (:q 5>#>)>1>=>@-H M@጑8' G000 0I ЍF>r 0@- 0@ ,MPr           0 040$0IP 000 M,Ѝ00bq /0/!//A-pQ`.0  P@ x0EF,P Hpp`@tT:80*0 5'J b@R>@-lP>@-hj>///1/8#81/1/  R/ R/ 0s S40@o//0@3S0/@b/DP>p@-@0PT3/>p`S0p@8/4$$#   p@/W>[>a>Q0 Q Q // >W>>>O-P`$M 0 3/$Ѝ03/@yQ  0R $Π  M3/0 0Sp00 `"R 3/ 0A0CS000 3/00u00d0 0Q 0 3/$C H! 3/(!0AYS-000(c0C S#0x   03/ 03/@ 0t3/W  0\3/0 L3/W0A CRS 000 0R(3/07  1 2/0 30 r#03/ $:$(0". `: S0P3/$&0$ 0$3/0 0 &6z R'zppF0$03/60S 6&0S Z0  |3/03/ Z0Hp083/$O8 OS   F0$03/5t0S W0  3/   0 3/W? 0t3/0t3/0pd凰Jq" W  'pS 03/ GR03/0pW03/0S3/ '$0W$ 0FL0G$80 0C2/$01?3 ?3!?#;00 2/@ 0q0 00s00$* "0 : 0#$90"?  :$#: `0H#0$"<407S0 S0s03/ 03/ 03/ 03/0x0s0n0|i$3 l0$2 \0$0LD, R$03/ᴡ$03/t  03/03/0t3/W6 0t0q$0 3/$($0 :/0 oPq0 3/200$($0 %:/ $8$&$p0 7/0N)>>)>*>*>+>>D>*>*>*>*>*>*>P>`*>f*>s*>x*>W>z*>/*>)>*>)>*>@*>*>*>*>*>*>+>+>0+>:+>@+>K+>N+>P+>Y+>[+>W+>]+>e+>m+>p+>*>+>+> ?+>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//@- @/0/@-@/@-@/@-@/@- @/$0/A-`@P (pW A/ ,pW0  `//p@-@$0P`P A!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S pp@4@b ,00,0/0 R,00,0/@bp@-(0c0@ TPUp@bp@-2@02 P<0#0P20C22S Upp@ p@-\0!C !2 Q02(0$!   (0$!p@@bR/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/@b -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R D@P 0=S0@V20V 0  SR0T=Sp'p MP@ M  (MP   P Ѝ/>7@- 0@P P0P R Sk @ Ѝ0@-@0 }P L %@oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0PN@ @0 4/@TP @> 4/@G8H@Nc1 !0R$04$0/|b/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ̌bccp@-AQ+ 0S R[ xhuO0_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0$00pB@cAi!iLb/>1?/ //0 ?1@o/̌b//0/////?  22//-P/6b N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: Nԍb؍b܍bb1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  "(00(0/O- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0@bH00S/@-@0  "!$0p03/0 !!cc03 /0@-$@4 L< 4 @ 8 L < @ 0 < /p@-P$@4 L40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0p<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@70` WL1017800` !.pW 0000 0 00 `L<`划0@0 0S101ߍ@b@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  XؼT101101 0\! 6 SSO-0`@p0M 46CSЍO/t Y7000 0$0L0 0C0C004pЍt!pppV 0  Z 0cQ  K J<!PP)1\Z 0  S PP P0X   0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C @bb02/0 $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S p@-0ZCU lPC^   LL& &p/p@bpP 0@- @ |M l Q \\ QQSH0t SU60  !0 @|Ѝ0@b0!R 10/cp@-@P ePp c0 S   e0@-4 0S$ @ cbO-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#   t 50  !0 Pz}|ЍV@@ 0 ;/P t 50 !0 P$@Z|ЍO[V@bІbc&0>^ \  "O- p`0F   0 00p(`$ ' 0,!% 0    0p(`$  0!% 0  ,  0p(`$  0, !0`%$  *  0 00p(`  0!% 0 9   0p,(`$ 0$,00 '!$ 0 B   0p(`$ $0p,(`$ H# 0 L  ,     0!0 S   0 00p,(`$  0 !0_  0 00p,(`$ ~ 0 !0m  0 00p,(`$ i $ 0 !z 0  0p,(` S $ $ 0 ! 0  0p,(` =4 0 ! 0$  0p,(` '< 0 ! $ 0  0p,(` D 0 !0  0 00p,(`$ H 0 !0  0 00p,(`$ L 0 !0  0 00p,(`$ 0 '!0  0 00p,(`$  0P!0@0 0 0p,(`$  @<ЍR0>b8 Dq2 c @b cG-`pMP `  @G000P00p 0@R 0 p0 00 00000 0b ?o2P0S0 SЍS0cc A-xM@P`` pGP0H=D0X 00 000000. xЍbC-0|MT@T 0S P`p` iGH@D0X 00 000000 |Ѝ- cG-锐xMZ- @P`` pAG IHIC0X 00 000000 xЍ@dp@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/ cc@- @p03/c@-@0 @T  0 !! y@=b:1>A- ! 1M03/j0P `X@P pX0 Ju T@Xd@@@ K9@p`p0?c /P2~]0pL p4G20$p00 Ѝ܀bcR> ccb@bb/@- 40@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00P 0S#020 0xP 0S"020 0kP 0S"010 0^P 0S|"010 0Q Pd 0Sh d0G Pf 0Sj @0= Ph 0Sl 03 Pj 0SnЍ0(Poq!000l0 Pn0Phj`!0@00e0 Pfh0!000cX0Pdf!0:0a,0Pbd 000_0P 0800Pp 0800P@ 070|0P 070`1>dc1>j1>w1>~1>1>1>1>1>1>1>Z0>1>q1>t1>{1>1>1>1>1>1>1>@-H00S<00Ss0 00000uЍcc00/G-Sp@` A S5 S11P0 @D`Fp@03/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0cccO- 0@4`lTD r0PhqX pYG  X ЍR:B Z: PN Y  L\!TWX D p(p W*Y )  p 0S p    0@pWr P@ \ @-0QBQ*   P0 my/1>A-Pp4`@z_P 0Pp 0<0`@P00 (@0 0,0 @b4f_G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 07P  `FP@VU0,00,0000,000000/O-0p `0 W W W Ѝ@04"0 S )4S 0"4PS| V1d0 ЍO/ @D P T*P0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!*0 0 A3A3C?o20 0` @ `FJ0V @DP T*0Z*IY! 0CY!08 0 07 @ `FJ ox .kxR>1>c1>G-@Pp @ЍTDЍb2"0S@SG0j0O-@M<`N@N;@5TpP3:T#3p0 ?oZ20S 0 PH 801P;0; 0 X0=Ѝ`@ 0 SPTx0 0 0Q0 R0S 000 R!>S>0 jJDV:FQ: 0 bR>L2>p@-PN@N@ 0 p@0`R>b@-0 PS@0S 0#G-p`@00hTЍ PZe 0 UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 Ѝ@bO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0 H`P0``>0 BB6*a"*UbY 50 0  0 P PE 0H0 H B @bO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T MBP%@<5 P @[H0@@ .5:S P%0:0PD0@S B Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xPA-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R > (0+0  VPV0P00 0 wЍ R > *0VPV0P00  0 | v$ R > (0+0 VPV0P0 0 0h2>2>2>3>//C-M`@CPT#Lu,'@u0'4uUF/$ 2?0Rr 岟LQ PPPL P `1|pQ iu 000<0 au cЍC[uЍH3>U3>b3>,c$cdchclcDcTcl3>C-HCM`PBT~ЍCvRn  "Ÿp"0*P*P l. (>sD3S<P 0S(<X!\1pP H |U0( 0u( v t vWT3=WGT3 vT3@vT3  uu1!0S 1*B0S0 1F@T1-0pW0p!(r`1 0(09u(u G R$$uT3 u!1@TT0 0 0 0  xW pYU buЍ@\u 4u;>b3>h2><><><><><>=>=>=>7=>AXVl<>3><><><><><>`A`AtccyoB9=>X=>C-`APA@P03/sTDc03/0L30HP3,G?b07@A40C 00O0  00O0  00O+0  00OH0  00Oe0  00O0  00O0  00O0  00O0J 00O0N 00OC?0R 00{OI?0V 00rON?0Z 00iOS?^ 00aOW?0b 00XO>0f 00OOa?0  00FOgoj0 `>O04L ЍC @t ЍCtc@b=>h?> P-`@P p!c pЗ!P  R $LpL 4Ds 4/!`@S`!W , ,`! !oDЍ@bsReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! w!oDЍN  0O   ! "`"Рop8;p0xP0S<lDh@ H 0pL-pr)pL %p (!pI>J>K>,K>TK>|K>K>K>K>J>C- @`p(P  0S 00PAP 00(0Sop(Q 00(0L0 Ѝ@0?  0 L0 00S 0 qt u(  p$`K>s@-@ \ \P`t ]( 00 `$PЍp@-1@``QPM R' $ pz? 0    !o060o$0W0o40(x0o080L00oЍ@bK>O-@D@M0Ps3/03/10100S  !0 0Co 00嫲Š4041 @T 00 04/P7[ 0n`S5 L0  8o@0 v V%* Q ( R 0R6BS 20000St '00 0(00,008<0 N`1000 :S0L0L - 0Q0 1 ,212:+*B*R8 L>; T S3 RLDLOoB@ 0 s P 4(S$ [009n 0S00&R ! R &R h!h R \A@X1T@@@(0 0P0( 0S I  R [ (0L0Ѝ0 nt #'0 Z0o Z ZA``PzO@0 h0 Ttn 0(0^ 0Y ( Xc@bI>cbL>M>1M>O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 zP/ t &0 [0 0a`Pzo`0 Gh0 n 0 0 0t &0 0 0$  00@4@>0  P0 @TL@0* R @TЍ@bc1M>O-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ?oT20S00 ?oT20S00 joc@b@d`ddd_M>00P (031000Co//,b@b!:!P/ 0 00S/@0. 04S/Q0 /0,b @-%C.@-%O-0@|Pc0*4S/0S0 0 /000/c*4S/@-0@03/0BN0cQ(QT0\0 )Q/R0 S,0@0D0//S/0H0cQ@-@ (4S80BNX03/00)4S0<03/0)4cp@-@0Do A("(RP p$$Ph$! ,$" \%R 8Ah00CS0p0 p@ h,b@c@c@-@|0T0S$D 0SX 0S@@#<0QD$   D$ @@DD,b@;cc0 04Ē Q884/0H4S/2],bcT H$R ]@-@@8P 084 $ 00 4c,bb@A-P @`pTQ 0 "A2P 0`PR  V`p@V0A31003@b0P/@- R   B B  P^^ $ B$ , Q R!! B B!!,bP/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  ,b0S@0S//0O-P` @P\Q pQ00ЁU00SE R㴑; Ѝ ^^p1Q@` Wp0U0 WU0 `` 0!&Q0 !SL   0E&  @T00 ЍO/QᤠT ``  U [  R`` `!& 1!L0L  o@,bccG-1pS@0!R00R0P  \  \ 1!1`V0`0ó?0`QP 0  ^ ` 0S 0PR" S 5YY 0S 0h0hS 1S 0h   PU0S0`000O>,bp@-0PPdL4S N@l $60L0V L0?4`003/03/+#pc,bcp@-`PU;@Գ<@1t[TP_X[_P`\003/`003/03/`\T4PX4P__p;cccp@-D@[PX_0``003/03/`X4P_pccO-Ph4dpQLP4Q9 @䀟䠟fU*%*1Qh \ : 0010?0@03/@0Phk%!1PLP L0]뚟@03/@Zcc XO>/O-p64M@00U6PH4S 0 : 0` T^0 01000X00006T =0P0 +60$00$ 0(01,0(010Sp P p ~:pV, 0SO>O-@4M` ሱ TU2T 2x4ST B>0PS0 4pp0V :ḱW @^p&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% 8P <00'  Te[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sj0(4S   0x W4Ѝ,b@bpc;cO-@p@P` ;8PP`<`L 巰  *60Q000  ԰ @03/00 3/03/  0P4 0?PUP'S 0h<0<O T00  S  S80d5 ,0L42 S0`5,bcc`0@-0@D0PSMt&PЍ00 0g)P {'40 U0*0rHd@O-@p:T:~003/O$ZZVUP!N`$5ᔠ?`U0 0C07P @0  <@0H 00?@03/003/J`,bccA-p@`P$4$*$00S3p(DF0@00V@U($<01S  2# RS$60KX 0S(H$HJ$J@L W000 ,b00 p@- 0$@0P000Sp`H4S d0)$4$#3H P4hh5hE000D40@@DDpc,bO>O-`MlP@n0I 0000 T : 0 S:0SM᤯ЍO$jjf V `!vP@ p$5?pT*. , 0 6 ᚯ7뚯R0 P>0 #!R/080/@bcs@-@P %60h5`P 80 00<%#Ѝp@^;cO-q3Sa100@-4S[0,4T倁勰U !0 PU ,$$#2$$0 SQ8 0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$  2/03/00  !!000T(4xDT U0-40-4|D Ѝ|03/VBn@b,bbcc10 P0  044-4/@b@- 4@S 0 4cP $0T V0(4 0@0/,bc@-$a  _ @- 0 4$(4-@T R0D4 p000 00S 000D40P0D4\$TPp,tq0000'0$4$0!*10 ,$020 0 Ѝc@;cc@-@0 4mp@-@Pp 4S u0 4yY9P Pp 1T 0(4ph1q*2h$T徬 0S0Q D$,$ ,$ B  B R @@TQD$h0 0TX0x$R x$p@ 4U_DPD$,bc@;cc@c@bc@-@P@8G-` xvPd幬G@@@ @pW0S   壬YQ @T0,03/03/YP`ѬP 劬@ᆬV:p0t0|U4 (0C4 040C4 0 @dZY;c,bcpc@-@(Pd@cP>O-0P 0UM0 0@p0 0 0   P@{Pk40PUЍ0    0* 0 100R `0A  S + + 1 L4` 0 0 V'! B!! ! R 0Y0 0 皟  *0뚟 0  0 5  B    S 00 ";cc,bp@-P",u@@@ <e@崫p;cp@-P",d@@@ <T@士p;cp@-@p@卫p@pO>;cG-0X`TL4 90?003/03/@`pP 0` S@03/@@@00?003/cc0' 70/cO-xBMgV<*dZʀ 0! $@"08"0"   !&j aw0W:Q<03/,03/03/  0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0c@b@d`ddd;cc,bcp@-PPP@}$F@0S0?@003/0p@/c,bc@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-4TD,M`w|T0 0=$4  !0S2 $ ,P$ kb&20PYpbbh  0000# `ˁ \ $4P$ ]`` V (P Q`b<03/03/03/2 x嘧Ћ唗P  )5? T唇\딇(P@b(5? `X唇 "0S70977'3C?6C0C#:%. "&0#2>0#6!' 7_D h@p1q $4!*$010y,$020 0@,Q,1 00C0@@ @@Y1 0000 @@TS0 0 000@@ @@@Y+0P000@@ @@Y |<0,ЍO/@b,bc;c;cP>P>cP>Q>c dZQ>xc@;c@ccQ>| chbpc` @c,!@ccQ>@0!S@0d4 S00h4 S$0;00;010?/c dp@-0`S0@LT!* Sp0PT S`0dUP0SHP,`$EOR0?pcQ>R>@-!01; 00? 000$,bO-~0PP04 `p~R@p R R1!ěd`V Ѝ|!t1d弋Ld!\1h帋PV[#0$ ! \ /FVfF<R0 R  T` P -$%/("(VR#  U뚿HXhF /JZjF5R> dcXR> !:!/ .,bA- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p dc !i!!G-`@0匀pB00>0>0PT0?0?0000?$:aP(_$5?[%J܍bbR>O-@ᨐ娀zT:00ЍO/ 06Sx`1`!-P$5?PT:0?L0 HS @03/003/ Jc,b0$4 /,b0  ")//0 !Р!/0 ! !/p@-PMd1P# @,`~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍp:ccb002'0 S#3/c 0P/ch0qp/@-3P p< 0BS B 00:cbO-@2@BM<03/ sr $R0S0  "S  & P\ЍOPq\0`Ph 0Se z3@\tЍO\iP;0Q@p1į0 00S\>0p00 I06SP1A\ 0 G0:0 0 0 0@KLS>6S>c(dS>NS>R>R>pS>S>RS>S>^S>S>S>s@-0P `R0  @P1 00 @Ѝpx0d03/00 `40P0  @P4000400040@@S>cb/0 "")G-p `P /)#~M0@:0$@P $(U 00<0 0@0$000 0 00@D@D //C-H0M00p0]00LP@0` 0%&px00@`@UЍ ~0 00 ZS> d bR>A- t]0P0>0\ @X0`@Dp@ u00 L0000L0S>R> bO-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJd5[ЍR>cS>0/ᜒb0/0d0/0dT0@-@0 @RS ,0 Ѝ00000dbl0P/0 S/@- ^@LS:0 0CS(0 S0dl0P/0 S/@- ^@LS:0 0CS(0 S0d @--^0 0@S>p@-Pk^X0@T ^T 0PE0%VE$ @p0S 0ES:@@p@-@P0Ppp@0/᠒bp@-@P0 Rpp@0/᠒b@-*@P 000T0X0\0`0d0h0l0p00Pt|x04 iYT>@-@cY@$O-P@M800Y*Ѝ0 S+ 0R'`(# p,P # ` ,P #  ,P 0p` S @0P#/////|/x/t/p/l/h/d/`/\/X/@-P[L/H/rT>T>T>T>T>T>T>T>T>T>T> U>U>*U>MU>jU>bU>T>0 8< 0/P0  T0S0CT0/ 0S/0C 0/M 0@ 0S*0 0S*Ѝ/A-\0S"`0PSp`?X@ 0<A @TX 0{@0VD0W @@0@-\@M0SP P 8 00  3LPЍ0@ Ѝ08dU>@-@`0 | 00 0H0 S 0HP 0p0040P@PP L i[6aZЍpU>hn!p@-@P0ݡt00t0Yp0S0p@+Xp@-`D @@?\P0! 0PQS0  @ Pp@00S   0 /0W0UG-p@`00➡PY0 S<80  Z7   3<80S.8倀+00W00á<$MPP+ 0W@@8`<000f00x0W 0P0x000⡡W P8008000WW00DX00C0 80<80W00}00 03/0XCW@d V>p@-P @@ 0R8` 0x0 0  MWN00C0 80<800S80 080@X80 080p@8X00Sp'Pp0p@0/@dp@-@P4`V0x0Vxpp@0#L00L0/L0CQL/80/ X8 @0 |Q 0d0#/@- | R |080H^|   @\H@^ RQ @p@-@P00⊠L00Lp@0ʠp@-@P00{0p@0⻠p@-P@`0l0Sp@0⭠800800Vp@-P@0`03/0Sp800800Vp@-@HP|V020C0S0P8ՑP@VUpU>>V>A-@`@00S>l00%S P= S< SC S? 00 03/l<V6Sn0m o48V VzpS qS00 03/nV6Soqnp2p Ww03/pP 8008080@Q P80 PP8 <203/P00 03/1ZV6Sb1pG Wdp\ `0R0C?o20S0`0W P8008080@x :RP P  80  x %Ry R P Px0)Sy0SP80080808  PD0S0CPD0PU D0S UP0 Us0SLUo`rpXUs`pGs 0R8UW>W>V>DV>U>bU>U>V>V>V>V>V>>V>40: -$M00  (  0 0$Ѝ/'C-$M`P@p G00$0 pJ0 0@ P0 S <(P J0 00@{$Ѝ'2W>@-4@$MJPp` 0040 000`0 @@p[$Ѝp@- M@P`  00@0< 0  ` 00@= Ѝp`'@-@ M , (* 4  0   @" ЍA-(M@p @`P Z00&4#0D0 :00 0L00H0`00p$`(Ѝ-$M(000 ,0 $Ѝ@-,MPp` @ U00$4#0@0 :00 0H00D0@00p$@,Ѝ@-@PP X0P0O-4,MD(,00C#  ) P D1P100@00a0q$00 09 0 0`P@PU',ЍP|P P0U  RTP E P!0  ` P  YpV Wp0PE\q@ `A-@p0`ŝP0P0tPP P0t0p0`t0T0A-P@4`pVd0✝T# T) T@t`@H P 0 S08 @TVA0⾝00S 3/|@T T\0Td0Sp!@8 0  S   8 d  @@@ P 0Sdp`0WQ Q QG-@@P(M`0*d0Sl0Si8 00 03/XS?0\`0\SA(S$40X3/p(Ѝ0H@ 80 ;808ppp#  0/xz 0p l0  l80Pp;80夐 Pd P0 d00 03/<eS0d080p 0ǜd0S p0Y0d  R 003/p&00 03/7Sd0S60(S3@00D0 00 R0B0CS$000 03/,S0$0 p0w_0d00<00<0H00H0P#pQ0ⱜ`D0Sp 0CD00_80P0 0d! \000◜|pPL0$0L0!0wD @P D0S0CD0pp00 03/R00 03/dRd0S ?0\0 0S 3/0 80 NW>sW>bW>U>W>W>bW>i!W>X>O-q@`P\ d0P0C?o2?3\0S0v`` V)`0S&0؛ U0d0SpP P 0  QP0⹛p W|0Pt0Pl0Pd0P\0PT0`/0@ 1/0000q QU>P P P P P >/0( 1/0000U>P@- P P P P (<00 010000ꀖU>00/00/G-@0Bx0S G0⃛|PU @p 0R,L0S)80k&  80! P(P  0d 0P80 @00 03/QPx00x0t00t09R R00 8080;80 @P0S  RT0`F6T00bV0 0 03/ HiQ`0000 }c0?o `c`X>X>p@-@P4`V0⸚x0VCxp0x0Spp@`p@-@P|0⟚0P 0ݚp@It  t Qp@0њp@-@@`P0ₚ<0 0ĚKP0 0T000 0T0@ 00C08080;80  @0 1T"T <08 0<0d0 0S00L 0L0d0S0S80@;8080 p@0≚S 0@0vQd0S0yp@0000@@G-L @p@R` P0S P1`SRL0003/<0\ 0<00` d008 80@   # 880   080p R   080PP9 0U0 0$3/#oP|(788080 ! R"  R R 00 03/8ARP5R 3/KP#0e0⫙ 0\0⢙Y U 0@0 03/)PVD@00O<0 0ΙQp Z 0|[&X>X>X>Y>,Y>A-0@S 3/`0jP00P0Pt0US0Op 0t003/ 0t00┙ t0 00!/@!b0r05p 0t00u U R00 0eppTP0\bgfffGY>A-@Pp@@ @`0SЍ S`P@ 00 0X q@- ^ @/$0/p@-`PE%P@ $@T @P pp@-@hH%PPp$0Sp`p@p@-8@PṘ@Tp0U @0dp@-M@P9O $0HS 00 03/,O$00$PU !R00 03/O0^0 @P` 066 99000000PЍp@RZ>Z>Z> Z0dA-P@`h0C10 @B1d0S10\0` 0C 18000E0A0↘ lA!0C1plAq Cq00 03/@N00000 03/d NJZ>Z>Z>O-M[>p@-P`t@TpSMPd`s@)[>C-`p䑟`0S Ѝ @@PX  008  @P 0SM$0SJ(0 0S0@S $(8> P? DP 0B F $:dP8 9_(0e{P 0 rP 0B  $= 0PQ PU !0_AeYPWP 0  RPPPp0P0D00@0L LAPD>P<;PQ1[>G[>h[>q[>z[>Mb[>[>[>[>2[>b[>[>p@-P`@`0Sp 0P 80 @   R @R 8   P@[>A-@p`00Sd0SA3/p@ l0!#B@ T_ Q@+P\ `Q ` T\@|Q@tQ< D0SD 0C\QD01TQ8008080@0 0Q @80 ( @Q00 03/L8008080&8 # P D0S P0CD0@PUT @@|PlPLP@00 03/lL@U @[>4\>[> \> \>[>l\>\>\>\>v\>_\>O\>\>@-@`pP4P P@0 0L0 4L Ѝ\>\>@000  00T0/@-0@00L 0$1@ @<00 /3$0S8$0@-`@0P p 0 000 |L2Pz220 @K0 $K Ѝ@l1 Ѝ谒b\> ]>&]>A-@$ P0<` pc&/9  0 000H0P <0 (K0d09ЍyP]>A-$ @0 `<Pᒃ(p 90ἁC 0 $000 K10S |wM 00 0 p'$L0$0D1L R 0#3!0 #31P0 qK80d0Ѝ0 8 0 8  `\ Q  C40l0@0d 40 0 d0Q 0 TCK0 l d<\c]>Mbb]>!]>^>p@-P7@8p@m\0O-$ $M h0Դ@ 0 `0 pP<   0 00 KW800S p00L00 J<L 0 0SC80d0%t0S 3/ 0 $ _020 \:/Y L0  0 pY `8$Ѝ/000L00 J0d08x0S 3/}? 0 ,03/ ,0 3/<〓 ,03/0   C$   0}J|2 Zi 00P` XqJ @T04/80 00 07~0 ]J0I Q(0 UJ 儀 0 8/(X0 000 0C00 ` :/H0 l3J0I Q(0 P+J 0 `6/(QA0 J0`0\, 00S 0 dv^ ,03/ ,0,3/ W I  0B$ dl  XIC704값bE^>^^>^>^>^>\>_>!_>0_>n_>|_>_>_>_>p@-RP@ ` R R0 <I8Kd /p@0d070&`>P`>p@-`@ 08P^P Up^ { 0< P 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddA-p0@PW@0`@0Lp0 0 KIP0 0_/@P0d0A80帀 00 0 00 0X00\0 P040h00$0P 0e/A값bf`>`>O-M0`L 01 `>`><~>;a>\ O- $ h0,M `0 p0P<0@08010030  008 | Hu50Su80\ 4 0\ 89/t0SY0 $ _02\0 9/d0SO 0L $0000 0 P0 0 00 00 0G $000 0? P$0% F@+0H00 G%G0d0%0l040\@ 84/ "\f,P,Ѝ3/0040\ 89/ \80|!L0Sl!0 0!!0 T!!1/t0S 3/0 $ _02\ 08/ $0000 0 p P 0 S0 8   #8  @000`0 S8 00 0 $dPG0d0P0 8CG0d0(값ba>a>bMb %a>a>b>a>A-@ Mp0HP   ` 0 4   ,  ,  P PPP0H00PP080PP0p `( 0P`D Ѝb>!,~!!|! 0R://p@-P@`P0J P3p@0ℐA-`Ptp@l0S 05PPgDFF~F4P00 Kb8b>p@-P(@ P@ \Fp8dCb>@-`@50P )PnI`@ I`0\ LS Q 0IP08 X0 Sqb>Mb>b>b>b>b!8db>b>|!8@- (@0000$7cX@- H@P 0 0uP000$7cG-Q@M I0a@D{P 0!0T` 0Ap 0 PR 0@0 P 0Q @  P00HЍ"c>c>O-p`M_PPP3p@0Dh0lJ 40@ &0 s 0S 03S 50 * 0ES$ PPl0 , &R8  8 n  H  R 0@SP0,0S[l0 P0m0P3T0t0X0|0\00`0n0L@dh0000H PPR8s0 0000 00  00@ 000000000R 0 0SS ST 000900000:000000000 00040 P 00P4P 000 L0$%RPPP%* vH0S  4@h0000000L @ЍP3/Pf ],0SdY0000000:00'LGKPc>`c>5 !o>00S 0L0Sp //O-qMp P\00C(0w!0`p$0pG3 3100 0P0(0UЍQP\0S(W`0S$pd0S @ 0`@@D@H@3`@P0D@h0$ 40L0P0uN00SH0㴒 i,_0 (@0*8G0 4"<42@00`0 0 @@B@F@0P0a0 8< 0 4 Z*" S0!@<,1@C003,0@,0001000 0 @R3 4940 8<  ,4 (0` $C04, 000, Q>00  1V ++0S` @ $@+ $4"49#9V0@0$0 S00W0S  T +  P)  P @W00!@bU Pc>'$o>!@-@/@A-`@P0P p F0 ;0 ܌pP0V 1Cp Xˌ R00 D D0 ߂0lzo>b@d8dDdA-@aP #|0 R p T T X0T 1 00AA0A $7cUU UP/p@-Q@P 8F0S L 2Fphz>vz>R/0@o/A-pP`0_\0S @P 0S `?A0␌p@-P` @0EPPwTBBB4P0$p 00s @ S'/Q@-@ PEN0 @00^ C 0 0 EЍ{> {>A-@P5@P`0d00`0E\E4PP 0؋p6B3B0Bpp0 P\HEP\p@PWA803/@1{>3{>A{>H{>O{>U{>Q @-jE/w{>A-`(M0Pp 00 P40 040@0 0|0 0@P 00 D0@(ЍW/Ea{>!ԣ!|>0 8< 0///O-P`L1@ 0PP3pO1 !)0  @ 0 p:WW[0*L0mm|ZOV ЍX!~>>0@-,MP@ 9508 00  L  @ 00,Ѝ00up@-3LA0PH1 8 !t.80080kp@-,M@p` PG00@0P "0D0  #0H0 $000 00Lp `!P@,Ѝ0u0@-,M@P K08 00  0 00 L$P&,Ѝ00up@-(MP@` [008D#L:8 00   0 0`B(ЍpA-@`@P000S3 S  pY oY W}0LA0000P 0X00080 080lCdD0 yPA@CH0 SH10H1H0S40940P>|>>>>p@-@@0PbhQpP`0U0$00p@Yp@-@SP@0ZZp@0 ZA-l0@P~0pSSn0@0SLx0SIypWF|`P^1 0 n00Sx0Sy0S|`tPD0 0n00Sx0Sy0S|@YP)00( 0bi!@-@`Pp<<0$M((0 00,YЍ6cA-@p F`0@PlP L18 \9@L VS(0 0`0\Ѝ6c@-T0( P@"6 0<H1 (0$ 4cR$0L1@6cp@-T@P0`S 0S 000 0 000S 0S000 0 000K0Sp Rp00  Q0S0$007p@F@- 00 0 Ѝ>0@-P$0M 0 0 ]Ѝ0蔮! !@-(0 0600NЍ䔮! !G-P @P  ~P0: bbH0$ H08<06000000 0(0T000$0@!A-(M@Pp `DB00@00>00 0<0T000 @0L@p"`$(Ѝ0uA-(M@P @p`C00'4#0D0pT%0:00 000 000L0@"$p(Ѝ0us@- 0@P La@0P40   H0b",4b4#04!400 S0S000Ѝpp@-M@0La Px0 K?4X0 X 8  !0 X0<0 00 0  0ߍp>0@-LM4 $Pd@ 00 @0LnЍ0 @@00@0LI N@-S\ 0000L Ѝ0 0L i NC-P0,M p` @P 0 P 0S! Ġ"Č  Ƞ,ȠH p `  P ,Ѝp@-0P(M ``P @P 0` }P 0S $!$("( P   (Ѝp0@-,M@P S00$ Q>4PT6 1XQ0 P00P"0pԀ(80 pH00PN0S A0$0(<@ D0 pl0<PtcP@0cS400Ѝ Qe@;00u R>G-(M` Lq@0 P?`aL0V SH1H 0㩜H1  PP P PU Vq(Ѝ-PP80L;L  0PIPX 0 S 000P ~P0S $!$ ("(R  $(  R%=0 0!$+PX!T1808 080 T1 0P1$ (0d0,0000H1 0H180080    ^P;L  0P 0 |N>>O-$MP~ LA0< 0R80 080n=#@0u$Ѝ@ $PJy4@pd#dD0[h0030#P00S&h+8 4 )  ``&  0  0R0pR@P0 W0' 0 0+&*(0'4a `0p0 e 0D040PT`Xp\L0hP@  b!0uO-$ `p@<<4!44Md@H 4  `d0@d/P2 MF0ZL00 T0P `40LPp#4"48#8S { P [h5 50Z00 ^00pX`pPN0 4d#d5h&hV`` hFh` &4_0X0``P30F c `$0 ,($0S*/o\" RL\  LRࠑ (0L岠RR 3 ##@000 0000 `0C{ Ѝ R R pRoXQ 'Q(0RRR 0<0㑓#K0RA#ᰐ 0 S` S ,0A(Y X, Q   $0 0C$0Q X<0RR!K0R0C1#0S z P YC0X00 ^0 0pX`pKP0 $4"4P"8#R#hB#< _0 0X``5P0 0 p 0 ᰠ`FV 岠 RpC; 00 00 p0l 0%Y Y 0 \Zp@pG\ \ 0`F7N &j4"48#8 S㴸͑ f040 g04i 00000"20 00 0@0k 03 0Q<<< 50lp tx| 0uRCs@-0@ CR 00  P0`P0S L140  Ѝp0 h0C1Q   L!4  l(,"$l$" A0C 4"40O-MPO30 F0@pᰣT)@K0R0La8@@ @\?W Z2C7CW"0CWX?WE 0 0 0p~UP@B0 0 0p?c|GrGWpp>W >W >W0d` @00@PL140 0$#$  @h>W ?@oT<>34ߍ$>W >W Y?C0CWT ?=W =W@P`PU V 0 @0d0@Pf g0@0C10 0d0@Pgf0UVJ@ύP?3Q#QQPPG@=W^@D`80 @P4 0 @PN0dp0 0@P80S  "L !$ $l("(          ;W ;C?CWG 0W ߍO;W@PM@ 4"4e xE0d0& c@pd c@d@!cpdcc ccccdj~>c(c c<dȂ~>@ Ā> C~>~>~>>0uL> N eR0 d00D H D k0j0  d@Dpm0 0 0)@P40-pu`P  eR0d00 d@k01#n 6:00 00p000 0L@P+[ u dpE R0D00K0?0M0:00 01D@00 00@P6$#$("( 0BS 3y,rHu`Ps  enR0d00d@pk0h26:00 0L2 000L0@P 04$#$("( R@  $@u,px > :F0,0:02 @ 00004@P0 $4"48#8RS#00@ӑ;@$ 00@P$0 ,0 F0,00 30:03 0000 @OPi 0 S0 <   0@<0;0 9Q080"0$h8@@0  d0&@P 0S  t$  G $:$ F 0L 0  D@P:   B# D# F@K@#0 @ 0 L@P #   B# t@P T*04#!A 0 (Q(0(Q)  +!Q0Y    +!Q"00;000 @@ 0000;;>0>0@0@00 >J?000 0<< S0 00)S@}7 0EC0D00J0:D@0  (0LM@Pe+ *00C8#833##Yfkm 00 10000h0n43i0g 43oj0# b 4303000 p-000@ }0| 8< ~ ,4 (0 $"000 000 0(0000ߍOp0GS W Q )0GS0*QQA9!31  ߍOCQAQ@RQ +QQ 0AS8 30AH 8#8# 8d: W 5/QQ AQ B0ASRQ <@ dE00:0@  d0p@Po0W?00o000:0<0d @P W  RߍOg+QQ QQAA;!31 A AQ A eX0 d0d@4"46: ,00  0 0 [H u0S<0 8< 0/O-P`L0@  PP5;Kp1 !)0  s 0pmW}K0]{ 0{T  Jᇀ Ѝ!>ԁ>p@-La(MH0S4@LH1P@0H1 a500<0\ 000P0 @@(Ѝp꠆p@-YLQ0`H1  @PH1`0 X4H1@0H180 .80080,p>@-1H1  @PH1`0 h4H1@0H1>@- 0dp@-@0@PH1h@`0H1QpP`0U0$00p@Jp@-@P@0{Jp@0zJG-@P@80P0p0Sn00Sx0$Sy0S80 00 03/\ 180<80`l0~0pSn00SFx0SCy`V|p0P0 0`n00Sx01Sy0SO`V 00;z800800}z9(^`P` %30(z800800jz`w>>bi!>@-@`Pp<<0$M((0 00IЍ6cC-@ Fp0@`MnPP P L18 P9@@ WS00 00pIMЍ6c@-h0( d@"6 0PBH1 L1800S (0$ 4cR$0L1@e6c@-`MtPip@T 10'*"*0*00(00,00 $0$00Ѝ訁>p@-|0( x@"6 0dLa80 80000$00p@PP p@I6cO-PL,MxQPH1p0H1 `[o@PP`D  ~1 1%wH0j `S7d1 00 0`0 PP)`0 hl0Pd0\ ` 0X 0x10T P`$4"49#9003H10H10o,Ѝ p5%0 0/X0P00`0 0 Ppz`P`VSP N@-LP4 D@  \\ @@ @00L09Ѝp@@ @ 00L0pC-`@pLMP0 00 000Y0 (0 0P XLЍ0S!04"408#80S 0?0S 0Č 4,48#800SQ\Q00 $>4"48#80@- 00 0e Ѝ>C-@P@@0$M,c 0`HЍ6cX p@-`P0 & P<@P `P  0p@Ip6cA-P`p%0Mx@PЍ?P L180 0040 00000pI6c0@-P$0M 0 0 [yЍ0!!@-(0 0600LyЍ!!p@-@Pj `14L180X00X0pO-,DTM$ F0@ px|?)0@4RLaP83W 0CWg37W@ B27WE  0 lIP@  0 \3\0S00@TЍ QTЍO 0S0`2X0 \0@ ~@P80 TЍOH0S0  00@0 l@P0S(0$00# p" ppS40xx0  j 00H000 IP0S(0$00 t|pZ H0S=0  `I00000 (@P\( $ 0000S0q 0&?00\0L     0 @[   0 k-@P H1 0S H1@P@0H1@`0H1@<@:@8 @66cvd>pO-4"48#80C-1@SP\Mo< 0|0p`\Ѝ4 00000L(0P P00/ $4"48#8 0 L P< 0@00 005:5 020,30(40$10VWSQ! p`6+ 0p` #$+4"8  > C"X!\1, P!(00 T!4 x!2L0^?0n/ P00p`| 0# 0(0,0002 00 L(0$ OP`_ Pr+0So 000SV Si ,0p`b 201 483 00LP<0'6#$+4" H1 0`=P0 (00 00 0( P0S"+0, 4"40 8#8S0 48L1 80 P-  {P&wP#   3/P p`> N>C-$M`p@P ⨁*n %X409400000Sv S  B! B   0LQ0100P 0X00080 080,h!-40 PP ^Pa-U< U< \hl!<#  ! \10X10P1T!,x1S \A,Q V,,p,U M \0\QxPL,$ЍH0 SH10H1rꨃ>>ԃ>T>`!!v>G-P;Lap0@P<?PQ$0U S @ @L @PP@  P@@ T 880P P800Y .P.PP 080P0@-3@PdM *QLP+dЍ0  00R( 0 2  0*ꬄ>>ф>p@-P!@0PS ?!600#Q0SP(0?0` ; S00,0|0YZ2Xl0%XS40T10P3/P1'4 X3P@-X3@  T1P03/X3;X3O-Mp؃@w13`Ѝ?0P X3` t0P ` 0 p$1$@ WJX0P0/ @  ) B$ H$  ))`, 0徲4 #(08 <#T! P2/P! < "`P!V0p@@0u>A-P1l@P`0$S PDPT(V*P(@8pV4 !$G(@TA @(>8>U>Z>O-(`pT@[[00P1P*0yP1P1{p  4(d,t"< 402X#  p3`S002ձ02ű@202(0HPD4T103/Ll0Q0X'T' HD@',)00lb>]>Å>v>>>>@-|@`P@AAG-pPW`@(  8 X@D (,$D00PT`H00#AD n (,W00 02X3  D\(0p, 0 Q0000P0S202t4S P10  W0 202 0< 0u4S P10  0S2<2X3@20202X3 0<2X30 0 2022<20RoSx40x4pT1P03/GpG-p@RopP1PP1x$0 S 0!R*F Pd0P_PO$P08 p#PCpb4"p@-R_@pp|#Rp@pd0|3T-p@-R_@_p#Rp@pd03T@-@`Pp<<0$M((0 00?Ѝ6cG-DbDRp f0`Q(@PpT JP| `3d#0x X3A> S9`a WVpA00p 0 0CpP7`X03 P1px3SVP1 RRBp,00 4(`P!,&PP1o0V0U0S P! 0S ``0x3P1 pV Ѝ1 06  #:: 0*PPhP&PLP  0@&`p6cŅ>l" >E>^>p@-L(0H@P#04X3 @t3$0S$@p@r6c@-`MtP<p@T 10'*"*0*00(00,00 $0$00Ѝ耆>p@-PP@%00$000P1 0P$P L%`0P1 V`p@p09SYS! 0C023 0t~QqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`nꬆ>>11@@p@-l0( h@"6 0T$X300$00p@PP p@>6cG-@`2PY P1ЍG< D0T`0"R0L0Sl rwn0 00000 R!$$Y 0S<00L0S,3d00!CЍGnlq 0 P1 2P *0& P1*$qP R  qqq|3  d00|C0fn00 2@0S *"*%0S 0S$00P1 nx40Cx4Fn=ЍG>lb>D>Z>]>Å>">/>>>">L>h"br>p@-PT1P @0`3/P P P1 O&T1 0P3/T1 0P3/P` P PP10S p( L6⁽@00;000000 e66P1 p虇>>p@-M@ PP *l0B8#8S 00܍p:< 8000tP!Q     8@-M` PpP`-*0B8#8S) ' Q#P1 0,00@400300r2T10P3/P1 4 P1` ߍ-`0u̇>@-@8  _t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0|$@op@-@T1@0P3/PPX3VP <r&T1PP03/pX30;X3؇>O-MpP`@ HQl 0xdT10 VP1 P1& P1  |cc%x& PE 1& p`<%<i P1  PG L5LqP<& PG~L0$0,($  `ʶ0P 0 %Ѝc moP0Q Q P\ P d2 ` |&PtQL1S 8t/0T | | &L1  %0P!00P16n %?0 X3<X3n?0 X3@0X3X3|w $2 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ |]6> #W?0D0Y?ⰰX3@0 D ?0t# D h | %W tL%V  04%0%}%t#Å>|>/"/">> >>>>>>ވ>>,>H>J>>>͈>>C-@P@@0$M,c 0`;Ѝ6cX p@-`P0 & P<@P (P  0p@;p6c0@-P$0M 0 0 OlЍ0"l"@-(0 0600@lЍ"l"O-@03, 6P 0M`8@@0uO-p@ 0 `PZtHlXP1 !)0   0 PzUR9 niT1P 03/      꿄    iB 8|TU 0|4xnG 3i0P!0P!0 Ѝ ">>@-fT1@0P3/P VT1P03/p@-PPT1@0P3/Pv00=pH0   " ""   00H00D000h0ԋ>p@-2RP0@`2 R R0L00QP0 $ <06#p@ /0L00P0S6!>>p@-P@`Pp0D0$ 202<06# 2/p@ , 0    , /  A, 0/ @  /$ O-@pDMPh0 `00<0 $0f [H 0 \0p 0+ t0S 3/0 $ _02\ 0:/ U3@ a`4@l7P D3@ @47P40!0d R2  R00p + )3\ $ h0<` $00(0 000c& 010,00S 29 200(_0 P <  0"߽p 2< 0R2<0,, 0C0CC(2 p 2( t x@0'x00 S0!< 80 S( 2@ ŠĠt0S 3/$0 (_0 $2\ 0 3>;>D>M>b %(>>->ˌ>ٌ>>A-$ 0<`Pc&@pF 0S `0q00 . 0 0S0L01 c 0 00X0'<0PX ` Ѝ1000 00 x0S 3/ oP 2  0   p@07/8(0< ,0(000,4000 04 @ 0000CS00ӝڰ2* >:>k>p@-@P0 h  pR/ 0 0Rs00#/ 00 0/Q@-@ o l輍>ɍ>Q@-@ b0^Ս>ލ>A-@PD0S0$D0 $`p8 RS < `V< < 08 R0< X X <00<00 R p0>A-@p 1SD R$8 < #" R0Q `PXp7e`00PPxe 0A; 0` dp@-\@ _P0 R p   @-0@\`\P 0A0 00p@@0 @0d HJЍp輍>d 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-  MP@&0 `00 00 0:@ Ѝp >d=" 0/@-@  08 0(0!3R@-b /@b@-@<P$80>080<0A-`PDP@$p80SU 0Aop0 0ATMP <00Q@Q<00P P wA-80@SP <0S$p`<0S<` 0$S8P<  @< 00A-P@h003/P` P PCA6h003/pW h003/O-0P`0$@T p p 4 ЍO  0S0 00 0S     0R <0X2)QA    Q!PX < P 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    PP X 0R{ R\ ` $ @` >adp@-@P`1 0B 04@0 0xp@(0`0S 3/  0 pp@jdp@-@P 0<X00X 0@0 00S` p@*00X0S0X  0@ 0 0 04[ 0 0 00 R0S 0=@Sp@A-`P@0pS,P 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <AA-@p`$0<00P P h0 03/<0P0 A-@`帀h>A-P`0 @T\pNh0 03/D@A-@P`<Q p0S 0SA0 0R 0X00S0  h0 03/ Q\00 00@-@ a@  00C 0/G-p@P" U  U  U 0  0C 00 0AG2$ <08#  + ꀃ d, `` 0`0 0 U  U#  U0 03/0$8 RV < #"0$0@-@0 0S80S0,XA- @Dp<1`00 ,1T0= 1T> 1PT 2C7CT4c0,Y^8 R<0Q$ R (0S @t T``@$pV80S@<04#P P -8cξ3A 2A4Ap@-Pb @`0T@ 0 <0S 3/@P 00C 06pC-M`@VP`6@P40S  pᴀPl`00pp@axp `d0pLN P f0@ @fP0ЍCZЍ蹎>b@"d>0S"M"?">T@- DC@P 0P0008cp@-@ 0P CS <0S 3/p@C-@P 1MSX03/<`4`0S  `x< R% 0$8 Q pk@0 00@PM P! ЍC \0OT]` R00 < ,` ЍCЍdd >d^"G-@p`+0$8 R4%$ 00S 0SA 0a 0  0; 0q P\ 0, 0S < 0 <  0  80S 0: 0<05#0  0*P 0  P)3 0R S  P 0BS@>S068PAQM:>8>4@- $'@0008cO-@P$80S Ѝ<p0S P `0 00 00e 0CbP>0Sw*@-@@0@Q00. >0,! ,1Q 0 @㜝bMb@-  2 05S=00 a`09#80 8802 0<<0A-@`P%p<`3  AG-`@ PP@  ,pE0S S8 @@ D1. 尓 ,/ 408p<003/3 3@ z0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0d NEFXPi'TDA-pP`||R @PP 028(00,0?S40003/U3 PPBdG-p`P* @PP 0,00202?Sb40003/,3 PPdO-M M`0P @0&pP00S80005/,Px '000$0度dRS00X2PZ< :  R+00d [fd R  PWW Qd R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ąp 0p0p00S ۍ ЍOp[*Wۍ ЍtP tp0pGWpX8PLHD@W꜏>>>>>Ϗ>ޏ>>>> >>O-,@4MP ] p]80S<0 2S0$8Q D R< #" R*T03/80 S%d0S 3/ $`80SGfPP] R00 < (] yK0$<``00SQ  00  `0Q0 00 00<`V =<00`  <0 0Q Q<0` 0 d%>d="I>p@-P@`\ PU4]p0S \P0 P/ 0 /p@-@P\@]pp@-@`P\0 @T ]p0S \@ Pp@-P1 P#UDP3x0 P0 0 00(005$ @,08,0P 4<p蔐>@-@4<@DK@-@ y\,A❽0S譐>p@-@P 00P`g\ᖽ\Z\Ap@A- a@TpUʀ 0! $ 0    ! 0  @ 0! T0t l   ! 00 0h0 03/@T \p P @b@d`ddd\U\/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp =,0帢,<zpsL!DH1003/X#-  Ѝ_?0Q R 0hh100100100 0R-/@@@>>G-@p`Nz⥼$0*>8x"8"O>X>bq"ɑ>m"G-`Q04@B P1J_pC RIZO1 Q PRH R\qPUPQPRPZG $1Q PU G  z1Q 0U ( p0S jh dQڼ_V0PJO`C RUZ\LZ@HZ4UDDP=U9>>>">H>>J>R>>>@-o@-MPh0`@ Tp@@d00@0 000`FP Ѝ@ЍA\>t{"p@-@PL`hY 0S 000 P0H0P0@@H@p@YA-@`LpPOY 0S Q H 0 0 00@YU YPX0S U xYU ,YYP @YG-`PVLp@Y0P 0J@0S7TYG^P,(0 ၆i(0 PT) x \GtXXX~o=;P P7U3 0@- $0\@[A-@tpX0 03/`$PYYV 0Ab0   Q @-0 03/P0S/A-P(MsN@PX@(Ѝ0`P0$0(0 `0 03/$0 (0 q?00008 ԅ0P/ p 0 `p*08/0S0=0 888/Pr? 8 居P (<03/ 403/姅ZN>p@-P@$0 (0 嗅(<03/400 43/剅p@;N#@-d}P0.X X%,à1 0")!0 <"#1o\Q @#@8MbbC\c>@-PM@P   010 @0PЍ6$p@-P0@$0 3/D`V 1SSpp@-PM@P`P 701@0T@9C>H0 @@0P  0( 0 0 PЍp@-PM@P  < @0PЍ0@-P(@TM hTЍ0P $0 010408020@0P$020겒>2p@-(0PPM \`PЍp00@S SQ 0R0@`P  0T1008020 @0iTP`  2P0@> >@-(@00 3/ 40S 3/00 3/00 2/p@-$0@ `8P8P08<0,4p P  `PU$09$0P@-@t`MV0 03/$0PPy99$07WU W$09$00<0S 3/ P0p03/7/PPl 0 4pW  7/PP <H(0 ?n03/(0 KPP(0 $0 K8PUQPP(0$0$0 O(0 $0 P $0 P PU8P0S pp 0 0S $0p p00 00 P PU$09$0KV$0 9$0Ѝ@VW Ѝ@Ѝ)>D>[>t>>>>k"A-@`,Lf*VPpDPU  0R0H0 0 XP`V03/VXM  0Sf $0 P  JVUP@P7 @VCA-@PT   @ `840D 4p P `84O-`0.40$M 03*@@R  :$Ѝ![z [ [ 0  +3"[ [ 0 S,  P P9 0 40 0 0@R TP P)TPA  0RT@?4  k h e2!!1 0\1 Tl04  0QPP 0@EG?0 0B0P[ 9 6P @P +P@  %P[@pk[ 0 x _ PP   0@40  0400P} 4 0 0P 0  0Pf 0P 0B ! YSV@ RoГ>>>>>>>;>>͔>`>>z>>>C-0@Pp`*0) B = ,0J)00S V `. VL`) 2""  /  ЍC ܕ>>$ X0R/0p@-)00+P@*0,,劥JoNOPVPp(!I>C-OopPd`【TMBP  0 1@iP 0?4/`V<?oU20S 00TЍC'O-`dMp0pV Q ;T.;P"PP@P N5020t!(SL0LpU`10W ,PDHpP0G S<<000 0``kP7 R00,`0 t0@0`P0 hdV 0UpC00 0  dЍ4 80 PE`2rp>A-XMpP`6@P*U@p 0PN0P TBP402t0PSd020H0$P@P(00 <T 80U`C00 05o XЍ2@p>@-$00$00 00  0@PT P P$00$0Ѝp P$00$0%>0S,0 0TP P0 3/ `PP, PP  ꠆–>>A-@00PP  0004P<0P0<00 03/pP` H y`0p`0<0<,0S>>@-000 00>Ѝ@-1 0 1ЍA-@04pP0 3/$`Q\@    0 03/P tH `P X@ 00018  1\1\1 Q004`V 6/P`   ` @T :0  I 03/tA yPp`P6>N>Pa>y>Mb>>0S/pp@-0@4PQ 0# WPL`0S 04A0P30PU*<p tb>0S/p@-0@4P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ2@P@@@0 P0`HC-Pp`"Q P 1  0{ Ѝ @P@@@0 oP0`HC-@P`pQ P 3  0U Ѝ@P@0 HP0 P ` GC-@P`#pQ P !3  0- Ѝ@P@0  P0 P ` G@-0000  0Ѝp@-0@4P; 0# p@@p@-0@4P, 0# p@1G-p`0(0S PG@P WGP`/G@I `P Q0S40(0 3/0000@005Qp@-P0(0Sp@`P 0R000 Q0 (03/4QFp@F@-0(0Sx@Rp@-@`PPUP0 p@,0/0 3/Pp@-0@Q4Pp ` 2/P D$ @p 0`( "4`#/0S 0\/@-48 \$ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0( xMP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00}@P8p0 }P (E0 X\000h0(00(``X0d`射@P(0 00 0~} EP@P (0 h} <03/ 403/xЍE rZp@- P@@@4?`;QpC-@(0TMPp`p( P  < Y<00010481`1d`@0(0 00p0 0 P 2"0 2"P TЍ8 0b0?o0cS2   ( (0` 1011SP ᖾ 010 80t0@0uP P  ᅾ 01(0 080@`cP 0  rr2 6$O-0@Yp`P? P9 00 8R/00 RZ 28h1 0000|P> 0|0 FZ,0 00||t`0 0000!0]|P00 0j|0 Z \| Ѝ0 00V| _M|G-@(0PMPp`p@ ?0 S㣤030#$ 0 P  ޽011 @0P-P  Ͻ< Y<00010481`1d`@0(0 00p0 0 P 2"0 2"P PЍ8 0b0?o0cS2   ( (0` 1011SP  01|0 @0aP P  q 01(0 080@`OP 0  2222 6$O-0@Yp`P? P9 00 8R/00 RZ 28h1 0000t{PB 0{0 0Z00 00r{m{t`0  p0000!0D{P00 0Q{0 Z C{ Ѝ0 00={8{21BP31 a1/G-0xM01S`P`1 @o (0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0z@P;p@0 zP (╼0o\0@0`0d0040(0D00h0(00X0j@P(0 00 @0z@ @BCP@P (0 z@ <03/ 403/TPxЍBC rG-`0( xM@p0c   0P*5/PP@008P< 5/PPB,1P 0<`zPP4< ozP (0$\0<`0d00040Dh0(0(0X0PP (0 00 C-TM`PP p 60 X100  @0@P$ U PE_oYRPU 0XP PP  (0 080@P@P  0 DS@TЍ   H6$6$2 2 ח>>p@- P40 S" 3/P@000S@  3/@P\0 4`V  @6/P@p 2/03/aO-pMp\1堠@Z 0100P4` V  6/P <03/H1S< p`P   ߍD1S R0Ԑd1(0    p xVp@  p 0P0 0 3/!W +(0 `-21 1\1Q00S  40S- 3/PVQ < PԐd V TsW```F0 VPW 0 03/[VX [ 0  PgPI040S=   3/P>HX1000 R0L!00V,a`2P)d1S Se! 0 Ԑ# 05h1h1S 0 !t P000 \1Q00S 0 4PU 5/P 03/>4>S>u>'>И>>>>>#>C>O-頠\1@Z!0P4` MV 6/Pp DR 03/(0L ` 000 ``00*8/PD00`80 8/PF9p 00wP8`0 wP p>00000\90308(0p 00(P(0 00 0ww f?PP (0 aw <03/ 0403/X Qpߍ?x|74p`< !4 4tp00P  'P " (1pS  PXp(0o1S\1Q0Z0 S 04pW 7/Pp2 7夐8#t200( 0   0p*@7/pP008p@0 7/pP6p 0@0vpP@0 vP q0 0@000(60 01(000[pP(0 00 @0v@ 0 (pP F012000 07pP00 3/pP0 0p  H-`1 k 00PpP VWa o 06$0(0 Q N  003pP 0 R pP$08$0(0         Ho48#|2婒\1Y0 3/(p\@>PUpP (0u v@ <03/ 403/W p0 `0 n0 c0 0 0 R0Zp ѠБ[0 [00 !0;0s1 z Y xX h0S T[ H W8 4W0A($pP .?>(1S 0 Pt000ᴡ S<#0 0 R XX :1S* 1S' 0!`Pt161`!A?;`V)      '. !R尰R , ][0 " !(   尀|000> ro>>>>>ř>T>r>>>>>>>[>e>>Ӛ>՚>>>>>A-P`@v $0 DS P9 PJ0 0(0 `L rPaH TXX p[1q#3!?A1c L\1`06 SQ 6 `'``La H`P  r{ 6Hv `'q`` HLaiP`d T_XX[ p[V<0q#3( ?A1c\1L!4L1ꤗ>gfff5>>p@-$`P`@0  p7 `l2 Xp-Pt)Hu%@v!8w`0xya |  pH!R0BS2l5p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yza>C-dM@d p(P |02P_P*00$0`80 ` 0 0 `h0&hS `Pb(0~P 0(0 p8P0`UdЍ40S04P0<0P(0P@-0000000ZЍ>C-oo@PpdԐTMbP  (0@010$0 )0 1P( 0 U 0 pTЍ0 1pX<UG'p@-PMP`@P ᨴL0 @001`?oT20S (0$0 00PЍp2W@-$0\M@8 0$0(0 0 03/(0P( P $0 R0$0a PPPE_oR_0[\Ѝ(0 P V:021$0;H06P,000 03/ `_P0`(0$0Q pR |P0SQ0 03/T .P$00 P 20H0 02PP$08$00@-TM@PP 010 P@0TЍ02p@-(0P@ ,Pp$0 SP000p)P pO-P @`pD(0  PdW@ 0 @Pp\ D Ѝ0 `@0 0 qP 0 00$00S (00  00@q00 0q`0 @P00 0qO-P `p@6D$0 0 03/P p@ oD Ѝ(0  PdW@ 0 K@Pp\ 0 `>@0 0 lqP 0 0000S (00  00@fq00 0aq`0 @P00 0SqQ>C-P@(TM@>R`>:pCP  $0@ #0 01020D@@0@P P Ӳ$0` $0!01020d`@0@P P ᾲ&0160 @0@CTЍ@A-@M@! `PpvC$0 1pA?!0@P !0E@P 1 4DCߍ0 >@b>!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-\$O-PU@yP)m_C01naV!no1SKLCvU~o p\`0VnTBvO~MKA,$p~P =pPW C$00呗B[ iP1 fPC-MPppQ@101U 0|10p!]?l^ 0t$0`Ap19l!lM 0va 0~v 0 mhBn010ȁ1ԁo @ャ01$ F40 00\` V10㨁 t1ߜ>>(""t"9><""@-@p*VP1haq宕1p Q V  0 t1 0 @ PU:Ch0  \p%/W 100@,g>u>[>Mb>>A-PL@L`mAP0n`ABs@- 1`QPp@p000#@0R'Ѝpm_ARP 82<"0820 <"0A0P0t0L`000 01no1010s 10CS1nvd@b"p@-pP@mojAP P2""N0 0 ApPP0P0 P1t"p@-p@PmoFAP#@ @@(0 @0 @1}Ap"A-@`$0@PA಩ E UPmAU 101ZAUPA101A-pp@`P9oL!?R01 AA-p@`@D0L!mϠQ  p [00$PP@AЍA苕0 $0+ "PP 0S0 0000:lF 00 0@1S$0P0<0$8 0աЍA@Yꨝ>ʝ>Н>b"p@-@0P$ mo @$31S1p@@ 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`ddd (0 R 0 0040/d,dO-P(pP`@\p!RWㅡ& W5 @ P`p1S0 0@0 A\'0S0S  @ T   R 0 00qT 0 Tb 0S 0S0S 0Sp>d>R>z>@-0@S f0l S 01 0000S>@}  Q Q  0dPA-"S@`p0 100PU0S0 8/00PQU0S0 8/P>dPp@-P`50@0 P`00 R @p 4@0@ 1Sp R  R ,      0>d,d>@-@ R 040 @d@-^ 0@/$0a(!"$a$"  b"!4b4#0/p@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Qp/o"0#?S Rppp,b Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 Pdbhb>/@- @q <Q 0(Aq >>!>0@-4M@P`000(00 0 0    , 0 0嘯P 000 ⪳4Ѝ04"O-4M`;@2`2020 00 P0 5/0P  P 5/P WmrZ pp 0< h9/P\0 ! U0>0 4 9/0 4 ;/Y  Un 40 3/[  Ue^ 0 !0 < 8/ሁ PE(_CSe(/C#b?0ET Pr@1P  P C =000!(00 01P0 0 P00P0 000 P (00 000>00Pw  ‬0 0|0 0Ү4Ѝ>~^4dbpb8>0AQ>t>@>Mb>1>4"@P>@X>"/O-`0A3vᣁᣒᣣLP \[ \  P @P@ PD  \ # ZK0/4d@-D 0S 40@/0S U4d>@- D0Q d@/Q 0<4d>0/4dA- @0PS ` p 403/0dU00 A/ R 0Q0004dѠ>N  0O   ! "`"Рo@-k>@-g%>p@-@PፗPpH0. `@@@Dᙋ$0~ p@0R>b00! $0 /@b@d 0(0S 0@o/@d@0 !!/@-0 !@@-0 !@p@-Px@x(PW $0dP$0 ,0KO R0(崪,04S00!p@dK>\"@bp@-@p  PPPDUT ʀ0 ! 0$ 040pc>@d0$/@dG-`0p$0PUG|U !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pf10, TP2/@b@d @- 0 ! 0^ Q    D $ 10@S@@@@d@bL@-0DPO@bp@-$0D0P !;3p@bG-@`pro  P00TS\Q0 !HP10,p1,a(0 ℑ41 0 , w>@d@b@-@Ko  Pl ,00DQSQ @"0@!,1!,0,q@@d>\" $0 0!0 00 /@b@d`ddd,0P 0 Q>0// d@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S  dѡ>P0@-  d@/  R 0 d>@-P`d@`0000  p 07/PPXG0Lq 2/y/,9 0 4 8 < @ D H L Pwn  P   O R0 P P@ Ѝ@J0,0 0@ Ѝ@>+> d"A>e>0@- !" 0 !0@- ! 0 !`QO-RrpxPGx`q<@U@Tp  G210@ 010n  P `U pT X Ѝ@U   0 @[X ≐@0 4P0ڬ 2/p[ꃢ>@bp@-P @@@@m  P`@p0/ dA-`1@P0_SL b0 _SL0_S Ip0 _S I0_SO 021   0 0Q000S$ ShA d>٢>A-|0 `pR_V0@00C{ 0@@_V=Pp @ dG-1xPPxp@ \-W 0GSD ,0S 0 e 0 @0p,0Y`0,0 B0  W30# W _YOO@A$ 5Y0 ` _YOpq _YN @ d >;>j>>l""G-0`@i0 p R, * 0 R& _TC _TP@PQP$B@  A0P% _T F d0@-@, _S= B d( 0 _S!C d( 0 _S! F dA-PH0_PB`@@@Ap0S  A d( 0 _S!O dO-00Y @b_[pLpq0 CX_[ `I`aPPp0Z 0 @Z V O  @   d@bʡ>ɣ>p@-@@0SpP"0 PpA-`P᪽8` `p00p D1@ v0P   8/P Ѝ0t B| x0Q  6CQ@ 6Ao0, N 0AoXb>p@t%`A@-P 0|!SF &BS &SG `ЍpH!S0Sk  P(A 0SkA1  P@`p2 0@0  0P` ` 6/P@0 \` 6/ z|0` 3/0Sjk\@\0 0SbkD@D0 0@  p@`AȗbbЗbXbЖbbbb/!/!`!//` `! /!b!b!b!#b!+b1/c 8!0/c#c4 4#1/!)b!1b!9b!Bb!Jb@-`Pᾼ@>P0@00 p0 7/0P {P d`6/0d` 6/ Ѝ@#>b>5>@-咸o 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddA-Qp@ 0d`6/0 `_P0d 8/0 48/V00V*U03S 0`4P 5/ P0d 8/ PV`!U0#02bbA-0p@ 0dP5/`P Pd08/0 48/V00V*U03S w0`4P 5/ P0d 8/MPV`!U0#02bp@-D00@ !0 4P5/0 , !pbp@-T0@˶04P 5/0 00dp@/b@0A-\!\Q\a0@0i  PD p8ᦶ $ p᝶ ᙶ`0 00`0 00`0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/0`0ЍA DdbHdP1bG>""7@-0Â"6 @FC$0S0 XPV0@T :@@Dd0 0S B @DT Ѝ0bQY'A-pP@`0!0 48/0dp0 7/0 dp7/0 !!b@Bp@-8 0403/8 0d`6/pA-0` Pdp@403/ ;7/0 4P5/P0@ `dp403/ ;A/@-8@/48/@-8@/@-8@/@-8@/@-8@/@-8@/@-8@/A-@`hO-00 0B ( 00Cp 0 00S 0F0  0G 8V0 S] 0J$00 3,000  0 C 0壐 000 000p4$00S0@0@0000$0@A QIP QFJPPBEQRH P<Ѝ@03/d03/400 P4 L0 0R0@ 0R0?ZaPT (Q <0 3/ R 40(3/0$ 0꺤>\c$tbcxbt>>R>A-PM@80 00 ". `6/`P # 001! 0@0P $ 0 dp7/T1 R `   P ,bЍ@(0@8p<0$0:0 080 S@   1H0D 0S0009Qd  z000040I> 0 0000 8/0 @00 W,jΤ>>>pb# > d6> ]> 0S/@-@ 0S/@-@ @0S 0CS/A-@M`pP ✠T1 00000 @P@܍ 1P: h0R1ʖQ001  d $0` pX@y000040@ 0Q Sp@-@P  Pp/C-MP  p`P): @0 0( 80<  S@ ʜS0H|0D 8  Zy40 00T 5/00 @00Ѝp@-0PS @  00C0 0S0 0Pp;(Q $ <03/ R 403/p@f>$p@-@R 0 0R 0R pR 0Rp/00   ,000 0H00 4P5/ @o_W@@W@AW@EW@- o ϜDH R< o    @03/Ѝtb@-0 4 0@/@-0d @/40P 0S/0S<0// d0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LT \\LXp` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPLITP,Z`N `Y  \ pXp B`\  ::0:0 & SC-M`pʵ@p0000E 00 P0 5/PP \ЍCpH2傏@   p@Wc  P ("( 0 00 00$ (0,0 0S3 rUn"0" n2U]"L" ]2L2PUP*00 PPp008/P  1 000:88/P )>0:! r\P!: p\P<: R? p@ P 0j=0:* 00 Ѝ訥>> dХ>>$>P>#O-0`SP@ Z-0S* Zcp   P00Z0000 ЍpQ3# 0;c  P  0 p@SHG-paPP@::S0YL M"L"8 R Pc  P  d0(S  D  "O-@ P4 pჟ0  Q ` !PU h0pW㋰   Ѝb  P  '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0oP t1 R8 8  01Pjyz> 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddh0h0@- 0(0C*s` Ѝ1pP0d0 @0 L~`P 0SQ 垮Q0 ,Xm`P,pWQ 卮Q0<00D00 87 H0R/ R0 0SH01H0WH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 hX2H02,00@008000@@0 0S%40040 dA-@2PVD`q@pWA40@00S 80S0p 0sBPh 80S80S808   YpDKXDD)< :RD01 "0D20LML q @50@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0  d>p@-h2@4Pld 5/`Ph”l0d`d 06/@Kh2ld 4`6/h”0ldd p@/'p@-P`q@&PPFP jXႺ cp"R h2l`6/0p2pA-P`Kp@0h20prx$0`#h?0  0 8/ P ЍAq0hp2(Pl5/ (h2d 4Pl5/4Rh”d 0dpl07/h2d 4pl7/h”0d dpl7/h2d 4Pl5/1h”d 0dPl05/h2d 4Pl5/PGh2d 4pl7/h”h1d dp0l7/h2d 4pl7/h”0d dpl7/h=dph l7/h2H 4pl7/h1 dpl7/0 P h2p"lP5/0p2gܹ0P  PX4 Ѝ>>'&>">#p@-P@_  PPp00pp/@-0*T00@/@-0 T00@///@- $00@/$00/@-@$00 3/$0@0//@-@$0 03/dis@->0`@ P  B` 0ŒQΌ Q @]0T00 P05/P  0 ЍpA>p@-0P LE00T0@4`X 6/TX0d` 6/p@]>O-,Mx @ d0SS0 p(а d0S ,ЍS CS 0C$0Py(0``03/P呰 0PP0  (0`P  pꀧ>P,#>p@-@$0 03/$003/` $00) 3/ $003/P$0 03/ HxF$0 03/\>XP$003/Pp}4PUp3/$0 0 N'p@-0P`@ I0 0T @ ` BT0 0p@/0@-@ . T A-0@0@q`PU P PUh0 !g R00 C1g$003/P00P$003/0P RR 00`(d0 U T0X 4P5/T0 dPX5/Pb>>/O-@,M1 !dQ B*d0S1 TX00 P0 5/pP L1,ЍOd0T 0C?odP2X5/x d0SS0p谟d0S },ЍS CS 0C0(P` 0pPP3/p0p 0 0 $ݞa h p00 po h00>b`)#>$(#,(#p@- R 0@P5/00 ^p Yp@-@9dP8 5/0dP 5/p@ C@-@@s@-@00 P0 5/PP \h00Ѝp000(` 6/ 0000>G-`0 p9d":/d0":/0"d:/`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z :Z 5pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z oZ jpWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/.`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < 2000(0"((>?>p@-@ک dP05/pp@-@ͩ0 4P5/0 0p@-P`Ὡ@`00:00 p 0 7/P { Ѝ@$ ┒`0p<SlH8008080(040,0 Ѝ@裆 0 00$0[>n>>PH#H#E#E#@-@ၥP 0SW  P0<00 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddA-@3`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-P 0 3&*?=0 `p?x0@xpA x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X080/@-0d$ @/갨> Q/0>D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PE_U Ab>> 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-P@`U$ kV  P0UP0p U /0S  \G@t x0dP 5/0dP 5/@p&.>p@-@`TP T6V  P @ph@@p@-@P0d` 6/0d` 6/( d`\06/T00T0app@-@Pt`\00\0dP( 5/p@N@-@$X @00@00X0@_ep@-@`UP\00\0d`( 6/p@/Q G-@P?10 d`?06/4 d`16/18 d`6/@0` ``` `@h08`SlPUt>>b>O-0@4P, 5/0P( 4`6/P ^PX0S   P0_ X080S X040X0@0@(_ X0D U  X`@0p8 ē0p 0< 4:/04< ;/ 0 'X0D00 4p7/p@0p  p<0 1 / T  P+@0 0S'0D0@ 0< 48/04< 9/04< :/2$p 4 < (p,pDpD0S80SP040`T  P @0@(Z P Bb@P :PX0Sk  `  X0D P0 X040X0@0@(2V\P \PJV "P` XpH X` `0HH0@0@% V H0S+`P + Y'0L,0@ L09/`F0`F\L0 L 0D 9/VX0d`$ 6/@>C-4MPx@P0,X v0P 0 P05/pP  dp4Ѝ0"-P 0P P5/kS  PNh2h2ltp0S  P<;PP`d0hP`O( 2P0vPb "0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`10P,0LPt(? @(0d!`(0P(0(0  (0  (0 (0, `(0,P(00P(04 (0 ` ɍ0@00 000l00p0 0P00$0S  PP0$00$00 PZ|P0P (P ꮩ>é>Aũ>LR#ݩ> N,L>@A>\J#DA/>I#K>TbQ>p0\ ?R"0/A-P` VP@P 00S lp<P U@ X0@0X0@t`VX00 @@d4c dp@-lP VP`⑑@l`PUX0 U0 X00\0`0Mp0X0d4cA-L@`slpPA@ \0S@1d4cA-@L\PU `80lpph0d4c>p@-@p`lPp@X0 @-\0@S ` 0\00s00`R`0(0C#p@   t X / dd0S/p@-`d`@PfmT h0 0!T0$LH @   ! p@ d@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-P@dP \0 0T ?S5[@0 2 03/Ppp@b> d P0 P!ڠ 0@ S0/P P t`S /d/`/\/X/T/P/L/H/ /</8/4/h>>>̪>>>&>I>h>>>>̫>ޫ>-3@-@@-pS@ 04MS 2 03/Dc2 0 3/00 P `V 0 0d0S e00 00004Ѝ 0B S020S' 0S P000  00 0203/0 000820S 0SP0002 03/203/ 0S P0000 000 0S2 0 3/} d0Sq n 00 0$0Sf2 03/2 0  R05"105%R0 0f d0 `Sb pdpZt0 0l ?0YN 203/PJ cF ds>K>b>4>>bU>p@-@@`lP1o 0 Yb`>A-p`QlP@1W 1W 0W$ @ d1W# 1C7CW2 03/P0 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0000000 @d4cA @A A(@f>b dQ @-/}>0( o( / d@-@ab d>>>pd#>p@-@P P " " " #p@r@-op@-Pᯓ@PpC-4M`pK?0S,0APT( 0S 0s S$Q0 0$1 0(1@0弉008 0$Ѝ $@T4Ѝꨘ5dm#p@-@`ᱠPLD/@00000 81Ppp@d>f>p@-P@ᕠ01Sa8 p@ R $ R $ p0ꈭ>@-,0D ,@ 04/01/@-,D@0\ 0@/A-pdP0AT <1S 0,03/@-80AT0S $P @SG-`P@0<   P@Dp0AC0STW0l0l 0PPpW@DT >000XT0D 1 01{Ѝح>٭>ޭ>p@- 0PQ@ `M ` 8kU < 0 `܍p>>G-p`@ V@0s5 S20s/ PPE_oRP! Q P P Q PP Q PP Q PPY U @`FPY P 9/P@-@ᆟ0@00/X0 @-(/>@-u<1 S̚bh>@-(0 `MS$^@(0X001T PЍX L D ARF:@ PA,,00@@D  BD H0H0L {M wN sO oL0P  Bi(0  c _(000Q?0@  Q T RC G NX00X00S 0,p P 5/PP H 0 D  pP 05/PP 0  2/$n,l>>p@-(0 `SX@ 01S 0S P X00X001S 0H  2/ 0,  2/p@X  D  BQ:@ Q0l>A-pX0@`P  h0 p 07/P  0L0Q0CL  QL P R*P0Ѝ跮>p@-X0@ P 00p@/ܮ>@-pX0@P` \pT0S LP  0p p07/PT$GT Ѝ>0>U>p@-X0@P 8NT0S(. 0 $ 2/0T0pq>>O-p`@M 0SP㸐 0S5 0  P 5/PP,7P UPU0E U0#3S\ P  00;/PP$  0S@XЍ 0 @ 2/$p0S 0 S @X 0  @ 2/, 0  2/$pʯ>A-@`(Pp 0S `p0S 0 ` 2/,p 0 ` 2/$pG-`p(@ 0SPp㸀0S%  0   P 05/PP,p 0!PP$p 0S$4@WЍ0S$4 0S ,0G'T 0,@  2/A-@P$(`4p 0SP,p0S 0  2/PPp@-@P`Up6/PP Q(Pp@s@-@@N@-@h 0 01 0!0!!01(!10!0(1A-@PUP@`P| Pqx O-0p"SMSS ЍD/0C@ S00S0S00001I0S000S 0 0,P5/1 0 0,P5/P`1 0 00,9/P V 1BP0 !0011P0`!BP001UV0S 0 0,P5/ 0P 0,`6/1TQ 0 0,P5/ 0P 0,`6/1TQk0Sh 1S& 0s01! 0 0,P5/1T 0 0a,P5/1SG 0SD0SA0S S<P: 0 0,P5/PPP 0pRP3U_&W\p"P  0 0,P5/\ 0 00,9/P0S 0 0,P5/` Q0`PP S:1S 1 0 0,8/11 0 00,9/! 0V1 01 0 000,9/!0U100C/*    0 0,P5/aPV@? 0 Sb C C/`m011B/X0`1 aP 0 0,P5/P000@000 000000 0 00,8/00000P 0,   ,03/P:8   ,03/PX0C/ X [0S 0 00,8/0S0PPSPPP0S2 0S 0 00,8/0 000@0 00 8 000 ,8/00S 0Y0P00 0 RU 0S3 0S 0 00,8/0=@0@000 0<0 0 00,9/ 0 00,8/ᴚP0`0  R S @S7 0 00,8/00S0_1>  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/P>  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( 志8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0X P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0p`X d,0B"3/P @t@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 00>0>@-@M. ~ 010K/0  $!(! 111 1014!, p1>  ލz#A-P{  Q'R R@j`0S_(1$!0aVKO0SQ AlhhV XP`V; ,$#0 S(0  @T`\0S0 0S S||t| 0SP0S Xtp0S\Q 4j0h0 c0 ^0 Y0 T0 O0  J0@ E0 @0  ;0  60  10  p,*AwX%p 0S<Q 0(A$pQ 0AQ ,pE>V>b>>>>>u>>>>>$>>> >> >,>:>E>K>Y>i>>>>>ױ>> >>'>U>e>s>u>>>>>>>>ʲ>Բ>߲>>5>K>P>`>O-P@pa$!0r0C?o20S (!0r0C?o20SPA Q> VP;P8 Q5 MP2W10S  R(pW h@h }0041@041CC/n0Bp Y `W ,c$p_W>̚bx>>>> 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q ҏ`P 1S PǏP(㕀 0S>p@-@ 0P` P@HTppA-`PᢓX4S@ @Tt@Pp@-0@@ ThPPP T[PP PT0P4p%@-@TPTu0P4C-@Q4MT4P 0p`  8/P 4ЍT4  0   p  09/@PE |PT4 0  2/0 , 9/@ TT4 0  2/0>O>A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-Mp@\p PT P <ЍO4 0(0  RC> 0800P 5/P  @ 8$D0<4>`P2嬢42 4HVG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4}0Py 4Py0 *Po0X4Ѝl>8#n>>#4%D#>D%\%%%L% %L%t%%P%%p%%<%%(%%>> 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0(>A-`pԑBT PQ@Pp@-b@0 P PpPP  0 22D 0(1S5Q  "t%X>b@-@ 0 2p@-`Pᆑ@P  P p@ 0t(0 +PP p@0T1x0p0p0L1l0P13`YP0P PRP@0T102p@#v> #ئ#>%X%%> 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`ِ|4S@ P߃@Ptp@- 0 R\0S 0 000P00 Ѝ>p@-Pᰐ00S PpU@t 0  twPP xQ t0x4< 0pPxxQ txTPd%O-M`p}@`` tP  P ЍO 0A(P0000h0 00S0404РE>L00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 $#X#J>f>>#$#>`#b> #>> 0R R ?R//p@-陏Z1S @sqPp$Q p0@-01 0P Ѝ>p@-@T=X PS0@  ``\6/0  GT-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 FT=X \S`PA0@  5/p@0  FH>O-@M`V 0 SV0 SV0 S ⤉ ➉PV Z @00 0 0R5Ѝ0S0`pX d0`\h0Pl0UtT=S3: 8t #8;/T=X \S< x 0`;/X=p`T=S00> 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPp኎U@a 0L#^P$  RPP $x0$=1S 0"P( P0 "ET-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PUhS  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0Bߍ~PU$Q $]u%?H>#EO>->G-`@ᝍPh@ X P G@ 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}9徽 0\ R`l0P x G I P 01g>#i>#>>>/ 0P/Q/ᬛb@-@) R`0S0`Qd\0@-@T0$0-p@-@PH2Sp$0SpH20$(\003/$@-@$003/$@tA-p`@Pp 00%0徿10HVXB0$0Mptt P>``2SᏌS0$03/00S $!Ax?@#bL##A-@P0S},$^ 0H"$Lx$S@0%>b@a}fac8 d3cUtUUĈ\c##@-@@` d8 dH0 60S @-@,(0 x@0@/ac8 dbp@-@X & R@@PA@ 000S @ p` db8 dp@-@TT0 60SP<0p@8h0n, ppp?` d8 dp@-\@ RPP Q.5S0(0(000C0pp講bb@-@P U /0PP0300cS0`0e@QN@H@,\ Dx0S Bt=D ^Ѝp講b` d8 dA-P`I0@S"%0S A 00@0$n@-0@0$ 0 00@0$a@-@@p@-@P0P03/0p@0 Ip@-@P0P03/0p@0 < P00/000/P0S00/00/P0S 0S8020////@-0 $ B^\\^\^p 0 /G-P@0弑4p X0IbS 0 $0SP0$0W$0\0S000 0 0  1P" P"0,0$0S 0R*10$0P003/0S PZ kP  (0S V0@@0$(0$ 3/V 00$U@`D⏵oob` ≵W 000$0 0S0SGBXX0S pp@-@DP$0qP 00$0S0$0003/l$p@dA-p 000 ,`lPPP0 @$2100 P 00 $0(P.⌁X0  0  Ѝ@-2>  0 Ѝ@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ@-8 "  Ѝ@- <  0 Ѝ@-<  0 Ѝ@-MpP`J@P   ,0 ` P00 0 Ѝ! @-`P1@P  00 00 00 000~Ѝp@-`P@P  n (0P00 0 fЍp! A-`pP@P  T80 p `00 00 0(00IЍ! A-`pP@P  780 p `00 00 0(00,Ѝ@-  ! Ѝ"7@-P@P Ѝ00  $0CQ RR!Q Q @-pP`@P@ Ѝ0P @ 0P ㄙ0 @P {00A-`PL,( p0@0 `OT Ѝ< @-,00@ d8P@ b??8@-@@0 4@- CRS<0S'RH=?@-@P 000@-@PP0S0S @-@0P 0S @7@-P @ P 0St 0S Ѝ0s@-PSЍp@` @ P P 0S St 0SЍp0  R0 0S00/ SA-`p P᳘0 @P 㪘@@@-0@0$0 !0@0$O-@I0HDpF`B0 80E0PtG0@Ad(\ R \  \  $0Q \/ \ \  \  \ \ \ [t R l[x R X[p R D ЍO[ Ѝ????????????00S/ b!?Q @-@( /,?5?G?O-P0tMp@ `0PW E0DF IG0T@H$H0L 刱4PP0<`!`@hPlp `E W tЍd !R8 "!00SA X00X0\0000`0000d0000D00  r @R( Sr$ ( h0 00 $0000< 0,n P  0 0QdP!hh0WU?5#@-@\MDT0E0DFČG0I`H0p4@000@8 HA00LB4 <P j  gd00\0\ 4$00p(Ѝ6nPP XdP`phpj\Ѝ記5]?D#@-BP 00B000 000A-`P`p@P   03/@0 HHI0t \P H/0@@0H @0H( I00ЍGF??? ?p@-`Q@ Pp 6P $ *, $p?,?p@-P` @ p0I"RP Q 00#E@-, $ @,# q5\cbMb? A-p 0` P0 ?@P 2 @P0 0X@Ѝ @#A-@0P 40`CV^^p`W ^^PU\@p@-P04@Pp0S0 p0SSQ QS Up DQp@-@00$!srPP00$pp@-@00$0 0P 0P!00$p@-0@0$0 !0@0$p@-@00$|0 rsP P0 0 00$p@-@00$e0 0S00  0@$O-p8@PU`P. Z P  PP 0$0 \=BP 00@P R ⿬U R4^R R^[ 0 R   R,    00@^(r@  ^ "$ $?O-MP,MUPPqPU xP7@sP0`x',ЍO,8D8rP7U8ᇔP0႔TP 0{080P0T0 007 PPZ e`p 0 pPP f`V0  7QVP 0IT0S0!4R P` 00CS`( PQU(`0 `P )[`0S0!4R T`0 PRY 0LJ{ 0 P8  ɫ P0P#30 0PP[)  Pp80弇 08P 2 0AdB 08- P 08tU Hx8 080Pd8k8R_[,Ѝ??@-`QPp@MЍ@ :P 0S Ѝ@M0Sp@-`0P$@0s S@@T00 @0$pp@-P@0$00C00p@$G-$ p`PPP-0U000@0PP4P8`ppP 9p@5O-$MH L`^0 $ЍO/p0P@ [0 SLcy0 P]0S R\ 0 $\廫PU0C##00 00  0   $ 0 1 $ PP<00 )0 X PP  R  P  0SC0@S@0C0=0S aP$Ѝ<0SP C05P40P0 :PP =P A P  q@@sP0 PPPPd00 PZ^ 0 PP f00p$0h0 500\0 BRX0@ 30 #64 ,C帰7 P`0@0 7z?U?b?G-0@LP`x0}00 000b0`pO$V: 1n LlP03R$I> $ $ @04A04B04 04 0S004 04``V5 bP0`V3\0S  0N΅ P P R'4ЍcpQ  1P P< Tpp@0,0Spp@/j?O-0M@DP00Z pD`3S0 $0R  ЍO( 0R$E~ $0R*PU 0S000000C0UZ0 3[ 3η 0ᓉ(0 03/0P   "  XP(P 0 SD00 03/8$n 00 0$'ep@-`_OP +`Up000/A-P00S A/@`pD4Pl00S0 0S `J0S 0 03/0S ϖoO-0D@P 0`S\ p*0/00lp!se  s^  s X jN 0 r Z  HD0OP WD03S00S 3/Dq3@033 @/O-@$MD03S `$Ѝ3P@  00S1DPc`/ßXQ. V00 S$ 0 02 0000@0?Pp D,`b `Ds3/`P 0 `V` D 0V:` D& p@0S  (  Pn` p@0S  , PU`$0V:5@050 0S `G%?( 0 03/00` p6c{Dpܠ.c 0V:`o%0cdMf00SF?oD 23Z=!2`00o$7`c$?$b??G-Dp`P $J@P(Gb520 0,P00koGA-D`P/@P(pAF5 2ToA%D0%/D0/D(/D(/D0\/D3//D0/D0/A-P?c0`D20@2bRL  M   { wq `:3 Dp5$Dp/(w0 /(33$l$ dC-DP@(`aq <h<1X`01(p⸕01e01003& D`(021垟 2|1|!2x1202D0\d1`0 0 00 2S " " %0SP0380ScV0 0 P08/ 0 *Px ЍCmd8P`\P ᬤZ Ѝ$$ $ $$\$$$,e?$?A- qD@T\ 3SY 3PS\b(pV 5@ V 3S 80S;3S80003/1pD0\rD`P  0VpD`P $0M003v }{yK3S  K?30D08VeA-PpU`D@(cXpcRcpLc-00S0  S/8bO-`tp\0S嬢P U\0 E2#<@T `0S0 Pd Qh 0 Bh `QhpWdӈdp`p?p@-EpP@0/0IpG-p5p0\`V3 @ P0Z/*  DP 0S0EH⛈ 0\ $P (哈 P (厈P (剈 0S P O-\0$MP 0.0S 0`S 000/@/0T$$00 uP A  @\0 D2#<Q 0 @ 0 0S@p0 \D⚃#88 $ !R!  0㚃#<P \0S 03/ 00#"0 0:Pu03 2pt 1 0  0Q 070S  客0㚃#7 R7+ 壢 0  p0  0  p(@  "  [0㚃#< 0㚃#<0S  L  B  K P#  V@ 0 0S_0( ,0R PN $Tl( Wj-0SC$Ѝ0㚃#0p1 pW20    0<    p ppWp0GS  ZQ 0 @00 P  Pf 0㓊(7<0Z0-0J?j?????Rp@-@p@ kRPp`]( U:,PU 0 ,0$k( |Wp@ 0000PC-\Mp`wn@PZ`P00vN 0S 0 CRS G0G G0G $pP 0S 勡CZ\( 02W 0S^ 00CSZT5$ $p07pp 0 0&pS  W   !R00.0700ok%0' 2p103 *0"60#X02pSIڤ$ W 00Q    |尠WBhd$P ({ P (vP (qX 0GHi0\030 0 8 0/o20"S R 01 0"000 #0X !! R0R!0GH9L3\0@0 00CS R  B. 0" 0C&0$C4'0( qP$ jP0S$jP 徠$Pp 00S \ᱠs(( ( $u( $EV0,0001 0(0$00@0 05P00S  0 CRS0 <@P6 78Qd}A^DQAD W0\0  P  0CW00S 0.0-00 PT+\Ѝ$?/?L?*?r??)t-$???? ?!?9?2$@?\?y?p@-@lP0 $\00$p@t`V 0p@-P`l@k_PPP 3P$P  0+0$0 :,⹜(WpQ@-@  Q ?? 0S$0]S(0S/GS(0S 0SS@-  /O-M`P`l@`0P=؟ ( ,l0@0D048< p 0  ȟ 0 - Pr 5R0CS S<00 0 00 S 0s!$ 0P ЍOF P R0 R 埞 4R0S S0CS  t4  VCS P$S p  44  F0t0 0S$0]S(0S??bmL?C$dH$tF$I$F$,I$J$5:$b?k?@-@ MP  0T T LgЍ H`R @ 0R0C 0`P $04$pH 0S Hg0 3/?RRG-`@P P9(p.0@00X\40X0\0,aj 0G/000/000/A-`@ MP(p0P PPHP<0S0<00S,P: Ѝ80S VPP 0001380<0S P0<0080U吂0H 0P1 00@ L0 PGq: P00PP#T @ P PP`0( 0 1000000P0TP T0SPPP R0P0LP sLJ0L0HJ0H0<0PaT.TPP@bB$ `p@-P@(`k000P0S @0S D0P(Z0,D0哚p@A-`@(PL0D R PB0,D0{<0S0C,p<0 8X0< 3R800B<08g000m㶭!00 0Acu]T0S PTTPP 0P0LP L0L0H忁H@bC-p @R`00@ Ѝ㢁P0 0jf  0@ᓁ@-00  ЍG-@ P0SP- (`P,0'4pWDy P Pl03400@0 000 PTP@4p͙ЍP@bO-@PP0MS: (pz0-4`V,Dx)0400 @0<0X0@0\0008008#80T 0T#PP UЍ8ʚ4`@X`\`,⇙PPPTC$?0/@-vh@Ep@-@PohP  $     p@K$@-0PQ@M 0Q 680Q 0Q 000P  eЍ vP`VP <0 0 p,07/X9pUDiU@nU\c##$0 0!0 00 /@b@d`dddʀ0$R/ @-0^ "G @P Q H0Q -1CQ0 /@-:10/ W@ WQ@-@ :04Sh=  LPh=0h=h=9h=0h=,Y$G- M`p P@ e 01 0SđS: 018#(!#( 0 R R0S  0: 0@ T Ѝ@-g0 $2@-@gT0 04-A-@`}gPzz1DT" l=S BgtǗ h0 $P VGm@B8~B0  h= ? d@-:! Q \ \ !R0100  ЍO-MpgPp0@000000 0 0h]040 P刚FP  d]`سծP|T]PFm, 0 #P8`<G0#`4 0 X#P+ 0 8#P" h=0h=h=0h= 0!  Ph= 0h=0h=;"Ql0l=02$@Z00 0A2`1081 aaAarA|.@2 b04"0 ("!xA0"U0$14Ѝ8 h0"Q+ P(Ssl0 h=0h=p:txl0Q`4P\p! Q +\A˙ LЍO膙S IU 0C#pTtXx\0T,P;@Q  @t0 S 0t0x0 @d=S @p00t0 0x0`=t0d=l=Sd < T\z?|?? d?O$bMbU$D,???g?H?/?@-@ 0 PЍ: Q/@-<0DT 0 !0  !@b0@- ! 0 !7@-P@ U H :(000U J(00C0 Ѝ0 dG-P@0pS` 0S00h=0h=,2S h=0h=,2S0P #.P0C ,2 20va 00PX0PG d?0/C-h=@`M 8! P(!14  "R. S>4h-<0.p XS ,h-PP Q 4{bU h=`   0pb,Rߍ ,h-: p $`  vUߍC=p?G-@P` MpTT-0GR8`-!d=Q?:h= F h=P<h= < h= h=0S/:!P b0 0@a0 G?]P T< 030p 0S 030G???bQZ$p@-@Z1Qp+ 0 / d0 @-  @/00Q/@-0 @/@-id 0 @-@bdT00-A-P@`pP Vx`@P V@P @UA-Pp8d,`@00</pP W0S  PP hS10PSSU SA@-MpPc`@,Pۖv N` uT00000 0}`P 000010040 0800S 3/00S 10S$0 '0CS 0c4`8`(0S S0 ЍS PS0000010001 0C0S B1 0(0R4 `&\HV 0S 3/P8a `p0S 0R S 0Q+Qe帖0000PЍ@觖 0 SR 00SRR`Q:40078%0 0 %0  `P 0FSc@ 刓 Ѝ@k0S80 080 0 P  [Ѝ@00 0P D00S 0P  x0 p W00`Su 0CS|000 0P  0P  0P  0P   0P   0P  P000 0P~  Pv00Sw 0CS|00Sp 0CSH2n1 (0RjRjlmP`i M000 0PC  0P;|  0P3  x0P+  p0P#   h0P   `0P  XP 000 O0P p l@=|:70R- 0 POPh?j?(?H???????-?M?o?\???P???@-@P p 0S$00CS (0SSPS@-M$@\ ( Ƞ,Ƞ 0EPЍ7@-0PS @ P P2 " 0  P   Ѝ0@ Ѝ0!@-`@V Pp1WT0P 00$0%`b0 P   Ѝ@ Ѝ@-@\ (8#800 PЍO-P4`0U@DHp@B 0  ЍO/@N  0IJ <00D`@0000I?o2K3H0^00|0帐弰`PȀpP 0 0<P  ЍOa ЍbUSBCR@-@  0S   Ѝ@P t0BS00U  Ѝ@=000S 000 vP ЍS  0^00 00S 0 @U U0Q 0 Ѝ@,0S  ^U `p0@cS`6 0$0 0CS000000[00U R0 04  \[04]8^<SU0[025S0^0 B0A@ 840_ C <#$` #(#p@-0@0P$]10SZU - U p00 00P00p000p@- MPd0`@00@00 00`PE,00$ 0@`SL Ѝpz>@0LP Ѝ ,0RP 0S ,@!@-P`@)0P  0 00,     `0Ѝp@A-p@` P %(@ p@P ({ pW< &("(A-`@pPP 0  00@@ 0 % (`@P (E`V<Ѝ@&s@-P@`* |D0  R= 080#80C?o2S  cD03  Y R@0 D0  R= 080#80S0S [m@P @0  0L0 0nЍp@V p@-@ PKPp PUZtz@0~$  & ~@0  { p@ɟ@'G-`RMpZ@ڍuQ x W00H000(00 ,0L0d0TH ` @ $ P0P T H Ѝ  Pm0 00>bE0@080 S 00S 10S 20S$ (0P   0 SR0 R2R1M`P l #h#YBZLNJ!8X@9`0 @g@B@y@A-pPj`@P00P `4VGP  'H #   @-7 @  @G-@(`0P00 0SH L2H0L2  ЍGBT pTL2H@0L2z  P @TЍ u]P0 #  Q0"Z-.R0W30B00@p P/O-peMPY@卌(` + 0(00,00 0$02P @001 00 0P0@0@``  $0 PX,,0P P 0 S,010,0`00SP ` E Y00S 1`P eߍO背c0S 00S! 10S 10STP@ 0 Q0S0  S`S1  X 0$Pᓌ*080N 9QVX=0 |Yeߍ P 8P@@@6@K@@^@@@@@@-@@0`A( @0CR@Pp0@@0 (} (0V Ѝ@-1@00  4P  0S$@oЍ@@-Pp@@0` T@D T hx0 0 0 h Ѝ@'x000 F Ѝ @-8@0,00Q #^  P/0@-M@PuP Ѝ000  00  P0-Pp@-0P( 0CR@00 (0 0(0 C40pp@-000 P  Ѝ4 @@-@8 P@0  0 P Wg Ѝ@@ @p@-P`hwo@P 0 0 0 i 0$ k0/ 0$  0$ m0/ 0$  0$ 0/ 0$ hp@w@-p@PT` 0$ R00@DR0S hVw0 0 0 h Ѝ@_w00 Ѝ@-0   Ѝ@@@-P`WP@傊p x  hP  H Ѝ@NJ0(00,00 0$0<q P`@p00 SPP 0 Ѝ@變p0S8  =P (W孇0 | Ѝ@0P \  0 SR0 R2R1PR @T @X @ @ @ @s@-`@PD P (0  0` P Ѝp@@-@ `@p@-Pg`@ "P00P `FaVP  ` $ # " pO-P@GpP0 HL2H0L200Y HO SHbVL2H0L2p:!H00H0 JZP+!H0[0H0 00 `VBP/s@-P`V@\P W00X000880o0\0Ѝp@ks@-(0P@ ?@@R@3: 0`0000( 03V  DL?Ѝp@-0#00 P  Ѝ( @@-00Q@00  0 Ѝ@-@0  0  Ѝ@-@P?@0`0 sS0 0 05 @ ЍpG-` MP V@冉 b` |቉h0(00`,00 0 IP `U@ -001 00 5P LU@     GP 8UH彅   ?P0P q  0 SR0 R2R1`~_00H000 `P K8RW0 0X00m0\ D ЍG @ @ @@@Y@@~@t@|@@@@O-`Mp@5P005PP HL2H0L2%  % ЍO505HXWP    ((R  tXP\  RZ   PXL2H0L25 0500\008 #8d%@-@M`pT DP00000R !X0<BP h)t0 0 0 hЍ@2t000RЍP/@-000 P  Ѝl@p@-P0( R@06(;Pp0< `N=<pp\@-@hs0 0 0 h@ss@-@P`MTЍp@ D0 4  000ЍpC-(p@`CPP W = ЍW@000000  @0PP0P0W0S@  <@- @0@PЍ@-0@ 0 0@PЍp@-PQ`00R@ R 0@BT@ l0R S\ 0P00p Q`@7@BF@-0 0 0uЍ@-  0kЍ@-0 0 0aЍp@-@PpXL _Pp$z <PUp@7.'G-pb MdSP@F  000(00 ,0<p P@ $ 00P H Ѝ PP m 0 0000PF0@0`S2P0S 00S 10S 20SU0P    R 0S0 ĵ1 ĥPR 0S2 ĵc0.080 P 0K@d@J@v@A-Pn@pHP00P `5VTL ,   &/.p@-PQ@T T |0@DT@ T0T jRD 0BPpQe@7@BFG-p0@00PKPH5rPL2 0HL2tP ЍGbV0L2V Ha XP  UP L2HP0L2J? 1  Y!  00 `Ѝ&*P/@-0$00 uP  Ѝ@G-@00`P@(p 0h 0&hPS@9,Oo0XB%XA  BWpS  `P&d%T`P 0 ( T 0    @-( PO:L0Lb@-P@`pP  0@0@DF  0p`@ Ѝs@-P`@P0@ D0FI T  "@@ @ AOCO R= 080#8S S S 0D P 4Ѝp@& @}LЍp @A-p`@4X@@P0 P@0 @00`0  @VЍ! C-p@MP`V4Y@@0 @j0 0 0c0 h@\Y T͂@Ѝ`Foo0b0@  R`V00  @@- 40$a S00@60 PS!P `0P% 40 PPS 00 s 0P0 pSc  0P0 @S Ѝ@Qb"@-P@x@-@hDp0 0 0 h@NpO-M@ pP` @` ( RЍO 0@ BD0P40#0 @R03`1:0D00`B @0?VPЍj& R000Ƞ40# 0^ @@R::P ,ˠ 0 0 Q0  Q0`B @D@0C-`MPD0@00L0P   T_PP HЁЍ0H00PL2 0L2H 000 0 AbVp0L2pV H U000000 * SP L2H0L20000Q - 2W0A00`Pp @O-`K,MpOP⩂D G &000 (00` P,0 $ P - H,Ѝ0 0$0D0 @0 tPm~@0p< 0 0S;9@00C2@0S<K000 P^L0?SSK0?SP4|@0@p pT0 p0 <00P010 p봡9Z3 9 p X000P    0B?o 2 00S0@^00S 10S1R00S2R5p4 00pB0 S-  10p20 S  0p"0 S@  v10p d``0 p L0 *)@ aZpl0 0 )@ Q 0 p0 p)@Cp0 p 9H0 p 00 \p  '0p ,8000 PI ŁER00܅ p0 pS꤅ 0p0 S p \<00 Sy 0p~0 S@i <0pZRp Ĕ 0p嶡e0 SP 0 x 0pT 0 00S>  40pC0 S@.   0p30 S XA40 |0 4w40 14 0l0 4g&B 0 4p( `40pS+0   T0 p< KH0 p B0 p(0p  300 0 \  (H0pp  $02 p0Sq0  0p1 0Sl0 Pp1:040 $P @吀011pW0H#40H40 0p@0 0 040J0@0 ;0 2@0 10  @0 <00wH  hIP \Rk @ !@  @!@bVUUU"`!@`!@ U0!@@-Pp@ P㰑@`800`Y0 H0 `I0 ` J0 E`@0 !nt40 0 0 < <  K"40 0 0 < < @0 00 !;@00 ?  ?f?P P Ѝ0 4J T@0*@ 1L  >;5@0:@005@0:a.*aUP/@-000 P  Ѝ,"@0@-MP@hPX0 00 A1#P  P 0 }Ѝ0J"@G-P` C@P 0   pW@-@hk0 0 0 h@kG-P`@ pPxx T0l!}ЍG0 $0( ?( (!00@007c *0J8#8 S 0C 0S90Q"' Q/o"3 QRA000@ P0@  0*   |@0 0S8#8@TPЍRB0 0?j"@@-@P @&A-Pp0(`0CV ,@  @00Veڰ!0&}Ѝ1V04@00T@3 S0!H00 040$#$S  ,!S S A/o,0"<,& R!0%0P 00 0($(̠ ((   $($L @0 0 0R5 9 P  0 0@ņņ3@ @"@p@-MP@`#PP0 00 `A1P P 0B|Ѝp@"@C-p@``PIPE$     0 PP    0PH  a|P Ѝ$[X ( #@@-@@  `p0PP 0S SL0  Ѝ@ ЍO-@p@pP *p&iI1 @=P` B|<`@0  QV Ѝ!@I; 0@1`P BDX:#@@-@@@ @Ѝ0 P@oO-0` 0?   `P `3Y 0 p ` pW 0 0S  S  t+p) i" b ^ 0?   `P 0S  P $GF`&8 $& & 08`b  0\ A0  >0 20(0 PJ80G9 0: 0; 0< 0= 0< 80?9 0: 0; 0< 0= 04 ]#@_#@d#@#@#@ $@+$@F$@M#@U#@Y$@C-@4`Y @P0 @pP VBAy @ Ѝx0#-5  0 @P 0 <@RBAoy Ik("(u$@A-4X@ p0 Pz`P [BAQyЍ I\0#-5  0 `]P  WBA4y<$@p@-@AP*A jA#@< ?( A]AA p@U?p@-@j@0P``` 1 ++U **p@ <@-00Q 6 0Q ui p@-@GPOPp@00SD0  R= 080#8S0!23 $3Pp@0# 0 0SD0  R= 080#80C?o2S+ *+D0V ` [P R@  . 0 0S0  S(  p@CH@p@-@20 00 P4 T8 G, FQ.pO-@PUM`pPPhB/H/@ /@0㰀`B_HVPPS \L20L2\H|XH`@0  j fp  a W0!$005P!aB!$  $ Lp` ,F0 B (>0!0$0PT `!]BAw ,Uߍ` 041H0 0b[V4 8!0H PHpW$@P/@-0$00 7P  Ѝ$@p@-Ph@ge1 01  hp@pes@-`P@0   Č \@D\0 Ѝp@ L(00"(tЍpp@-0@( ARP0i( ;R< b.< B4 0ppp@-P@Pp@0pD0  R= 080#8Spp@tA-@`pPP 0  0PpP<@P  F.ЍG-` R MpGE@)xx x 000(00 ,0< ` @ $ 00P Hbx Ѝ P m  000$E00d0@0剿03200 S 00S 10S 20S7x v0P    R 0S0 ĵ1 ĥR 0S2 ĵ0208 0b P,@000,%@%@%@%@07@-@P0P Ѝ00 BPs@-`@P P  =  0` P }Ѝpp@-@PPp   _Pp >PUp@9'@-@P`pP 0P0 ЍU  @    0  00@-@pP``P =  0p` Ѝs@-`@B 0P ~A0 a qZ0  iP% N ]F U> M6 FU  PЍp( aPP @-@P`pT@  @ $0  p     ЍC-@PPs@0     ЍCP H]L2H0L2堽 0 009HGb pV L2H0L2儽 0  **= > SY  C 00 `V  FP L2H0L2[   Ѝ$0 0!0 00 /@b@d`ddd@-0 ,0@/@-0\ @/@-00l@ 4/Ѝ@-0 4@4/@-0d @/A-Pp@`T d08/< S   S Co    / 0 /ᰞb0~  ꖼ0~  ټؼ$@- ? 0:cp@-t0P#0\?/0@ 0 0$1(10  000 pp@:chp@- T?P@/T1S `sBP 0 p@0/p:chp@- T?P@/T1S `UBP 0 p@ 0/p:chp@- T?P@/T1S `7BP 0 p@40/p:cA-(0P#0?w/T1S@BP0/`ᵾPh`F $a0tp000-191910919!03/0 Q$1UP!`0 !6/$10C$1 10 1A#:c@-@@寻x e@-@ P`  A80U C0VH0rЍp&@0110   ą@-<0DT 0 !x0  !@b0@- !i 0 !G-H1@pT`(A- $0S)h0L3/# h03/h0P03/00S "YZ 0 00++R4S0000 1 PtPh0L\3/ PUl0  83/00 (P05/ЍG\c dbcIA-@p`h P0*0000p`h0$0Pl00L p0A>p$$$<&@p@-@P0d %S 050pp@-@`P0d &S 0U60pU 0h00l00p0p 1S/6!Q0061210/-!R $!$10(!21//0| 00Q  Q  BQ6!0 210/-!R $!$10(!21/6! 6!6!061 ltG-@ |?p(,+PP` T1S`Ѝk>P  0$` 06/p` 0  p`ܑ TE 1TV 1T0CT 1 C T 1?A3c0:c\t]t@{t d&@1@Xt@1(@jt@mt1(Mb?1S/,!t       000 l0/p@-@P,10,1@1  ``0d 0 `0d 0D!@0 0910BRS91091R91@09109!t3/P1Sp3/0T1pp@- ?`*P0@ @003/WT1S c=P 0@0Sp:cG-`0p#0?*T1S@A=P D(pZ  SPP⨏ZȀ F0P * 61p061 Y ( A6p61P061 $0( S S00@ 0990`1S@1Sp8@/80OτB 003A1+ \R? 6!@  6! i R6!@ =!@!051( `1RgS61>!0gD!0ETPR;1v011,1 ,10,1,1 ,10,1D!0R3003/08v/!Rs /1AoR6!=!@ 6!6!6!  S61>!061$0 0!1B8:cbO-0 pLM?)@P`LЍ0  1S ,<P P0 `pP 0iP0 n0`@0Sp̠L1S 3/P o_o`>0T1x`0d 0h0S В0 ` dQShP0 h00&091@1 91091D1S91P0 0CS91091t9! 03/0 3/3垵V? $ !ܵ0@=K,!D0t0 D0@00$ )$ $ ($ $06$00`1C|1810<1l1D11 1181 01,10,1 C`P0  03/`P3 0@00S-*eSw Rh00SZ=9 R = ?A3c2#d S 0"#!0 "#1R 3~?4X]M:c&@Mbd d+bb0Ap@-0 P"6 0?(T1Sp@ ;P ?1S YU,1 ,10 Vp ,10,1S,1 ,10,10:cp@-@P @δpx eO-T!R :P 1!PR 1! A(0q 01pBR0  R<" 0"  @V`0@S @DWb A!  BR!V:,!K ,! ,!9! 9!D!R:9! 9!90@`FSAV    R<1! 0 03/p,! ,! ,!0@`S @D` BR9!@t4/,! ,! ,! 0!R p 0q3a 4A4qA!@ 0 2/@!  /! /! .!R .! $   h0A  ЍO Ѝ谞bb$0S/&O-T1S @:P tPI03/0`S E ЍD1 SPf03/c8!03/03/`D1 S 0S @0V 3/1q0 R 03/ Q  $ P\ˠˠ \ Q  D!R0 ,!Le `V03/03/`j0Sf0S`Vl3/0A  3/8!0 3/;!03/ < @010;0a>03/ 0p3/ 03/03/P0,,0 3/03/0P 01 03/1Sa S`0 3/1@S` 03/h Q\(@ dc(@'&@ %'@(@(@b$% $\$t$&@(@`%(@'@'@'@ (@(@(@@(@#(@7(@'@'@p'@'@y'@'@'@(@%0@-@PM0  0 00 Ѝ0p@-HP0S p`@5P 0ST00p d@-50 0 t3/p@-5@tP 03/03/p@-4@]G-p@ `APCQR U010! A-P@` 0$ pE\:Ie X0 A\ ^G- P$`(p,00 N\:(e AY Y@0 G V @ AT/C-@P@@0$M,!c 0`~Ѝ$:cP p@-PH0 & @4! P t1  0p@~p$:c@-@xPt`$0M\p!P t1 0040 000p`00Ѝ$:cG-p0P 6 0`0a!x0@U  Z40 0 0Ѝ0 00:/p $:cvd@-@( $0$$"6 05!@~$:c@-@`Pp<<0$M(!!(0 005}Ѝ$:c@-@dP`p$0MH`!P t1 (0 00Ѝ$:c0@-P$0M 0 0 ѮЍ0%(%@-(0 0600®Ѝ%(%@-@3 1R0@-80( 4@"6 0 $p@˯$:cA-pP`@v3^ T 0pA/@-d3@݇s@-P`]3AT 0( `4/@P dЍpvd )@@-o/@-p@-:3@R_t103p ,@$,@ 0!< 04 0 (   !/@b@d`dddO-`@P0ȠY p3  L%^ +P U 0 0 @ T0 ЍN,@\ P/0 !8 00 (  , !/@b@d`dddp@-@P T⪚9S 9S 404 0@a 0 (|p@2%bgfff6%D=S/p@-@=P0C==0CS=>3;3p@hCA-=PS`p @PVD=S@ 0r '=@S蠆A-@p !P`P  0P Q- 0T  \d`Ѝ0A S  ,W` 0  ,@,@@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  I_0d 9S 0Q Q   Ѝ0  D*@G-0Q@pP0MQ 0ЍQ z 4=3/|7S (h70?0?h70?|7S 0 0@a 0 (7|7S H/ox""0 \%  R # z)0}^q q)B,@bgfff6%A@-`M MP@P#EP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q X3P2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp (0SSp E /  ("( E @=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 00(H0QN0 pN0N0%*:iFA-όp` 0P@sP 0 `kP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S* S S@@S@@n R 3 t0*[ X@Ѝp@ S S@ S@S@@@Ѝp,@O-@dM@=S D=Sd?`< $0=0=S >S3;3dЍ9S9 YU 0S990090C9R0 U05 p 0 P 4 0 03/039Sb.030@]  vaP303TW ?9SP^U PU 0S000000C0Ls R0 (P 0 S30 03/噒pP[2 0 古yt PPo\"(0傿)0Rd-! "G\ʔG 0 bD9Sㆍ P0S ` P 0!:> *00! 820a08/ᠾ(0"0D100 0>00KC19- S) 101/0< 20~(0 501=0$0P( `!0 \ /d=  P 0 H00YXZ Z!0  b 0  7 0 PD10=   =0C== S-,0>0>pe!-@p@-0=@S 3/`D]U'm PP `V|j\pT=X \S2 d 0``6/T=X \S4 h ``(06/ P NB-@C-CdMpL 3` <3`0 dЍP岢 RU`@ ,0D?o2P0S Pᙄ  )&V00P`@UHP֢DH3@<30G-MMpG@ l$PPnW`T$A0Vk  V7* V  V @-R au$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  %0 0 ۍЍ \ R\P@-R 6  -% P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!v0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0P Pl P9S9  09b sPP [@ VF x9i*F%?- S/@-@pP`,M t @$"0 G,ЍC-3@@DM >  H=S  CR})9 N L)"" FPP> ?PP@ ;[0 l U C$@PU0@0 `P3@ > Ud=;d=DЍSP-1R >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#p@$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> AP=0 .:^^XW3XR=3 ,=3/@]G  O-@P@MX,=3/`P0@= C&V>?oH-2R0S 9l&89d=0d=9S00`P  ?;< ?5989H-R%9" ;Sږo%#}> p ;V("( ;t0} 0h#0 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332 YT=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  - "@Q UH=S 0 `Ѝ  H=S ?  00C0S00[2ӕ Q1ڮ۾=-  P  P>X `D:XT-X \R0 ` 003/ i1Y%X<`T-X \R" D 003/T=X \S4 0h `9/= [0=<-@*@  -%3*@2D Ih@8 1d-@-@-@p@-P`X4P@@MT @:婮p0p@-@2@=Sp>PS 0CS>02tTp@>S 0CS>02p@0UH=S >S -@C-PpM<$P@ `@P NЍ1Y0CYD1Ye 1Y 9 - 09 |94P@4 =#@=S M\1Y7 1Y . ᮝ@P#@= S7 9S    @y S 4 4P@3@ @O0 @0 0UQ@P4P@3@ UH=S@2iii9iO-@=@SdM #P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0JP L0 V  T-X=`R" D 0p\7/=-0C==0=1 k& T-X R$ H 00\3/00` (0P㖯) 0X*7BV= 0.`3 ;3B& T-X R$ H 00\3/<0 0` 0 P▯= 0)BeV= 0.73 ;3 T-X=\R  0P5/` 0p`1,)S { S  BS T=X \S=4 8h `P#85/= l3  d=0S $P #0=00 S0"( 0=T=X S2 0d ` 2 9S8t$8W9Sp02"'P`P' W^0  .0< p0pTp(p320@@00` P! (Tǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК &P 3 "*8S00C8( L< 0cX(Rᘋ9_ 8P 0/)` V%0 c ~ pQp  y0H(མ=[8%)0EU= -JZ%88U=0= O0F&>=~)0 S$IBb᥶Pp UW .R *R &R T⼄ lRV\RXR )W n`` pQ 0 /Ⲣp0G'བྷ=[#)08BT~= -JZh#BT=0= 0H(>=nf S0 0 042<#_0CSy0d=0d=9S9Sm `43/acd=0d=_H=S >Sh"PS 0>P9SMd=09`S 4Q`PEUP#8뎄 U >^pP>P@ 0$ 0 0$ p@&00 02` S08#82́ 000H-Q0R RH RI xET  0> hBP``:g>  L0>YP 1>#F&V   01  ?& *22?2 ?"LP0C.>2>2?5?# R #.D2-@(.@|.@̘e.@b d.@.@.@.@.@/@/@*@/@O- @ $M&P( P $Ѝ] I\ PT=`X S2 d `P0\5/T=X \S4 h `Pp85/0D=0P0D=U_}0 4[P  $PXB  ፞w P0 00  P0HeGQ R)P0SH=10S"lP0H=0 000P0 0d1!,2# 0L=mP( 0(=v pbP0H=0dp0 0 1!ᤆ2# 0H-P=R0&SS+ 00x0  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=H=S% %S0B  PH=嬥嬕S L}d\:9"a0@ghOPd:9ȏ"a@h 0$OZ  )+4),|04p@04\r0404043099!= 0 _P R:0㠠 0I10S S2 ԊO베YH08 >PG0  SBQQ Q"< 1?0:H=S0 d=  0 !P0 d0מ0d= d-H-R' R RB d-Pt#Qb?d= d#Qژ0d=T3)Q8<9 9<9< (S:S:R/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0T 0 Pe 0SbڴyX > 2 t=2(x=6=⾀ᰀ)DP᥌44=4!8=141:1:141=1=1=1 =R@p1X 0>9/  k>pL1a  8b>p0T8 p@-@P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( f/,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002匑ቋ`ᴙpD: ^0@000z%Tx%%x%xy%x{%4%%3@@-@4S@/G-3PA@,p0 <300 U SHbVHD3<3> - 2X>00`V  P 3<300 UHG!O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S b4@<%%%%t}%4@4@<%%p%%p@-@P):pp@-@4P P]p@-DA-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0sF03 \P05/2 ,P5/2P,` 6/ `$C P@U! C P03\` &N6/0 8`xp0 `KVAxHB$P@ 4B0P,B#P4@*5@;5@v%v%`5@A5@J5@#W5@O-P \h ( ` ,@,4/ R@ Wd7W0 0 ,P5/0D(0@0O-p\h@R`C$x102c000 0Z PPP Ѝ00$10P t0S 3/0 \$8/ V ,0,3/" t0S 3/0 \$9/ V ,0,3/U d0@ K,PU Pbp5@\0O-0Q05ph`  @^ |03/}V0 ,:/p +40\8:/  hP l0 [ $0\p 7/0 ,P,5/t0S 3/0 \$:/ gV0 ,,:/t0S 3/0 $\;/ QV ,0,3/I YʠZZ Zp0 PP Zp0 P t0S 3/0\ $:/0\ :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/0P , :/P P t0S 3/0\ $:/0\ :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/0P , :/P Y ЍY;5 t0S 3/_0 2$\ 0  0 0 0 00 0h0 03/6@96@ 6@O-\0`pQh@P t0S 3/ 0\$;/ @Rp +40\8;/}5R0 ,8/p +4 0\88/ $RWx0S 3/ OV(0,0000/@-@0\}hA-`p%P%@w*X0VP`|`hp*<`*{*%%ж%0 RT   RH  | R< |  R0  X R$ X T R T "ꔭ%%ж%>%đ!@-@ 0Q !@\0@00A-` P@0S P 0q@P 2P"Pp@-P@"p@p@-0`@hP P 0 \00 ,@,4/p)P 0 0 0 0h0 03/P 00 0pp@-@PR*p@0,C$G-P 10!Up0 0$C! $C1`(,:*T 0 S0 (ЍG0 PЍ!PP  0 P  0$TPUPbMbm6@O-@MphP)l!`P ߍO)EP' \0W%p᬴4$0"Z:@<0 R80S@p<0( R(p)TPP40 080SOʇߍM!80S<0(Qt0S 3/0 \p$7/ P0 ,p,7/p<00St0S 3/0 \$9/ P0 ,,9/<0 R@ 8 R(0S@0 # &$p1 YL <0S( 0 G&P ])0"%X) < 4&P J)<00 Rp  *  @)`uY 0 *><&P L 0 >%)<00"))<00  t0S 3/_02 \$0:/ PX0\ :/0\ :/0 ,:/XP<000 ,:/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 03<3$Ѝ 4à@  P ^8pP pP#8 MMbb %A-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`f& 00 0%PP 0S  0  0` "Q08 "U P 0,4  p@6@\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/@-2 \#1@0/@-S2 ,@4/p@-PH@2 ,`6/”0P\0p@ /@-P`p@0@$0PL pl Ѝ7@@-P`p@@$0PL p‰ Ѝ7@p@-@P0 \`6/L 0 \`6/LU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&k 0!d!0    !0G@b@d`dddb7@-@ &^0202020 DR2|0%@4S0000 2S " +" Ѝ0@Yt%T%%%v%v%@-@ &@菇@-&Pp@-@P&2020p@-@4@SS&އ 0@eb@-@i&@/@-00  Ѝ7@@-@H8Đ<0\ @/@-=84< ,@4/@-00 v Ѝ7@G-p@d尐PV㬀ʀ 0! $ 0    !&⪇ 0!d!0    !0G@b@d`dddb7@-@&^ 10202x02p0p DR2h0d0000 32S " o" Ѝ0@蝏x%T%%%v%v%@-@ &@ӆ@-&7Pp@-@P&a2020p@-@&& 0@b@-@&@d/p@-@DP0`,0Sp$6//p@-@Q P`00T0 0 00DPSʁ@p0C0Q/ P /P  /C-.04@5 01D`00pP$M lP/0. $4"4H#8#8SA # SS $#0CS0S1 #S- CS" BS(  S @$@9$Ѝ S @q"S ʤ"S ST00 S x"S(T(@#h 4T90{@TT D" 8C8Sm  SF  BSb  S  S0ST@#  S  S+  S0S T @# T@#0 Sʤ&!T 1 #S@0ST@#d 0 00S*T*@#4 >@I2,pS$0 $09/I2PS$`@0,@6UiPh  T 0@0T00Ņ0{@0YP8tY9ƕqJ87@  8@z7@7@D7@V7@h7@7@7@7@yoB7@@-0 0`( "4`#/0s@-@Ph0p2(`l 6/h2 4l0Ѝp@/0P/0?0/ D00H(/0@-#20$A?0R  $$D 0 QH$ /0/0 0H00S00 A-0TP@0 `p 0 (T0Q 0000A @-#@R 2S00H0\ @A-@P` p 0  0 0 0 0 ؎P(8S_0 A0 ɎO-`$MHpS00H@ H㲎(8SZ@2W<7 0SPX 000 S0 ~Z0%ZZeZ P0PE000C0j 00((0R0 0(8S0Y   (8S00R2(`Z 0 V @0W   P @(8S W0000  ^Q0 20  0p0Pp0 p,p(`L0P$ЍG-D0p唨Z b@` 0X0T0X?  4XP 0  `(`( 0Q 000( 0Q 000(8Sf  0 `202P0̍ 0 Ǎ(8SO0( Q0000 㳍$Ѝ0s@-@_W} 4h @0 400(`p2l6/h@0d` l6/Ѝp@}A-@0MxWe` PČ T $"d% P ʿ/BPA  BP@0Ѝ %P3 @ %P *BP PQ% 2@ PU $8UQP 40 8 0Q l$\`$0ЍAU0$8U84PLQ\ 0h0p2(` l6/0hd` l6/0h0p2(` l6/h0d`0h0p2(` l6/h 4p_Uzep@ze}G-D0P唨Z w@p 0X0T0X?  X` [0  p(u`( 0Q 000( 0Q 000(8S  02`020QX0 ` 0 I(8S0( Q0000 50h0p2(`l 6/hlP0 d`6/$P|Ѝ0yO-D0MP.008S .04005 XpX00p 00X`@ 04T 07 00000 %(8Sw 0`0000 Hى(0P 000(ȕ \Ġ0 000 ‰\0 `0.\0 ᵉ("2Q0 0(8Sv40(8S-0(8S$"0 ,0(@C`p0 ⇉0((<RC0A@@-S>  pBFP`@0Sq@P,x0T*01Skx <(@ <80A0(P徒1 0p@-0DT 000?P  @-D00000 T ?P A-D0`p<0P@@BT0A#6T@1@@V:YPOV  00(P异1 0`0`Fw@80@xG-0T` 0 \p@` 0P ( Q0000 (8SvsP /<0P 0S0 0 0  0 ˇ R X0<( <8T08( 880s00aR1 AG-@ស ]wHhP<V P $P10CSp!p1xW000$0xL0@ r GwP 1 21Pb%D H(R/ $ pxO-M0P唨Z @ 80@ S 0S S@33P0@Ѝ`P@  YT`yP@&0X 00S :"; p&pP 0Xp 0 0  B/o"   $(8S00(8PS0(8S 0 0Y Y Y 2\@ 0@0$KP@Ov$82TP080s0S "-@W v<80$ذ", (88S000 4,48#8? \0 0R0  0$ S$ $0 ` S$ $0 X $0S`Pwt9@O-D0,MPQ `RT 0H00S00a\0s 0 Y((2R\0X@0X00 @0 0H00(:~#:0<0p 00`@pQq0X 0 0 000(00!\0J (8S0(8Sp0p(8S0(8S0 020(`#20&a?0R  1$F$00 \0 @ 0\0`00`00 00$0 0ׂ(8S_0( Q0000 Â,Ѝ 008$ 0cP ᘂ:#:K 0呂 0PW\$ fZ WQJ 0$00\1 00J (8S0(8Sp0p 0(8S0(8S0 0(`0020#20&a?0R  1$F $00W\0$ @ 0\00~p0 (Q ! Z0G-D0.TP@`P pP 000`pX 00 0 0 sP Oq<80a.0 PSP.PS  (X'000㘙 PP PPH"D+ `pIp&"0H pP*XV`` $*00 ,Ѝ 0 ,0p$ʀPb2,2 F[0 4P/ ( Q0000 SP ( Q0000 @P ( oQ0000 + PPPQ)nV Ӏ025( P 0U000E00140(8S 0 0 P?UV⯄0(8Sr2 Q,0ۀk4<P0eH$a X P81S0h0 (Pp2l5/h1dP l5/G0Pdh0 (p2l8/h dl08/y.Y\ Uh (p2l9/h1d l9/U )h (p2l8/h dP0l5/dxPhP (p2l8/h d0l8/dxhP (Pp2l5/h0dP l5/ :P Yo) VP   `h` (p2l9/h2dl2 0 0  9/h` (pp2l7/h4 dp0l7/h` (pp2l7/h4( dp0l7/h` (pp2l7/h dp2l7/z0hp` (plp29/h d0l9/$04yb'yN@ @h ` p2l (:/h 04 dl:/h` (`p2l6/!qhdP1@ l5/,8 04<:0PhP (`p2l6/h0H d`l:6/hP (`p2l6/h8P d`l6/whP (Pp2l5/h0H dPl5/0 P$8wHPU$#0 0d000hP(L(0(Pp2l5/h 4 dP1l5/0t29@%9@:@:@):@D:@d:@:@@̈:@s@-t2S P@hP (`p2l6/h d`P0l6/hP (Pp2l5/h0dP l5/Ѝp@A-P@hP (`p2l6/h2d`pl~ 06/hP (`p2l6/h4 d`0l6/hP (`p2l6/h4( d`0l6/P8S hP (Pp2l5/hP(0dPl0 5/LXUMPphpp2(`l 6/h@0 d`l6/`!whpp2(pl 7/hP0 dpl7/2w0P8L8Ѝs@-u@L8PS0L8P0h0p2(`l 6/h d`l06/2vЍpA-@P$ onXU>P M2S 0h0 (pp2l7/h2 pdPl 05/@6nЍ@P/ 0\R/@-@ 0^   \R@-@0U. V? % 05Ѝ@#:@A-PQ+ t@pT'P P h `0d `$\0 K@P 0t000 R$S Ѝ@$;@;;@N;@TAT;@ 0`( "4`#/p@-PϠ ,@ / p0@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0x;@@-  Ѝ@-  ЍO-M@p0 (P $   `0 S p  .( ߍ      0 (i @0p@-@MP `{  @ @@ @@ D }zw t.   ܍p@- , Ѝ@-@ ЍO-MHR@`L @. B?<00p (008 <040,0$08 @L 2!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@ ߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00 X ( S 0 N 0 p$008,0040< O @L I8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@ q  .   ܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lq @@!H!P!X !,0( $ OZ`@ h$(,.` @ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.`W @SߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPn\0 P0h0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@00V@0 00W`V 0  @0 4 i0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

H0 0<00@-P@M  H t@  `Ѝ0O-yM00 00P0x0S0pCU0D0y 0` $00(00$0 , 0 00`0@0 000x  0F| 40F0 000E4  P 2  pX0 X&P$0 E80P |2  pX 0dE XP(0 ,0$0` 0 0@0050 0800x  0<0| 0F00 $TP (dP P l1 > pX0 PXαP $EHE0 ,0#0E0(0`0$0@ 0 0000 0x  840<| 00 E P | JPpW@@#x0S0S @PdD0SSU0SS Pxyߍ|<@4>@6P P /@-P/>@A-@pP0SUA@0A` `FV`! 0PE@G-@P`0S 0X  P @0PEp pGWp! 0%H0ppGWp!P 3@`FVO-PDM %  !  !  ! "+P%PP0#0P%PP! PP0!0#$0P 00#$, 0+<0 0"00 0#0@0+(0 0"0#,00 "`@ 0,p@,`P` @`&! @@$$p +! p p' p' , ,,0, '00#0#0#0# P(`pP!!@!P P%`#, p'p@$@ `! @$0#0#4(#0% (8,%p# p'p,$ !$@8(& @$+  4!() ,, 0,  , " " $* * 4 P< . , 0 0#!.(P%P%+0# 00$ 00#0#08000#0#0 00 ,,0#,0# 00DЍt!t1G-P@  P@@P਀` ᩐPP`pP0 `0 pQ@! P A, @.p  q)1 0` p%RPPR$BpP@P@PB! ,"0 @ @  說UUUU3333-$M  $ЍO-RM  RO R p pG pP` 1"A0 0`TT0000h`ᄡ0V,`0 0`T0 ` S@F0@ S 0`` P   YߍpV \ ?@UUUUp@-8@8P`\p 1001UUUUO-R`M R. R P P& Pp"Aq  TT00 0F[`N`0   T  WЍP[Q 5?@O-EMP@PC 2 00`$00r(0 0,00 0000 0 0`pG0( 0 V000000 0 >0  >2  >2  >2   H  Eߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/K0C00 <,p 003/  0<3/00 \0l` ⵪000T }1S <- 0$ ⣪PF@5G@E@6I@F@!F@I@G-Mgpp0@P 3/   0@00,`( '6/ G`P  WH 0 TAkH 0<"<Ae` 0@0 08 ,8/ &P  0 M 0!H` (P 00( 900!t4` L  0@00H( 08/ P $ 0  0 ` 0@0 08 08/ P  0  0x l` (P pl00D4( P 00BAݩ`ލI@(b6HboJ@F@!F@hbJ@J@xb K@J@DK@O-Mßg?00P 0PML A80l 00S`4P^>00V 0(0,0 !" 000 03/0@0 4/ 03/ 0 3/@@00p0  l02"  CP aP y0 9g0 000  $0S !&.L<PP &> 0S !&> ]&>ş 0S " &> NP0p0 59/5 0S !%tP p5 0S !P5<< '$ş45 0S " 5 P0p0 49/4 0S !$P 4 0S !|4dd Lğ`4 0S " @40( P0p0 49/4 0S !#P 3 0S !3 ⻠tß3 0S " l3XP ⬠P0p0 83?9/?0 0S !? dP ?0 0S !?0 Ⅰ?0 0S " ?0 xP0tB0&.088/&.8P &>, Qb/&>\P&.t00!08/!P 1 C!1=P&.U00x!0x8/`!DP H1P0 $!01P&.600!08/ P 0  0P&.00? 0@4/? LP ?0X8 $ ?0 PߍO@PR@T@6T@O@_O@T@ 0A-aHM0 @1P4/@ #@P @0 c⺟@ 0`00 !p7/@ 1{Pp @0 q⤟@0pp0 `X0 6/ e`P 0, ?⏟`HЍT@tO@6HU@U@p@-`@pMP叧 ⒨ ⎨`a R ↨@TӨh ?pЍp07@-7P|@~ Q@00#47 b0 P Q0% Ѝ0r00#4p@-@P`\08M 00 00 P  8Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 8_0 p0 P@`pPtЍC-`p0MMPStX@pP `צ0 (`(0ا7 `ԧ `Ч`  N ∷7 (%`VIM0bP ⮦7 (Ⱨ G i7 (eh a`╦0 `0喧7 `⒧`p 0b"!4b4# 0(0 7  (p0h 0p0`8 4Mߍe7 (hḧ ( `F O-M0@, ? R$0(@0 0$0 0p t 07 0001  E0Pppn0ERt  7`EPS0婠@k0C?o200U 00 Q @7 t0 4 t# t0P  U0Q00pp0 Q@0  7 t0@ 4 t0@7 P@@R tRY@0Z_0S0}$ЍV@`a@a@a@p@-l@P  ! ,ap0@-,M@P4\0  g 7 000Z?,Ѝ0Dcb@ 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddG-pP`4ANT (, LaT@! PU,QP N  0 0  0< 002  ,QЍG@P 0,`000<00@ hk<@P P0 @PPpp@,\$Yp@ ꐪ&&&f@&f@f@@-e 0O-`pp@DM!s0 00<0,(`$  pP<0400 ,0H0z@  00!(` 0 $ @`pDЍf@bp@-P<@L0,`P@00̫4 V  p@bbg@Fg@ dP/P0/ d@-0 ,Ⱬ0S s<00,b@- 0,b@-0 @  00GP P `忹PP t Ѝp4 0PP PP$娹 d]g@&gg@:cbg@4/0|'RI032E 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-P(0@Tp0S @,bp@-@P 0T 00Q 1S  0<1i1Jp91S!!1! YfI(0003/p@SN,bg@8 dg@e 0P 0CP@@t #/d @#/ N @@80P 0CP(0P #@// ̇?0S@-c. QAAL0Q Q 0 0,1&'1 0Qh@h@ P P/  N /P PP0// p@-`%P80@Tp P @,bp@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P8P 0"pA-wn0@S!P !R d"00ЍQD@2厏1p0! R U T 0 S1S !0h  REVv|@WpS 堁Q 6Vv1Wp舄U} UyLxP qG PLM0 S'0 Vv|Wp'e ‷0! R U!VV0 S|Q0!V&R! 1?0|8|Q|@h@yh@g@h@h@C-@p/L2 0iP>05/cw^ 80o`000S P0? p /00p W`0S1001^n80 Sd001c00N8fG0S00d0Q00@Sg/1!p11S4H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 S01 1S  0310@0xj.1S(01 ЍCbeh@h@,b0b8 di@&0.R  "-" R   wP/P/////|0R 0\ R\ !L/P x7S0S/g@g@O-`@u_Pw>0S4 0!px0Sl@TP P W $ 00p4bi@i@j@ j@p@-`@%PP0p@ .00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;j@g@O-@0`pTM 0<^0 7U ⹵qw>0S9+ 3 a0 UUp7  0 MUp7  0 EUp7  0 JV   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p ?*P`Ѝo@@-0<S !  0 b Ѝ0o@<@-@ P0@00p@/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` F%ЍpG-R@P<M0 % ` 1 01(ppG0G  09_ P 80R  $Ѝh_$"P//O-@<`IMP 101p    ᅿ 000 S0 08>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  ,@0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍ||@|x@A-@` 1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  m?0 "IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #||@|x@p@-P H[T 8V($]$PЍ0@Ѝ/J}@}@}@}@G-Px8pS@` &@P` 0 ᬁ8/VG4)p@-Ph@c1 01  hp@l|7S /0 /00S /0-0@-MP@ =P HT 8($$Ѝ0@Ѝ/}@}@}@}@0-p@-M`P =D@` $J0,HЍp@Ѝ/`}@0@- R 1 0  Ѝ4)R  0R @/ R0 R1 R 2 RR3 4}@P/ 0 0 0/ep@-M@P M=(` y:H}Ѝp`}@p@-P0@P`  R ..Pp p@_-@-@M0 0q Ѝ@ Ѝ/~@G-P@p  Mާ`  a9W P0S1`fP  <0 0 0@@00@0 1PQ ЍG<~@0@-,0@SMPz.P, 18   <  ,PЍ0@@@~@O-lM 00PR0 = @ 0`  [0:0|[ Q1S  t?h 00 000V t0^,p 1S ?pM00000h' 00.[  㠅  P 1 4Z<|>  0 "000e $P$\ 1 >  0 &0C   0SH Q1S=Y 00 0 0S9x 0 $0P 0 P 1 $ 4<0P H<(= G CP 00[0Z0S  rP   V%PPl 0p000[|7S0E00S0S !R 0<<0ppW9p090& 05 !# #^  #P  R\ Qʐ! +0 00 p' l000101p0S5 SE 1S 0 0D; 0Sp10p180080|7S00S2S14+ * 00?B D10D10 q7/00` 00(0 0pP ]P 0`00 01 |78*`S,0X 1 8*0 Z000 03  0   P1 90R?C0C?0000`zX0@0. h71 H)00}?B '$00$0101Xx8S1 (00Q?B 000 00 0 2S1 ("00Q?B 0 a6/ 2" 0 S!-0002021 H:!= 0xS!-00C02021  H:!= 0bPQ1Sz 3/w1  H}:P1 8M HQ 0SH1L1 P10CP1S0 900S000000 0P0101? 0t 0S0t0`0S*\`P0`  Hm0S0S0S0S0SXGYI0 0Sp S SLXI RE00 4(04$0$04S]\ `Y (0 0C4!<0V0` 20 %S ! ( 04  C00010100`00$00 붡0 ,0$0 00SG X\0`50倀05X ! Z /P   )P 00#@ [,0S 101[000X(`Y(0 0(00嶡$0S `|V0`+g080 R ,003/P 1 # ?B B2101M00 0@00 GJX2L⇸ XP40  0@004th0 0 0040a6/4ZZ S  03  CH10H1EHqW1 H7 nⲿ*L10L11S 3/0SL1H100PHP1X7S  Hx7 I1S 3/ S  Hg70 709000000 0Spp0p 000O-S@Pp`MD #0So Sl 00 |7S7S  40040T@S PS- 1S ?-Cp BP000BSh S] S70CS40040500CS 1 ?/0=>C( 0C0L00L0"h7|7S2S 0J S1 4?D/Gr0=>C!0CL00L0S 40040Ѝ, T⪡0d0252 5$YX0Zp0S1 =.Gr0;C!0CD00D00J S*1 >(.Gr0=>C!0CL00L00SS  2St *St 0S ! -00 P00P0SPn xl00phQ1 =-Gr0=>C!0CL00L0zx7S 0450!0P0C2X00Z0Q1 <,Gr0=>C!0CeL00L0Wx7S0X0Q1 <0,Gr0=>C!0CML00L0?0`0H5Q0[0 1 0; \H00H0Q  04 8 <+S0S JP |~0S! 8+0Gr:!H00H0l0S1 \:*Gr0C>C!0CD00D0 R1 *Gr9!H00H0X VY1  D*Gr9!T00T0YQ xQ 1  )GrX9!X00X0A=P:1  )Gr9!d10d1xU !/ ) W101<00<0101|7hWSPm2Sj U   ۺPd dⅴ7![0R 1  @E5[ 71w. h7R7!66h7[071?%0#  1  @%5 ?w>0S)  45?|Q 2  yP5`0S ;!0:1h7 0 000T0"08U l7 ?l78l70 000T0"5   ZP! T P 0`P00 0HP  x8Xh'* 13/?S PT0- dس|wW 7S 40040  0 RY/1 5%0N>C 0CD00D0BP*1 @5P%0=>C 0CL00L0P 2P P00S ! $04 zH00H0lZ1 4$0C 0C-`00`0x8Up W - pPU 1  T3 0 00 00 1 p2"0U>C 0CW   IP   -P0P a6/1 HR  ,2<"0=>C, 0CL00L0㸑qἡ  @3 0 xph:S  0 3/P1  B 000|7S0 a86/h7 1A &00Y>B l00l0|7S0 a6/xYE1S h 00]>B J/@.}@@@@1@A@Y@l@@@@@C@X@p@@@@Ѓ@ @6}@P@@d@@ф@@@ @H}@@@8@@@[@~@@Ӂ@@@@ @xb@ʅ@@@C@`@@@PPɆ@}@ @ 0 C  ! 00 B000 0|Q4px0p 0S0HP! 00C0\!00 0- B00000S 0GSX 1 !O00]>B 0S ! !0 0M B|7 "S ! "00m Bo7S ! h"00} BHW W㐑D  2I/Cp BU0000x8U,  PP` 2 020000P ,.1#  T_2H3V P 0 0, a06/r2 f`x8U f #00=B ],P^ #(00=B o ⲷP  $>00=B h00h0H(4  T2` Z7S.W) W7,P #0,0Z 1$  T1 0 x8U<10<1h00h0 1 3/P  , 0 a6/1 |5I/Cp B000Q7S 13/Y 0S! %0J?B y000|7Sp x0p |7D&S ! h&00 X7WS 000x8U   PP 2 020a6/1&  Te1  6 0S }2 q7WSZ 1d'  TG1 0 x8 U<10<1h00h013/V 1 3/O1S 7w/C BOd00d0|7S?0 a 86/7 W00(000 0 I(S1 t8d(Gr0=>C!0C)L00L0x yP 1S 8(Gr0y>C!0Cp00p00S"0 $0000 0" 0A S*1 X9H)Gr0=>C!0CL00L000S0 S  S   0Q 0S"1 9)Gr0N>C! 0CD00D02S0 S P P$0 0$0 00S! p*0Gr:!H00H0Y1 :*Gr0 >C-B 0 a6/000  C !0pp$W,1 > pM.C B0L 4P 8P <S 0C?o020\3bqE0p01D/ d? ,B>C B借! 0?Q.C\ W1/ ?p/C00Z 1/ ?E.C*0A@0P ! ;F.C0 G  00 Q 0  1p :I.C B.D<08 q8 <0 HXB i pG p  1D*R D: >CK.B  C !0pp$W,1; 9 pM.C B0L 4P 8P <S 0C?o020\3bqE0p01`) h9 O.B>C BLL00cWF01 441)  Ty.0 00S8C0FD CA@8,P $ 0,0,01S  TS.0 Sh8C0,T 0( a6/ox00x0]00 /Ph7 1S  T&.0 S7C0Y0( a6/C|00|01000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 0P 0004P $04020|7S7S 400400LS1 464&Gr0=>C!0CL00L0꺁xXX 1  T-50W 0 0tx8U<10<1h00h0 ᐕ 0\Q<1 h5T%Gr0N>C! 0CD00D0LP*1 4$Gr0=>C!0CL00L02P  P P0Z   P0S! X$0GrX4!mH00H0_0ḡἑ  1  T/-30W  0 0x8 U<10<1|00|013/;X㺯ᴒN  pH 202-wh7Q / ? 67Qh7 !, h7R7!66h71  T,Ÿ h0WR 0 0    Ÿ   13/20276h7'0R40040 0CS1 1!0=>C0 0CL00L00q001 01P400401  T,0 ^|7S S 40040 1 3/x8U 0q00101 P400401  T[,0 +|7S S 40040o 1 3/hx8Ue pa@C@`@@@@݆@@ @Ӂ@xb@f@P@@@@@́@@@ @ -0@-@PM0 0j P, 0Ѝ0@Ѝ/H@A-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0 !GR # D1"022222220 " 8," ZN292S988-#87 0C2c70r0Q   ת0   04Q   ̪0PP0C03254h@A-P L0R8pL `@Q|'R"⭪(R# #0 83/G?G/ @0?@D00Q0000L00 ≪00 R  001H0O-`qF尡MT9 0 Yd (  00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0D!GR # <0S/S10C1ߍ(0 , 0" R 0Q   0   0" R 4Q    UP0pG@h@@-1CMS@CߍP` T@P p  `P 0,ᇕ0Q    R,!0R 1Ł|U@p@-2@SP 0aS 0 6/p@03A0AS@-@e ⷩ/C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍCT7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@RSPPa4VA  MPP` 8. 0000000Q<<0K 0 0000 P00'  0R 000U @ TPDVOxc nڨ  o xW>_o`/R χ166S1 000P U0!01S 1PTP8TЍCTЍC"1S "SPP  `P !ZR !ā B*TP2괁X SPP  `P 2 01 SP0} pl 0"P1UP0UQ  `(0PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/h@I@xB'5'@0|7S2S/004 S00R  0 u0000/A- MPpU%@jR`Pl0$`S9 BS` BS!? S* SU  S `Y$02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C Vῦ@`U0"0t"]0h7=$`B000i;0d 0k ࣦL 000X@@@*-O|d|7'G-p M@`'PQ`P0'XHS^ + BS*? S* S  S `@'?;CS00$'S?  Sj BSX0Sj p7 h70h7s&Sc 5, BS  BS&?;C0CS0&SDX @0SC00P0S Q>⪎0pⲐWC嶠C 㷑 @0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0 z  (ץ03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R< : ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  gx7 ?op2X  0RQ ÑVP P6P   Q A0 S -X@%v@EOz@O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO' ?Q0 00 0p0{PPM.x0@FS00>Q >Q F0Q0 0CS 4PP/|>Q7S|'R h7   ʏ0>Q $ QL >Q>|ЍOh>W0.|ЍO/=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8NPPH<0 SPo;XK=0S|7S=xhY >⿩PYp:3/0= 8PP <0S0#0$" 0#0 < XOV > PP 3S>ñ:3/V H4U< ' > ` `PPXqs`~!Rj8MPP8Q|7SxH 9eP 1P|Ѝ 9 5 @P DQCA!*R;8MPP80SS*0|7S-9 iR B0<PP" @P>0CS|7S < @P 80S& < |'R R0< P  < @P 81#3/ @8 f |7S P pP P !MPP x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> LPP 8⏍x7 ?o2x`QQ 6P  x@Q @A0 S |Q x0@`P|V` x01@0S S2 Q_P|Xe 8ⶡ03A0AS7SP U|7S cP 13/P]!R8zLPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4SPP 03/P Z0U 03/!R8KPP  8 m 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(Riii@i9ii:ii8i8i(7io?@:@) ,;'I@i@o@?@D@* *s@h@Xcy@@b`dddi@d! 8 KPPj8` V#=0  h9nx! 87S (#8 9_! 8LPHx 8  0BS !R r39S0S0 p Q ARQz0W8@ ΋  R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0SD@pX0 0CR00h'4PS4400Rh7sJPP 0 0Hޟ-HAP h7~N#2000@000S@@T`' 0PP0T0 TZKPP  > 0S p7  h7 ; h7h7 ; h7N50000> 0 ␟ ݥh7P:: x℟1($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S|j|ЍO^0 00 0p0[PP- |ЍOHLKP   03/P|ЍOTꔥ唅唵Yʀ 0! $%0    ! @aRa/#J6PPWa/ᙊ 0!4&0 !    !0G-@M,00 `p@(0#00a0$  @<0PeP0(0(0 0Q@<0$  a,@~eP<  @Ѝ胊@ފ@A- 8MP4/ ! A0     P,`p$0 0 a,(P @4 Se0P! @   '.$00 0 ap,(P@4 ?e0P P#!X0X@XP R T:8Ѝ4 n03/t dPj'@PbxepBpB<@C-MP 0`p` @P0 0 00 l00P 0@ 0 `?o2P@@T-0PЍC-p@P`M(` #X0  k0 000000X00`ЍO-QM0|MЍO?dQGR0 0P0p 0p;/o0"/6$R ʀ  !Ā .! 0 @!( , $@TR$@lU 1l #T   $`Q)  S  @*Q PP R$@M @(@@ P R$@iN@xP R$@@,@ ASXx( T(Q@, c@$ ,@Tu \ P,@$ ( x(Ri. Q - Q UWX H0/0$6 3DK <Gt20!R0 o` BB!$ PN 0O 07!Gq "|'- "bt x  !D!(/( # 4)%)M/ )6! 0`2$,(p0/0H0E  0<0@ cP| <400 00!@0 $ 0,(p<0bPe <0 00@!0 $ 0,(p<0bPP < 00@!0 $ 0,(p<0bP<> 0 00@!(0 $ 0,(p<0bP'w> 00@!30 $ 0,(p<0bP 0N@?P!$ ,(p @P<0@ bP  A\Ѝx@i'~@Pbi'Nj@ce@-@᭤P៤p@-@`PUp0S00`00C0  `>-@-0 0 Ѝ Ѝ/ߋ@p@-PP UltU`:@P ;0000 (b s<@P@p@@.C-1P@`p x8圀QHC 0x8 S QVed0 .I Ѝ BV0 lgI@@-1P@` x8pQ0Gp 0hx8S 0 fI Ѝ@ 0 hH Ѝ@-@@-1@  0@ iH;@O-1020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍAG@h@p@ ) @0) 8408008,08089!= 01/({'z't'Py'Xy'2 029 0/202/@-80000#Q0Sl78l7 .0 0 ( ( #- x Ѝ1@-@ h70  (0(0Rh7=h7l78l7h@\@c@p@-@P83/p@d@-P` PQ}Vyxw- w> G" !@ Br 00# B1  Ws @0@ GG?0@ Q  Ѝ7SD10A@ ꒐@@@@A-`P8p3/@P\00\0  s@-P8 `3/@P\00\0. 1 0  "x 00x822x80!H0003/090020T100PЍp@p@A-P`8p3/@P\00\0  x8 0 0x822x822xx80!x8 99p@-@P`=Z@pp@-P@P xG G⹕1S 3/pA-P@p`000 ⡕ ❕ ♕0?0?x80101 M? 061071 N? (Q 4 $Q 0 0 ,1SA/@-P ` pk@P 00 0t ЍA-|7PSS` h7M @ iN@p0 R0S P@xH A-|7`SSp@ h7] P i^P0S TAT20 R0S P@xH0S i V1Sp1 0H0  0#PԝAЍ̝@A-pymPM|7 `S 0 xH⹝T |7SS @P ⪝O@1   0!R000T@C-P@@@`pAT ݐ  P01SzP1 t40 $0&< Ѝ@ꔑ@G-`X  pR 0S R@⻚OoB@PU@ ⨚P 0R01 S  R 0S R┚P0 P0T@`C-p`@P }P@T Ѝ0S lP1 0t B0    AT  QP0S HP @͑@ӑ@A-P@U, pZ&P ЍA0S0S i V1S1 P0 !f 0!tP ЍAЍ@@-@xP 0x8i <P 40<8HP.0H8p@-|7@SP yn089,8AxxXP 0 022220000990{w>018|'R 13/p$@A-1@`  y^|7S118889,8  PPp >(# 7x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGQ ؛AR$@V@@-@xQ `P 1P P 1  r<10<1ЍpⰛ+1 h'0HH <<8 8 0 >Qh7U i^` PIh70h7Ѝp@4b\@c@R@O-M80i~ 0<0p`P  0@P 83/@P\00\0 x8 0 0x822x822(7x8 991* h7' 0000p 01X'r /@1 @q? 9X 000 .0SR )00S PZ R 00 | 07 0 0 0 000?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4n$Q0 0h0 XЍO20 [ 0Ѝt@xb@ԓ@C-`@y PP& ⾙08pS% 4(Y" U a !\ V T  `P1 |0@0C 0%- ЍU` ړ@@A-2@P !m00C02021 V0  `2Pq 02HQWP,RP ,PP~3P{3Px3PA0SH1L1`P10CP1j31S 3/D@G-Pp ```  0V x ')G   @T 0V `  9/@d@ T}'A-x2!@0SP` 2 L9|QI0S1 $2Su :0S 3/"<2< "!0!-200C0w>0SX? $~Q A1 0 lY0Sp7  |7S 1 4 &HE2-~Q A1 |0 10S1  &h76h7p7  1 t h767h7V @ A Ap@@@ޔ@@$@p@@O-P`|7MSS00 0 ppp 1 p 0% 0W  A@:ЍO   @T 00Ѝ0W p|7S2  0S 4"|0 0P4200x8S} 0 0C8C80Q Ro P1S: 00! 00 00HP 0SH1L100P10CP12H1S 0 R B0 Y 1  0 g1P 0Q113/0Sʐ1  0 X h 2S 0 ᬑ9/000`)Sʐ1\  X 0$ 9w G LS@\@@b,@H@@d@C-2@SP`M !Ⰰ8#8X 0 q7/ЍC`< p 92<2<! !000w>0SB p!,20S +2 hkCWAⲂ0 ؁P 1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 0 GP202~0001 0 7S 1  th76h7? 1 P eh776h7rpq@@^@d@i@@@@Ė@@$@]@A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3V@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 4 0BAP 00Qp@ ×@p@-PiN@ @P`5xh.VxHp 0^ 022220000990?p@@ޗ@@-!]0!@S001 Ł<>HP1a 000Z.  yGp  l 070$8@1}p`Uwh,884X dP10XQ 00% E 0 Ei~  FG  C  0' 08' jn P6D'@7<7f(Wox8 p  p'    H ( < ) x8 k ЍT@'$@p|' A-pʀjPiQ` 0ES  B2U U U ,U UPPH$H@xqWpx@'x@@@p*0000>0h'0S0000@/p@-P@ ]s000 0t u"    @v w 0  " @x 0S @@pT@A-0 0S@P p `*|7S00 0%  ! 003213030 0        8@t0/C-@`M<+PP000m Ѝp0 `ݐ0=0 H02 |7S0000(001011 `ݾ0T A   W00L7SPP7HWLW0P7a@@-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1H0S "N)RT@O-0LM S< P@ 8Ah7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8 >0 060000H  0C FR{$*@P000 Vڸ d巿4*0Y000040  B    004@]4@Th t*U 0      $D"$  (00 #RH L0S0P  -@P000> 40H   CW0C00000 (0`0(00 0|7S000 0g > c 8_0 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8 d 81081 8  > x 0 08   >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: L孾$`Y  *P`PPe( I)0 0姉 0 010 1 00 0 0 I0, 0), 00(0080$0`0000 S0 000((0C<)0 8000000C001!0110/1!LЍP`,Y0 S  04o,P 4u,@r,@[80[ 0 00徠SX (#묘@p@@@@@!@Y@j@C@O-0S h'0 p  0j000   J0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0uPP0 = S  岀崠 85 0,Y 1  00:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00y0  , R :01  0D0@001 PW|'R  {3Grq穸 0 厸1 0100L7SPP7HWX0P7080LW2z@$Ѝ S0 PP 0ᰀ00(0101u|8S>HHPP |7h'S000 (  0/  p' ; W00  . x (G lwh'0  4 R  O0Q  0 00 0C0(0%3iPP3 h'00  0  ;X00  岀0  " 101G%0h'0  4 R 0C0(0p 101#RH L0S0P  'PP@ @@@3Л@xb@V@A-`p#@P 00(0K0P 000p⒄  ⎄p@-`P#@P 0; 0(0 `  wpG-!=⼠p7p# 50`G@- PP1S  0 000Ѝ o0/ |'hR    0  + h  (0 pw0S 00000   0-0  00|'RE00 0 ! h7   h72h7 Y0Sl7 00@10 @( #RH LQP  &PP學    N  0 00H   CR0C00(0p 0(00㲀0✃  ☃ ┃북?@S@O-@fMP|7h'S000 0 0  ;0h7  9)+ S09h7  h72h7|7S{hgpe_ !PUP0!2!   # 90 9G9S!  p L 90 96PSH(Q PU Q0CS*e1 S`0 `!  0́ ``` 0 Ⱑ PH!h75h71 |  008 S0R 0C00 S 0S00Ѝ0`d@؜@@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@a1 0 -Ѝ@%. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`3V1Ѝ@/Ѝ@G@@-0@ /2S/p@-@Pa0 6/p@m 06 08880 8077090(10101/* * L'p''@-:@0S 3/ :S@0/p@-`@0SP0P    00T ,P1S 01pp\bx d@P0/x dP 0!/x d@-@ 0@踝@\b0 R  \b؝@p@-<@P0S,d@T ᭀP@p\b@ Qp@-0@P PS l`0FUp@P B^R <`0FUp$ܴ0ִ@@ @@C-1@pg 4!1000$Z4xX倇X0d4`FV`|7S S 0 8C:0S 3/ Ѝ0 a6/  K|7S S 0 a6/x3V0|'R/I032+ D3Q' h7  {1 : h7C 2 P@ qWX  l@@-0@M 60b1c2d3eI{J|K}L~S|7SV 9 h7 "w>0l!1@ABp7h4 D2! i  j9k9 0 g9!01"\0Y|7S!=0S* 9'w>0 02 9i9 00/\0n>|7S 93/1  |7T S499Ѝ@+x829009h72h7Ѝ茝@@\bp7/p@-@f_rp@%p7/G-`Pp㬁嬑Mw@WAL WO WO10@|'RN 5) 6) 7) 8)099!  089 079(!%069059000N9 O)PQ R   00 opWPx8S  19ЍGl 08 @\ X 00D 0590690790890Ѝ踠b,@@8@@X@@@-h7#1 @  |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@ܢ@O-pM`0`  P}0@0 00P 000 0_o`@K@RPPU!R:"R :"R:0ЍC-MP 0`p` @u}0 0 00  00P 0 0@@?o2P0S R0 Ѝ0O-DM ,00`pA(0a0$  @<0PCPJ00<0$   a ,(CP900<0$   a ,(CP)0'0000㨐$ 00a,( < CP0$0h0@00 00a,( @< CP   DЍi@t' b'@G-SP Lo `0@4p8à St# 00000SW 0` 01`P1 0Y`0 d`岯Ѝ@0@T@AJ0^0P0᳐0Y:0 b֤@@-  0 @!  Q3  4Jz000 P1#9P00T0]YX耖C@BC-P`尀p0@ A0 +z0S HP `=0` 00S Ѝ b d@O-P@0MP00p1W;*0S`0 S00qp0少  A$0 y[! P p0PQ`1P  0 XPP0p 0 0\Ѝ[ <lP 1 0CЍO b(b d`@ @O-@0pM00P@`#Py 0SP S P S0P0܁ R@*00Q:0S  +P 0 ≐00)  0X 0  D姮 A ቐ 0R 0 ]y0S0 P 0Pጮ0S" P PaP {@GtG_PJ!0Rdi X@Ѝ` `?X벰 0(Y b d@(b@@ӥ@@ۥ@@-@@@- 4,4 8 #8g Ѝ @p@-@0M SЍp@P` 00 0NЍp@-$M840, (  0 $ЍD>c@-`plMK@P@ !0 0  ( 0  P0000C0 p0!050 0C0000 0d@S2 001 00@0&H0L 0 H0L lЍxe dD>cO-0HADM  0@ 006PPpl0!   0 0 0,P(p$  `NA0  0 0 40P,P(p$  `;A 4 d @ 0   80P,P(p$ @`%A 0DЍ#@=cD>c'O-\F,MPp 哜0 0 0 垜0d#dh&hV *停0 0 0 匜,ЍO[0 0S 0S*zPP e0 0 0 ,ЍOn00C0F4P N0 0 0 00C0000`P' 0S S S/3 0$ 0 0$ >3"0ZT$S (0, 0 (0, *< P P  /,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S J2Tw @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S %w"@ [ @00噛004 0 004 夛30 R S 兛80< 0 80< d 0S /#P`0 0KD jPc 00f@0D 0 @0D q0S 0CSQ00N0 0S0K004 0 004 V3 70 R S 480< 0 80< ?  0SP`0 0  P 00@0D 0 @0D 0SSSD>c=c>c@0p@-00@4S 3P1 00'R0 0S0St帠P 000 01S0H00``<2Fv@ap p=c>c  BR/ $R/ #/0 0S/d@-P@1S `pv 0 @1j @Tr  Ѝ0S 0CS0@q 0S0 0S;00 : @=ce@-M 801S@J R  R 0=c@-@7 D0Q  0TS   á@* =c03!"/@b03" /@bL@o/!4! #4! B#4!0 P/60S/p@-@P }c!>000pp@-@`̮P@P JpP/Jp@-@PP Jp@-@P @@-@ 01p@-@P*p@QeO-$M`@P pP 0$ЍT@ @ ` X0@00S @T  k00S 000S00 0T 0060P` ` @Z 0 [0 T60P0T 60P ` 0K 00`0/G-pP@0`P T 4 06 S H0S 4 R30 Y}PP@P8 0x00PPH0TZv 05 0v6 06Vq`SH0Y 0S 0C @ Q*  " 咪(@,0/@- 0MP30ppp`h1@T @DTƭ 03  !,,0 , @ 0 Ѝ@ 0#000S2 0,0-ypᜭ 03  !,00,0 03  P,00,0,0 0 (!VЍ@ d(0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@s|`pP1hSl l0p sADs0P1p00`0101S0@@)Wq d@-60!0 0 0Ѝ@-@Td$,d,lH,l $.` G-@phRhb@M#0 p00 @@l0A10A 壬>   E0F? ۊI 0`p!+0 000,`(p$@ @@ @j<0 000!T1000 004,`(p$@ @ @U< 0!:0 0040@,`(p$@ @@ @B<0 400'㸐!=0  0080@,`(p$@@ @`*<0 400MP!0 80@,`(p$@ @ @P`<@Ѝ耦@ d(,bp@-P=0@0T@0S 0CS d ` R 0\0X 0S @T @DTCp@,b dp@-`P0@TB2S D0CS  Rd ` R H000S\0X 0S H@T D@DTp@,b0S 00P0#///0  S /0C\ B /@-ȫ @d0S0CSR$!@ Q \@D R 10S 0C dp@-P@ L`0!S <S21p@-@]@Q d@-@B H00 d@-@ \@7(0@s2p@-3P @j2S  D0CSp\ T T h T \ d\ ` T X TjpH0S D0C/,b80S/@-3`A0ASM;,p.PBT D@DTJЍ@%00S%=0 00fP0 R00!0 0003/PH@Ѝp@-M@`PBT D@DTЍp@00S^0S 3/0000!ǪPPH@@-@$1@Qzp@-@P 4yq001Pp0S 0Sp d@ p@- @P8/@P@p@P@ dA-pHQ`P000➛@PhЍ0 p 000!>00H `P SP` q1S0 d q1@0H` qA0, q(10(1( d1i d0@-@MPPEUP xЍ0@!>00 T ( P0@PS   (10C(1Ѝ0 d2i dC-0@SM 3/> 0p3   eP 00ЍC`P00S0CSUVUV VY N   P `RPVU0S 0C d dp@-@,0P `0,0EWt x0Rx0t 1x0 0S  0 00 I000qp@ d dO-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y P 30Sڸ0003Zʀ !  , ! _p !D3@3 <34300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0Sh24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0P 0# 2 |U0```10S 0CS-̨ 03 7 3pP,00,0. W-+P0S  P 0S0S  S i    R# !,  p3S0St00XYV 0S PO 03/K0c@b@d`ddd d dO-<PQtM p!< R$ 35Q +X@ 0W@DlW<<W26,<,,0 S00<Q 3C5CQX U   ;W +W !BW-`S R R   `E  @ TW" h;W 0 @\ 0p@ p0S P p!>d6"00 `0i0 0  00R 0`㶧BT D@DT ҧ1`tЍh:W 0 00 RVd  00 S^ H@ 8\h0 @3\ 0p| @p3 P pP p ᛧ0|0 X{ 0  tЍO00000 M%@Pk 6060X`\00` <``F` 9W 6C 0CW 80S8W1CWf 80 S`8W0ST 0j*| mt80AT @DT @@8@(WW00W0S( T1`@ 0S0Z @0W0S00}0SZ|00SXܤTꀠ0Z0SX,7,'WW| T$700 `0 0 `0pPeTz6@P7`o 0| 000?893 !>8eom000000MVP600 0 0峟 P3TEy& SM0050SE%SB00| ( `3  3  00 < 03 P `P )T Y 0}@,0   3 PY0 `Y 4T E0t01x0@t010S ؀SS P0؀ PV EP0P0Yd0P0 PY`0`V `000d0尳 !0S` 0S ` ` Y%00 0 -`3 !0S P 0ST  ?ZR000{<2 Dt `@Y> `h0S 0S000PS 0 OPsZ V`[ 1 /``` W003 P R0``0@Q 0S0|`W| 7n  0n 0Q R0`1 0`<ii ii io:@ iߦ@iii@%iߖo?i@'i d@oiV@r@!i#i"i d$c08 P R/ !  / d !  ds d d dO- MP@Dp  `0@0@@P21@T @DTO ڤT100# Ѝ!>00  0 0 `P H03H0BT D@DT$ ᴤT 0Y00C?o20S. 0S+ }P@ ᚤT 10@0L0S H@ 03@@P 0  z80S 3/@P  d0Q&@- 0@R0S b$",0S R 2\00S 0CSO #  QD0/ dp@-`PP 0@0L0`0D00@0 0<0(080,040D00040,000@p`((( ($ (((\ (@-@$@&0O-,M,00S@(`7@P 0 0 0T1"T00XS%X"@P  00 ")a! 1 00 $a$" 1040  0pP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80Q0$0$0Y C *,ЍY 0 PP  m0P00@pV @`Ppo V`[P 0p0(0 4p*4 0Ằ 0&p0x p 0c8##4 Ib4#00 1 00 & 0 p0 0`p@`A-`p(@P P PU@0 PT/C-0@SPP @A0S`Დ;pp0 p0 @4"40 0 U&W  0  0 @ 0CA&0 P00 R0("( ,00#,0 Ѝ 06 p 07@-0P 4!4 8A#81C & P,000000! R ݑ0  0 Ѝ0 0`( "4`#/03" /@b@-8@5i000P@P0S dA-@MlPlpP@@ @0 ˜D` P0@@ @P 㵘Ѝ@b d 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 0 0 (  , !/@b@d`dddA-P`@0p P 00   ?;$2020S A4b4(0p@-S/@@`ӡP0SP \0P 0Pd0 1@p0@ 0R/!&   SV 0R/!&   EVO-0PXQ p`H ($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 A-P@T0S((P` (`p0W Q(`pV (0@@-pDMW,8`P @P& 4  U<00004 000040   000 c PU g DЍ0S/8p@-P@Tp0S 8`0P H R@O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `XD%XpD%DH$H00!1P03@@1!P\\ Q \\\ P0S 0S0 d0S&A- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Ap&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QP@P 000S  S0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Yp7p d0bG-(p0@0SP,``M く ROd0" 0 0  0 P" P c  iP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0p<P 0 ⧐P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PSXM70S/30SU 0` R@( RK 8r R R S 0S0C00匀XC1#212(0 00p08wpP P1XЍsA0S 0CS # 00Y00P d0 K  1C က 60 0,P.<0+0SQ 0006l0S (000L00  00!0bPd /P /0 d@bA-p(`@pPL0S   !R, 00! hP f8p~0SP  Jc0S0 A0 de0S/@-40@0006 (01@ d@-0SЍwS !>00 000080Ѝ8@- <0b",4b4#  #$  #(  #< 噘Ѝ!@p@-@0M SЍp@P` 4"48 #800{Ѝp-@nQi< cbK7Q 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # BnkPpEp@-40 R@  000  / Ѝ@-40@ R  000 j  rЍX0 0&-$M840, (  0b$ЍdC-M 0P`` @dxp0 P 00 00 0 0@b'?o2P0S B~Q ЍܡbC-PMp@  0` d`0 P  00 000 0@3'?o2P0SP @TP@P T @P0%ЍT >cܡbO- @p`0SDM!  0 ,@P 0(p$  `+ 0儓!0 ,@0 040`(p$  `* 0 0 0'! 0 ,@0@ 0 84`0`(p$ *0 400!2 00 ,@0@ 0 80`(p$ *0 0 0!#0 ,@0@ 0 84p0`(p$ *0 0 0!/0 4,@ 0@ 0 80`(p$ *0 0 0!1 0;0 4,@0@ 0 80`(p$ ~*0 400!h10H00< ,@0  0 80`(p$ e*0400 0 0!N0 ,@0@ 0 80`(p$ N* 0400 0 0YP!  0 ,@8 0`(p$ P6* XP<!1ゆ0@0TE"DЍ@ܡbcdH\(>c >cp@-P ~~@lh 0S Q 0P @@@040p@Pp@ d~0>cܡbb0 T"dO-P|M@0010pC5#21 2 P 0S 2`|5 V#2!12 |Ѝ 00<` `050Z РJZ]Z  <f(PZ  R` 30 șZ DJZ@ Z| YX\ !>00 ( P0 $cN(@bp@-0P@,1 01  p@5dC-ᶐ`$M@P 400   0 @P Ѝ PP XX_ @(1 }phW ЍCq T)TX%XU d4"4` 8#8R* 1CS0RH0@0!PU:pWPX0\p JU:H @D P *0X0\T <0 @TtЍC#`0d 0S S :\墁@0D 0 @0D 孁`Pdp03/@b>cbpN(ة@ܡbd0 h\ 0SQ HP/P %/QS  1//ة@@@- 4oܡbdO-QpP00P BR0 0 0 ]02"0`0S 0XA0C?o20S  0R:!R\2S2 HB,0 0 0 7 ЍO  `P 4"4!8 #80CS@@0SV:V`!P U[èa PU@0 P(P2(X2 h嚓 0`P(Q1 01  0XP00 0 X0 XZ[ 8 #0 0 000 040000 0 0 000PP 6vdܡb@-$M840, (  0)Y$Ѝ>cC-MP@p 0` 3^`0 00  00P 0 0@ ?o2P@@TPQPPЍbG-M 0P` @p]`0 00  P 0 0 p@ ?o2P0S  0000 0P00Ѝb0O-`,Ml@s ,0 X0\ 0 X0\  ,ЍOP 0S(1,!0 (1,!0 ` ,Ѝ!>00 `$`020 00P20 0 0 0 0$#$ (0"(DRD PP P0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00_! 0 S0!0m X {X0\ 0 X0\ U, 1@ @ eH L0 [H L ` d d` gU` 0 `\U +7X (X0P H0@` 50 @0 0 ?@>c>cb@-!>@tPM `0@@p0 10P"ЍL000>cO-=|Mm+ b@P=|ЍOjPX ~ 1$!0 1$!~,=D@0S S ~ 1$!0 1$!~D~0 0 0 ~D0 <   DP~0 0 0 0SP@0@S ~0 0 0 @AT~ 0$ 0 0$ 0TPPD 0S~~0 0 0 ;`( "$`$"",R a(!"4a4##<S3 D1, @000@S SZ~0 0 0 3 :0S P 4"48#8T?~(0, 0 (0, eD(S2~0 0 0 X Q0(0 CD D0;00 000<0P(0DP 0D0~1!0 1!40SPDG 00001S0`0 RP0D0U 00400S D0 @p0,P0$800010C 0 0STz 90S@s 0dPPm  d0D0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z fF0d00e070S| $0S @E 0S [@@D 0h0/<d(0P0<0KZ.@0 TG0e}0 0 0 p}5 0R*+Z 4 m0P $0[$0J* m0$0@K@ hZZd0P00$0  Z $0Sh00000@@@T@hLP LZ @ ffF0d00e0,0Sx 0SJ Zz 0R: hZ먑d0PJ0   Z 0000,0= ḑhLP@i L ZYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ fF0d00e00 0S 80h0TR0|P o0S jH @HX000dL0 :Z S000 fE0d00e00 0S  h#Zd0P0 5  R@T 20S@0@A@@$0pW201S 0CS# 2SD0CK 00SG =Pi%|X0\ 0 X0\ K W T  X (  (  J #G0  R  Q W7 h W4 ` W1 X W. R+ H0S D0CS@p#@10S (0DS 0 0s{X0\ 0 X0\ {P004 S ᗐ000S D_ PD0S 000010{p0t 0 p0t {,0 @0<01# 0D3/e>c dxec@bLj(Hbؙ)4b|i(Db@bc@-@g @e A-pi@PP0S PP 0 0100a10 `0 0 0U0 0V *0HHQ0C00 9@-@0ST 00d 0 /d@-P(0dp`LM @ @ 0 P@  0 P@}PP"   0 (02,0(0P@ `"0  ````(0 ((rLЍp@-0P@x1 01  p@x>c03!"/@b03" /@bp@-@`/P#@P Jpd00S @-ہ P3<8 #8!R "00 /8bdP/0P7@- Ѝ0P @R Ry v 00P0S0A-`Q00pPg8'#TgT%%<  @P@VP\SX001S 0CS W @#RP 0 dA-@M`p  XP3 @P%0 R@ 00S,UP' ( DA!>00 0@@PPPP 00@ЍHP Pj@uUPᏌ1@P P00O၌A-@ PRp   tP 0SRE`pPc12P 00Y0\ Q 7U0 0!0;0@ 0!A-PS@` pPl0 A/4@Tw8!< 8!<_w0>chP/A-p`0PPQPEU `f @ T T@ @T@  T0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴSw0 0 0 w(,Ѝ0000 000000#![< 0C] 0((04"<00 00000@ 0,0@0,0VP *0C SURv0 0 0 v0 0 0 7P UPP(Rv0 0 0 vV7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0qP 0( 000@ xP0v0 0 0 ;v000:, ,0@ 0,0 00800`P@>cxeO-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00ux0| 0 x0| u0S( :?00!>,00000408000S 0 0S 0 0R 5$@Pn@Pi,PP,0 0b mu0 p0 0 u`(0S004 3SH0L RP0/P Q0 0C000000<@0 @8S(0P 0(00S000$#$ 8$#, kH0 00@V0g0 00Q0010k0R ``P[Du0 p0 0 Nu3P 0LP [p/u0 0 0 :u@0000 0^PTp @z0qS>q(0[     Y Zu0 0 0 u0 sR 0 W [U PR LP dZ`t0 p0 0 t@0`0X0` sR 0 PP3 P 0^PT@P H0S Ypt0 0 0 tAP@0D 0@040 D 0  PW0p/Tc@PY`t0 0 0 tp`0H4PS0@0D L`0@00 @000D 0ppW 0P0X    J0  #RV  3Q 0S# tPP XMt014!0 014!Xt1P80S t80,3/PP tq0 0t  AP* [ 0S% (CPP 00S(PP ,0 ,00,000i 0 , 0S 3 Vs0 0 0 t(PW ` 0RX L$PЍ 0S80S W `w80,3/`Pr `p0 0 00S Us0 0 0 hU6 3 lUs@1D!0 @1D!Y0  8Us@1D!0 @1D!s P @4"4D 8#8Q ( %0%<#*Ts@1D!0 @1D!s(P( 0<00 (0(DQ ,   40#0 @0ANV Wp 0 ("50 @000mPP(0ScAs1 !0 1 !Ls`J`0<  )0 !><0 0 ` @0DPHP+`P/ 0P+0S( 0#p# 30S  tP3#3 1`00t0⍄Ȓr0 0 0 sWpMpp3 20S ( ,0@0,0 (4"4 8,P#8S G04X 0R0  r0 0 0 H1P00,0 @  (,0@0,0 3  10S |10S (,00,00 ,0 0 0  /P%3  10S 00S ( ,00,0  (VPP((Q Utjr0 0 0 urtU A(0   0, Pp>cxe>cc@b@ H|dG- P8pȀ`H@Tp@W< 00C@S@p0S00C0S0 *o@0D 0 @0D 5o @1!  dd>cdO- Pp0`@DM!  0 @ 0,P(p$  y 0!0 0 040,P(p$  f0 400!'>o@0 0 80,P(p$ ` @PFNDЍdF@p@-@`M0P0@@ @0 ydP  <@@T 0200 R00C1 2"Ѝp@]@bdb@- QPBA@dA-@70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PAdb@bdO-Mp 4"4 $,$8("( H#8! CQD0G9n0 0 0 FCSC 00 Z V`S "(?AT0&n0 4化 0 4n z`PEn0 0 0 n8q Ѝ R:Fm0 0 0 mP R\ \ @ 嘕0`R m0 0 0 mh= Q 0 p" 0 崡10T01A0000W2SS}$ҽ@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !Rbm0 0 0 mm0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  !( !! B! RA10C100C0!m80< 0 80< ,m z 9!AQ ڴ! Q Ƞ,Ƞ B!} RQ  p y! B!  B WZe 0R ` ``d1S M0 0}1`p[ |0R  B   B 5 `  yX0- 嶀 q0(t"|p   0 ! 0 1C00S,00V(`8 l0 0 0 l-00  ny  G  0>cddd-//-/-/@-@DB-@-p00d0@ ` P d0 (00  0 W(0 0S(J Ѝ1M   @-~h@@-~r@p@-@P>0S 0S 0Pp0Pp*P p d!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ], 0  02# |0R0@l@ Ekh0l 0 h0p0l t 0Sp0 t ky d dP@x(>c-/ 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 0 0 (  , !/@b@d`dddp@-@P<`}0{.pe dp@-P`@1pp@-P`@3pp@-P@pp@-@`Px000p dA-P@p`0`0S ~S 0S/@0S@00@f1@e0A-S@@pr0`0S ~S 0S/@Pᇾ0P d0  0S 1@=00@0e 0O-PplADM!0 (p0 00,$  P`" 0!0 (p0 040,$  P` 0 400!d0(p`p00@ 0 080,$ p @` DЍOh@,e) dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 ~ @;( d@-p`( PSQMp $ @r30P PUd (0F0S* 10H   CR30C0000Tr 0(00(0 0 () $   R  h 00` 08 PЍ#RH L0S0P  @SASC 0 #RH L R    @P+ 0( R($!, $!$ 0S(0DS 00 0 0`P0 0i0 0 0 i7Pb(P PPxe>cG-@P`p1U0 S8@00S# ~S! 0S/@0S00 @S9@ 0  %`@pU0000(&1@e ds@-aPU0@ QPd B% / P gP d0R0;;d0ЍpU   Ѝp@3P P\IP d0R00\d    k  0`( "4`#/@- 4"4!04"41@- F Ѝ 0<P   /  $ 0l1\0h1)  1R ;.0CS 0X]P1T!0P1>/T!6040^;H]0 0 0 S]o=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ So]h1l!0 h1l!]P 0Q/ 0;`80  BR0!0CSlx\0 0 0 \\0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS ځ\p1t!0 p1t!\U0404 (0pCr\x!| x!!| !w\,0SC H!R 0L0CS86A 01R81 03/ W91X0C10 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS908P(50}!10CS0X110C11W0#4 500( 50C01 0S 1  NQ 40?0T 0; % 0S 0;841@. 0S 310V!0R1$ S *s[1!0 1![$0$ 10101\1S$05\150 0 !$10BS$!% < S <0 W0P00J c 0S0 BY; S1 00S220 0S010;0 0;E821211 lPFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S h0 h0 0w0 04 S0 #0P0000  hE$ A$00S!>6 l 9&00090 S   hKhdDbld@bbb,bHb0d@-0  0'S(P L@Z1!0 1!Z$0 Lhd 0`( "4`#/ 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`ddd@-@0:0@p@-P!T1PB1AP \lX1+8T@1D01@ xSx0 S 0; S0Ҳ;pҭ@@bO-0M@S 0 S/p`V 0S?(<(PFP p( !R `0d  Sp3p# RppWO^hPPC D0S0S0S ᙍ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4V500P4%4158L500P8%8150<01@00D00S_ P0Se P.P%p0'T00Sg 0 0C1!4!R4!480P00L00T000(00 :0Py  10S00(|! (  0B00  00!0CS41a-V`!;p00\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 P0;00UA(0SP kUP!~40PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSPTP8PP90%pwHp30 @P&QR P0S0S0S0s  `#61S`PpU1S\PE8(0P H0Q8S80P H0 8(@0D S8D!00C S:08P0 RP 8P0STP 41R1'!0!0S01Q441q0\=0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP18]0;V PF03 PE UVO0k80P Po0H00(000S4 yP08uP, Y( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 005`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#rЍ1 @a0 40K0 _0  W `4000:80U040<3 V00S0U0S- 0 0 0 2VpP 4 00S<07bV024"0 024"V p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PHi0QAQQ0 3SH L0SP0\ 00<  0CU4 00 0000 Z 0 S 0 0$00 ($ QbT h0 [Pe갢bdbҭ@xb4b|b@bdbb)@xe@8bldbbhd@V0 0 0 0 80VpP@ t4 00S$0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RHqh8 3 Q pQ   AQ U 0 BRU RZ ȡUX"\ X"\U ( @0% 00   V  `=3 & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1U004 0 004 'U`P 0R 0!S S{ 8P z0;t40g40` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S> l   '8kP0S 040Q: Q6 @ Q1J0 A\-Pap J1 F10 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRppbbp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/@- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R c1M  ?0MX @7p@-PUp@`z0P 4 )n0Pp`d  H Q1Q44!r010p@xbp@-PUp@`[0P 4 \W[0Pp`d  H Q1Q44![010p@xb@-0 l+Dc@d 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`ddd@-@0  :0p@-T0@00SDP@Kd [T$3Sp0p@qNxeteB@xb/)@- @8)A-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S <00\PP   (  0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S0SPT0(M 0$ 0 0$ @d 00!/@dA-p`塧PUA@T P P (_M0 0 0 (jM~0:0aPe@d@-@01S001@d0SfC-0`S,M(P@%Pt!0@ S 0\q\1 00 DLS<10S UA 0 Sp< ( 0R*T ,Ѝ h 0CT0!  00VP6@ 00dSP`00S H00@ C3SR p0/4@@*Pd[@!)4"d0S,4! x!/@-@0M  <01,0 00 0R0Ѝ")@Pd@-( (0 ;NЍ$")PdP Q Q@\ \2SQ Q @00P1Q0 Q(000S@080P1/xb dG-P0S`(A``"0R^ !QOd2S01q1O@T@!A0S(UXA``2SN ̐ HV0P<dBT@pp0;PA`V pt00KT *0D'0 T1GYh"R l2S0傴Pp2S<0h2S lBT@GPpBT<@xbbt@ cp@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS H     82tЍUxb#)@d@-0S6& ЍS6&^S@0b? S /A-@P(pT0`8@ TL3K@D0S@D0S~@DV x0|  0T@ D&X0 P1XVL 0   @T8A%815Anxb c0S0 S(00 b/ R /0SA-0`S0MUPSPQ 2q0@S0@?oR20S@Z P0@S PaQL L0 000 0冿P  0 00TP! Q U0`0@S010@Sʲ0TT#T1X%XS !0P90D0Ѝ  10CSa0Tw00000090P4 W R0( @Q+ Q 0p00 0娽P00S @0G3WS "!>20 2 0 $080  ɽW 0/ @Pd!)4"d;(p@-0P@(cJ1 01  (p@lJ@dA-8pP(`@QJ1!01@@(AZJ@d 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=xd@-@P w0;@0:P@< 04 \3\# `ꬮ@bH)O-m0@SM S( /`Pehd8"dbTb 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 0 0 (  , !/@b@d`dddG-0`SpP S@0@ H>@$00#.0#A0@.H>@$00#|w# 0 00 PU `0S l+P  +PPxd%@-0@ 0@00 00@@L$$00S@ Ѝ褮@8"dxd%O-4b@=PS)Q'Qm0S S8 > t00#.0#8.> p00#`# p\V 1  xQ6G1!0 1!G 9 W00;f1S 0 0A0 0g!P00@0@00=0=\G1!0 1!gG ЍO-0R:JG1 01TG 0SH 0 A SS0!\ 0 xd%Hbhd("dA-P`ATAAp@O-Q<CP0T 0 P0T CPT1X! 1C1S01S01S0# 01S ;SC0 0 0 C01;S"P!T11T10P1000110H1;S0;0103/-_eb$")Pdhd@bp@-@Q傝0  p@ĝ8P ;` S0 D1 B00R *PT11XC1S014cR :1Cx0| 0 x0| 00!L> 004p0,`(p008P$@ @V040> 00!$0 0,`(p008P$@@ @?"040= 00!+0 0,`(p008P$@@ @(X= 00!/04 0,`(p008P$@@ @= 00!?0 40,`(p008P$@@ @040< 00!P0 0,`(p008P$@ @ 040L< 00!Y0 0,`(p008P$@@ @ 0 !c04 0,`(p0H08P$@ @@ @0 400!h0 0,`(p0T08P$@ @@ @0(04; 00!p000T ,P$@@ @0 (00 !:H0z0$0T 0,P @ @q 040: 00Dʟ!0 0,`(p008P$@ @Y<: 00 ɟ!0 40,`(p008P$@ @A0409 00!0 0,`(p008P$@@ @*0409 00!0 0,`(p008P$@@ @040(9 00!0 0,`(p008P$@@ @0408 00ȟ!0 0,`(p008P$@ @040x8 00dȟ!0 0,`(p008P$@ @0408 00ȟ!0 0,`(p008P$@ @0 400!00 < 0,`(p008P$@ @@ @040d7 00!0 0,`(p008P$@@ @040 7 00!0 0,`(p008P$@@ @o0406 00!0 0,`(p008P$@@ @X040\6 00 !0 0,`(p008P$@ @@0 400 0 0,`(p008P$@@ @040H5 00!05 0I?0,`(p008P$@ @0404 00ğ!K? 0,`(p008P$@ @0404 00!M?0 0,`(p008P$@@ @04004 00!= 0 0,`(p008P$@@ @0403 00!S? 0 0,`(p008P$@@ @040x3 00!V? 0 0,`(p008P$@@ @0403 00!Y?0 0,`(p008P$@@ @g0402 00!>0 0,`(p008P$@@ @O0 400!_?0 0,`(p0P08P$@ @@ @60(02 00!=0D000P ,P$@@ @ 0(01 00!b? 000P ,P$@@ @ 080\1 00 !D0 40,`(p0H0 010 f1 SRBAb80 0 0 80;0`1if 0@ @P a @@P T0S7@S=0f1 chdbG-PU@ p@`R000S S @ ᫮@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; m@P p@-@T P0`SfpSf=pp@-@T P0`S=0S:=ppA-0`SP@p0S 9@@+0S ;2XR* 0R< 001000@0x7@A-`@pP000S S/@X=2D>4c  彪@IPePd0S p@-P_@5@p/0S) A-@P`pLT0S1@ 0 `1 &!#00a!0 `10#`11<1/A-@0S `pTP 0S b`@X=@0S p@-@`1P ,p/A-@`y00p0S 0S 1;10;0PPlPQ01 1PPQ7PH0 PP [0 1Sx01PdhbG-p0M0@`0S6@ЍZP V V @|  @  .`Y`r Yt3HX'@P 0R000@P0S@+S; @P@T 2sTA @P@T t2]TA @P@T (2JTA @P@T 17TA1HXg00 0S;   ; 0= S00 000`0`S0e00d10200q0 000CD1 P@@1T#3=P012|=T0814X0\1 l0 1pp|00t00 p x02000020201111*@ @b@b@-;@SS8#8S TS0 T @0;@0;;S0(P E; S Q 00?0H S0P 0PD00  P $00  P bbb;SYp@-0@(P0 Qp@j@P ip0S p@-P-@p/0S/p@-P@p@p@-0S@ `@Pi@P <@pO-QM⸀ 0S S4 Ѝd1p`1`\1@X1P 0`  0 0 00  00P 00 0 00?o2P0S0S*  BR 0p0`0@0S`` S`V WpS0 0SPP/CjRP#US@@Ӗ/CjR@#THb4bDb@b@bbbb@-0@". /@ @p@-@\41P!aP301108480pp@-@\41P!K00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0 $b b;S/0H @-0@0@Tw (0S w @X#dpb@A-;@S0;)`! AR80;p4Q H0  CPPPw 00!0C,2#41000ЍA0404Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m 0!aq?A3c 2#!0C01' AVt14X6' $A$A! T@T(#3#  p0p [(1!20  0 [@ @0`FB`d1 #<S01R4!41$Ѝ 0 0  0 0$ЍOMb̫gfffA-p@`{P  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   #d$d@l%d(%d8%dO-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 DP- 4P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   #d$d@ $d(%d8%dO-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000#d%d@(%d8%dH%d$dO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:#d@\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /#dp@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>E0`0"#0 0 9/0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` 堄@|pG M @I(PU@T D0D 0?8c΄Ѝ 0@0$@el%dbgfffT&dbPdO- S@Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0S' pW* '078!800$0#1S<0P%1P%PDЍ00a@p@-@P!t `0D0034 0 0 %0 0%0p#dp@-@Pt `080034 0 n0 f%0 0%0p#dp@-@`?PPpP 0V 0 10 V& :p0% 8 4 &#&#(    % ( %    % (0 @10(0D`04`06% 36 3(00000%0(0% 0 000%0e 00#2%0(0@10(0RO-@PlM3 $00 8%P !  ( %qp P$ 0`@  KPP 8<% 0 ! ! % 0 0`48(0@$00$0lЍX   %`0!&bPP` 8<DT0 4D0%0 010102%000(0C-MP 0`p` @0 0 00  00P 0 0@+?o2P0S00D DSS  S00 Ѝbb@-@ C101H00H0101p00p0101000 20 2000800 u$00 o#d)bb40!( ( "P @@ /-//-/-/@-$0$ H') 0(营b|&d-$M840, (  0(  $Ѝ|&d@-:x@@-:낲@@-@  -ۗ1M/ A-P0p`00@P& d0 0  0 ~ 0PP@ۨ٨('004 0 004 ('Ѝ|&d@-@(0((0M @Xⲿ@-@0S 0S <剝P0 0  0 P |&d0bb-/ 0!< 04 0 (   !/@b@d`dddQA A-P,p@`s}10 00S S S ,00S @$!,0( "(0P x@(o'0 0 0 (z'F}3 40 0S 0 ႿP/|&db\ P/0 !8 0 0 (  , !/@b@d`dddA-@pP` T@PHoA-@`pP @`p@-@P<`90吚7wKpe|&dp@-P`@=pp@-P`@1pp@-P@L'pp@-@`P101 000p d1S/#ꐥb,) 0O-@`pRDM! 0   0p,@(`$   0! 0   4p0,@(`$  400 '! 0  8p0,@(`$ @ 0 !' 0  8p4@0,@(`$ @ 4  0 !1 0  8p0,@(`$ @ 0 !; 0   8p4`0,@(`$ @ 4 0 ! 0 M  8p0,@(`$  0!` UP 0  8p40,@(`$ PDЍO7x@b|&d,e)d)\ 0 \ /OwG-DhM (`%0 0 0 (% 0Sp * 00 P  00 Qp%p *Tl8W (%0 0 0 (%hЍ  ۦP p 0S 4"4 8T"T#8X%XU (%0 0 0 (% uS A0  PP !> 12! P0 P $00S"(P,PHpWh P 0Xp  L0☨P L0 Qp%p :W 00USx 28 Ⰳ&0 N3T⼄&04` 0L 0uvp 0(P\j *%(0, 0 (0, {$^P2!0$0孙PP4(%80< 0 80< (%"$TPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX $ 0$ 0 0$ ($ 0 PP P|&dӲ@@-0S0SP0!0@SP R \`0  0 0 00堗Ѝ 0ח0 @)|&d;(A-0`0P@"Xp X/@0S  N0S  ᄳ@ЍV0dS*@P唹@P0S S @d0Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B |d@-`P@M 8p.( .h`' .' `p0+Ѝ@0@-ASS!0CS0Sf B +1QA 0 0 0 BA 0 0 0"A 0 0 0 0A 0$ 0 0A (0, 0 (0, A 004 00 00 Q QB 0 0 0 B 0 0 0 @Q Q QtB qB nB kB gdγ@ѳ@O-M @0(`PPqpPX T60SH60S  0F00V  <~P 1  Q,ZE2 8$(0 8$(=Pߍ0P0@`0 >h P9hP 0S!00S 450S  .'%0+0S 40S  .&0$0W0v+DPC 0$ 0 0$ |40VP2 0 R 0S ,40S 0  $0F+?  0P0! 30S .&0  #0(+x30S 0  X#0N@0S ,30S 0  } #0^z00@ S1 Ko0}P [20Sy  00 ]"0nZ0 ((CTTPL20S 0  E,"0*P@ R" 1050 00S  10SC  .7&0  5"0!0C00*-0+0000UP[?DD7s单410SSus  fT P  K0086lBύd`0p0 0nP hYTPCs<0Bύ1`bb'@gdTb>@b@?c(b)O-PM'U@50S xx50E00(0 00(*ၙV(UM p0( ҕ(E0/S0㜙@PF ( pE((0K0:00p\(`)2P440P,0( HDP PPPH0 p,&PHBU! 840S .p^% Pp0c)0/S0U@PЍ/PPL 0`00:00pPW |1000p-P( :0,PR0 <0L30 P0#1 PEP0: S |!  |!  V )V `F|!V.`2xtPp0P,pkPP 0P` ,UbD200S F  R"`F|1V,`  [ w|1 000n 000f 000^ 000V 000N 000F 000>1!0 1!60!  ! . 000& 000 000 000 000Tb@bֳ@Xbٳ@O-(POM@PEhmP |1 00U0* 8$(0 8$(5|1 0 00  h0'S( @P  8$(0 8$(|1 0 00 @00000 0S0% %` * D0$P D0 Q`%` *t)@V   @P 0 0`0: 0P,0 >0S 0P. `#,00 0P=((8,(0 (8,(0儝B?! !X2 0HS%@=0S 0p. #0B. #20 02(0SN,0H S00,H|1X1800S h0|00 R0  0⊙P 0 Qg:Y ,<0dPPW { 000;[3 00/U]" 8$(0 8$(-q|1 000  0040004 0$0[ 0$. [. 8(0 8( (0,0[(0, |1 80<0[80<PPP @ 0 R 0 3SH0L0S 0 `P0@`ᛖP@0 R0  H0P H 0Q:00S U  88<(0 88 4<($$0 4 $$T#|1 @0D0@0D[ U%|1X0p t p t቙P Kfx | x |vK|1 000UN084(0 084(W(80S U8 U\P 0P0S0%0 * L0iP L0 QF: 000S 70P)`hP*0S00S# )G0S[  PP 0  3S H0L RPp\0p0pG4pGWE)00$0$ 4"4 8#80(00C(0pC0S0CS `p0<000SW 00S S6 `$0 SW`` W  0| rP  b0S|~) P`$0 S 00CSd50 0T%0CS00<5PP 0S `BNj `^0S  0R`%` *  P0⤗`P P0 Q``V 0W 0 cP XW(00C R  RQ p H0 \ ?^R(00CS\HQ RS8000S4 (P4 80 ISp G0 Rʈ 0pG00Sp3```-P{p`dp8`pPPn ᲑX((  (0S0  R R )02s0 (0嶔0b88<(0 88x4<(|$0x4 |$(Z0嶐<(0 0 ?o2R0S (Pp"`^(10pWT 0 09 ~G40W0u(p P0P$0XDHX$0S5 B0m0b(08 X`p00S(0S `$0P0$0``P P P  0 40S PHX DH   0q0W 0 ~G pp<`Ue0Xgd'@Tb0@@@@b@exd|dhdd@dhd)024 80R)0 280`0P 0S(0 0(0?8 )0 (  00E0 #R HL R\0P  0800B00V0080$00 V 'V481Y~I0(0 00980Y rW DpGWVY~I(0 0#R00 S( *00S 0(0 S 0S 0 0HpS`000`P P P0  0 80S 0S2<24u'Bjh,0800}0 0 0 000 < 垼00< P0000啼00CP100 $/$0 0`)`$00$000C0,00,0ppEpn|3( 0Wp (  0 4ᰔ04pp(p2l|1 H0L0H0L0S|1 P0T0[P0T00US AP 0XX|1 X0\0[X0\U(P UU|1 `0d0[`0dUP QQ|1 h0l0[h0l'UPljo[Uz00`0S0% % *0 T0P T 00Q:00S 8$(0 8$( hcOߍPp00,W0{ AWC +W_ 0V`0 0 d0ŔP d00 Q:``V d@0P0^ 嘰0 0  _Pd|0 _0SdU 1&;3W <W R00  X0⃔P X 0Q`:00S  3W Q  Qp R00  \0ePx \ 0QB:00So  [00  `0NPa ` 0Q+:00SX ,Ro P%0@`:0000|000P̐Sp`0`0,09 492#0S  3/~X9`V"U d t90S(00  0 |S-F(|0 ⤩0S(hѨ᠑|垑0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U បpPP`d :0S(00  0 |,(|0 E0S(rA|?0|0K5MP0T 0S P0T X[ I\ O-LMP`p췟 =000p,P(`$  :@㢴 0!0 0@D4p,P(`$  却T70D74?00 0@008p,P(`$ t'䶟6 09> 00@008p4,P(`$ ]0406 00!6 0? 00@008p,P(`$ D04086 00!?0 0@008p,P(`$ ,0 400!5̵ ?00@ 008p,P(`$  0400 0 0!L5 ?00@008p,P(`$  0400 0 0!4 ?00@008p,P(`$ 0400 0 0!4 ?00@008p,P(`$ ȳ0 0,4? 0 0@008p4P,P(`$ 尳 0403 00!3 ? 00@008p,P(`$ 嗳0 400 `!;0 0@008p,P(`$ ~ 040,3 00A! 0 0@008p,P(`$ f0402 00 !0 0@8p,P(`$ P0〲40 0 00!<2 B>00@008p,P(`$ 6040 0 0 0!1 C>00@008p,P(`$ 0401 00!0 0@008p,P(`$ 0400 0 0D! 0 0@008p,P(`$ 0400 0 0!00@ EN @0@8p,P(`$ ҲC shyh0@YD0UXh\XD坪LЍ@)bb)bb\bbbbTbP@@?cbgdx*p@-P @lKhh 0S Q0P@@@040p@hP~hp@ 0@?cb̥bG-S@`p 0 0 0 0  0 0 0 ŽX 'R 3SH0L0S(܎@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0ԐP 0 Q% *H7 Q   8$(0 8$( Ѝ0 #0C?o231 夂P (MQMa  #RH L0S0P  0H@W 0 0 0 o0H   C/R00C00000T  10S q? 0( 0 (  /R 3SH0L0S03@P  [ [(`)p0, 0 `1 01   (Hzgd'@bХbgdTbp@O-0p'S(,`(@P  P [ P [P  0 ЍO@ЍO賍Ѝ@-0  岩gdC-0@4Mt02`PPQ7P(Rrf2V 00SS*4ЍCgg 1`1 VP Z0S  b!4Ѝ_!@P 400   0 ⩌P f@T;fP XX#F@f fXT 40 X`0d 0S S :H0$U0*`< B 004 0 004 F `Pd03/@b@?c$)gdO-p ᩈ,00,0,0 0  ҉Ѝgd(A*p@-@,0 `0,0NlbQU 0S   b@dbPTXb1S! 1! 01Zb01Yp@mgdO-R @@QPEMP`0Eߍ调 -0SS/HQT8Q H0PpP;(, )0S00 UP@ 0R R(kUP-0S3P;0SH+ HQp@0W ;0S *Tx0| RS:0S . |*|0#T[ TW@P7T 01X00L:5ᕱ300000 PXp H0 RSg D0Cc UcPh W aV399(0vP W WW\ a\0S AS-SB/1A pX a3SG<14 0$0 $00!!!$0BUpP  pX-  p1S A?SB?11ASB/1 81p 0 k<8t0 >pP70S . 0'0000h a1堷S 0 qFaǟhp`Lp DdxH\TPD :0P   0P 0 .4 X0006`  ఍1ԄP ~H U  0喀 0HP0 >>0PD60Sh  .0D&0000  0`! 0R 1`Z 5% 0  P 0 >PBt50S  .R0t%0000 N0L00 M0[0UTP ᯀP  2P! ᥀4 xX0004`  ఍1KP t8`1hS 0 w`H0U  HP |0 =Pl `1S 0 [`CP 3(0,0<,0aP0 dp p-0* 81$ <=40$0 00}~~0S`P L CX=V PX=$3`U F*pKY @W;;P $0S(P[ 0SX0S `P H0S 0S PpPԀ p፯H0S 0S  PzP H)0S  0iP (h0s0 [0000s0 P000d0 8Q00 00 0aP 10S000d0 00.[ Z 0Xw W Vl6_2SD0CSXX H0W40m$bTb @gd;b+gd@b@(@xd|d@b@-p@`T0P p@* Ѝ@-@^: @<_p@-dP@^0SA?C p@@/_!R1S A?CSP gdgdPD0@/S/ \\  R  P $\H0S/D0CA-@p`6P@P VQA-pP&``0@T AODT  `tP U p0SU4Agdp@-RUD@E`Pp0S  SPUP $4RPH@T D@DTA-@p`P@P bVP/D@P/0 R R 00S/Hp@-@`P@P @Vp@-0@S0S0S 0S* 0S00S# 00S A?CS`  "d  "h  "l  "1gdp@-Pup0`@TAODPpAT AODT  `P0 ~pgd 0 S 0#/00P/Qp@-@p@ LP 0 SRp0011pH@@SRG-Mp4PQ@ $Q !BQ-P+ R  R RR RR P  `VY` ,4Y] 0`9  $ P1PЍ@X$ (0S,0S0 $~p Hu 8H Y0X0 0\00S d Y 0t0 0x0 $iYW00`00008 900P =09'  `H $$0 0$0 (0$0(0 ,00,0 000 00PorbVQ1P!Y  $iZ"1YXD p H 8Z X HVU d Od K00b0<8  ?P0 $00 000 000 00 0yPD`FV 0S H`0 X #PPP30  PP P ;00 d@iikii O-pl8@QP`M #P8Q 6C0CQ 5CojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi @ix$cO-pFMP`BTD@DTU  2SD0CS5UWPP0S0 00SpH@T D@DM PU v` Y` `$4RPPQ <Q H0S D0CUP PP8b80S/A-3`A0ASHM p-BPT,D@D?JHЍ00S1Q=0 000S+c[P' 00000S .` X 00 00h02EPxQH@T D@DT0㥊@bTb@b@-@4@A-HM`rpBPT쀟D@D6n|1S  00 0HЍ00S"9QE00S .`  ` 0u0000_P QH@T D@DTTb̺@@-@|1@dQDp@-@P P oppp@-`NPNN49K d0@0L0`0D00@0 0<0(080,040D00040,000#d@pHC*xC*C*HB*LE*HA*A*A*p@-P@id0@`0X9XNN Kp@Ne0008C00 0/p@- @P!>00000pp@-@P 00000000p@-@ M Ѝp@-@^NPvNPp@-@0Q$MG 'R`l P'RX("($( 0t0  0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@蓍PAQ R000CS1ꄻ@@A-`pP@l2SD0CS+XN 40GSDV`#0F0F P@  P: V< T010#S0 8 o` o\Q\ X ^ QPQ `P H0S D0CS #S S %S000 00 00 00 00 00000V0S  0000ԥbܥbQRI p@-`@M 0 C^.^ P?R1  000 C0PU'X tX+ X7 X3XZ c`0 0<000 KP`ЍpA ER PPC/C-40@SMM  S|1 0 0 0|1 00 0Mߍ R@D  Q *40S $0 MߍCLS S #3R l40S `$09|1 0 0; 8T$ M`P2 p ┦3̍a```0(1,11 0``1P l30S p#0 |10 0(0 S@#2q12D PP ` O2P<2034P09P 20S 0"  XU uPPP20S `"07 $20S 00"00000000 00000000  /JP1010 (1,1P /P \10S t0 u X 3"p'qr 41PU ~_EUX /X0X 4PX408 0000 0S 0|T P0 D00S T P0Pa/ |yQDMTbڻ@t@@F@@b@4@@@exd|d@-@ L3@6XJ*0O-M,00(` S@( |@P 0<Sz|@P 0R 0 0b"#2(1 040 b( 0{pP 0 K0 0 $!, i()Q"TiT% @ Q         R/ R !! ` , 2 0!%Ȍ 00 #8SS@p@-P@Tp0S 8`u0P H Ru@uO-TMx@T$ (p $ $($ Q/o"  U R Z  "T  R $ RPTЍ Rb&R_Q R rd  S`R``V` RO RL r2d`i@ R= R: r7Q R r``V` QR V   "Z  R V PR`Q R R R R rd   PR R R r d   00PR R `Vr  6/0 0$0S 03/P [_ V2S0S:0S70S4 ``V`0S0/ R, R) R&S0S0S 0S `V.Z^ V `S0S0s $0  P S 0SG-(@`P`,pPM00````& R,0S0く RF 0S 0S 0s 0RkP' (00 0 P" (00%0PЍ0 04"4P8#8 S0#03 00 0P 40 X 40 X 0S. P0S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 06lA-00MS6@S0S0S 0Ss 0SQ`p 0S PI(0`00L0S/P;h1NDPP5b 0S3 R0 r-d0 P0S>  !> 0Q00S0 =JP,d0)1P^ U  PP 0@0Ѝ R S 0S0S0S d0JP 00`b@0SE0@-@8P<$MP 0S$ 0R )ssP sP0S0S0s!.0  sP $Ѝ0 /PS0S ,0 @@r/8rO-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  P0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 BPP 0SK 0SH0sEd0 0S0S0S0S090sX3#21208S- 00$`0D0 ` 0 X0P 0 Q S R `6CP J*0S0S0s0S0sY vP!>7l0` x0(0t 00` 0dP 0S10 0 P_04 @4帐3 GQx ADJ0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +i 00000S 0`( "4`4# :000[ )J' PU1P iP P1P0P`b@b (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 0$k!0Ѝ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50(@{Ap@-@08M S8Ѝp@uP`.p 4"48 #800H8Ѝp2@ 0 /b>@- '@(㜠X8)-KCB]z<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00gdG-@Q M`@pI YF 0S BP`0d 0 `0d /@P Ѝ  0oPP 4@@ W n nPA0 0 0 A@ H\-PH0S |1 X0\0X0\0S1 0S.0s+ N 0 nPP-TA  0S# UQ H0Q SppW |1 X0\0X0\[n00AR@T hdO-7|M#2p夠1 20Z800004SH000[\0# 0S P H@P@ @\04 6PP\`VH0G40@P= 3PAP4n0\00C?o20S G@PP Z@[V `VS 0S0S0S 0SG  ^h5dpT5\DP(1PL0 T APFL0 @J  ?PP ZF<5 #2!12|ЍPP`Z@W 0S0S0S 0S PT ( >PP`(0p0p4P0`UA_E0 0pUV: 4 8>PA40 R=`0\3d 00h0S/ 0 \>P), \>P#0 ,0R030S `0 8$0pP```20s j0@0PQU A_EV 0S8=`=Y 0YXpf0p\ P0P 0  0S0s0s 50@0P0s S(0@0P"0@0PD 0RJS 0S 0<0s0 X 0<< <R6R[ | r5h! 1Q4 R pX`02=0SX0W08`0"p`r0s ԙ0@0P}SzRXy R QRX  #  RN 8`$0P$0GpR ZP@n@bgd8bbP P/Q|1 00/Xbp@-@PL0@ 8PGl P H@=lpp@Xbp@-d0,`P( 0 0@M 0  0"` `'P P!PP d0!3d04"4 6Ѝp(0 @-HL H ㊸ < gdC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  V0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H *xP0H000H00@@b@d`dddgd10SYp@-HMPH l<0sHЍp$P 0 R0 $1aUH@, TP>PH F@L00PLP P ,$P @ }PP ,$vP @T0U0L0 -/ꔊmuHgd0-C-0008`0,p($@ @ @I'0404 00!E?0 008`0,p($@@ @1040<4 00!I?0 008`0,p($@@ @0 400!>0D 008`0,p($@ @@ @0 (00!`3D0O?0 $00,` @ @0 (00!3D$0R?0 00,` @ @΍0 (00!2DB0>0 00,`$@ @ @帍040`2 0V?0 008`0,p($@@ @堍0402 0Z?0 008`0,p($@@ @刍0401 00^_!0 8`0,p($@@ @Pq b0P @@@!0CC10@ T0 !0^'6'#xW@ f0LЍ R  RR  CB! ,0*?c8@`b\bXbPb bHbDb@bPP W<,0 <,b3h|10 0 0=( `xiP we 0 G R= 09)0 9);|1 0000 0 0 ) 0M 8>(   8h PJ0 0 0 |1 0 00 0<9)0 9)R @ =02F?! !2S28(0 8(8(0 8(0'S(g0 `R 0 0 0 |1 0 00 1 R  RQ Q$Q Q  \| R\ |0 0 0 |1 0$0 0$ Xgy0'S(|gP _ p sa00! !i0(  -gP M<,0 <,X 0` 4P ;0 0 0 4 P Q4 PL40P0:!0 00S1|1 000P8:pWP p0 0 0 @0D 0 @0D |1 80<080< b99LD00H00 \0 $0Db$0pSB pph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ Th0 0 0 sx $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,^.P C40 0 0 ?@` 8#(#Q@;( <C.P $0R (0R(0, 0(080 , 0< 800 < a ((@004 0 004 ]P "0 00(00 dP `0 3SH0L RP0H0 0AaT `P (@(@@42P@TL000S;  U+ . LP. 0#0;P00|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  3G] , hP" $bP|;<3x0S00C0xP唀R P|P;V1q V8 00V41&P 80 000 0 00PVR V 00VჁ#W<`p`&P kV39V0 SRx03V\0 R000&V0 R|0p@@`b@-@0PS`pM&P7 a,0 00000(000Ѝp@-P`{&@P J [P &@p@-@PF@&G-hMP pሠdk@P0S( 0$0 @@@0 0P @ P ,P@9hЍRsZ ἳ0S @( @P0 ,0" r!.$  ,00( $@RP@@R`P H0 ,@R@RZ 0(<$0G- pMS@P  )S *@B pGWP P @9pd@4pcP P*0+`0G<S000 000 0 00c@Pj@P9WgWl;pGWp0  R0@pЍ d0R88d0c A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R55+0 @@0 0@P d0R55 P=j@P A0:P=j@P A0 %P9 j@P /%m A 0h@`@`T $@P 8@`0`0000( 0CS0 PiPi`PP  *P 0'3Sб{10v0S@7 0R;0S8@T5$@1PiPP0  R00sh700 iP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s p[b P*  `V 3S100 $]"PpW0 $ P 0S 0 000V $*P p4 LiPr408 0<0spbfD\ )P` P  "PRpWO V 0S P p 5XpTP04P ht!P`5X00 *-0Ei@PN0S S Sd04M d044Hd044Dh@P7IWW > 40SKW$(h#0GS##pc`V S19@ 38`8p40 00@=0 0 pG=g' !4gt# q* @(0`0(000 @0R] TQ 0# 3SH L0SP0\ 0p<[ 7NP bN0 $R<`0d 0 `0d Gu< 0CS00S  00 ݮR 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T `0d 0 `0d P ` @0S 0S0S0 000 `0 0 -P@}Qp+0S `0 0 0 X0\ 0 X0\ <0S 00(  љ< X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0/PP`0D0H0&0Sx1S800X 0Sx1S &P D`@V<MPP `0d 0 `0d m0P?o20T00S |1 P0T0P0TD0S`dp H PwؖPl H0Rhtp H P^ܐpPT H0RP3{Uyh d00l 0p 0q   >ⰐJύd0[T#P^ Ԑ[  Jύt0D#oᩒiYL 50S .d D5`%3 1`00>Xux`0d 0 `0d V |1 X0\0X0\Y1P@ DL P@ Dg `G P TR`0d 0 `0d P\(QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P083LP T`PH00U@P  Up3\3:$R*PX&D0S K U0X x0S 0SX x0S\^ \0S L0(0@ 1P>LPpm0 @=P@0S~R p<,0 <,U@ T0<<0 |1 0003S R0 0 0 T |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN <1 0R00S  @ P @OOD<:K<0PGK0$[ +$0%UߍT@PUPe\c X ( ,0 <"  W hP<0 0 0 G(P@b@TbTb@idbb(bxehd$" 0@/D0Q0*$ PPnP0<1 0.MHYW=0S RG 0P 0P @ $(  $@ 1,PP0 3  10S (10S @ ,000,0D0 00 "p_mS Q0 0 0 P U*Q0 0 0 Tt |1 h0l0h0lk00S p0(0 0 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0KJP@#s79`0d 0 `0d D0@0 pN@PWT"p0t 0 p0t -0 0048900(0@0(0l4 000$0( 0S0 $PP 0X    @P 80IP  80  00J04!< 8Q#8<000,0 pA00 0400(4"<$ 00 OPu @0 0S @  ( 0x0| 0 x0| T |1 p0t0p0t,WP?pP @0$ ( 00/ 0$ TD000@ p@PEUMVk0 0 0 vV |1 X0\0X0\APP/80< S001R  ! @0pS001P0/03" /@bQ/C-@M w0(pP dž`Po T0P4`ӎ@0!Q8P=A` A0P4`8@}Ѝb@B(0s/@-@$M@∇ EM0(0?cO-2CS0&!X0P00%U?0T000&P?AT ~ODTebL+de b@-4 R0R 0 0, Ѝ,bHN+0S%p@-PX0\ @06S LP `H6S000c0#062H00C0p/@-0@0,M`S6S 6Q0C?o20S i2,Ѝ@H@0 P pt0\ 00 00P p$pRH:H7H|1-`bp@-0PM@\`P ^(0(S00 G 000 |0 00@X0<8@400 `4 L@RPЍp0  @`容@C-1q圑1!M0 #2a12Bd1P@TAOD2_3"`&ab ЍXAHN0s! p0@0P P VP @TP @T0s bp0@0P000Q0 0 be@bbL+dgdG-|1P`p M0G S!2S D0CS@  R   ` Ra R H0@T X p  0  0 0 3 @T pЍ 00 03 S #212 00 0BT D@DT 3"(00S @ 000jH@@@b0@-MN3 F00000 0|0c00@P d 6TP0L $0< Ѝ0@b@cddAP+@d@bL+L+p@-P_@0@0d000?00:<0?00 0400S 40S3 !0 0p0ub0p@-P P@ᢎU0 @@@D@H @Pp@0Sl G-@`qQ@ R HQD0PP ႎDY1`QC 0 0 0 )P o01 0S@0@H0C Q+Q! H R   0L S L0`S@A 0 0 0 H0S P pdH R , 7H0S /u@ bgd @Q|Q/P/*p@-@P p@製XJ*0@-@PP0$M @E|1 03/PAF$Ѝ0p@-0 M @` ?PE|1 0@4/@"FU >T06 Ѝpp@-0@SP M 00S&P  xP0@o Ѝp`<P 0U P E>0P 4   H R>>0P/@- Hk@1@-|1@PH2`PM 0CPi 0Po 7C0CPVP 0P00PЍ1PC '7C 0CPB 0P0  PP  4`PP 6(06 06$0Xp\00p mp,pzE<1P 0P,0S0pW 0W p20'u?0040 0S0$8  0-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$PEVDx00Cx0,Ѝ PP 0 `O-f14p0,00 0 H0,DZP 00S  .p p0K jP 5p(0  pp0(00 00@0q@0Ap 5 B]oxegdTbp@A-0 p003A0AS@`+xPE%DP 0  P` Ѝ@-P;Ѝ0 00S0V<002101@0` 0(00pp00 0  $0 (0 204 $ (0 P*@X240,0,HD9 P0 0  H0,#PP 20S .p!CBPp0AHl9j=002 0SP ZSP0SU  5(0  0(00 00@⽅0ɑ@0A5 BP 4*4( :0 0,R&0 00PP"V |1 000|1 000l@-X4\$0 X4\$8H 9@0S50 R0PPxeTb@gdO-OM 0`007`00PP  0R@@  0,?P 0 Q@@4T(G 8$(0 8$(`Oߍ@0  p `P[L 60S @. `. &00B 0PA:@Tv0S# Lf. 0 +0S .0  Bo00S .@ A/F0 Be僻C 0 0 0 卻W"0( 0, 0 l5R40S80S<0S' 050S ( 5`0 0aP40S .R00 02@0S40S|$[ HPH40S <$BA@t` `A ;A쀝0XS 0S0S0X?o20S 30SN  {00@pt 0徶@P"l3@0@k5pP 40` 000S0t P@P* 0`00U5T 0pP0X 50000 S 20S @ .K50l0 06 ⳞP$20S| .  0q$0 (0,000 QeX 540"  q?  TQ+ 0Cot "0( 嫲p0, -D1@ P0ppSp00p'0S032@ D% [ 00p  0S X50 0000 000``S`0`&0S032@0@ `bn@gdTb@@8@d  0dG-0P8M ` .  0 08Ѝ`ġ R008ЍGeE 03 Xy|q@  `P LT X8ЍG蛲T A.`  0 0  uP[ 0`` 00``0@0@0S p. `` `0 p(Y 0d |1 00P 0D @at80  @@bd@Tb @bMbu+dp@-@D FPPp@ p@ dO-@Mp`, PP- 0S # Rp @` .pp0P. L  "0\X XD P20S "n,:0 00$ 0( 0  0R p0I<P p0 QP FMA 8$(0 8$(,Ѝ0S00S |10S .@`!@0PeTa׸L!XH10   ݸ 0R  0;P 0 QP F az R 50 00Sa  l00S .@d0X5 C0`FL @0U`0 003^TbY@@gdV@-/1 @-$01019/@/-/-/-$M840, (  0(+$Ѝd@-@2909-@-p0`0d 0@0S P(00   05(0  Q0S(`@9P99(0, 0 (0, ) Ѝ1M  Od@-@-ʵ@-80@0SP 00@/b@-[P-/p@-@4P(Oped@-@4PA-0SP00S1P~S 0@S0`TPP0S 0S0s _0pS 0S 0S 0S@qE 0P 0 1Pe`b-/ 0!< 04 0 (   !/@b@d`ddd0O-LM 0X1`0SP ~SN 0PS/@?0S@;00100@P0#212 0$p4∀0 p 80@P 0P0 Q S R` MO  #2!12LЍ ?P @1@e`b@bO- Ppl0|ADM!  0 @ 0,(p$  P`w[ 0! 0  40,(p$  P`b[ 04 00!0   0 0 80,(p$ `I[ 0!0x @  0 0 84P0,(p$ @`2[ 匼8ㅷ0DЍ(@d,e)+dO-PcP4Mᙶ0 0 0 壶 30,QpP0@ 0M e74Ѝ0SD0S S?0S0S0S0S  sP-0S0S0S0S  aP0s. K0 0 0 V (0Q<0 0 0 G@TW P 0 0CCP PWp7:P 0 0 0 0 0   0$ 0 0$ ;Y 6@P0T 0S P0T g` @PITp |1" 0"0 ͧdhd0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0⓿P Q AoҨ `0 0 0H 尻Ѝ@0(p0p/[@d*@O-M0(000406#@21,2`000S [ 0 P  PP0016 pPPp00:S0P 00S G6@P7@0P0 0 i0H   C'Rk(0C00(00T 0p(0(0(00$080(00 0<0040000 80PS4Q [H$0000`00040c<4 04000:S80 Rx BRu:(p03 805@P ( 0壶 805@P#RH L0S0P  (5@ $P 5/0s08 80 `  ( y00:S80S |U-U#BP側101勴0S PV54<? 2, 2 "12ЍdŸE|Q E Q<E|1Q- R|1000000000000000000000101}0  u000m000e000]000U000M4@г0040004N@b`bgd@@dp@-`1@P M R8@ 0 0 3P@R9@ 0S/@0S@ {4 Ѝp7@-Q@T0 QP   G Ѝ0P HP0S)T   Ѝ0@@iTdTT Ѝ0@1k@DT\ Ѝ0@\ Ѝ0@ A-PpjO@00 00000@P& dVʀ0! 0     !0 0M@Ph(@P Ѝ0Pp0  ]|@b@d`ddd bbds@-@P` 0R0%0 * 0#6P  0Q0%0 *S @ز0 0 0 x R ! Ѝp@`0 0 0 ˲ 0ⴤ@hd@ |d@-@@" " @-0@S00S SS000C0S@  0咖P0S@t@0S0S0S R @-01/dp@-@PTQ @P 0S  00S`.P !pS 000CSp8D#L0@0p@-0@S8M  .60 000S 00S0T#TX%XU `P S 8Ѝp 000CS0P0@@-@n+P P @0S00S 8#S000CS/@-|1`S   0 08p0,`(P$ HT 0!'> 4   0 08p0,`(P$ 1T 4 0!0 !'>   0 08p0,`(P$ T 4 0 ! 0 1  8p0,`(P$ T 0!t 9@ 0  8p4P0,`(P$ @SPA$0DЍO螈@dbb|&d,e)+Xd0SWG-0`SMP@ 0@S>PD PP 10SЍU8 0 Sp* ( 0R*Tk 0b,T 1!00 PU100!L4<@ЍV0dS*@PD@P0S S @d0C0CV a?V0|0.2Vh 1CVQ^ Q^ Q00`0V0 SBp (V@  8T 0S p0S1 d)Ѝp0L#@p0S1 0    R+#  R0S  0R0S7 P-xdfxyf 0$0Q Q Q0 S0 P 0$000zd:c}fUacvtUp@- @t ` ?o2R0S@ P(̅@P|0(S  P@p 0d:cC-xM dptx0P @0@T@0S7@ rP 嘅@Ѝ`4@0S@X r#@0S k@ ዷ@P ,@ R^0STQ S0#S@1@!  K \@Pd:cp@- lt@P$ P0S `.  H`Xp`# Q(嚟(`,U0000x0pd:cacPp@- @9t@P P00pd:cTA- D!t@PP `0SPU PကxP,p p0 PFP(Pp PP  Hpphp Q(,(c00x0]00 Pd:cac+A-@P`pK, ₷$Hfp0S (<pP 0 }Azac7@-@H$ IP 00 0   t0$|`0"Tɹ @]0 4Py Ѝ0@@A@I@p@-@+D弊P`0 |=Hpl@//C-M@ PGs0P@h !T@d  Rd*  Pa Q^` V P RW R Q RP  0  @F V d `-@P5pW W0p  -@P s 0p0 00 0@ | T@  Q 0 .@W )V  $Ѝ@D:cI@- @T00C0\dXp@- HrP@@AUp000~pD:c\dp@- PR@0 0S   hTpp@ޝ@00 OA-`JPp @T 0V `000A00R@0@-$M@P n00 0 0Pip$Ѝ0h+ 0Q @-啸/@@-@T  0L^ S0   $@yЍ t@@@s@-P`@P0 @Ѝpp@-P`@P @pp@-P}w@Pp @-u0\dP@- P H0S <0@f0S lb4+\dp@-@PUQ000p@0S p@-@`PAQ0P00p@0S G-@p⼠P$0`V S0PP@ap R 0 pWppU œ0 0U`G-(MP`,@.YtpP1(StpPHq  m0 0 00sV  S1!11%*X!:Qax|0SxZZ PU  DoP<]KCD1 P 0$1;-(ЍzቈpP >hpP ᅈW5hP0hPp*hPpTg0 *㄀P  7/P T0s P #0!@@+yaraT@f@x+y@++0@-@$MP Q: |϶$Ѝ0 P 0 0000L000@ 00Ѝ00r P @5+A-PMpPc@ᄂ`ႃpAܶP0p0  po  0 BP⇶蟂pBms`= X^PV0 80l0V404001 0`,@D1$00(0$0AP00 ROPPЍAzp8100ᬇ`Pᬇ8 ^P < ^P<D0@ ^0P@0D0,0$ ^P0$0$Q  H1<0#S@0S  R:t,0S$0H0 0L04*PЍ@@&@\+=@@P@S@]@h@r@@-@᱂@-  OrPZPZ   trp@-@`PP ~Pd00 PpPpp(00S0000S01/\c\c0   (0S"" /P/@-@0 Vk 00@-@ oB[A-Pp`@P@  0S 3/@P E@- @R 2/@6O-LMppt0P|0 0W0 2`@xQ [Z 00Z 0!) Z7 Z< $0Y0# $$00 } QH00$C0#t p0$0 "0 aQ$%00$00 @p0 ;/ LЍ[ 0 |LЍO/W5  03/P 03/ (03/P Xo `100@r[ `[0@X" Z V@ $0I3/PZ0A@ 03/P  03/P Z00S (0Y3/ 03/P @-0 0  00 0 00%Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/@-Q@ Kq F0@:@0  /`@p@-@P`ᘀP $0 p@0/pO-PLMpt0  0000 ղu @P PR40080d(⥰4004000(p00040  00(0C00uLЍOk 吰0 ;40 B0 0PS40(;40]jLЍ8pW H0q;/P 1|! 0,01 0 D5?<C3Q#3?P [@P # [P0  R= 080#80C?o2S>^|0 7/,0@ 3 #R(0\\Lp|0 0,00 <0Xb?@\+A-(@  0 S0000SA} 0#dt0  ~$P ,0]@[ 3 [iL|0 8/,0@ (0LP|0 5/(0LP|0 A/@7@-@(0HP| 05/0<0(0LP{|0 5/040 Ѝ07@-( $ 0# 0@ Q 0HP`| 05/(0HPX|0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LP0| 05/}_(0H`'|0 6/0SPU 0S , P(0L`|0 ;6/Ѝpp@-,0@t 08/0@00@0(0Hp1t0 7/0  D00D00@0Ѝ D #D  8 0 D00+ (0L`t 06/(0H` t 06/(0L`t 06/D0?, R 0 R0 066D0 pD00D0 R0 0@ 0 0A-@40$003/,0 , R^`P(0L`s0 6/(0LPs <5/(0LPs00(0L`q 06/=S  0"Sp@@-eP @@G-Ppq@`V᠐< O ⑤pp<0 00(`0`0$00,0$003/(00Hp0 8/3 03G@@s@-,0@!;90(0LPp 05/}㟵dP(0H`p0 6/0S㑵PU 0S , P(0L`p0 ;6/ЍpA- 0pP(@@pD0(0 `Hp 08/(0Hxp 08/(0Hppp 07/0@00@0(0Hpcp0 7/0  D00D00@0Ѝ D #D   D0 0 00D06 D0D0D07@-@P B 0R  0"S44 0"S (0HPp 05/(0LPp0 ;5/ Ѝ0$03 0 0"Sp<@@-_P @@A- 0pP(@@pD0(0 `Ho 08/(0Ho 08/0@00@0(0Hpo0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H`o 06/(0H`o 06/ D0 R60 R R6 0R R6060D06G-Ppo@`᠐⍢ + %pp<0 00(`0<0$00,0Y$003/(00H`o0 8/3 03G@@p@-@(0LPKo0p@ /7@-@P B 0R  0"SAA 0"S (0HP(o 05/(0LP o0 ;5/ Ѝ0$03 = 0"Sp<@@-lP @G-Pp#o@`]̐H [ ☢p<0p 000 0C2?000(`00l0$00,0$003/(00Hn0 8/3 03G@A- 0pP(@@pD0(0 `Hn 08/(0Hn 08/0@00@0(0Hpn0 7/0  D00D00@0Ѝ D #D  $ 0 D00 (0H`|n 06/ D00Q0066D0 D00D007@-@P B 0R  0"SZZ 0"S (0HPAn 05/(0LP9n0 ;5/ Ѝ0$03 V 0"Sp@@-P @A- 0pP(@@pD0(0 `Hn 08/0@00@0(0Hpm0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H`m 06/ D0  0  0D066D00D0G-Ppm@`'᠐$ʠ 7 bpp<0 00(`0H0$00,0$003/(00Hm0 8/3 03G@7@-@P B 0R  0"S 0"S (0HPrm 05/(0LPjm0 ;5/ Ѝ0$03  0"SpD@A-Ppvm@`Xp<0 00$(`00,0< R A ⣠p0,0$003/(00H%m0 8/3 03TAID@W@x@p@-@(0LPm1$003/(00HEl 0 :/3 03t,0  `&8`k 0 ' 80 .ܟGO@@/@@'7@-@(0HPl 05/000(0LPl 05/ Ѝ0s@-@P B 0R  0"S0 #R (0HPk 05/(0LPk0 ;5/Ѝp$ #  R= 08( #80SH`k0 6/000(0L`k 06/k0 6/00 0"S0p@@-P @0@-(@P@0 0D0(0 `Hpk 07/(0Hpk 07/0@00@0(0Hprk0 7/0  D00D00@0 Ѝ D #D  0 D00  00 66D0G-Ppxk@`ᰐHU [ pp0C2?00<0 00(`0l0$00,0$003/(00H$k0 8/3 03SGH@p@-@P(0UL` PE0 k0 6/(0LPk#@S0$0|$ `*$003/(00H1j0 8/3 03`AU@@@L@@7@-@P B 0R  0"S 0"S (0HPj 05/(0LPi0 ;5/ Ѝ0$03  0"Srp@7@-@ 0S ,0 (0HPi0 5/0  Ѝ00帮(0LPi0 ;5/孮금@-!P @G-Ppi@`᠐`ⵜ s Mpp<0 00(`00$00,0$003/(00Hi0 8/3 03G@A- 0pP(@@pD0(0 `Hni 08/(0Hfi 08/0@00@0(0HpYi0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`h0 ;5/ Ѝ0$03 [ 0"Sp0A/G-PMPGh@뺐 Ir?p`0D P D 0SA 0  Ⱋ<0` 000 0C2?000(000$000,0$003/(00Hpg0 7/3 0 3 P(02H`g0 6/PЍ 0 oAA AA7@-@P B 0R  0"S 0"S (0HPg 05/(0LPg0 ;5/ Ѝ0$03  0"S poAp@-P0@ P@YT0 0pddp@-@X0S LP0@` P$P(P,00PGP00@@p@bN,ddp@-$0S 4尙@,P2 R00 p@qAddldA-@ 0S p`P@UT\ P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$00ddld@-@D0 000(S   0$00C$0@ldp@-PPL@T  0R 00 0 Tp03/td 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-4@P0 P0n  9 ptdQ,p@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ 8AA-@pP R00 0`0C 0 0p0 0 00 00S PP0p 0@@@^ AZ 0 std@- 0 8 00 00 D  0 Ѝ?AdA-p0S `P ~@P D OX U PP 囒@ 0@P4 0`ꄂd@- 0@ @0@ 儒ꄂd@-04 00 ( $  Љ0 0ЍcEAdA-hp0S@ @`KPP @ s@P ֌0@0 @Pꐂd@- 0S @@KAdp@-P`@U@p 0RaP PE @-@-@N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝ脃d(00S @- 3//ᄃdbp@-LP@0 S   R 2/$0Sp p@/ᄃdA-P`P 0003/Di@p 0 R @Te$0A[AA-@4P. 0S+ 0QP0000`0 `06/#P`p00 30P00U000Y,p@-Pd0@ d B  pAp@-P@`U000000Εp@p@-P@ ``xUPEPgA0@00`00 0S Xp@UA A AA'A|p@- @l!`PQ0LS  1S P 0 p@ 0/ppp7cA- @!pP`pQ0AS1S  0p 0A/7cC-pp@` @`!(QPP 0S8' ЍS C0QU? @T8 0ll10А p1@0峑P@ Y0810<1K<@10D1=`1\1j0 00003/PY 0 R 0YO000000 00 07cc,V,+p@- @!P`0Q\ p@8\  1S P 0 p@0/ppp7cp@- @!P`Q\ p@8\  1S P 0 p@40/ppp7cA-P`0`%@ LpP0S 01S 0S  A7cL@- @<!P0S, S 幕0P7c*AJAA-`Ppmc0嫖P @R囕0P嚖P0s$哖040000U0 40S R p R@0X 4/#P P A[000 AgAAAAdb,A-`Ppc0XPЍ@qU00004P0Q> !R <P000U00000SL0 H0 0S800 `8/#P  ЍAcAA=Ab,dA-`Ppb0 P@Q P P0st040000U R000 0 000 AtgAAAAn 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddA-@0 A`!(O00QU0X<000hp 0`0h   8/ `P 00h  P 5/0P00P 0<00Q =7cbQA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 0Pp 0 R   8/0 800@ 0 03/ cЍꌃdAA-Pa`@P p0S`V⻑Y P @-@0   00@A-pQ0@`P VP0Qx]P `O-Q4M`0I@PT`C P= 0   @ ^0@000,  ( @$0 4/`P# 00$0 0,0(0@ 0 pS0 @ P  0  03/`4Ѝ0@00 ;/p  0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp80, @0 0 S0  0 0tbbX0 0S/ R P  R   00/0/tb8@- 0000 0踃dp@-@PH P` 0H0 00P0000000p踃dG-`p0 @P05/ᘑpW 0 0ЍG/0 CR/ I0S0C 0 P0PEPE0cUP!00:/000P 05/0S0C0 P 5/0 0S0:00 0 0CR 2 5: P 5/0  P0A5/A P/긃d; S 0 0//ḃdQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/A5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`PpA@-0@000\P W0\0`P Q0`0P K00P E00P ?00P 900P 3000T@+܃d\Q@- /6Q@-A/%Q& 4A0&S0&Q  @-.0 .0!/  /A9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 SW0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V ⪈0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 803/JЍA<A0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 @0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPlB@Yp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000&\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hl? p'00(Ap,Ap ppRAA@-PP@ p`Ey(0 0 000@)$080 k\ Pf`dP a ] Y U Q Ѝ܃d@-0 @04 80\0`0d000000 Ѝ܃dp@-Q@<0 Q Q!R0 ,R0Q *Q !R0 ,R0!R0 ,R0<0p!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@U`1P3p1:PEU`p0T 08/`0S T R0T D08/`P T0 P>`0S  0S 0d00 00CR00d0A-X`@VP1p1:`FVPp0T 08/`0S T Q0 `TD06/`0S T >`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00k> R 0PD05/`P  [>0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?S +@0C4S00*SS *S *SU  SW $Ѝ*S 8$ЍC?*S ! BS;  SPh`h0S! lPP*S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S d8 0TipFQ D\PQ R00)P   8 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/]0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRC0A0d0>X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍColQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0s Qo\0Cl0S ekl0 S0C BR 0[l0S SV \$ЍC7<\ 0L0HPLPph Q@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0l 1R1R aRYRPRB0dBPP\pB APR40@0D0HPLPpPPPPPPPPPB R p\&P A Rt 0$P(pB R p\P A RtpR  p \0 AR00Ѥ pl0S0D!0 0   8l0S S S< 0T 0C 0 S S w o s p ml0 p S03S0!R 0CQccPW< T0X00hAJ?u&p$c>Al?p$?AAAA!A+AA4ADA[A?AMATAp@-PUpU- @\;0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC07 dAA-@P` 0!0`3/V0p4`e%n 0!0p3/ WAp@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@ A A; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000d A/ A A A A A A A A A A A A A A A A A A A A A A A A A A A A Ap 0S S"0A(0,D R  Á(,//0C-DM (00`p@ a<00,$  @P< 0PL @   p  a,($00 0@< DЍ Ab<0S/@-@Y0@acSA-@ S t ‚hP`pP   03/@NT@@AN AYc 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-@p`Pp@@0S/p@-P @ 00 R PD  h@ 0P4p脪b,@0S/@-@@h0@04@O-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ JV`@0  A0@0000@Y 0S@ T`` 0@,`@[ L#@080 0B@P > AA-@PpOA@` 0 R_@)A-PU 80p`h0@6pf A @-@]80S 080<0S4@.A-P0 @R <"p0CS3 :  `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@OT00@-N00*p@- MP@l T`[P 0 R V ,TL ЍpRV RW SW lp@- \`P<0S@0 00P00CS0pp7c@p@- 0@P;PP  p@p7c8@- (@;PP @7c0 000/G-P`NP0@x000000 ! @Jp 0S0 ލЍC0h0 00P0`P PލЍCk ``W W @W@W @W W@W @W@WWW W W W WWbb@-@p`L0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0 ЍP R 0 0q`@ @T@@~fvtA-@aP( d90 pA7c40( R/$ R R/  /d@-4( \0^@/dT0Sp@- @RP 0'l0p0p@//@- @ P@A- `.9PP@ @T@`V X0S PpW@0`P`p@P Pp7cD@- 49P@T  P 7c 0!< 04 0 (   !/@b@d`ddd RP RP }//C-QP `M 0q<0 0dV@p# 䀖XW Ѝ0 8/P 0S 00p Wp04&08#8 S$=;G"0C S04W00G?o  2`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  t0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZA01 A$'*As@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 dbA-PIx0UTPS@UTp W `W` 0 `U`RT0 0$l00p3/`PTPTpU@ 3I |+I AA\ P/0 !8 00 (  , !/@b@d`dddp@-@0Sp@z0PS 0p Sd :!)$T0S` 0Sh0T0`!bMb@-MPIX0@S `$#x0S 0$ P`V% 00S" 0p0CS00 00yP b< p00` mP HH|<^M@H0 ?ЍdbAAAQ @-8|/@Ap@-`P0@   `P0(0pd,X,,p@-P@PPP(Ppd@-Mp`PH0@S 00#90S$  hPP: TP0S4 S P0 0!! !1Ѝ@j#h0Uh0TPP @ R 00`SPU0P00 P H \yЍbMbLAp@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ WyA9pAp@-0@SP S` `ȶ < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 Txx0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02"AAp@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`p*FPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p,b@@- @ 001P,b@@- @ 001P8,b40 60 0 1P;/,b/@-P`xㆵ@fサp0lpp000 P$5v0@@0 P0tp0 ЍA0bp@-PP@0S `ᇵ`0Pp0p,bAs@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@H+E3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RoD0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0J 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00;D\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcW@b@d`ddd$ 0,bp@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` PC vPlpWXPVC@ C <v00S 3/PP\pAA@-@CTT0 TQ S S @Q @-8w/\Ap@-@PX93PppCP 0P X0SP0Sp@ piA 0`( "4`#/R/`0  B@-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P Q   @@-:#:^:,\:( 0 /xAA-Pp`@@0@Dp@0@L$<#@`W >0pG`@A-PlL0pLALA$ `@`W >0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0`!pW:X  QY Q  x? 0PxAS/G-` p P#"Y@PX  >0S  M?00H@PR/G-PQ0Fh pY@p`V8h (?0S h !?@pG-Pl @R`T  Vp P匀`#801U "0S  >0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  >00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  YP p A Y Q0000000PLbQO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@b@d`dddO-`d)@4pS0ʀ0!4)0,)$)   !@WpVP`P 400 $X0@04 00$00 , 0 4 00CSTX40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ J{: { l:p1ʡhPL|00 10000000  P 0 Tp ` 0h`Waf`` :`Fd 00C0c& 0R0 0C 0`!0` 0RS0C2x05A45t454545454544 W%00t%W$43 W 0倀TVtr Ѝ R97;BSA S S  @<Π` P BP RY 0 S < b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ夂01 `@380!A!Q Q ^: 0 0S  u V`@2pg( 5'b`0{pU9lpGW04 TP    ̈́I 000404040404PTP!  ̈́I 00p04l04T04P04X0@b@d`dddAd,d,,,, ,8,,`,,@,,,,,,H,O-Pp`( 4M&0S=0,0 T0$WpVP` D@ J I 0@@ @@ P,pp004ЍT0     ,o,9 P,0D0 ,@@ D0 m /0P00#0CS04<0@pspp000X [0R bQ" B3Y 3R b\Q" B0Z 0R b] BP"YY !1"0202 tnY0XZ0cY0[\ ]0`kX 0D2$ ÆahFh`bV`aP"A 0Qc2 D0A$ Q0SW ASL 0CS>T0H90 P U=l0 S00P10000@!@1P@@T(T0 [!1P@@TZZZ0X00X00X0 S 0@00 pYD8#  T0,88 < T0 ApA$dA 98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-9/AO-PP L0!p!`W1 p` Q02 !X800#0Q00p0` P b C22  A X80z  " Sy  " 0S  W90p0`   A&A$'AS/O-`4MP@XA P^!1 00 Z P0̹p c02Aq4Ѝ W Ġ   ! Ġ ! ,  ,Ġ 1!Ġ !  ̠̌  1!̠̌!!!P P h i P D\R@TqZp0pp PN0@000ȷ@T0 @BpGBS0(01 0 0d$000Cs0v 0S0 "<<"$0,04#$(#$0,0 S "<<"$0,0$ 32# $ (#$,0 0"00#0  0ERa0SP 0G0S@0#Ġ #4 <0!<Ġ< ! 00 Q Ġ    `1! Ġ ! 0##4<0 48,0(4(, L<\0? 00#00#0B0S (0 !700pP^<T! 4 8!004#  #4<  48 0 0$30##4<"q 0i3##4<44, 1 00A1@00Z@@P0S0$0 00 0C 000Cs0~ 0S N 0#,,#4 < 0#"<<"$0, 0  R ̠̌   `1!̠̌!0# # 480.̠t.4̌ x<^0[ 00#€t 00#0R Bp0(0 0b,0(0S^0S2 4 8 0 02##4<00 S0 b##4<032#$(#4 < l!0!  0S $0 !700@PW 0i3 ##4< 0 1 00R! 4 8!002#  #4< 48 0 0,30##4<00pA&A$'AO-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? 1!pW:Y  ! !QZ ! !Q  S6 `AA&A$'AO-$R@4M@ R^v C^r*P`! !!X V`"( !X P",!P Z S $p0~' 0p RhʠS: 0 02 (,0Y4:04!48#8400p0R2##48 0S0`0P 0" 00#0 R00`0PY*X0 0t 0c PRx `R 4Ѝ衯0 :00 B0c 0! 00#0Qa0 !    R h@P  "S ] 0qY4*X0 0t xp0c PR`00W 0PE0s00 #  "0  S r  !  " 0S 0 `FR5pG0s00 #  "0  S r  !  " 0S  350`0P0p0 cR2 ,00 (0 1$0Y:0 $4"4 8#8$04  p r  000!Q"  "$,   P r0  00>  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ 40`0PAA$'A&A00 04040404/-P,,` -O-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  F40 `0P[:004!48#804pQ 0S  #40 `0Pό\00PE0 S 0S 0 `F4pGO-Q@,M@Q\ C\*P`!!P pV" ! P` P S"! P) 0 $0 剐<*4,2,2  )00XR:0 E 0=R0S  30`0PX<:0 Q0$ Q0! 0 a`0X0@0cP[0$00k0僱 Y0K0c[3\;$;b!Z A bQ"]100 0 S0S  l30`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `FF3H$dAT00  ,0X00500\04/l-,-O-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  20P00 $4"4 8#8$04  ` R0S  20P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PE2pGO-4S@P,M@0S ^0L^*0p%!P0`P#80!)V` P \"P !)ᇀ ("( - $0⒎($⊠""00 0000 000 0YR:0E 0=R0S  C20`0PY<:0  R0$ R0! 0ba0X0A0cQ[0$00k0僲 Y0K0c[3\;$; `ZB$aR!]18#80 0 S0S  20`0PP0 0t x0c PpR`X,Ѝ0PE0 R 0S 0`F 1H$dAX0S  0R   Y  Z0X0[ 50 0\04/--,00S/  R 0$dA-`PV0@P0# (( 10`0p $10$p<.P`5.  0`000  @@$d"/p@-P$0@Tp5/@$d\0P/ L  \/@-  , "  $dPbA-p`^@P P@@@ @S PU$R : ^V WQ /P@^T0 N^@D@D\'LD@D BR@D@D\ @ N!N'O-Pp``08@TV#2 Ѝ 0 U`P@$dp@-P` 0@Tp 5/@$d@-P0P0P`@P , 0< 0 00 20Ѝp$dO-PcTHHCUDsT# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@Pb1AO-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0PPb//O-0`p,@` 0ЍpC-0000`C-p@00CSʺ0 V0  =# C!! RK'P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 40000 P4000S 0 ,00/ 0 S _R Qr4P e> 0X&  ( , P B R   ,0[,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, q0`60A00hI3AT0T \/@- 1"\0?0A@P4b>Ap@-PQ0USLpR @@T00APES Q T03=?00QS^T ?6?0000@-A\\^CS0Q Ӂ0ѳ 0ҁQ/0C-P0M`00@V5p +j 0R  (: {>C 0C"4T0 0  ?d @;c U l0<#\0B#E@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ Pi@Pod0PЍ耖p@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP00p7A G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP )0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[7AC-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁    Y@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP    `TF`% @P TT@@ YV@@@$T P 0!1RX 0SRR7AC-P@?00CSLM`LЍ@0 `p0R ? ; 7 0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ B \ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 @-@tPt`0 `x0` @CT` 0` 00 @@C Ѝp@ߘ:Ac8d/@-F0@F@՘8d@-Q|L 6ЍC-@$M` S0pS rBL S?xx^D@x  !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \E$ЍP @0 H0 0I0 0J0 0L0 0M0630-*'X0\0800sX L000 5X0@0000H0H @0P0`?Z< 0+@0@N8d!!d;A:A 0Q0A-` @ P80 rGLppF\P:oPpd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P+0 00H0 C2 000\0 >0>00C00$0\ *ЍA;AO-@L8`p0,MP 0s @$ .N,Ѝ0 *\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B 0$ - \P 0;P> r 00 0Pd0;0hl0 Q! 0LP  AH B"     \P0 00S\P00#Sb1;Ap@-@PoF P 30 0`$Y`?5Dp8d@-P`@P,B@ޖ0 000 001 0!00Ѝp8d(d@-PĖL@P4Ѝ TC(dd(dp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@}<AP$徖FЍ0 0巖(dd@-0Pp0 0cd<@TH壖Ѝp 0S (`C@(dd(dG-P@|xpX `D2 H.W L R ! V xvx 0 0d@-   11 1`00C`0`0  0`0 11 1/@-  Ѝ0M000Ѝ/p@-`@TPPtPU \ PU*x^\  pO-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P `Y l0d H BT02000V`pd000 0SNX\0S*(P > $00,0  0[ $ ,0(R:P %(P 0(l ,0 B$"P 00s000p0pD 0S (VpP pGhplg0d h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$00Ppp`0 00za0 {0[0 l0808(<r0"\!o0C00D0l `$0 B"0$0M$ 00,0 =0P T &Kp.0Sp+ P 'KЍr;AO-R4MXP0v\0@Sq:  00$0 0(l $p0 B$"`P5( 0 z/E 0 0! $1Q- q5 :CQ0 : 8 #8#40 (-0(00t0(P 4ЍZ  R 80 #8R#4P00 0RP ,,P`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`p@P )0,    CR@lЍ     P 0@OoB@@P@M@0  . 0.S+R R'0.S$0pbD0 Sr L0R, R' v0  =@PX 0'rRppW -0@0\P PD PJ@  0p$00, ` 0'p0S  0R4 (`0`0\0<`S H00 (D0P P$ P40Sx 40Su  =@Po[0`[ 0Gb0G@,`00d  D0p0p$0l0TP C)CL@H)0c"$<3P<0 L`H0SI(00(000    QQ[0`Q'60[ 0S0 00 0 0 00 8P $0S  \ P 000 dP 08 ,`SR0p00pG0p 0BB00 p0p04 B8LQ0R S`bD0L00D R` 'Q  R 0 v  <@PX 0'rRppW@ 0D@X 'rRppW ,0000  0D@P O-8@LM00 \0pR`:,p Ad01000 0P\ 0  LЍd00 \d800000@ P00lSh0 A)A )0aD@48"03$P4 h0@0P 0 PH0 0I0 0J0 0L0 0M0 0L0< 0\0<0800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S s0S{ L0 X0r00L S000 S<0 0P0<0 00^h m04S4 Kd8000@ 9PP,l@ A)A)0aD48"03$PP4 h00P 0P80 0($ 00 0 I00JP 00RPP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PEPPi h/04S& d0@ 7Pl@ A)A)0aD8"03$P 40h 00 0 pG  P  0CO-`p8$M000 N@P @DOoB$Ѝl A)A)0a"03$jP0P [ pQ Q @ 8P $P   P;A;AA-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@0800S 0s \ S00\ }(0$000 0QPP30$010,000t010(0@14110  00 10:0000l0$0d0 0TLЍx|e00P@8P .T P d}b}00O)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$PP p00 0CS0! 0@VT0PSWTPnO-`$M0S S@ d< 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 0:@PV 0 \ B\ >0>00S H0A0a0000 0H0  C200000 @P[; 0S0\ 0T [ 000D 0 0 >0 .0 03@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP 巪p000 #8 *(80( 03P @ [B$ЍOr@<@: `!D 0w6S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!0Sx0`S0040 0#240Fx 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, 000SF: TPF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$0PD0\ T00CS0H08 S  8 \8 000X :{0 L0TRQoQ 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  l0 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0 `P+ \P,0@ 000 000< 0C( 00\ @TpTp0S [   0v0P0Pv |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D Z"=A$=AA-@Mp0@P`00 R@@00V T0L0 0L0800"0 VT@`00R 0 W@T@M00N0P 000Ѝ@-0`P pMX0S, \0R@#0*x rP @P&00h@l@!0 0\0!" 0080H00 0 0p 0, x@P  0 000 YЍ80 000 m7@-@PP ʄH Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  0 0|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S }P3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  Ѝg@- `P@P 0   0L 0 0<03100, 0P Ѝpvd@bG-0p` M8P0X0S, \0R@#* 0@P~x 0PP(0(wl0dT A@! 0C#p00$?N@ p 0@ 0) 00!e   XpLP:!0.e2-8640q."@* X %@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |@P *'=A 0`( "4`#/p@-@(0Sp0PSP 0 R@TpO- DMhR/@lp0-`p0P00`$,`@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P h4Pᇤ,兤$[DЍ$ @P P0`ᙠ< 0P0 8 \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R Bᴠ(0W0 ,000,0LA8b-C-萟M8P Qo<01 @`p 000o, 0 < 00 0 0 )P0SP7 000գЍ蠆A-PPP Up`ПU@ 03@P0 A-0Sp@ϣ@P 0`PP`P0 P+00`p@-@㒟004P0 pp@-0`S@㖣@P P0S00  |pG-0`@ `Pp9@lT Ѝ 4 VP0 00@0`#@`@bO-M@Z0`@P %1 1PPZ|0Z00008p+08|p0 !P8B|W(8p ([( (( (  (ᗺv|P%u<00<0%#0 3!0LVP0@8003!0I@T#%X/>0 SC&P02#@ 05:0P0 @ 0000000$000 p_@ 0 SS$ 0$R00S0} @N0刔pC 0Sj壠@#!P$$(00D 0(0#00$ 0A@P$p00ʿW0y!G"Т3" R 0P03Py 30p 0ag@P 0! 0B"@0 0  0U80(, <00PQ0 1 000$00 100@Bp0@$0  0@ 0 0_T8<$p 000x$0/0 0 v!P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S 2!@0xT!@@㓟0 R P0R 0+ 0p\! 0  41T 8@@8081T#\ x徟#0S X 0S尟I0p-x!@!ox A0\ R嗟 0  8@@808ꐫd@bLAܬd1uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0 Q Q Q .0S S 1H0C200<00 0ᘿP  0 P0*&00000$0 0;00@Pap| 060QP 0T0 ;cS10! 0p$00:0 @P 060 %.P    X- 0 0$00 "$Z 8S  0RP a$0 (000J ( RY#QQY*  R, ( RNڸ \RD  00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* c 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 >% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AC000  0  0   gX0(0\0,0pr,B(00,0 040S W X0SZ%Q@bdMAbO-P $@p @@DM $c T<✐0娰 ` ߝP  0 DЍ`&W`V `V`P  0 0$3 0壴  ! *P+X 0S68T08咜0TSJT0S 0u 0 R #1 TyX TМ 0V  01 Cr T 0!@u!O!uP0 ! !0Bq  H@o/@-M@P` < 0 0P @P +Ѝp0@  4/@P2V@002d0  4/@P Hu+ mV 000( (0ਲ/MAciMMAikMAbMA-C-p` 0TM P pȭ@P M+TЍ. " =!>V4D`Y2!>3`04\@ 0$p 4/@P 8,+ $(00 0aMAci@MAbMA.p@- P0@@`Pu<04 @ 04/@P * 喭7NAicWNA@- 0 0000 0Ѝ @-0 000 00 0Ѝ@-!>0004!4 0ЍO-@Pp`LM$@Wpl[*X ᲝP0 7 |8/P $j LЍ ``  4:/P 7* $T $`Q88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 S+x0S $0x 00$0mNANA 0x-p@-@P$ Bp@ 0`( "4`#/O-P@P00(m@P@Pf #P Pz R R 00U>000 C'H)10S@0   @U. p)'000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@X0#T00S 0 #T T0S0S0<&T@0 OoB0CB001 tb00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @岖0 00 S00  P  圖t60Q &(10(1Thod6@Ty 0S0Y @0 00000D60S: 8, 5(6P:# 80  <0L P0C1001008 ԕ 0`000d0嘚*0<00L 0  !  000d5 000 s 00bR0d`0Y   P:dd0 00 0`0542(8p  ,?$<'Xy,XX0la0HS^@2 00?=9V;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :8.偓0 0 0_ \.-0S<Ѝ8< 8    08 08  0`H|VAdVAAd0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8V.0 00  Ѝ0@Q.Ѝ0S O-@$MT忻P`L Hp RQJPP0UPPӔ0U  QS 0Q P=`0S00S pQ0R@6 k1 1H!W?Q000 00U0P00H0 00000`00X03"181qk$ЍP0PP\0001 1pWÏl0W~k1 0<U"181k/OAOAQOADPAC-DMP` p \a <  0$ 00 0@ "400 00 0 =0|0 0 P0 S  Va P RaDЍL\ 0 \0? 0 0 90 0 0 0/a 0@-8@ ٺh0l P 0P3<P<#/G-@$q`0d 00000`PḺ`0d P Z000Pp"SR \ R3#. - - H8   088  H@ꐫd 0`( "4`#/O-$] @ j 0q00j0a@S 0F  `jF` j0 S  0 `@jtjPU- 00jHjjo?0尡Z | Q ! |! BR!!j QOj0S 1S10C1j0S j 0,0000@ q删!!  *P!X& _! ,++:10 0 04 ,P !*!0l 0 4 ( 40  ++!✧bnPAwPAG- MP  p@`T ?r@T Ѝ Z@ʟZ R00 00@@_TP0T00PP} $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X 0 T0 0C S 00   @P eZ? 0 y0P0? P!KpC!0 SH080O@K TY  004005000@@3?0 S0 *?0 "?@?-Q P@ 0P 00T 0,Ѝ@0S   R00   S @P ~Lbp@-@P)h0 ?p@hhG-1MshQa0S 00NWhЍ@T0S_@LhU  PD 00 0?h0  $P ! Q" S R- Z03H0 $0X\ RP(0` R  X000 R 000g 040 0@0HL RP0P R 00 !/ @bdDbdbQp@-@ @Q>\0@$0@0$0ppPg$@gTp\0$00$0$@p@-Q@pP @Qx>@pkgd 0$ 0S (0, 0@@gd 0$ 0S (00, @@p@-p`PLGg@T 0S4` 00S0C040S00  0S00@p@mg@Dbd@- g@0m갋dPA@-T@0S  g00C,`0SFg f@U갋ddA-pM0S S\1 @#P1P!PCh0 4a4!Cf R100 0-T@P gЍ̀`V@0@0P `X0 h00|4000@00S`000pP 4f@PAPA@bdPA3.DbPAd@- $\/p@-@/PP 0SH0U&8`p@$)@3PAA-@P`ptW͍0 A!p@-@P`0 x0 @`Z 0 \0 @0`@P0@ 0<0@@30P ЍpPAcȋdd<:.d@-@31@/ȋdA-P`p@ 6@V0L00唀@0 0L 0h,hd`dPTP (33 0&L 0 ȋddd@bQA7@-P0@P {@T00  Ѝ0@-@p0PS` H`HV 00|03 80 2008o<080S 0S  V 0 / Ѝ@bȋdp@-P@0S  0S p 0 j@QL5\PP aP ]0S0]e'pHddȋd 0`( "4`#/p@-@PKe0Upp@eA-$PU0@$0O1  /e` pv1SoeA賞_]z@-P 0`S4 R13U  @Ѝp $`V@ 0@ 峋@ !00 0C?o2 104A04/@P U 7T0S 0@0 0 0 0U>0- T 0(T@0 0 07T0S  H DR2320   (T @@b0QAJQAO-@Mp|84@P0S0㈇0@0\<`4IW00 Q, 3Q00 3`0 0'00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  ~|Z @H[ @ R20 030000 3SH0L RP \0 0@`00^ P ,00 B R  R@0 00  `!H0GS5040v400 3SH L0SP0\ 0 㟆0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0 m0`@0 <  0CS00S0W00  ;|e\d`dlddehdddtd(QA@-8@P(0, 0(00 , @갍dd7@-P Hec d \@200P.0 800(.0 D@@0Dp Ѝ0谍dLX.0QA@-4,y$0@H=cP(p@갍d0/ᰍd@-@H1c00H@tc갍d@-Q0   0P0"3 \ 0ЍA0C-P4 " @ 0ٚ@P s0  000000) 0Ξ@P t2h"1ẚ@P 00 Z9@  Ƥ1 $R00S 4 `P 101@@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ @P1@010@00@1:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S   000000t C0 R006tp@ሀ@M@b@bdQAO-P`1 @pᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,a0S2b 0! d0    !tT# 000 ꗱ@P481?P 0 R (@- 0@bd@b@b@d`ddddDdQAG-0@@p` !4#Q!PP4 DPX0  0` P00C 'S(0 0  ( PP ᪇`Pp7\ 0R ជHP!S 0 0   PPP0X0P07 0RI06 0R J0X00H0PTЍg0@SK00@?o21P0 [PH PQ PL0\61H0KP<60 S?P IHPP 00 0 0 0C R  APP 0 00C S 0 0  dPPn pP)('&%$Pp  P0 0A0CS!   /PPP9W  W000   PP}P  0 0 0C R  PP 040 0D05갃0 SP PQn 1"PA00 R0$P@ 0H 0#0000040p(00c?@ 0R 00PP 000CS0 0   PP 0QUP x= 1 0 00CS0 0   PP8P  P nQP0@0P0000 000CS0 0   iPP s0Q P \ 000C S    JPPU `PQ|PU 1wP P@ R p oW` 001d0pP 0$ S0(0S00P0 0P0XdTdxd VApdtdQAQAQAQA0@- uQAC-PsP0T 0 P0T ^@T4_|^0S 3/PP\*_U P3@ ЍC 0S  0 P4 P 00 0P@0Y00 - 8`hX21<1œ22=<0P PXh 0  l (0Rd"4U 0 0 0(0$ S8" 10 1, 21 R <0L`R0Ca0`a``( R 0dSd0(0$`V !0000S8 R40C BS0( R)0  0&R 0 SP 00@1004 0  08/P Pp00#P00S 0004h0 0 0 0(0 0dSd0(0d00 SfXPh  P `P[XP HXPPP@H [  P0@ V`!V  0 0       B @```HR000/ B\0H/O-`@pP0MPPEY  0 BR`AЍ0SF0SC Y [0 R& 00 B I`V1 PU [ 00P 0  Ϭ@KPE   00C0U0000ЍOHO-P0p` 3SH0L RP@\0@ @U$@0 00 ЍL0 0@DT@DT000 0PE`00C~U@m~0H0\0000[@ 00C0 R000UE!  0  00PE`M 00SЍ/p@- @d0@T0P;[ 0S PP@0$0( T0w[Up0p@ Hdp@-P @T0[H0SH@@T0^[Tpp@L0Q/p@-@`T0[(PPE(PT0I[Upp@0RAG- 0 p$@: @T6 W` r@"\/XQ@EDA@T0ZW@T SR @ l00P 0S , 0$0,(00(0@TT0[RAHdO-M@0P0D0 0000 0dB 0SX0 H0Sp`000 0 0@T0ZT ,0  SR$0H SR 1T (00CS(001@pT 1XV T0Z0!0(00`08@` H$Q,@Q@$ 0 e 00QA000(00@0(0(00(0T0mZV ЍHQH RAIp@-0@`8888 0SpT0PY0#100#0$0 $`V U@` HP H`T0p@+Z ,  , 0S@-@ _P 0 S % 000 0800$<00 $0,1}S00p}?  $ ( 4 "3@0 D0@ Y1 .PHdLd@dbMbHdDd@-T@ LP 00CS0<(Y PHdLdDdp@-P0 @0\R B@ CUp0% 3SH L0SP0\ 0|0P00 P Up@AT 0 S00<  0CS 00  p@-P@O L IP0 H2!0< 0?,R:,7(41. *$0#0#0(,00$4 88<@@HDP HX L`PpT @1R10(,0P0#01P0S 04 $ (8,@p 0B`0H4Pp `0B`8X<`0s 0 ?@c@p@0pRAAMbG-@P 0Q`pL ' P 3SHL0SP0\0 0{0 @0 <0CS00S000800@P 3SH0LQP\0 {0 @0 ̄00LW\\0XX00400HdO-,p@0Q0P`( / R 3SH L0SP0\ 0 z0@0 <  0CS00S 00018000 @(ЍOdR 3SH0L RP\0 z0@0 ̄0 0L\\ 000P0400,(H PX`HdP P /0 R0@o/0S@-0 zoG-@`pPhM㘀~_ @ @P& ~04 a 4 a bb 0&P~3 08 0"*0EXW191W~hЍ\.p@-04 $   4 pP@^@^ñ@- 4@R 0P@- 4 @$R 0P@- 4 !4@T  R!A-@4PU@` PpTpPp!@T`PPU@- 4 "(,4 @$R""R 0(,A-@4(P,U @$` PpTp $Pp"@T`PPU0P  H R L01x0 R R// /bQ 00/RA@-(@D0SDP @xHddO-0P (yppW`5y000 3SHL0SP0\0x0@0 W (y< 0CS00S@ 00 L0P   8 04% "Z Z   #RHL RP \ x0@0  #RHL RP \  , BR xU@0@0   } EQPE X    #R"HL RP \  B/o"R  #RH LQP\  ,5xfZ_x @  K Z 1 4 40 0 40 JZPGUX0 R PPM, BR  RM<0 S<0  00 #8 M8[808 000CS  R 00@0(p0D0p0 0H0(p@ Ѝ0, 3SH L0S P0\ 0  0C?o2S wf[PwP@0 3SH0L RPP\0PP 0  <\0 0PE[ P1  <[0K00<00<0HdRA@TA@-@V0 (0AoR{00Ѝ 0`( "4`#/d0SI /-//s@-`P80Q30 : @0@(LЍpG-w@ {T181T ` %PPWPP PP W XT181T1p 01>PPW4zZ{8T  o v z0  ebVAp@-@0` P@PP pC-MHoP`p㨂 h@PЍP  ``PP꤁.O- QDM` @p ,0  0,@(p$` `` `<"S/$ 0'   0  <4,@(p` ` P P0  0<40@,@(p$` ` `DЍVAd.A-0MP0`0 0p` @$0 P 00 0000@ř?o2P0SЍ@bp@-M\  LP00  L?\@ R` 0`@P  0T@@) _@P `Ѝp@-t-10 0S0! 40 dܬd@-)@P P /%PbO-$DM00p@00D $0e8 P``8`# #RH LQ\P AVL0S0P0\ 0  0CS]uVڠj , BVOL $8#`P yC800008$00$000$0$000Fa aF1(LW0(04000 0 `P a4( <000CS0(0 ,  PP,  0Ty`DЍP 0 0<^PPV 04 (P0 00C/S00(0 , 0 rPP,P t0 PS!t tPXXt p0 PS!pPppQ00 S Qppx0 PS!?0x0S Y ?0Spxp 0 Isp p P0r05q5Q0ao0a 101VꐫdVAO-6LM$3@ 0080 0p圀0 |W 1 0 %W000 D ,0) WP@ 8Q```# #RLH LQ\P AQL0S0P0\ 0  0CSbvtVC+ , BVTL ,@`P0080000<0  0 `P aWq 0<0 D0000CS000W 4  wPP4 N 8,x`iLЍ@0000@,00,000,0000Fa aF1(LQ #RH L0SP0\ 0 t@ 0   @, <  0CS00S0 ,  0 ,0yP 0 0DPPV 80S 0S H8w< W00 0 4 0CR0000 4 PP400'R 0<W0N 0=P:?;;0P4;T0P.p +_[[PpT[tPp?;;0 4;PUĠt (P,pP  0 0$P4P0 P$ 0$80 (ލ@b@d`ddddbgfffWA0WAO-34M`0PSp` >v 4ЍzC0ᬰ00@ᰱ嘠1 v jO00 00o?0v?00 1@"P0 0 S>C2 |2ѷ 0<0:t0p0x00008|0l 0 0X 00Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 0?PK0 TP E!` 0  0Sp   0 E P0S00000C\0 Pp0p  A  P ~ uN ovzvgu(@b7WA>WAEWALWAdbPbSWAG-PR M 0GS p`0 V Q 40p }@P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@p VS  7<$(, 0 00@SD@HD ]|@P6Z>DY `0 ᅁ@P)Z `]Z.DY 0Du@PZ `M000鋖@P 000 s@ *D(D &D@@@bA-1Ms1P@˝<P0< !0 0姟BP_@P BЍ0( A(0 !    p@PE  V0p0X0 0(0"@P( 0( $FJlt?`d0@`TS!(pW (@bdYWAPbWAdWA 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P O 0 P E 0 0# KPp 0&p p@bG-p0M0`0@8 ;87PPi "\D00D0 D 0f U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSRoU3h, BUDL (!PP00$ 0 0 0 013 PP Q 00 0,,PPK vs0Ѝ(0000(000000#000EQ QE1(L3Q #RH L0SP0\ 0 Ro( 0   ( <  0CS00S0   0 0,00S00  R,0 UꐫdXA@bO-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C SynZH AZkL ,<P@P rP<0000<,00, 00 0,0r000J! !B1(L<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS nT<0000<,00,000,00DA AD*00010(L;TP QH L0SP0\ 0 Zn< 0   <, <  0CS00S0 ,  L 0 ,0 <0 D #RHL RP \ ;,n< 0   <, 8, BTL ,<@PDY2Pr?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<J@P@004000080 0 4@P AU 080 X0000CS000( (  PP(  4q@P, B[ ,@  0,0?0 0K1 1C! O2P 0 0 XPPX0 080 P000CS (  `P(  4Sq@000(2 0R$78 00 00CS000 (   y`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  @`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X H(P 4pP0%'TZꐫdXA|dO-0pdM00 ,0`0SPdЍlV$HH&圀t00t0 $0   , V@8u 8QPPP# #RuHL R \P   BUL0S0\ P00  0CSPylU`., BUBL $8PP \p`800008$00$000$0 000EQ QE1(L0SI,0@ HN@PH` V  LSP8&lH@$0:d 00 D0@TuD0T`0H`SW <0 000CS000 4  @@P4 xP 0 0H@PH`k<HP0 000CS000 4  @P4 UP 0 0H@PHPH0+S[u  p0 D0-@P0@ H@PH` +U V@@TTꐫdXA@b@-0S00 Ѝs@-P0S`@P   0Ѝp@-@<0 xD 00CS 0@DL e@-@08 <6&0@ 001/A0e@-@08<70@ 001/A0e@-@08 <60@ 001/A$e@-@08<70@ 001/A$ep@-@PUD0 ,p@DA-`p P@P!@ 0;@P0  Nl030000 @P X 7Ѝ0 ʥ@bO-@M0SjP{{Xf 00 `00S00 0POP * 90 0 S(!0000S 0  0 Ѝ0S. 0 00R0S @ D0S 0  0000`[ V:0N000@000`0 0 000ꐫdR>XA@-@8 0 , @P0XA0 X'7@-P@0LP! " 0S, ,00 13/ Ѝ0AXAA$eeXA@-@0S N@`C-`M @[P- 00 0SS S p$0 S2 I00>00 P 0   0@!ЍO-p0PDM,sr`l90V0< 4%P00P0H $0O8 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CSeTHhT0 P@ X@ @T@ T0S@DЍR 0, BTQL $8@P2 bi TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L 80 3SH L0SP0\ 0 *e800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013i@P A4( <000CS0(0 ,  `P,  0h@fRSP 0 0<`P<T 0hTN0K 00G 0S S@A4( 000CS0(0 ,  `P, L @DЍOsS@ 곑 0@0T ꐫdXA@bp@-`P@M8  ;8\P00 I  08 H@   0 013/Ѝp(A0e@-p`@M8 %    #P00  0H X@ u 0 013/Ѝ(A$e 0/ R !0!@3 #Q1#1@281Q1#1@241q#@2q#@Q@/G- `08MP0 0C, S0, 0 @8Ѝ 0R@ #p000D (0W8 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CS]cT\, BTOL ($@P g$0000$(00(000(09000DA AD1(LI <2, 3   !  @P A , 4000CS0,0 0  PP0  Dg@hP 0 04PPPT  , 000CS0,0 0  dPP0 00CS0 0  0 0C?o20 0R 1 ^E?P? 0H03!@P 0 8ЍGTMWAdXA@bWA|dp@-@ `(MP0b 0 0$00 000 PF@P A f(ЍpO-dM000/H0p0H0 <D ` $04 X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSMbU6, BU?L $4PP dfX400004$00$000$0000EQ QE1(L#4$^0q  R[ 3SH L0SP0\ 0R>b400004$0PQ #RH L0SP0\ 0 %b4 0   4$ <  0CS00S0 $  L 0 $040 3SH L0SP0\ 0a400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05a400004$03R 3SH L0SP0\ 0 a400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 240q u R> 3SH L0SP0\ 05ga400004$03R 3SH L0SP0\ 0 Pa400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05a400004$03R 3SH L0SP0\ 0 `400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,v(s80 ^0P3l:0S#S$Pe PPe">؀(,x1 3PP!  0)E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 rPPЍP@bO-00$`pT0DM|0T0 D $0  WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_Y]T@ڔ, BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  [PP, L 0a@DЍ800008$00$000$0000DA AD1(L̽Q #RH L0SP0\ 0 \8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0`4( 000CS0(0 ,  @P, \ P 0`?@R 0 @P@T4( 000CS0(0 ,  @P, 2 P 0n`H@\WAT!ꐫdXA@bO-0 0p0/PTM:0`<0 0SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSN\U , BU@L 4HPP! _ TЍH0000H400400040000EQ QE1(L宼H0A 3SH L0SP0\ 08[H0000H403Q #RH L0SP0\ 0 [H 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0<0PS5 630!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @E_PM,P< P 0 0D0LK@PLU@4D8 000CS080 < 8 D_@P< D8 000CS080 < 8 DG@P< p0@P@^HP0 0D0L@PLP 80DP @^ P@^ 0K0 00S Oo0BS@T@$0TPUꐫdXA@bO-M<00`D  T uP0 @0/P:0 <(0007>00(0`SX040H00L0M0$`40 P 0S`Vڨ+tPH\00\0 0SP1<0,PS    T0(0 pSd 0Q8```$ #RHL R P \  BRH L0S0P0\ 0  0CShNZV/ژ , BVZ TdL `P: 0^ 4R<0S p700C00S{ʐ7b7D0$ V 00Ѝd0000dT00T000T00Fa aF00010(Lкd0\ 3SH L0SP0\ 0SYd0000dT0QQ #RH L0SP0\ 0 Yd 0   dT <  0CS00S0 T  0T00 L刺d0 3SH L0SP0\ 0Yd0000dT0<  0CS00S0T00 0T0C@=D0`8` <0S~ `zY HL D`P   T\P$ A# d X`P0 0C0000 00C00 0 060006  d B 00X0 0`00\000 00`63`P a(0Sp `X p000CS0X0- h X `ZP$ \] `<  0CS00Sb0T000T0 } T0d`P h L5 0RK` X0 0 0CS0X0 h X `Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh >P0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP VV` X0 00CS0X0 h X `pP \A\`P0%'hUP\1\`U0PE 000,0C0 0000 0S/0 000$0pS SPpp U5Q> 0PݸQ 5$p[ P0hH0\[V 0, X0C 040040_ 0 LP0$0, ?oU20SS 0 E000 0C0000000 0S 0 59$0 0P  0╸$0SYQ0X 0`(0‐PP \[`wꀐ(H|`VbgXAXAdXAT.@b|dO-dM000&@`p0圐l0p0$ H pp  $0 8@ VP4n 8P  " QHLP\P@@ @D[L0S0P0\00C SJ[W[ A[<L $4@P >[`400004$00$ 00 0$0000K! !B1(LZD[`?@ V8080800S0T0S@dЍP QH L0SP0\ 0 W4 0   4$ <  0CS00S0 $  0 $04p0i 3SH L0S0\P00 0CW_L0S0P0\ 0  0CS VWe400004$00$000 $0e000Gq qG 1u800,000(00  0 @P KAV 0( `000CS0(0  PP  ,oZ@. < 0CW 0 $4@P 2 0R p50 (0 00CS0(0   PP pP TpXP@Dp'SR0000HS#SR8ppGor0( <000CS0(0  SPP `P 0 0<PP<YP 0SW P00PX0?o2P @?P ,YP0%'Wv[ꐫdXA|d0@-00 : ЍO-p0@0lM$ `H  x00x0000000 00 @@  ,0>[P<{ 8P  # QHLPP@\@@DZHL0S0P0\00C SVUZ @ AZHL ,<@P nY `<0000<,00, 00 0,0000J! !B1(L+WOMY `?@ [808 8080V0@00S0T0S@lЍP QH L0SP0\ 0 &U< 0   <, <  0CS00S0 ,  0 ,00<@0 3SgH L0S0P0\ 0  0CT}H L0S0P0\ 0  0CS TTW<0000<,00,000,0000DA AD $1痵< [ P8@@@N QHLQP\ATDHL0S0P0\00CS TT <0000<,00,000,00DA AD;00010(LL < 0CT0$ ,<@P ATL ,<@P0S 0<@0 3SH L0S0\P00 0CSL0S0P0\ 0  0CS 7TT<0000<,00,000,0000DA AD 1@0000 08004000 00兾@P A[g 80 p000CS000G ( 0 80PP( > `4W@P QHL0SP0\0 S<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<2@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(H`X\` C`@L`HP;P'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( lP 00 08DdPP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8hPP(  4W@`P0%'0000 R p58 00 00CS000 ( 0 8?PP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8PP( |`P 00 08DPPDZP 0SW P00PX0?o2X HP 4VMP0%' `TT1T ZꐫdXA|d@-4 0Ü   Ѝ@bO-p0\M0 0@ 0 00圐$<S0  D0 00,0*0 00, <00 `SPu 8QPPP+ #RH LQ\P AU!L0S0P0\ 0  0CSP5RU  0 x0?R*`b, BU:L <PPP VP0000P<00<000<0000EQ QE1(LϲP0[ 3SH L0SP0\ 0RQP0000P<0PQ #RH L0SP0\ 0 QP 0   P< <  0CS00S0 <  L 0 <0刲P0o 3SH L0SP0\ 0fQP0000P<0d<  0CS00S <0    <                0@x-00L00H0000  06 3PP Q0SZ L@ 00$0CST0@0" D  L`P H?UP\Ѝ<  0CS00S0<000<0D P 0 0LT6`PT0$0UHL@ 000CS0@0 D @ LI`PD 0000L@ 000CS0@0 D @ L0`PD `PFPL@ 000CS0@0 D @ LPD  Z#3PHT[0k +0 08#800C0 0C00 00 0 0C0V` !8888YL @0 0 0CR S 0@0 D @ L`P?D=:(70@S`HrTHP1S0@0 D @ L`P D(,kX04 Ɯ04 0000C000000C0  A0XN0 [p(00`Ḁ 00 L 0C00 00 0 0C0 @0=P HT PH`0 H ᇜ0 0C0000 00C0L @0 0 0CR. S 0@0 D @ L6P HSPL @0 0 0C R@@L`P`DV$ 01  S0@0 D @ LPDV w  000S kUꐫdXA@bO-0M0@00`p$ h,00+000\ 00 8 PPDP+ #RH LQ\P AU!L0S0P0\ 0  0CSYpOU" %0 x0?R*, BUCL 0DPP$ KS,P Y ZЍD0000D000000000000EQ QE1(LD0 3SH L0SP0\ 0 !OD0000D00 <  0CS00S00 00!0000 400 0 0@000 000000 00x0p00<00$0 08 3TPP Q@4 L000CS040 8  P <RPi8 qP 0 0LĿPLU<W@4 000C S 040 8  P8 0000GPGP@ 40 00CS040 8 4 @P8) [#3P<bR 0Sc0 Κ0 08#800C0 0C00 00 0 0C0X !8888@4 000C S 040 8 4 @oPm8 0 00@S<RHP0,cX0 儚0 0000C000000C0  A000XV0 ` 0 000 S0Ḁ00  0C00@ 00 0 0C0 40P <Q P0 H H =0 0C0000 00C0 0000@4 000C S 040 8 4 @P <Q PR@ 40 0 0C R0404@P8 X 01 00C;@ 4P0 00C SST040 8 4T @P8T ;@4 000CS040 8 4 @P8 PQ @4 000CS040 8 4 @}P8 0@?S@ 40 0 0C R 4  8@4aPG88 S> L:P8 ;,Hp0 ,⫼X H0,P0 11x C60 0hd,P YM 0,0@ 40 00CS040 8 4 @"P78M<0 H0FPH0T0,0S040 8 4 @P8w P@4 0 00CR4ղ4@P [UIꐫdXA@bAO-00p L0DM✠0L0<$ H 00$0 P 0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS9^LTڜ, BT+L $8@P AP800008$00$000$0000DA AD1(LW4#P?@Pl0SQ #RH L0SP0\ 0 L8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS KTv800008$00$000$0y000DA AD 1牬p00(40  h0p $@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  0}O < 0CT0 $8@P )*0@?S`0eOH@Pl00S=T 0l 08 U6 X3 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0? 0 L`p 0 @P  00!ODЍ 0@QL% 0 L  L 0h`L0 0 0  0-@lЍ, BT3L 0@@P :N@0000@000000000000DA AD1(L0S;N?@` V8080Q #RH L0SP0\ 0 J@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@S@P@V0  R- 3SH L0SP0\ 0$I@0000@00"  @Q00@00000^0A A1 o<  0CS00S00K000 00;?@0q E R 3SH L0SP0\ 0 tI@0000@00 <  0CS00S0000000:00 @0> 3SH L0SP0\ 05EI@0000@003R 3SH L0SP0\ 0 .I@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 H@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 H@0000@00 <  0CS00S00 00000008<@tz uTZ@0  \ #RHL RP \ H@ 0   @0 , B R  R 0  000408(@%HL@tz ~uTZ@0  \ #R HL RP\ A Q NH@ 0 @ 00  00040HP00CS@0 3SH L0SP0\ 0$H@0000@00\ #RHL RP \  H@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 G@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ G@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 G@0000@00 <  0CS00S00 00000001<  0CS00S900000002  0#0<00480 00 0|2 3己@P `AV <4 000CS040Y ,  <a@P, P 8R 3SH L0SP0\ 0 G@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  <@P, k0@?SP8JH@ꐫdXAddRAAMb@b|dP < 40 0 0C R 4  ,< @P,e00 H0@P]H0VT6 <4 000CS040 ,  <@P,  8[J`Y> X;[PP <4 000CSST 4 T <L@P[UPP% 0 0<XXI@PXV <4 `000CS040 ,  <]PP,  8J@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < +PP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  <PP, f`P" 0 0<D⹶PPDp[P 0S 0S P00PX0 P?o2X HڶP 8IT# i$0 )[P0%'T+p@- P`0 PP@0 [p0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSSET0$00, BT@L L`j@P H`0000`L00L000L0000DA AD1(L垥0SHH?@80VT00S $0S S V@0S ᰾T0 夃Q #RH L0SP0\ 0 D` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$WD`0000`L0"  @Q0L@000L00A A1 <  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 D`0000`L0 <  0CS00S0L@000L0zx00P0 0\00X000 0:3\@P A 0S \P 000CS0P0f T P \@PT ] X$x`0q E R 3SH L0SP0\ 0 C`0000`L0 <  0CS00S0L000L0T900E`0? 3SH L0SP0\ 06~C`0000`L04R 3SH L0SP0\ 0 gC`0000`L0 <  0CS00S0L 000L0,800<  0CS00S0L 000L0700`0 3SH L0SP0\ 0 'C`0000`L0 <  0CS00S0L 000L0,700`0 3SH L0SP0\ 0 B`0000`L0 <  0CS00S0L 000L0|6008p<@tw oTW`0 S \ #RHL RP \ B` 0   `L , B R  R L  0L0408]@ZHpL@tw oTW`0  \l #RHL RP \ cB` 0   `L `\ #RHL RP \ qB` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 DB`0000`L0 <  0CS00S0L 000L000, B R  R L  0L040HP\ #RHL RP \ B` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 A`0000`L0 <  0CS00S0L 000L000R 3SH L0SP0\ 0 A`0000`L0 <  0CS00S0L 00 0L0 81R01? 10000 086@p ,C`-H*P0s0{ ,?@c t\P PP000C S0P0 T P \@PT 0@?Sp`PX &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\dEPPsdY`40SZ00S P00`X00(pp?o2x hcPp ( <0R0(0XDTA80$ R00S x@m#sr8$srH(5 3 )@P/09 ,0 @0  808(0S0ЍP0%' ~TO-@ 0lM/00p0@@P0\@h00h0.   U (0 L0  <  (0" U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CYp?Y@%, B RL (<@P SCP`!<0000<(00( 00 0(0000I I 1(L00SKP0C`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0  ?< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< X@PyU <K0q ` R/ 3SH L0SP0\ 0&><0000<(0$  @Q0(@000(00A A\010 n<  0CS00S0(000(0:00><0> 3SH L0SP0\ 05w><0000<(03R 3SH L0SP0\ 0 `><0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 "><0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0 =<0000<(0 <  0CS00S0( 000(0008<@ty jTY<0 S \ #RHL RP \ =< 0   <( , B R  R (  0(0408Z@WHL@ty jTY<0  \l #RHL RP \ c=< 0   <( `\ #RHL RP \ n=< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 A=<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<s@PU<0 3SH L0SP0\ 0{<<0000<(0y\ #RHL RP \ << 0   <( , BR (  0(040<0 3SH L0SP0\ 0 <<0000<(0 <  0CS00S0( 000(000v AR( ( +0 0 0C11C!0 9t<  0CS00Sz0(" 00 0(00 1000 08@p 1B`HP0s0 !?@c@004000,8 0 0D13圦@Pp UAn T`8, 000CS0,0 0  E@P0  4?`"PPK 8, 000CS0,0 0  (@P0 0@?Sp 4?`H@PꐫdXAdAdMb|d@b8 ,0 0 0C R ,  0 @P0``H0 &@PH0T` 4?`8, 000CS0,0 0  ۻ@P0 OU P-@8, P000CS0,0* 0  ΆpP0 ! 4s?@P 8, 000CSST , T  p@P 0 0XX`q@PX` 1 0R88 ,0 00CS0,0 0   セpP0X\ `LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  DpP0 PP 0 0D pPy 0DSp $0SX P00pX0?o2X H/P 4>P0%'@ 0  y0X0X00,4 3 00 0@PX0T`00@`aT ᪴U`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00   U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;Z:Zh, BZ-L 0HȻ@P =>Pp H0000H0000 00 000000J J 1(L0S3P>p?@`]Q #RH L0SP0\ 0 :H 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS 9XtH0000H000000000s000H H10 傚HU0 | KqU R$ 3SH L0SP0\ 09H0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00#H0> 3SH L0SP0\ 05\9H0000H003R 3SH L0SP0\ 0 E9H0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0 9H0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 8H0000H00 <  0CS00S00 00000008<@tx eTXH0 P \K #R HL RP\ A Q 8H 0 H 00  000408E@BHL@tx) eTXH0  \o #RHL RP \ fq8H 0   H0 c \ #RHL RP \ V8H 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 )8H0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043]@P AU( D4 000CS040 8  @P8  @;`pP U8080<00S0T0SpV ᤱ,003 3 00 0@P,0T`0K?o 2R0S@  t 00@`2\ #RHL RP \ y7H 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 L7H0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 "7H0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  @P8  @:|0@?Sp`@:H@ꐫdXAd@bAdMb|dp `D 40 0 0C R 4  8 ۶@P8 @:00 P0@PP0UT`2 D4 000CS040 8  ᶶ@P8  @k:p`#WP D4 000CSST 4 T  `@PWX 0 0```_@P``@U D4 P000CS040 8  rP8  @':@jp`02 0R $4D 40 00CS040 8   NP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 DP8 PP 04 0DLߦPLZ㜀 $0SY P00X0?o2` PP @9P0%'T V [ ៯tЍ ᮯXZLO-p M0`t0 00SE$㊱@hA᦯3 1 H`PI 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0*VPP PU 003 00 0H@Ѝ000zS0P=e$/XA@bXA{AG-P `MpPL0S@ P 0t003 ՕP@( 0U&2ЍH0S0 RP@5P @ )P0SH0S300 10 CS 8:8XA@bG-`@0 S_Tp  SXᜭPڜ0H0S0S 0 Pᖮ@1 3 00000 00 0 P olUU0S 00   msT 0S 0csTxT ` rpЍ0 PP@bO-0pdMA@dЍ%`000D $08 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CS4T, BTzL $8@P 7800008$00$000$0000DA AD1(L峔80V 3S HL0SP \0  B R 3800 80$ $ 00 0 $0t qn0(0400 00 00!@P ]A4( 地000CS0(0 ,  γPP,  07@B0,2 0R `54 (0 00CS0(0 ,   㨳PP,`P T`XP@D`'SR0000HS#VU8``Foob4( 40)l"0<  Px0q -^\%<3R=S$^0#S\$0( 嵏0 $0 (7} RP$0 00 S21 00S  0IB˱ Q!^P  y^P P<@@ 00 PE000 ;} cP_oQeP?$00P40S 00 !}4000P0x RH0x0 T3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#3202 4P Rg0Pg0$0<Ѝ(0 (0 0g0P tf4P of TU T]A@-003!z?` 0 Ѝ@b ^A0@-qPM:Ѝ0@@'80@ 3P@z?00`0 Ѝ0@b+^AC-M8`0@XP:@DŔ  8TAVp pϬQ @$ @T@ `8Ĕ< R d(P`ЍR^A^AO-,M 0%!@ 0{PP``\\%1R=S\ `1R\0 嵟 {p1>0S100! 0 $y=$SV 01000W 00p50 00Tp 4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍO TU ^A^AO-00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP [(1b  $  \H000$ LqH0H0 , ]H0 00S  00S  _00R<0D@$0C!d 0 p$ 40`R0A|00S p B006@4"W,#0S HZ_A_A<`A/TU Tb`A`AO-p`0P4M 0 ?p0@00 !0\%0$01R 00@ ``&!! X0 00HP@? j4*!, ZS QS:]P ,l 00\ Ó\ bZ4Ѝ $0 R  X   !,ZT3aAU O-P0@Ḡ $MMp0\ `#,^ 00 0T ? A)A<)a>21,, X :@ 0@P⪹}]P h 00Q Q Z $ЍH  0 0 PwZT@aAU O-PḰ@ 0$Mo0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X :@ 0@P@J ]P h 00Q Q Y $ЍH  0 0 PZTpaAU C-`PḀ@p 0Mo 0\Žß0.S\! 00 Q    ` a 00T40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P SY40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00[P0d0(T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Mp0$0101 0 "p `@ H0PP0805@U50P%P0L05P000T40 `001 0 0%p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0DP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0-PP <0 B2 b061")(!\''0001S 1' W X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(zZ8U8U@e8 L0PP`P`U1S 00P000T \% 0 R qq p0@01 0 0@9p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000T0 p001 0 0 p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0&l0000 0($P(l00Cl00 01 0g00T1 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPdVPP0 0ap0T000400`0  0 F Ϭ 0f2faUd000 00 00  00Pd0+ MUpG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( PdbT^T< 0(bd0000000%FWP pH0p`d10 `U040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( ߍ0p !0001S P 1 sT X0P 0 PB2 b50>" pPG Q0 :1S1 !< Q8U@e8 L0PP`P`U00T\%0 R qq(0@01 0 0@Sp0$01 01 01 0` 0Pp@=P0p Q0@558 50P%P0L05P000Tg0 (001 0 0&p00101 0 0PnP1S 01Pp 0 0T0 C)C)ct00<21 ( 0 l0000 0(H!Pl00Cl00 01Sb00T!1 P  0 p001 P@000 0 0 H'PPx0d000 000p`0T0x` C)C)ct02160" *(t PPdSPP0 0a0T00|0400`8P<0d000000(0!(VPPd00L0L 0ql0< R 0P00 Rx0PT40@HqP dR80slpJx`40V:[ h04Ch000T1P Pl0R 0 L0P 00 0 0X@H@0H 00 (0 0K@Hp001 P 000 0@00H00 0PPp4ph0400 0000T0 C)C)ct0201<" (" PP4 d6R4ph4RPP480< s0L <001d R<04p80P0`XR10J`Pu00T)L0 010l02H0 0 0p001 01 0000 0,PPV4 ppt0p!R  !  0  T B)B1) b072  0(u PP400407l0 2H0L qPRQ1S !00h  0 0('UPP  0T0() C C")0c7#10 0 B d 000"00  ( 2 PHd0p ἐ?00T0 `C0)0c VQQ? Qg/" \5 S 0?!>0  0 F Ϭ 0f2fRd000 00 00  0 Pd0) RpG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( Pd"QQ8 0(bd0000000%F~TPd0H 00dQ|040n 000?Z00cTO-@PGxp(,`PT: [0 S0S ҁPZ@V 0000000@@000@ @O-需TMpP%0S,@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0f$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0{_o@RTP$PU000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUP0PPPh;8%P@5PL0P@b@bAO-p|M00-P `G븰[ 000KP|Ѝ0 00\@000S/ :0 80P0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P OU P n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ RPU@7 KO0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @HR( LP@% 0@D TTw 0,0 X zPU@mOV 0080\0000!Pi@b0   R  R*. R᜜@-taA000S -/0   R Q   -//@-P`00S-@! < @P@P 0@0 0 P]@ 0S R z@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 ɝ@P 0ST 0S@Pu@PL u0pI@p p G ppb x뼰0@0 0  Cp 00 @W  A Kx@K0P L" l1. Q*S  S0 S 0 S00@$Ѝ 0p@ 0 Zu pVu x Pu  :d  `y@P   z  d弰帀   @-@@A-P@00S= 00CS9< PP0Sk@p?oV20#S 00W: 0R R 0000@0` R x@@-A-P`00SE 00SC 00A0 Μ@P 0S 0S@Ѝx@Pvp x뼀 0@0 0 Wp ]@ @ A HwHpr ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$ c8H\0`0P00 00 P (0P6\0 44#T20T20$ ;60 0Rڼ|t ?0:# 4080$0H0(#00僣\K@P\坋@P \LdЍ\0000S00$00?@D0@0S@@T @ 0冒\00 0Ow800t RY\[M0 @0S 00004L0?tPP0(0`E 0/#\00000,< 1P(080< SH007D0 R00S 00S`0 1`0 0 400$0C0 0gb T0 C)Cba)0c9c00, `Pg  R !00 R(  ) 080S03 S300S P" 00 00y00S01 0( A0L 0 0P 0 ,0 0,000 000<0`V0<0(00C(0~S 0 00T0C00 T0 C)C) c0<;2 , 00PPT 0U0T0S 0S P0 嬑_o$0R_P@0S \LUS@baA@-`Pp!0MV @ ps0 W p0 P  $0 Q D 0  0V `0 P ( ,0 Q @ @0D 0 @0D 0  U P0 P 0 40 Q$ H 0, 00:00Ѝ    O-`0Mpp@P0 s00Su 0@ 00@`p\%1R,5S0 0 0 0a0 o."\哞T1`Z 0 ?  Ϡ ,2 0 `x 0a`0 C c00T0 ` C)Cba0)0c"03YNP0000x 0`0`\0\%R ,uW KЍ0 MK TTO-]M 0 0$0@ C0CSR ]ߍ0S1  ;100P`S00hp(0\5pSG\\D@5D0L 04;(pW(SØ,31  0 $00R 0x0$P :(pSWl00$ S(p` 0)PY 0000 0 @e8$\ Q?00 \0 N&/ 0N& 0 0 0 0Pm  P P 8ŕ0 @L $QgY~!0$800 <00 PS 00Q0S:0  y1 $0加S 00kP0$ c2# S,P!Q  RQIp S1Q\Q\3PR= $08u< p 0 H0pß $0YW/  010$0  W 00 $ 0P 10$ 0X #H0P$ p  ~p. ? 0̓0 S100 0P 0wR Բ0 000 0R    0t00 0/SP0 c0 SRQR3000Z,00004000 ZP t0T RX  R?&4D00\h p BW, W pq0S*0p ,Y ! !X4@X Y   !0 C 0[00 0 0pQt1(( R@ 0pPi1XXϠ R$0 0 0p0 0R$       0 0000k0P0[0 S0&t 0( 0Sp0 0St0Sx0|\% 0R  P ! P01@ # 0@0H  p 0T0 C)C )0c8Ì"h0 /0P(0@0S" 00 0 00 0S(0 01H0DL0H0LpW* p,0S40 0,04 rs \%5R,00 0!!0 ,0 S400 P00 L ᜐ pl̠: S?:0p000000S00000 00,0 S400 P00 A1ᜐ a8:<P0%:00S.y8%$"6600Q 00Si 0_P 0 b R320 QP1Q SQ ☐ pBᜠ b<  YS:0 B z'z b~3p2z0W p11$0 唓S 0  0H0$p5 5C20000 0G0070 p 0~pY 0X%0'00 0ᑞP 0 S100 0P 8@ŕ L     1ptpt1p@0S(0#S [ 0(0$ 0Z$0(80 0<080 H0<00 0R8   < < L   0 Rh  Bh    R  Ᏸ000_\%P0R !0 !08 P L@ l0 ^85@50%00L508Q Q0(0A0 0S 0 01H0L0H0LpW8up@5pL0p85@00L0TbA.bASbApGWl8Q Q0(0 TS1 p?H0L0H0LPp@-@00Px \00S /q0 ) ) d l p t00p,q0 ) ) X P  0@-($@0P `IP @ tv,08`<@S 0$ 0\ 0 <0S@@P 8F00ЍpG-8`pPP8 ^ U A 8YY L @ሀbAeAdA0` RP/! 0 P  C1  1 @- xdbAtbA0` xRo/ 10#/C!000P/ @-AThbAbA0` |R  /  /C! C!/! !/ @-,A/lbAbA0` |R  /  /C! C!/! !/ @-9A pbAbA$Ő\/RO-ࠡ@lPapPGSh$eppX!W@@đ@@ T'B^!B ɑP%P@DpNU"N  R Q^PQ! B!T!0B1$5S P#1 [ @  R PE  R0Cp@-0@ PR00^48<00Vpl0 0\V➢p DV◢  4V⒢0Q000p4eA eAeeAeAP@- P `SP PPOL0P@p SP0P db%0fAd2fA B @-00@农T/@-JM/4eA 0O-A`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPpk p$`W0@: ,0W0:F,Ѝ\0Q.0V 08T @)@)`"30DPd 00\ Ó\ @x@0哸+0[0: 0 TU p0Sp/p@-@PM 00@0@ @@@y|`0 0@0@ @@@kP0 @@ @@@P ^ Ѝp@bgAd8 p00CSp0/@- @ әљ@Ιbd@-0 R  @ @0b ` 0jЍЀ-M yPhioЍgAO-0,M H P00Ȉ0 bptW X~@?n /h+p+ 0 $+4FCP ᯅ  0xj % ! % ?\%0R004\5 P  ᖅ ,Ѝtl4RR  ህh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T34j  e000j0P0<(%0 0R@0@0 0T`0$S> ) %> 1S 0DV<3<30P4T$0X4S E>0X4'40`ANL V$5S0P=$#[x $K[`P ]PP/  80HL0S40pH0pՓT0 C)C)0c"03xBPP  0i  >80`$%!0, R0 a0P T:꜀ \Tἠ_<#| YP  0 ?<#Ή p 0Px 0T`0 C c00T0P C)CRQ 0)0c03"BPP {P$Z"   >kcgA8 TTgAgAgA0O-0400y0 4  Y?0 0* $?A@P40dɿ00\%R*   D&\%\%<R)h Q)8I 0 6VBQ @40 0h 51 5 0P R   %Rh ?>0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 S=0400P008T0<P C)C44)0c03"'A0P440$ R:=4 5Ҡ  0 Z00C?o200004圀A;M$%,0R00iL0Y]$5S0Pň, HS4\S944S@040T3 0P1K[110 1<(%0 0R@0@00P :>0 $  * IP\ 0L0,0T h0%0@㟱4P :=Ub0HV@2@2d0B00080 H0S0L0 C40œ T0 C)C4)0c03"}@0P4 0,0g,04 =,04080q$%0 , Rr 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P0<Z 0 <Ѝ\4S{ 5  0V000  0j* m@tP 㒂$ፂ00qgA8 TT 8TfAgAgAgA,hA@-0S0iP@  sAY@0T s Ѝ 070@T XW070[`0u/PpR0Y VG5C^FWc@bdNhAdA-P00`SP pX@P X@PH0  t`忒@Ѝ cC-@p3$M/P++  h0$+4`P6T/0h 0fp0 51 50@0\%R=S04, 030304040 50f0" " 200(0\5W<`$Ѝ :T8 O-,M@40ArKp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"03=P$ 0Df0$000SR<8 P9G-p MR R`@A ZP   hPV!P4 KVPP0 RPq0mP V 0S 0 0R\2GV 0\P 0]0 P@0&00 0引P寑U:040000 0aPP,V,`H`` P向U0x q0PxUp`y ƒ Վr~D~p`=S0 Po0-=S30N0SSP(0 jPPP 0 0S 50ó 5=S  0  PP Ѝ0 5< 0`V000L!L!Ɨ$000C?o20000\4S 0Su/V`1 5 0 5=S# UTP=S 0 R1C>00~0SUT010|PXPV@bTA,hAgAgAZhAhAA-@`D1pPP d00' pP@=TSGP 0 5<=y0S lق= S}$%0,RL1hP 000:0@bO-P@`=$MS =S  hUT㜡T00p@0 UP9UT 00T RdXX Tx ؎Pp"T=S+ 000CnP$Ѝ U P j}T 0(PJ} p 0   壎hA10p@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0BP 9 ;909  000&00P/P 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0\M0(0 0 0 ) 0% 0 000 ) S RQ0Sd0$0$ 00 0 ^0X:$0S$> 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  0r80 V 0(00 0 0P40S #H0 .`np`` ? U0:P00S P0S 0) 0p0`085< `F V`!V"40S N#H08<Ř  Ÿ   . ?xD HLW  < W Q  #&&  "00`0,00,000"R0 0 00TrTQQ80@ 0(00 =P;H0 C2 00000 0&",R0 0 00q[@0Sh0'C( 0C8RP] 000 #8 '(80(0堎PK $00(0 +\Ѝߠ0( 0 8 @  1/ݠ[!p@- @P坦 Pp0p@0@-@Pp΍9S ʰ;S  0"L`PQ 0 SL0L0 nD0P0 0  ЍdddO-pLMP4  P3s:Pp R00`5M:eP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@<:P80' @DXT $@0,0 $4bY8 6080[ 0 0 0 \$  0 $ R0 8P 6 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<9O-@P `R0 pM0 ЍO> 0 P0<:P: 0 6S ܕ0\0:  ЍO㤰0 00S Y  ) R 0P0 1R H0C200 00 0X% P ЍiAO-需,0 0/\*0 ,\0 0 ) o,0 V00P `0 B2>@ b6<bP0:0`40 00`FV`  a@P 45" 0 @P6<Ѝ8e@5``L0`(04S 56oobT`V 00 0S35@-P` Y@P0 0@P   0 00P60 ЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?>K p pY 0 00000.0>000 *@P9 W000 04@P, 0S)Y 0 @@T0S3M 00S00@P  0  0@3 100㙉\Ѝ2 3pP 0   0,0!2@.@c@bvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000Y0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(0=3PP 0 =$05L0 C c#3800 9!600< 02#T20T2.P $R0 Ѝ`i(0$ .4D40SU >0:000 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000@b@c@-0S    P (000 00 0 <Ѝhp0 p@-0@00P`06/ 000`06/P ms00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0 uPEP0W(0,0ů _ࣘlt1 000040 0 0*pP ᚘ$tLЍ0x 0 | P ( 01/Pᄘ0@ 0 p 01/7H4QOpUp(6*C/Q @ ?QD   00ã 0P(NM4N\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0l!  0`Lc hQ Ѝ!qA@-0,@00V@"4/Ѝ蔮6(6qAp@-@0@000@@PD @DPPP0 p P: 08Sp0PppppqAqAqAqAqAp@-@`P(0P0  X P b/D000@09#60pO-P@p0KM 0`@`0U0:KߍP1 00P0 0 ;0!Q \0:V&0'0S(.^S(,0S ^ P\)0.SP PO-P10DMp @0! 0`s 01 0Ys 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 0@P0 h 40R 0 h`F ` l 0s sDЍbO- p`0MP$00$ 00@0000D000 t0P @"D0900 00 0KS@$00|00000 2P |0S080$0@OoB@ЍᲃPM@`00 0`0|0S0800`0007X000C?o270L00000L0000[00CT0T R ?R5:0X80@040X0  <00 @0C0?d00?\00\0B0H00,008#8@0 0h0X0H S80S0X0T0 H00(80TX 50t@P t XT0 P ],0X t00?@Pq0 00(0t0(P0000ഐYg & R   0 P 0\  R Rj 4 R      IRLXP^P`z( ( (L R  A, T R? 4 R  R8 l0]Pl014 RB  R?\0XH800,0tP +`0Sw [08S 0$00 ;3d$X 0h0@0 C 0)X @<  X 0S (<  ,  8 R\0404 XR@@)@@@@R0*#f @圐 0R@ @000P+X0[00SW 0 cX00T0 0 儀0"XQox`$0x000 2{00S6 9S3 D0  P@0S 0d \0dA0L@X2H@PiU[0 @<0@J,0,@0X[Q@T[=00S X0  <  C 0L 儀0"XQ!ox` xp(@P9  0 0[ 0`p"P @n! x0Jp@Px0$ 0@X0[00Sf D0  P@ 0 儀0"XQ@  x0$p@Px0$ 0~ x0p@PH00SRbqAqA@A-Mp@ `0- 0?PP$ 0 T 9 0C8C890000~0TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP$0  @@  9 0C8C890000}0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?}@Pm@00$0@T  R@@@@@`ᴰK [00S S% ZP[,Ǒ | @ `@ T@ 0P@@@@@B {T0[ᴀǑ@Ƒ`0S 4"40 hT 7}0@P00 R ?R *  1/,ЍrAO- ,M@RP0Sp0 P刐`0I $ 0  ?1/P6 0 00P 00000)c@ 4"400 00C0 0   T|@P0 00`06/T,Ѝ ,ЍO5rA-DMLH ,  0)DЍLrA@-0"HP Ѝ@-0 \ 0 00\}ЍA- MP8@<`P^0yᨀPPP)0P p@`t Ѝ 0 嫐@-)@0奐 Ѝ@- @ 0 0)0 Ѝs@-`@0 0CPPPP ;L0 00 ЍpO- ʠ,ʠ`@*ᵎ0  J@R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#0 0 po@PX0|0#880'00 Rd0X00$00|0 *P\P7,Ѝ z0s8 0@@z 0 { @*0 p(@P 嬰0 Rt 娠0 Rp000*P\P+"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 ׎@@ 0 p~@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *B00)0 p}~@P# 9  :(090*P\PP+-@@@@rAA-`p0S t 0d0 0 0P0 Lf@P90VgЍ@fO-` 0M0kPR@X1)RP##G*D1 0PA@0 0~PPP79 08C890 000000p07/P |p 0 L. |[ P ) B(B()    >yU x ЍdC-` @PpTLp T, T4000S-@ Ѝ贀 F|@00@ 8M   b8 00 0P @ X| 070 @drAO-3B"  YV[ pf$ЍO!0 AT  QPP SPUR QP  RQ  R R  0R)i0@P 0 K000 A`P X0P`@ď T0,0PK`@$ЍddAc 0s/p@-@`MS  3HP1N <宻800`S< < # 6 0`Q6PP60  R $0AQ0%4 0yT2.HCZ`Ѝp5  0 P J35(0,#6j3,$ZBcetAC-Ap W@QU嚻` Ѝ<0@8PU w劻\"AR0@4 R`001S B XWP Q00P `ZV U T,0!X00W0S `"V0P `UAcBcO-@M ` @VsC f %  ! . R  )  0SI !e 44    BR - 00> $!* E   ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ {=P 2 q2 2X    0 ,  4 @, бdR>G- P@l  h U `D`(00@0$V0:PpY$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0pptAxtAбdO-O-DMpP@b cU v ;@0@@D 0&IcIs\:d#6 0  0 0LŸ 0> 00S #6:008  $ 001/#P1 0B!0S @00fT:03 DЍ0JsK6 0$( 4 0J0S Y: rP044820 $ (0+6{ 0 ,02P04 0{/,0   0 4w04F04-0404 Z 00 0 0бdbtA0@-,A,Q0  M*VP & V0,0,  P0 P0$( R*0 000p0&YP psp ,#004 ,0  $ 0,,Ѝ0@PбdbtAtAd#btA0ptA/O-pP@(0OT<6dBc uAuA@-@P  06   0R  06,0 3100S/ $Q 5/@bp@-@PpPU  p@ p@Rp@-P@ T p@p@-@ 0S 0 0P`>P   0_6p 0Y6pO-0pQ`HPMrPP U 2@0@T0@ 0|@P" 000U## 0@ .P U(0W 0 DL 0D0 0@@0@ 5P 0% 6 Ѝ&6< 02*< q .4P ` 0U2`Ѝ0S ,,, 0  G/(0, #6v0 p7P ,f,,GuAO-M00p0`H8@P2 x+0 2 00 0`P r,e,~, r4P ` 01`Ѝ0S Y,?,e,.  7P D,,P,SuAp@-`$0S 0$0P@P   0&5p 0 5pO-`P 0M53 p3RL"H"  L"H"0U0=0@T 0S I@T; 00  04 Q, f 0d"+-00S [n WV PC0 0  @ Z 7W@p>/!Pf S10U 00  @@`,@P " 0&43PM 0<61  04  Dp+Z Ѝ 0 }+L+3++ 0D0 0.ZU  0DAV  0 V4NpMp p@b_uAhuAquAO-`pAM$ P@\@"0h0i0j00$0Xp?0S / 82<082$1<0S$10$1}y:';vA8dpvA(dvAxdd66vAdbKA-, N0RǠȠ̌' @N@  0 `p0PP |d000U8KP(0 P00 0 P dЍvAvAG-p`0P00@ @@ Ao0   T0XhG, 04$pP 0 d $L$bP$(W q$J`(dbR>ddwAO-DM@p ᄠT:DЍ! ]Z`VU3#:E V@P`q3C$R>@-. .   Ѝp@-N@N@`P@ v p@4  O-@@04M^,00|10 NP  ^P  , P5,`3 10@p5A00pF0Y0<,`0S +P $0S)Q)0   $$0P 0S  ,0`4Ѝ zI "@0 j(dbR>wAO-N@N,M@$0` rPP)$p`AfX0$00 )0  N$0PV  0l($`0 P  $Rr,Ѝ H J"@0 SzR>"wAbp@-P`N40@N@ 0 p@-rbR>p@-8PPps@s0P3#pb@-@P  0, t  0R 7 0,A-p`V@0Ϊ 0SP%PU! 0B0 0S0S 0  B;  00S 0S0S"U !`FPYP0 (wAA-Pp`VX+ @$A0S0S+"000""`0 0@X @4$Tp@-0Pp0 P"@"0S R""]"Rp@-@P U Tp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXq@$0 SV 0 RP0`PX000 00Cd Sd05$0000 X0X00\0d080D0<0H0S  0` 68 4000 R 0F 0H0S ZLoX4;Sl `0< IpPe 0@ P 0  Q 0S `0L$ Hs@lЍ`000p``0 HL P r #RK4 0/ [n 404 J,00,0d@0S `0LHC$0 S@ $ 0CA0S#!000x!!@ 0S  `0R $@Hp0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #P2 |0/ xL(WX +D0 @&D0 0 &X `P 0DAP LD 0 "!D D.!D 00 0Y D 0  2!Y>Y 0 |D;PsKD000 H H01 0 P&0 0p 0@!P 0D00 0 0H0@ᡨ000x0d0 LE 0DV&LP X  H!b1wA;wAdEwAO-4M$0X0 P\!@lX0T)X0 `CV6`  $ ?0\0qu 0 ,  p 0,`1/P #X% T \h4ЍW,X Y , !X!  !0 / R2@bNwA/5@-$#0 @CcXwAd@-`@ 0 ````!PP " 0@0 0 00 0 0SO!ЍpC-`M 0 ````p @P 4 P!_"W' 0`0C0@ 0; 0! 0WD0 0/tW1 0S1  T 000Ѝ 0; 0p@bb 0S:0P//0 R:P3#//p@- P@^00^p@蟧 Zd0 @0 p@- ` H0@SP`B   DD00 $p@3p(0, 0 (0, $0Sp0Spp@/0G-8M,00@p00P  0P0(p$@ @ @`^0,0T0P 0H00'>000(p$@ @PpI8Ѝg1|wAbx81G-M 0p` @`t*P0 P 00 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0,ZP bP @-BYP010dp@-P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#p\0R 0B  UL b  pp d 0R  S01 R  S0100S/0/@-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B /%0Sp@A-Pp`^@P )0H10@0P 0A!&0D($P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```n%0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`0S #S Pᔥ 0S [ҥ000@bp@-P@6P 0S p000p030/@b@-P VBc-@ $M0 * , 000 00P U$ЍwAbdA-P`pP @(0 1000000 @ 0@AA-P`poP @(010 000P 0 0 @ 0@A@-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO- 0;@00CS@0Z p@bA-P@pUPP0` 000 PP00`V D#&R  p@0S 2 PU000pЍ4 R @ R  00B W $6SV X130PPV40S @0S00 80$0S0 0 0p@00@0 P@0S P080 FpP 04 R@  B@  0VP`U40S @00CS@0  ` d@bO-P@4M0`<0UP!@0, T@1T@!Pop4Ѝ,` 0 Upt230^0 000C0Uw0  OpQ @ R Fp U 0 R H$Z 0  0 U01 C00 0C00[ C$! U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ d0P P  $R  0S0S 0S   c 0 S K\P 0d 0  BR 1@b@-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P0+0000p+O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  kP*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  3P>Z   R 2/  U   U    B    AX D D H H 0  0 pG-|@ pP`00LP0PP@/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !0P0P `@IPZ0sU P3hXA uAsA@-@pP`MR  0p?i P Ѝ@/ЍG-0@P0`Sp0S 00S R 3/000 <@  < 0 00e0SX@`@@Щ$@ 0@00@(0 B0 2@@ R"` S0p0?U0 0S?#03@, 03030300ߍ dhdC-MP@P`` p-0  P喓H1 R*Q,ԓ ! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221ac`c db0a/Q/0S //C-Mp0@`00 0` P0 P 00 000 0PO?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 RP Y 0 03/:#:SSX  0 6 0D %6SP0S 0P 46Sd0 x00 0#Po 0 iR>@b d@- J$JL^ >00>0^0 s *0#03<@ Q03 R0S O-,M Z%ZU@N@>0 0Y*1 0000070$6 0 0U:@/0,Ѝ 0FpC W|#$ PP9 @Tk0 @PP Z P R:Z 1 0 $`  PR0 HX MV H0V00'0J R$0 0$000$0S Z@X 0! $0 (,0 D 0PJ0SV rX n$ DDP Q @w@x uAO-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { PP 0 0(0S 00 0<00800400 0 @00bbC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00\$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 08$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 xP0 hUh*Pn$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20\Y ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P 0D00 Pp@sp@-P@U 壵p@lp@-P@P Tu@@pG-`@P $K T0G袴 0pT'`JPO-|M@$0$0夀@T` +$0 $F00J0H0|p"T 008P@ 40$0 000 000400P 01/pP 00 $0|Ѝ40 S4Q3840@TÏ6  ?00S 00S 00 0   t (,0P0( ,0hh 帳0S 0  0 00 0pPjxA@-" "&*C61P Ѝ@-" "&*C60 Ѝ@-" "&*C6< Ѝ@-" "&*C6 P Ѝ@-" "&*C6  Ѝ@-" "&*C6 ЍO-A11 0R tqs!0\ ,R 0 (R 0!L P U` Ѝ P @`V2 QE A00S00S  R 0  *T PP\ /P101101@@@UHd@Cc d@b0bG-` PpP |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T bHd 0p@- @P!  ` 0( 0S凋H0;H0i(ȋ P0RP  0.  0+  0< 0000pXA 0p@- @P!  ` 0( 0SWH0;H0M(嘋 X0RP 0.s  0+o 00C0 0< 00 0pXA7@-""&*C6@uPP 0 Ѝ0 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-@P@T@Pp@Ccp@-@P@$T@Pp@CcO- s@0PSDM@0S^ D0S@Z b10  B0S#0 0|)`0@`F`0`0@000S @0UDЍOd) ?@@D @00r@P 0 Q"0p`0[) 1 pW1 @  P tT 1)DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@@   g ]  dHdbԽdduxA@-T R*0B 00 (qBR0\  dxAA-`Ppi@rP d@mP0SPD0S TNB aP n PeHdxAA-$aP0AS 0!>00000000 81Pn 6810`U 0CS*B뤀p0WW000N@N@W\0(ЍP< 0 JbԽd d yAd3yAR>`yAO-B2 ApPw LD PSU@@pA`@P$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0PP`E@0   S0P  9  @&P 0>0000000x (0D0 , ``F% 뛦*@@Ec@byA dHdB}bԽdb/p@-`P@'0`P @ pԽd0@Hdp@-PU@QAp@x0@QX00 1Ġ  S0 Rp@2A@byA dyA  @- 0pt0Shds@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6 U`" 0pK P(,`0p S 0: ` S 0; 0`P 0sXAsA@-@`P0p 0:0啯0 p Ѝ0 /@-@t0:0 /"&*C60S/ 0S/ 00CS0/@-@$d@-@ P@ @-0@SS000$d0S/@-@ P@ 0ˇPp@-0@0P*ćp@ῇ@-0@ R0 @00@ A-@ P ""&*C60S7 0➇ P 0 0; 00  0:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(00 00 0S0SPU 0]P `V' 0S 0x0U 0  :0V681` 0 >>⣂R4 P A 0S 0 `(0`T0p 0s1Q9 0 6 &! R  010@ 0"61@ 0"601008 00000;$d@b@CcHd d0bO-M 0DP @@pH뤲2 a  00"603S P0 PYYHP TE?Y  PY ,"($($ W     " " 0⠆0W @(0 0p,0<  0+ چ$ X  Z0L PY 0 P0 PI ЍP  00P0SX  R * |R + 0`Ꮖ  P @ ჆ @b dzA bbXAsAA-Pp`VUA]A0Ds 0 0 0P 0P 0  0 0b`0 00 Idp@-0@ RP0 D@00 R =TpPZ 004000TUpp@K @-@@)p@-@P0p@@- ( @-  @ @- 0S Q حP0Sp@- 0P p @nP T  0Rp@ppXA000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/= = = =@-@QPЍ@Ѝ /A- @@Q pPW`/ Q 000  0 +P(P0@/@! R!/! !AT |P 00S 3/V@bp@- 00S@ SP` Q @psq@@-|@|p0 S 0R``&0000P0(Q &0( Ѝd db0@-@t0tM@@@0 @LP @嘄 @4P00S 3/@TЍ0bbdEc4zAO-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Za 0S 0 Z0 0囄0 6$0$pU0$,Ѝ dC0X 00L b0 kPEz@bHd dDdEcDzALzA@-PfM0@0 06S 0 0xЍ@Upep 0 RP 0S  pc0B P :ЍR>d dEcO-P0M  R0 Q" @K `p0Z000 U00 0Z$[ T{ 8ЍU Z `@ p ( , "&p@ `p@` T@ 0S0`ᵪ 02000S QU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 0S  00 00`T 0 P0  ( ,"6  U $0U  }0zdd@-0  ЍR>G-`@M@fo PrEVY)X 0   P0  ( ,"&G 000  V0 "A[@Ѝ0 p@-8P@t `0Tp7dp@-P 0?A3c S 0 S<` , R0L <0`ODS0@` @@@?CD0p dQcVUUUdC-@PpȐ宂`V279-7P@`pV 0 p@d0@P`T厂E<Ђ4PTPE_o@RPb dVzA d@cp@-8@PP0`0 `P `pPpdp@-T@PPp@0SpX@0S @Pp@喂Ecd@Fc@-@@P1S = @耂EcdEA-@L0S:P`:QP2%4QPp0#L0R00S80@AP@00@0P 0`@0hЍAE@0 ,pЍHd_zA@Fc@b dzAbEcd@-UD0 < P@@0PP#P d0L0Co/Hd dP/@-,a.0,0P@m@P d dA- 0@S0p# PU# aP`Ἠᝁ 0S `U 0S 0  ; 0 B 0S΁P0S`PV ҩp@- 0@  P P `0 04p p(0, #6 P JO- ME E@ <7 5@5 `n`P 95Ep#|5 xL K&P<%@0S 0SPUN010P>  Y0q00 00 4R0V `$Vn000@0 0 0S*1.2h !0S000C0< 0S0 00 00000/Hd0b@-@P R00 O-TM`x0 PSPS#2Z@R V0!:3A00C 000|0N@0 V00 $FT0So ((0, 0Pʷ0S] H0L00H#0c(0x00c$0{0D6,0P @0$#6C`0#0P,0  $0$ 0SZ@lTЍC$0Pw0#v!Wo'Xk*P6PP!P1x0Wp!#60c(0 0PE PPZ P 00KXP1P!Pp1PE, PP0x R ( J%  B P40 E000C400Q 00SJ!@8 4<0 48  S <0A |  T `k `0 PP 0L 08 0H0S0H0L0H0 S00R0S6D (0`pz 60C0, 0PH PEP PUP1UP1x0S $00UP1k0fS`1x0S $0x0V`!0FS0%#&pG :0 U*0804 0 4 80 00[[pG V:T P`T@HPz  0  R0L0 0`P8 0|000|0 R0L0 08 0|_L @ 00#$(?,"(0, 0P00P0#0P0 0 0S 0S P+#U 0S` $ (00P1[*Y&*`` V `1[p! p1FW-PX `GFZ0 0 @T" lPY`1 `!Pp1gF 0  |@T `PP|mA 0DP[ dpd:{AA{A ypd04 S/P @- 20HcJ{A/0@/Hc/0 \/у0P1HcA-@p`H1ƒ RL R^!^D*   R `V`F`P1 E@V P^@o#PA A B R`V`F` V P L@Hco{Ap@-P@y2 Q*    0R p`VHs1`F`V @ LPpHco{AO-10SX1쀟`Pp U@j/0 @c/a/W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ K d{AHc{A{A$|Ap@-@X0Sp/"R\:@\*QLp@0C?0Hc@- pP 02 0  ЍHcp <0 P 0 D R 2 P///HcHd@-P@-@@-P 0Hc@-P 0Hc@-P 0Hc@-P 0Hc02P 00 /Hc02/Hc02 /Hc@-@P02 HcO-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 0(0 0000w3pHc d@-@PL0"D0S 03>4000 ,02Ѝ000Hd>|AtdHcM|A@-0XP`B 0\`R 00P@0 0 0 ЍpHcs@-P0@D0S00Sx Th 0P: T0`A P8/0`P@ЍpHdZ|A d{A|A|A|AHc0O-M`  0p0P0p-00ЍZ4? 0$$Q0D0BS0S Z5*a/P .0P Z`V/0`F`@V @ DpD @R` 00C 0R P 06# 00 P 00C 0}AHdHc }Ao{AHc dO-,MPP@P U.` 0pP 0㤠N@T P,Ѝh ``F&&$ $    01/ 00`@0/@- P00 ~QPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P`n0vw6 00DЍp0 P/0S  4\Q 8< Q < < 8H  BH /80d d P00S/P 0 (Q, Q/8d0P  /xbp@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P0S  00d dP0P/@- T000 T0 @SdG-@0Q00P00CP0uFP'P""R,40Hq0S)4`4140P !V" uL00CL0$ T00CT04;P - `wu000P00P0u`0``FV`@?``u, (<00 @A =Hu  ` d@Lcdd}Axbp@-0@P 9u#}u3uT00T0vuP00p 0 b?d@-P@D`:40 00` vv@ 勜Ѝpd`32@-P@H`!<0 060`0 \v@ qЍpd`3200@-"sr9 (b ?  0&" 0BS0000L Q`P( 0 0 $ 08  <hps0X% t0PÿH X @Lcxb|2}A@bHd1O-QMM`M6 1H`V1 Q` q`, [P` LPD壚@s<1p@0T sV000p00000CS`4@0U ,MލЍ R @ pV 8 aJ. 01 0 08  @0< $ P$ 0D0Y 9/ p`P @ dd@Lcdp@-`@0M @H@B sP0 PP 2+ @PxMt"000!X@ @@@@;P0p  (0 Ѝpd d@Lcdx-B~A}~Axbd_dS Q9N//O-@0CM`S$@7H00CߍPdX0P'0CS087 03/@. u7060`J>  ա0 0000 0 &@P0 S 0  P!l6pg3P H@0S &($04P0&00CSu00he`P0S %h| $0T T0,0h0X 00$\,`Vh %@@p!0S@0P$5 f5s`P#rP`  `L^rV @ P? `0q04p00S 00 < #+(qP 0r0q @ r$ 0$ 0P0 A* !h340X !v`PY& Yp2`0P j30X !oq[q0I[q V@b!h`P0 0 0(0S0,2?d4;&fj0S0F0Ye 0I0 210X!10 0 4C#"#04>0CYC 0[1 '1 I "'넱#x!(07Phm0S !0S     , $!-;P  )(0,`(0q00000L L P P Rq`VqPdFq@0H?q ?@@ dd}Axb:cdd~A~A}A@Lc~A~ADe~AA$Ad `AmAD2tA1 0S/G-H0Spa'pPUV'qG6@T P 0  4 c ` ` \pV  T4'#R<00# H00CH08@xb dAd@LcdAAG-0H0SG0P SQ@ 00yppW R00S0 00@T p 0$  0 0S0%p` #R<00# 0800X<0@800 00 0T0 0T0p(08@ p d@Lcd@-T@L0S@ D/pdX40 0P@T@@ip d@Lcxbp@-@4Pp@e$0 0$0p@Sp@Lcddp/p@-`LPp@( 0F 0 0C 0T00CT0p@8p@Lc d00S/O-4Mpo bP%pV# &4ЍO( 0C  0 @~0&0:@ `W4Ѝ@@`xb@Lcp@-0TP@S` 0S00$ 0 B&$ 0+$060000S$000T0+0p@/O-lM 0003`3sL0PQ2@P 0  plЍ?&6&:$+O4X  0 [   XM T2XH0 000<2H082t00800<06$0 000 0 @-@nH0 0@@Mn` cO-$MPH0TQ@`LpP0#0@ 00S 0Sb"0S R0 0`P60 0 H00\XTPLp$ЍO  O-$MHp0SLPP@2`00T0 00fP (, RQ' 0"Y j30 0 P+0S  0U壔P""   M  @   $Ѝ pP"SRHAOAO-tMP@U` &!  P0 p= I pZ I0 ! 0 P`hP Q 0U0tЍpJTJ0 I ! 0 P`IPZJ XpA-@PP`p(,0^PU  sq X  R 0 00  0lbbmЍAEp@-@`Pl(`,Pmp@4H/p@-P,0@TpfP @b0/b@-帓 0 dbA-`PpS  0P@0$0 pP0! 塓PPP 0S0@P@P000P@U <@ЍP% @PdbtAb7@-PP@" oP 0|S    P T 0S0C0@4崓T@,  Ѝ0@dtAbb-/A-pP`@`<fP@ 0S@ T@  3/@`冓d0@P0/0PQ/Q   / P/P0S  /@-@ ,00$00 000 0000$2X%2`$2$2 P/R 0R /@D0@D \0/A-P@pT@00p P`@T"  P P @ `@T  P  P0`S0S0PPP`P P /{b 0   /0PQ/Q   / P/P0S  /@0@-080@0000(0 0 00&2&2&2|'2 P P /2@bG-@`p夐 0IZ P1P!0 Z0 :Pz E 00 0 0p000 0`FU*G-PM0S : ` 0C0@ H@IT  Tp1{#I0 PL@D  \ 0*WAD 0!   0 00  * @ ۍ0LSA-@`pP(  pu q mЍA-`pvJ @1@P@00| ?!Z<0 00PPD0 !00F? 0 PP 0 0%0v ЍAO-Pp㠀AM  @a`pdH1 h0L1l01Jp0@@ a mq `0 0'jl0`001 0$00dj0z 0й$`0@T8 `#~@P80P$0`0G8`Z@Pi|pW@ UqK@P j 0T ;cp-hP@ 03/2h0 it3`0p3X* 4!P3d00DCDcp@00 0 0RЍl ` 0 ,` BPT L2J2|H2P Q /@AbO-|MP`x DZh@ pT PF 000000 0 000000 00($00(0 000040 0802<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 nA0PT00PE 000 @P @@ P0@00|Ѝ`Ps@-@P`>P Ѝp@rЍp@- L@P 0S 1(S2S PAO-0|M3S `PP1S S2S @$-$@P $|Ѝ22 0*00 00 0$pP $@@ 000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J sJ@D@0> $@"R)0&0CS$y@ 0000 0$>@P $f0SW00CP $Y@"R"T@10 @ " 0TL000@ @,@2S0$60S(0 40s0N@N@4@800XSB 0tp<1W00 @P tp0t0[0S3 @ZbC0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!]@P00( 0;0@P40〰 0D0@PDP5S7S 2$0$00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@c 0(@1!00L0 0H0WT ,0 S0002 02000x0h@|0l0$03/@P! <0@H0 30@0@|H2\52A-PpU@` U R5P  Q A0P ^ R@T P A0O-Mx02 CR@#2` 000 00 0$V@P  p2 S OoBA Ѝ0S%P U"0P0 0$1P PEPPE0PPEw@ U @-P@`pP  0 00=PX0@0X0 ЍG-X0 `Ѝ0@S P `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ 9Pp4  冴Z`  )  {`{p 000X $p0 $0X 0  0,;`P0 =` X0V X  R!X0`P 0X0 0\0kR 00dX0 "Up^W L! pP (AP P Pl<<//@b@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 00 (03100 >0#60ЍЀ@bA-P@U 00 ` 00000pqU`  8i`hbA- $0p0 $0 0@R`P:    U@` P h00 00$00hbx @0D0@0D0S/p@-@P`0S*000p P *PhbA-@T1  0`/ @+ P!pH@P0|0000 q 0  0 0@P 003/Ѝ@@-$Ma01@00 0000 nPP0p  W 0 00 .  00P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 'PЍ0@Ѝ0 -,M $001040 00000P$P,ЍA-X0@ 00$@0#,pC0`4R `1C0PBD`` !0(d@d0d8dedA@-<0DT 0 !0  !@bO-Qz ,Mư `0S 9a3D P䢟D202 000*06@P P0Q0  `,]00 p 0Q  \PQPU DK@ID,P`$DP{PXDP D0/SY0`0DP0F-0p 0pa s0!00 "0忏PSq`0 U  h  00`ᦏP:0 0C4/,`000H P0@`@ 8 cᏏP#$ ,A00   P0U0P0S@ PP@U00@p\ЍhAacdTAmA AcJAAAAAAUAfA!A5AyA0@- ! 0 !@- @0S 0@@d8dp@-T0PO`d !0UF Ϡd 0!T@!pd@-0`M0@ 0 Q00 00 R @`T#ʴJ@Q   4/0 0 &#:. 4/&?&6 :  "X 4/`ЍH>@Dd6+nBAqoByoBAbA<6mnBlBAd AAA 0O-p`'DM@O! 0 0 0 00`(p$ 巩0,0> 00!0 0 00`(p$ 墩'0 !0 ,0  00`(p$  卩 0 ,00!= 0"00= 0 00`(p$ w 0 ,00!= 0)0 0 00`(p$ a 0,X !/0 0 00`(p$ pL0H ,090 0 00`(p$  80,0G0 0 00`(p$  $0,0O0 0 00`(p$  0 ,00![0 0 00`(p$  ; 00!e00<$ ,0  00`(p S0,0 0$!`;0o0 0 00`(p Ϩ0 ,00!x0 0 00`(p$  廨0 ,00!:00 0 00`(p$ 妨0,0: 00!p: 000'> 0 00`(p$ 叨0 ,00!:D00 0 00`(p$ z 0,00 0 00`(p$  f 0R!0 ,0  00`(p$  pR9 00R!0 ,$ 0 04`0(p ;0ɟ 0 00R!0$ ,0  04`(p "0ȟ00$00 0 0R!0 ,0  04`(p  %0,00 0 00`(p$  &0+,00!0 0 00`(p$  (0,00 0 00`(p$  Χ)0,00 0 00`(p$  座*0,00 0 00`(p$  妧+0,0< 0 00`(p$  咧,0 ,00!>0 0 00`(p$  }-0,0;$05 00!50>00'> 0 00`(p c.0,05 00!K?00'> 0 00`(p$ L10+,00!N? 0 00`(p$  820,04 00!O?0 0 00`(p$ "30 ,00!|4 0Q? 0 00`(p$ 60 ,00!(40S? $0  00`(p 70 ,00!3 0U? 0 00`(p$ 90(,00!W? 0 00`(p$  Φ<0P,0Y? 0 00`(p$  度>0,0]? 0 00`(p$  妦?0 ,00!= 0 00`(p$  咦,c? 0 00`(p$  ~@0 ,00!1 0f?0 0 00`(p$ phA0 ,00!1 0g?00'> 0 00`(p$ QB0\,0j? 0 00`(p$  =C0 ,0m?0 0 00`(p$  (D0,0q?0 0 00`(p$  E0d,0u?0!`A|2o2bn2p<9$ 5d<|2bz2`~2bs2PbAu2Dq2,z2@2\w2 Xcln22t2dbr2r2+nB3nB0 0 00`(p$  ƥG0,0}? 0 00`(p$  岥H0,01 00'!?0 0 00`(p$ 囥J0 ,00!1 0? 0 00`(p$ 冥K0 ,00!1 0?0 0 00`(p$ pO0 ,00!(20#>0 0 00`(p$ Z 0!?0 ,0 <00`(p$  pE 0! =00<0 ( ,`$  p10$03 00!3< 0?(0  0,` ;d$0 0 00!|30?00'>< (0  0,` ; 0 0 0!%>00'>(0  0< ,`$  0!?0'>@A( 0< 0,`$ Ѥ 0 '!?0< (0  0,`$ 幤&>0,0> 0 00`(p$  壤05 00! 00 D,0  00`(p$ 卤5 00!? D,0  00`(p$ x 0!5O@,0 0 0`(p$ @bDЍO-ADMP/ `p  0  0p,`(`$P P P<C , $ 0 /      <0p(` P P, ,  O@ 0 <0p(`$P P P@DЍ`AXp2}2pC-QM`p \@ ,\ \ 0` 60 P 00 000 0@ן?o2P0S R0T8R \70Ѝ887dXA@-p|0M@P? 0`` 0 P 00 000000ᓟЍ;cC-p0MP0 0`` @0 P 00 000 0@r?o2P0S  ЍpdC-p0MP0 0`` @0 P 00 000 0@I?o2P0S R Ѝb/uA-MⰀp(0@P`` } 0R R#  L,* Ơ$ d `  L\# Ơ1 00X  00 000000Ѝd dC-@0M(0`SP0 P$0p ` $0 P:0S S P h00X  00 000000ОЍcG-MP 0`` @p 0P 0  00 0 0 p@实?o2P0S  0000 0 P00  ЍO-P|M p嬀`@` +0H`000 00 0@ 0 v0P?o2P0S 0000 0 PPP0SP +H0|ЍO-P|M @p``  +0H`0 00@ 000 02?o2P@@TP0SP +H0rP|ЍC-|Mp@P` ``0X X@0 XϜ-@X}X H0XS  00000 00 00p0000ܝX@H\|Ѝ@c@bC-@|MpP`` $1T0 T@@Y00?(P @6 (V(RX-X @H YR00 D @0  00 Q 0 00 0000p00ႝX@H|Ѝc@bbG-pP`0Mᵿ 0` @0 P 00 000 0@U?o2P0SD0Q 04QS03"# %05Ѝbb NMb@-1P3@Ek `q0VM P0 ! 0l:01 00$00`$00$0P@Z$00$0T0(00,0 0S00@000G8p0900S  @⊦0VH00L0H0 HH0 0P00T0<00 %0`00d0`0h0$Ql Ѝ0 `, 0 H0% l Ѝ@蠧@b AA@BA-`MPp@Fl 0` 0 P 00 0000@奜?o2P0S(l0PЍG-@Q0Mp000` @`0 ` 00 0 0 `@x?o2P0S, 000 0000 P 0R ٦<0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 {Ѝbɚ;6eA-M@P`p(0` 0 000000X00#ЍC-`0M@0 0p` Pb0 P 00 000 0P?o2P0S@0S@T0K 0%PS0 0@PPЍbbG-`RMAxp P` ($1 0 1 010P 0@Hp?o2P0SPЍC-鄐|M@P`` pvHs0X 00 000000ᕛ|Ѝds@-P`Ⴤ00@0S 0 㛎ЍpdO-PM@`Ȱ0âU0s 0ȰĠp@ЍOX 0UT@@ pwwXU2U`010# 0ZC L R?0|P XFUT|pW?U4Tm|Y[$UE\E-U  P  V| &T| RUK|# W!`IKq@p UXQ 0`FV`G: TM`pP0T   ;?0b|`TV TU010#`| 0ZT|Y[ D ET 3 PT|0S Z1`IK@˜ Ѝ0 M@XH acbcO-PR`@$MB @p幜WT0 RT릜@D @$Ѝ Z X  k     MD{T  (,TZ0 H @p PcdTcO-|" 00,p$@ @@ @`֛ 0(00 00,p$@ @@ @`ś 0P(0 0,p$@ @@ @P`崛0ЍAP ƒ #60 P *R  P 0 / 0CA-0@`P P(0p, UP1p1:PUp0S S0 0!d 0  P*0d0oL0 0!d 0 P:00 db00ST'4@x<0 80wfAddbzAbA0000 wd0@-M 0000P 0`@PP8 ⚽@P 0 @@0@ 0 @P hЍ0S  @!!@P @0Dp?  @Sp !@@Dpw@Pp yw`0S@|w0000 +@P L0S00p 00=@P ddA2O-RM0SP@ AXT @w0SPcs,0 Ёa,0zXݟP08 0(qNP0(@8(0H> C'რ(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$0X$0 ( $0,0O!@0<]|x|O[0) 100S$ ,(O!>0 00000000 00 @0X PP  @,0a0wЍ 0d@BbbacAdO-MQ@L @pP `VTP@%ЍH0 0D00@00 01/PP P@ `p@-P,0@TpP @(b@-@@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00@-@-P0S  o` ЍX/\/RA-PR`@P\p 0!S P d!X@}PP@@-X^ :S!\@ ~ cs@-D0`P  @P`00Ѝpd@-@0 ud 0  d0  d@0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/@bA-pP `V@P P6uP uV @000V 0 `@ 0S 0 00 P000 @  hud(bp@-@PM`t@@ @@@`0      7 O h    $(ЍpdAbP/H0 R R 0` R R (bp@-@`MPlt2@PTtBp0`0 00$P 00000@t@d@-@Pt 0S 0 0S0   L00C0t@ 0S 0S 00  d@-$ P P PЍ@-  Ѝd0@- 0 Ѝs@-@PM``WM0 0Ѝp7@-@ᣱPPPP8P 04   Ѝ0@ Ѝ0ds@-h` }P0@0@PDPHPLPPPTPXP  0PPЍpd7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\J0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍdBd=d@-p@`MY1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  YЍ d d$d@- $Ѝd@-0 0 0$Ѝd@-0 00 0 0$0Ѝd8 0(  R@0/HP 4/@-  @((vP @ tP@Ѝd @-K0 00dp@-000@S0S00 K0P0p@bd00CS0/0Ld@- ;LPd/0/@d@-p0M`0@ 00P0$00|0 0, S00` (,0 ` 00 000000̑Ѝbbb@d0S/$0 R/@-@@@b0/@d0O-aA CJ "H0?P.001P )PP0SPPS=U]`P P 0 0=0d1  PP 860S @ TPP 0LP80S101?1?11` P@V@@pp@-@HPD@080C@00S  0 8Ep@D\c@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PED @0 PUEt#3p0@00XPS 0  P@D003`EDpc\cbA@]c@b@-@@TTp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0  Q2@-  a>Q 0 "Rq0 o`/O-MAQ( <0@@|UЍOQO(0pS<0(00 0 00?o 2?@0HS=0 $00H?oR20S30H?or20S,UXC`xW01x0#L0C4`P(000U L0S:Z0S7 $0S`0$ S0C0@0 P 0B@DT`?D0vk`P D `=,0C1@4008040 0S`,CCDkP80Z80 @T XH3$ 0R 0 S030#R0S 0H0C`0H023W`x X⩲VX@\0P XP@T` 0dV`0(0h000l040p00|x0P00P xT` 0V㌐0P00P T` )0V㜐0P00P T`Ґ(0S V0000P00P T`"*0V0000000P00P T`宐H0000 0000t0SC,QCL00 X@`,CVT00000 00C 0X0 0$000000Cs  0007X @00S0000P"CX<C,(0S 0 '" <0 Ѝ`ldacbc\b@bO-p3tM3 WW3@03?0 tЍZ0@ T`3 0((00(@P 0B,B(3(JP`U L0STZ0SQ B0 0000P 0@BT?? 0+jP8 B =$0jB1@0000 0S 0S  @T  TB00S $ 0R B000?Z0F 0B $B@-@>@@@-@P 40 y@01 D]c031 0gH@bgDO-`2 31 L2Z0@1=0>q1WPPӄaՇ0cU.  p`P n5  J ϭPR0?Sòʂ?1?1P1`11Q1儡U> ЍSP > 壭 埭X Y P(P1SQP`[>00>U"00002q EŠ0 3 1@bD]cO-13A1LpȢgPPâ넁`pU/^U 8 CQ020?SP !011QPk?QQ? %?10 O[ P 0SW ( R 尐U4 P00@bD]cp@-0Sa @1S@ @A1S1SpPk?Pa`1Sp0S  R R    PQ @bp@-@T 0`QT@dPT\=IPHPP=UP@pT 0d3"IPvtac@b1R  !/1R  !/G-pPt3a @P    T\@@b@-@`Pp0P @! W#!! 0@@ @ 0  @o  0  @P@ Ѝ@bO-%upWpF@Pd3졓10S?` < 210030 10 .11 R`` #=%+ e- ThX 0\P0 03 [V  Ѝ3 <)0P  < z@bA0Q`/wt@A-@PxM␀ Pp`x dp` P<T HP  /m,<xЍdHP 0 GmacA-P`h0hp@0 0"+ - 0(00  03 b3@bQ-//-//-/-/-/-/-/$0 0!0 00 /@b@d`ddd0  c P0 000 cP000/0 P000/ 000#0 $000#$0/Qp@-P@ X <P0 R 0SP400S! 0"PT =<p]c`bp@-XP`@ PD03 1pV T( LP p8#p]c@b^c0 100S/I]c\c@-@;01@<]c@-000S Ἃ 0#  Ѝ\c@-@0S0 R 8000S 0s0000S0Sp$00``_VPT00SH$A<10 0 0 `b]c`ApAAd\cp^cx^c7@-@P ᔪ zh0,t 000l00p00 Ѝ02p@-@P, z00 00 0X0$00(0tp@v2@-@ $@ `@s@-@`P0 0 00h1d`S\PZ_`0W 00 0O !`0`@GЍp蝊AAp@-QAM0 0$0' 0S$0 S*:01S< `10XZ00a01;V  0 %c:!(0,0(0,娊  彄 ⢟ 0R1!0CSQ B0 00 vUP t1.S1! B0C 0:0  4x^c]ct2bp^c2`b]cdЊAdAAA-P`P p吀H0L,A0 U P#H0LTp0    0S:|03/0SS:@`b]c\c@-<0DT 0 !0  !@bp@-00P@00.p^c0@- ! 0 !A-p@d` P0S C C0CS0#T X$ h0l0h0lA]c`b@-00@0^c@-00 @0 0Ѝp@-PHM` P@ ('P P `9( ă (⩞ $ ẃ  ⟞9HЍp]c0@-AP0,MS 9 d0S&  BR,*  h嗃00 000L!h0l0h0l,10Sf0P=P,Ѝ0 R t,Ѝ0@9 ,aR !00 0` 0@,P(p$ } 0!(#w?P  0 0,P(p$ } 0`!2" 0y?0P0 0,P(p$ } 0!2"P0B>0 0 0,P(p$ }0 00!8"~?0 0 0,P(p$ `m}0 00!!< 0 0,P(p$ `Z}0 00!!? 0 0,P(p$ `G}0 00!P!?0 0 0,P(p$ `3}0 00!?00< 0 0,P($ `} 2)I21 ST,AT0t tl00 <8r 8⒗DЍ8Jt@껌AAd`bh2<2]cP22^c@- ddTj`0PTP@0   040 P Ѝ@T2^cgAA\2/d 0 0// 0"/// Bp@- ` pP@TMpA-P@0`Q ၴP@pbA-`PD0@XppQ hP P@ dRp@-P@ R" 0t  0!R4 0 R R 0`00  0t0$0p\ 0\0\ 0\0 0`0000 0 Ap@-P@@1tP"2pp@-@`PP1'00p`t02pp@-@PP1(0, 0@@2pp@-P@@1$P1Upp@-d0Q@P` 1 @0, 1(0@S@U 1pC- M` Ѝ0 SpA" S) S /0zP@H10@ 0`01 . 0!0 UTQ30 [?P@0 RP@`S@T0P@`FV`@Tt0P@00 P0 0 000 0!ʚ;@Bʚ;R7@-@P R: 0- puX0 0X0 0Q 00 0@00C@0X0 0X00"eP 0p`00q 0 0\0 0" Ѝ004 2Ax3p@-@P0@081@0 p@1X0@/p@-P 0X0p@0PX00 0@008@0$p@&p@-@PP0(0, 0 (0, `q pp@0p@-P@@0p@0p@-P@P00`00p@ߑᴑ(Ap@3Lb@-Pu0<@P0`Ѝpi0x0t0 0@ 0000`P 0 ` 0d@ 0 0\00\010Q0ac@bp@-`@ $P  RP|00p@-@|.0@O-X`M@``x0p0x00P0e0c0 00@PT``p dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 00ၳ0X005 \`$0`0/(00,  /@0#?0 $0>0/ 0 000p 0D`P 0 0 `100 0!#4#0 !Al❔ ///x00CSx08ЍT `[ _@bC-pP P`P' 0堐   ( HB@ r/@8l&`0@@<%+3 1 03 Ѝ\A@bA-PU@d0p00`h0Q/o%/褎Ap@-@d0`P@/`%p@/p@-@Px0Sp8UpA-@P pP&/X0 @ 0P  d/x0S^/o@0x`X03V00  R/M/J/@bA-R@P` |p.h003/8/h 0 * !01 0 R) p .X0$ @00C@0 R 00 X00X0/ /h00 l|A!#4#0!10  .p@-@`P ؝@0 1p0@00F=00`'t``c pA-A@ `p.@0Q0@$.@b #\ #] P 402 /,0P/0 0R03 0@2#/pb dp@- @`0PT 0T@)0,a@P"fUP P@ 00tUdUUP ,H<U0a@p U@k (dA-P` p@0U @TP  . A-P0@(PP3pa--@01@09.1S1S 1.-8A$H1 Q  PP10SP@bh0 0///C-@LM@ \0 0`0 0PPP P:` PLЍ(b`P 㾎pp-` qp` 0"-0 忎Lbx3@-T@ (d 3AO-P 0pQS lQ`TP.0P <T r @ TP$ @0R @R0@ @ D n[  ɰ  @@000㓔$  0T 0DC1 00  嬰V00T d(dp@-@P 0S &TP |}Tp@P\uTpPU @nTp PP  P`Tp(dA-P,hAT h0pS ``,\0$ 20S$0 -@A -|AA-Ppᘀ,ATA,h0S ``,\ $00$0  uP$00$0$0S ,@|AG-p㔀!nATPP,P0 C;00 ",p4(0 0\ 0 0$0!0$0X00X0101,0S 0h0/ԎAO-M( 0$0 0P 0 (0S $ Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` )SP 0S< }SP3S 90?00P03 @#04/PP30C3000 Z WS P MP  +1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @><0!#4# 11 | p+h003/PPp@pP |+0 0Pl+X00X0+0 P_+X0@0 X0Ry0X008 0@@0@@0@0$i!f0 R 0R @T @k 3+Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|V+0@ +X0@0X0H7300J+ puRW Y GU0@,0@`S 0 0C 0000P*X0@ "+P@0X06300x0S  ++ * P+ 0\00`0; P~P|3Sp< 5310 0P3S7 H@Xp0s0( KPӀ h™0`0xP*00@017[@*s@ 0S 03# @04/3pC(0PpA 8@P @0!S3S XHPt@ #T@0p00h t0 p00*s耍0 A*?* @hTX0x# @00 00S R 8i r*0SZ 8h*e*j 0Q 00 0h0T8K3S Q*{X0 X "0X0@00C@0 ?*|00) (04*)X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@0)  )) 0S@ 8) ) 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 8) ) 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| S)000h0 0S 0040E)h P 5/P40)U ) })6(dA@b@-,0 00000 00ЍAp@-P@Tp`QP y@G-`p3aM )1 PUGK)P (@bp@-P@``( 0@I @p@1)p@-@PP( 09 0p@%)00/A-@P@pET|`(h0000h0)@4A00/0S00  0S00o/p@-@PP(X0d`0)P("iX00X0F(p@(0 V@-@LÕjPP@H@-@X0 0dX0dh$*`03$!;$'H@ ,pP 1tP -@@b8d 0'p|8d 0|8dO-p`@嘰  HQ:/PDPWe \   0[P ?P Ѝ0S 40A3/0`@00@`dG-M@` 8pYP+0yP@@0/S WЍJ[0 0 S?@# ,* b60 C /  C1$@ O00<`00 o` POV@ k`F 0W@C0`F`00S/ P 3/bA-P0 `p00l 0 0010 (@0VP Ѝ VP'0ZP 0@00 0 0CS 0VP`V pZVPp VP'0ZP 00@0G-PЁM! @@vN a0 @@9 z;Qq 0 @0pb0 \Pp$@T `Y-W0AU2(@P 000(` S'Ѝ 00S S S  00@0P0p 01@ 01p@ 00P!0 R Pb_cbb8dA AC-@PM> (0S; $ X7 `V6 Qi0Ԑp03/ @0^P00^P 00` 0 `P O003/Ѝ ? Dx0 ৌ(0p`003/bA@bP/(0S/P/ R  00/G-Q @DM08$ Q!P( U Mp PU PU ^Mp R(0  @` jpP PU *\M$0P(@S0`$`$@0S   0 _cPbtbG-PQ pEM@(`T `(䀟VM&t! 0SX&@0S LPPtK&d{Mv"$@T 0Q S   0 U`@_cPbacAA-@`PpU 0S A  0S SP@-@abAP\]_%hP lP 0t@pA-@i` 00SʬW#Ѝ0 0 0 PPᘋ0 0,0pp00 00 0P ,0/pt0Q0!*~_cb|0S/@-@h3/0|0h0O-dMZ@$ ` +|0T L0P $0(` T ݗ`P8p$p* dЍ P`P$0p$p" 1 00\`V /vP0S{@! PPv!(PPp00k( 0;0!PPaP1 00 0000 0 XPPPY0$ 0C0:P0(1(T0$1 Rbj! `( !l  2/`PH0T S *P S:00S18 ,0 0Rl pP ptP ztX0Z `xZP PW`PPb8dO-`4Md@qԔ 0L0 ?0KX) Cפg壑4LP0 0/0 0,0p p00 000P 'm,0/pt0Q0*#P,00 06PPv,0L 0P0P000 PhP|P0b0(0L0 C5<0X0pPtPlPxPS,?K >PP X0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S x20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRo:D04Ѝ(PH! E'b$ t$ R!0 R $0 ]$0P(Pt`10`1Q\`jX00X0 dP\`\X00X0X0 0dX0u$;!$N$: H P >pP CtP ?dJJ`0 0R0U0S \y 8d;A=A_c44dbO- `0  0K RR⩦  300 q$1|pqL0 48<0L0 1 111"  "Jp RhO#p <0<0$,0S F,p,[ppPpulP`0<1xp8p=N4"P P0$(, 0P0 #T0T0(G(4}`0pQ h1d0l1=0c?0h0040083pp0 `040qd40pbW 4p40qVa40qU`40!0R "40p:"o0, h001q"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@d 1\D03/9"(Jr40004Z0bt"@r"1S' Al"[II(0 T 5@ "5`0`S V"<ЍD'4040pWev $Y!  S @liITgI 3""Y s#@@GANASAZ3acbc_c0O-,MpQ #0!`P#@t@T ,0〠X2 PO@PP xT P` X !P P`j@#0SKb㨇UV 0[U> :$@L$ O@PB B`0V):< `V 040 ` O@P0 00# $ 00`00 @PQ  $P@0@,Ѝ 0S S+$0T@P X X$$ Ť`Pb_c13O-a4M00PS@!Ub!0S 0081S aU}X0T P3,00000>0#6040080>0#60D0>0#6000<00@00t|80S TM 0!.1000L09L0@02!5@ 0 0  0PpW(pWL0<L0u0P -. B.`1Sp +pP0  j0  jVpUW pLWqLW!0R y p3 h:T0  j  [0 ha 000[  [ 0D6p30pGor   GqP  $($01 0Y:p⾽$!$$WpWpA / qz :qD: DD0ĐN I1 0?`1H!<1d1D1l0 p 07/pP\T!@0AX0  81 0<1$0@1(0D1,0 #OpPG l0 0,03/l00S 3/ZCl0 0$K(0Sq [o Yl 00Lp @07/ 0 03/3 0000  0 0pP 01K 0 03/GZpG X T#w"HD RpP WtP S0S  EpDW   /o"    2/pP#pHd1S p l0q 00S p0SD$@^F$0p  $@F0tp0P  1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/<10S lXFZ0F X 0"#  "p PP0. pl 000p p p $pKR0 0Z000C0V'X%D0 ] 0S ]K=p4Ѝdac@b=A_c8dbc0@-_MP P@P0 _ߍ0@-(000000 0Ѝ13@- $0000000Ѝ13O-dlQ R00 2   00`00(000(00 0W PX (ᇠ0 P>X (X{0Ph >+10S`10$0P `bAp@-Pa|@T 0Sp 03P T  P06P0 0S P0 P08P0+]A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/dH-wA0`SM P0P:P00Sړ00P0*  VIP|GE0l 0\000Z 00C0 y 0 ,+[(0 1111&I0Z00S H81S d뒏+CTx[6$l~0$04G !` 180S 3/U>mT0  o0[0 00[ 0 [ 010S2 [ ` 0`Z0|`` 0  0S  LH %8 `0 000 0 V ~&[ p 'ឱ$*5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x l冊%0@ ( H R( S0,0 2 P   , @0`080(0< 0 D0(00H0K0(0 <`|ᗿ(1S '  01501 0Z0C000000RBl BlKV ;ub 0 Y4l$895F1 P 0PL 0S 0S5p@ 5 =5l0Q Q*00pN `* x0S `JdkAbcacx e@bcAbcAp@-a@PP0  $ !O-M00S`؀  ᰉX ᪉z80S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y %P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0! RP  !P  00C0X 0000PB ,0Z R R%@   B X !.  5@00PPUPP0,0 ,0p0bZ0S000lP030dP00 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< }5 =5`V2`H0S& x 0◈%0@ @ H R@ S0D0 2 P   D X0`0P0T(0 0\0(000`0I {េ|p(;(X;((X;0S X (彜X (0ො00 20Z00S   00C0p0St t ' ` %D}% a P ,.<(0>P ĵD  IG@$; B/o"S R0 400P%`0 !^0Z 0RP B+ 40 0?  ac@bbc@bcd_c0@-q@M QaT0P0` ,0 TP X .Ѝ00@-P0dM 0 0@S0 0S0 Q  G?o 2Q0S X GdЍ00@-@0P SMS0R  0 0 0000?o2Q0S  G?o2Q0S G?o2Q0S {GSߍ0p@-5lP@0U5Pp@0`P *Py/-5<50 Spp@f@-X0C50S[0  J|P 00S @]Q@bdO-`$10|0L048<0L0 !80 !!L0?! 0k  g> 0 0? 'C001P 9DP  CD+ p<0<0, y,0S(h:0[00,00[` P055 l`0<10x080B4!P P0$(, 0P0n\T0T0(2< ( ht4[$ =0c?0h00400h0 0`00,00?2 40!! 140S  3/10 0S [0[00[0x0*Sp p0t (0x@tH05AAQ  RB0BS  R ly505`0@1d0Sd d0h 0d@h03 R @0@Y 1\D03/2022! Z! ! ! ! !20C22S pV`20S OP1211S ljT0  exp(Jf!>4pP04B 0 0Z 0000 l0S `0l 0005AAQ  RB0BS  R 25A0AS l0k G&@ @ 0 JJx$80pZ0Vg0S5D0DSXPFl0 G_cbb8dA̐AӐAܐAAds3acbc@bbd@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC 1|@e@00@00 00 !!0400000, !  !(<X<P 0 edT@0tgI<PKE<P3S @bc@d`ddd0@-@0PM 000 t0PP P00P0@00S 0 022201Ѝ0A}3@bA-`|p0PS dŷ @P U *< p0S0@U@` {<b3p@-P`@0`S L塷T  <PUTpp@`<0 3/b3@-; 0;Hdp@-PP@ ;0S   Upp@=< 0b@-0@0S R 2/b 0b@-(@ P0S   b$0 0S/ R0/0bA-Pp`C@p `PṔ$ 0S0@ 0@0bb0S   )p@-`P0@TP  ʇP @03/PP pb@-i 0@T@t 03/@b 0b_c]_c 1b 0 bHdMHd !Hd b 0LdbЍMPdTdp@-40CQP0[;P0WU6Kp@bp@-@00S?P00#;#P0ETpp@#K@b@-0 0@/@bA 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`ddd00S/A-@`ăPqPX`00S N?P P FP4 00$  d@b\cQA\A:A?AIA0 0 0/`c\dp@-@`S1S 01_000p@3H "0B0S,0_@a`3 @b`c`c~AG-霐P`VU`P@@ t@p0!0C8R#8 @< A@0J2S P B!0@@b`c0@o/`c 0P/,㵯@`c0@- 0D0R@00,$00P s @bC-p0MP0 0`` @Z0 P 00 000 0@V?o2P0S  R ЍDLc0@-@0$@0 @0 @PZ<Ѝ0@`cA`3|3`cDLcؐ3@-p p@p@0@@SC 1X01q@ Hq@@<<80@˲@`c@bb`cx4ƒAbΒA(b@bA- 0b@SPpbtb0@X4100S [b0 !!04L0H0@000, !  !@b@d`ddd@-@Q't T 03100|P0P<Ѝx5 00SMP 00S t T0 #!R `0S@bac@-P 00Sp@-P@9PpTUpp@-@P`RtPpp@-@P`JtPp@p@-@P,Pp0U p00/p@-P@0Tp@P 0 P QPp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@O!>0S P00 0000@-2 @0 0R  R@\ 0CS00S$@0 - 5꩒Ap R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3Ss@<@bp@-PP@W t PpP0 l t BR 8P08P0P0 jO8P0MP걒Ap@-@`Q6 P08P0Z0S P0S 0 000C0.p@>O41041/41!0CS41/p@-@Qp@p@-01Q@101`41Sp PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT@ K0`` 0M81S-8AEZ. Ph`0 !0L @0;/2 00  00r`P dRfЍb٬8APU 0RR `0SNPX¬Pܡ  2/0@ ! * 0 0Gr`P /X㨬  2/ `0*@l`P  0*sXᑬ 0000@ :0<`0|0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* xM'@b#b#1[  00/p@-@8aP 0PEt 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A- 2Q@Up` 0S Qsqt1 00$V;0 0 `!`0  0 0 0 004 00 0(00/1S ! !! 1 00C000C00100C0E 8 <  gЍ90S u9ZCA0S \P ˩00$P 㘫wg^W,0 县ЍF@b@bac`cO-PM`pDT 3RU q@r,0 \ *00 0 0P 0P r #@T  ᠰ8/{L h Q4Wp 3: 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S zL0P0<P0t`m mZ20H0S@1 1]X@00#] ؼ@p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S KP ̨00OP 00S  | x p@0@@SC 1\0100 1<0SЍ3/@b`cx4ƒAΒAA ac@`c`c A-0p3a 8Q@T0S 00(q X081 0*qXL@@bb03hl2/@be@-@1 0S@NA-Q 2@si 0  BR 00 1@0S 3/#VέFlK 5P0PSE P0   1hS!!1 !  5  P01 P  !<! @P0#ᇯ0$ 0P+00C00S  P CeWh0 IXr(1S,1S |`V V8^a=@bacݒAԒAG-@QTqYKP` 衔 医5P03P0< ẽF7S  <P > 6 00C0   0 I &  0 000P00P0 O-pA000,P0   P  i W& PP_ 01^0USS [G  `W lP (1 S0(100C00,1})|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010r  Q 0P 0R u`P ` ```A- Pp`3@2::P@1@!<`JVPP   y0@D@P0Q @@up@-@PPp@U``FUPP@p L  B PR / t0Q   0RL     / Q b`dp@-P00@Tp0 ËP @bp@- P0Sp8 P`@50 QV , Pp!!0p@-P@ @0$P0p`d@-@000P  @@`dC-MP00`0p0 0` @Ì0 P 00 000 0@dO?o2P0S R0 Ѝ7@-D 0HP0PP0@EU Ѝ05^A0/`d-@-0@00⋿哿(↿Ѝ@Ѝ/AO-P`С,M @TpPP VPp P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #Y0S 0 PP 0x P H0 000!R00! 0V0C0@bA`dASAO-0@!T0TX q!P `1 !R  !t1 `V`i ` 10 VP n`P `V@&0Q@D0 kP `Y0 `  S      X>@ͦ Ѝ`0   0P (  p`VȓAb`dܓA7@-P p 0@P X Ѝ0Q000 $!@ A(AYAA-@-<00S 0,0T\O ЍЍ/`cAAG-`"Q0B  @PpX  p$0S00SpQp @W 003/pP  P 03/p80S 8QT$0S R0 0C0!R 00! 0S% P $`X!P  Y0000000@0@@000000!00C0A)A?AZA`dAbAA-0a0Q?,q@T K ⓽@Y$0S- 0* v~<0P000@03/ P R00S ' :0S (0, 0 V"P<000@ 0"  b`d ddb`cAߕA0 /$/@-@RP` Ѝp@Oꉸ0 0 00 0&P Ѝp@-Q`M vP0 ( 000@P @P ȺЍ賺Xp PU@ 0  ˈ@P0P S  !  00C0b`dO-DMB,0RbS20,0Ƽ `002"@000S200   ĸB/PT:0`PhB(0 <0 P0`,P$  @P MqЍpp@-M`P =qP@@ ~V pP@ 0qЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0o Ѝ(33p@-`@PP 0S Tt M~ `Ѯp XP@r0SpT  8~ 弮djAvAA,0 0S @-宮@dAA-Pp`@͖00$0p ` P@ ,bp@-l@Pp^P UPU  PU0^00 p@襖,b7@-4P\o@P $000 +o Ѝ033@-` ㉖@gtPp1S`00X1S0@<0 AA0,000 o Ѝdbdp3@-0@p`PM  000@尡另|埦0t t@p`0PP P02@P =0X ( Ѝ@XҠAd03Hd3Ldd3@-`0@0 0@0 0000 0@00C@0Dbcac|0H S/P  \\1СA |000S \/0!`0 SQ/PQ//Dbc@-PZ00C0 -@--fF\2O-0S0PrPRM 0@0\* 0 Q00S  0 0Ѝ 0@`g`@  ᑕ0V  刕 0倐 00 00000 0\00  0#00 00000V00 @`F B&[0@@D0![ @T0@0@h @0`0 `ذ P` P@~@bacDbcac0uPd Z9G-MP 0`` @py 0P 0  00 0 0 p@y<?o2P0S 0000 0埩P0S0 0Ѝ@-@TZ0S[00[0&&d@@-p0 0  ^8 0@0000@00C@0Dbcac 0@-81M@T,  BQ 㟔 0  P@@   t!00P 4 0등0 x0@@ 00@@`@Q 3@埦 HЍ0@ AacPdDbc0uac@bAb(3$A40O- 000p(P$@ @?0谟,00 000p(P$@ @ @P?/0,00 000p(P$@ @ @P\?00,0T0` 00`0p(P$@ @ @?<ЍbСA3\d%4H!4000/p@-00CSP0@@$P,eU ܓTpp@(֓ac A-0 0 2#PU 0`S@T AlEpd0S R@D:$ 0R @TA㧓Dbcacx eA-`pb|P@vY @0@00T0S@1S q@m 0S 1S DbcA-pP@`RY @0@00T0S@ 0S@1S1S Dbcp@-P`  0 0@0T 0R0S 0S @P4Pp@Qt 0SacDbc7YWD 0  !"P/ R0S//DbcQp@-@ @PXJTd0P1@0P !0@@T@~pacp@-P(/0@p`opacp@-`PX\ T `@00  RAP @pQpacDbc `0S  0  /Dbc 0 崦Pdp@-@Td0QDSh h h0d 01&0Sp@p@x eacA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR wO-SP ` (P`Lp"0 0*@T 0 SV`0S f0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#boYQVT T R S+@0`00@p@S V `0P @$00@01 00001v[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@*x @V (ᜑW ᗑacDbcx e@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0acp@-t`@3P1S 00SP31S pP0  _S000P@bp@-P0PSA,00S qaPp)p@_@bbG-0PPpa|@P @T P03P0<ATAU YL0<L0W3TG.@b 0  Pd0IPd0@\Pds@-xR   /@ m8j | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/  0 R0d1`0S00#0H1``0S/00 /0 /i/6& *P 1:$i@ 0`0`0/0? ?,0l`00000dC嬲t0*|`S4  BЍp@Y@bhAmA@bPdbDbcacbcb@bbbDLcb@dR>d0@嬭Pd@-H0 0@Z07-pf@Pd 0 @崭Pd0 @ȭPds@-@P`V`V`V 00 P0SЍpBp@-P- R@ *B B0 0CS0 B " pʡ`ǡVá@ġTp\02S SMp8000CPp謡A@bbp@-L0@P P`7Pp@$* p@0u 03/@5pRcO-TM@  0{ w000Q  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Pt 0B@P ?0 QF R  QR03@0B  x0 1 >0/h2p0l"/`2 Z0S CSY 0) 0`7@0101010園#620!6夒0C2g0W/p2t"0 00`00` dp2< 0h1P<p00p0T0000 0S00@00hip0j10S  bJ>0W100`00` dp<`00H  |0S ,101D04H0 (L  @J@q PNPTX\`q10S7 $0 |01f0010 0Sh00h0100Sh00h01=1 0=[0 100S R  W 0X00\0`00` Xdp;Z 0BRS00 0#0i-( (!!( 0!!0 00X 080`00101 01(01(rq` @"D !HL  $ (,8"04<(h X00` p R=)B0 -BP2T"Ѝ0`` dp&; 0` `00dp;$0` (`00dp;(0` 0`00dp;,0` 8`00dp;00` @`00dp:40` H`00dp:1` P0dp`00:儰 ` 匰 吰 1 00xAAآAAAA@B@-@P`t Pt]PЍpt  LS0 00000 00yPP t 0Aac@-P`M@pu P-`u 0S %V RЍu 040 00000 009`acO-Q4MX@dp|4ЍO6QT@@Z`P; J[m@MZ40 @PB U>0 0O0$@ 0;00 Q@ T VJ3@y 0/40  l@P DAT@ lV@yo44Ѝ0Z 01 J/@P0Z@0 Z 01=/@P0Z@4l1 P& +[00 @@00㙟P@ c aVJ0700Z0 CSRL0 N@꒟ @ET@ @0J0 @P Z$0,0 00.0@0 \00 0p`@ac3C-M p@P0S !PU  A` 0 p@P`P uЍ@@-@w0 000 0@0oЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍOI50S0000(00S40SU YPEU U00=03 P 1L0:`@M40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S -0 00080@ 0回P f @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S ; 40SW; 0000  YW000 [8 Y YW& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@YH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/N7<1W<1@1@1D1D10Q/Q7 RRm1 1mW  11222!.W2 2 2!> / 2W2,2,20/|70 &$0Z 01$ 8,[ 0S%ES 10 Rx ?RQ |Xv{v,i f1UP00 +70  %70  70 70  70$ $70( ( 70, ,700 0704 4608 860d d60l l60p p60x x60| |60 60 60 60 60 60 60A/A60B/B60C/C60.60E/@6@0F/F1060G/G60.60/62@0@ 0 Dp6060 O00C0$0 0$0(0 0C(0,0 0,0 0S @T00 Y0S $0 C00,0Y * 2@,00 U=0s p1 LЍ R@bacAac1`00/1`<10/1<10/p@-@Q100pacp@-PP`@xV11 P@ 10$00@pacp@-PL`@_V11 P@ 100@pac@-@ p@-P@p@-@@-@p@-P@p@-@p@-@`P PpR0p@'pp@-@Q0` f`00p R0Q`R X/O-MPp8`eu@w5xGuYw ᜘PWx i  ጘP @ መP  0 1P K ЍoP  hP  dP[P    TP   PPGPBP ᫚u 9P 5{MxM널I,iyM vM0x /w ( PzO-MpP`8Yw@u6vHwZu PXvl   P @ P  0 吚P  ЍԗP  ͗P  ɗPP    ṗP   ᵗPᬗP᧗P  w ᩗv ᨗu ᡗ ᑗP@- 0  Ѝ"0@-00  Ѝ@-0t`qi@ufPa$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`q@@u=P8$0P 000 Ѝ71M000/s@-@`l00 0PR@PЍp@ʙAЍp@-@PT@#a8?1  i hЍpac0A-a(M 000` 0P᜙@P p0 j@P ?T@(Ѝ1P0 ` $0R  uYP 0p0z/`00 T0 0057ac(A(0310S/00S/s@bc@-d03" " R @" B"2S %@T*P @bp@-P@Tp y000000@p@-\03Q0S m@T 00@ ^Tp@bG-@`T; T[ T[VY h1*ERU:0CVQ ?p81`3 t 1 0S`} P U* W0@ @03A }L @T@0U00CS  @00J} @@@bbA-@ `50 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `Pj50 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#X@P 0 |0| 0 00 0 P"3S<0 R00Q wI@bd\cd\cVAdd0@-M 0000 0@0P     P ЍBA-@ `$P B  p9P6UV#3*P)U V VX031S ( ,02 0P03#P @bA-q`pQ T=PP<@ ovB rPac@-QM`@P0T  R 0@ 00 0@`凗PP PʔP ȔpŔW ῔p徔WP Ѝ,LO-QM@p帰Q @PH0P @@0P 0O@P:00CS@5 aL0` 000 0Sg0 00P 00 0 0 p)0@?o2P0S` 00 0@P  P0R00P0 ЍlAO-QM⨠崀:p0PS5` =@P0 @@0 0@P⒟ Ѝ 0` f0"00  P 0 0 )?oZ20S@ @@O-(DM  ⷕ 0!% Ppa B, 0  0p ,`(P$  -0 000@!<.  -  0 04p,`(P$ @\j-+0$ !H.  6 / 00  4p,`(P Q- 0!V {Đ U`P v``*V { {` PbHip@-@P`lALiPpgAP {P{Up@bp@-@,0SpP,0 R p@000,Pp@O- RMpЍP` Q@ 0:,p2p\^ 0R Qp 0 `0@P 0pP!0F, SM01 Q8 R 1=|1P Q118 R 1H10 ,&*.R :  !6:"S :P 004^\ 0 S L0 C  B0p10 B 0B0D, ,]d0 0R 1H00/S05 5S05 50`AbbbDLcO-QM@p 0VP0KSQH XM ZJ$ PA$` @ 0MP5T' 8`  [_, (V_[( 0 0h 00@0Oo0 p!BP@T (0 (00 0 0` 0P  Ѝ00@-MP@  P 0 Ѝ0G-@`P,@ЀzpĐ`P0W G1zbO-QMp0@T$ P0$` 0` 0ʎPⒿ  Ѝ zY@ 0 0` 0峎PO,PР 4+H, v(0` ^0 00000 p0X@[!0_oRPPU*0 P0@` 0僎PE[PP @@]PU   R. BRPypP   |^ d `yLAp@-PNy@ Jx `^pNy0O-ADM(0p<`0 <0 0p,`$  P<%<0 S] 'p0  0< 0,p(`$ $0 00<!0 0  0,p(`$ $ 0<!!0 0  0,p(`$  $0 00<!+0 0  0,p(`$ $T0 008@!  0,p(`$ @< $DЍTAd db  0  /dp@-$0@S,$0 P R$  Upt`0@o>0x0@0C0000   0 S p@bbG-@`Pᰐ1qS21 0! 28* h R R R # kxX0@00P0#*1S0Ap@0 0@00002S0000SPGlB000@ꙤAc@-@0( R (   B "R  B  \!RA 4. R!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@+>` T`W p W 3U  G&2P 0Scb@bp@-@P, p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\03Ap@-TPC對%0C0\0(@T@ 0S 0AA럍Xp@b@- 0!0@@@b0  /ĤA0/000S/@- 0@x ЍdAbc00/00//O-`qM`QS@20" 00#202  TY0"a=3" B"2S 3 "Ѝ `00S: : 0  (Y : 0 ,0 :V 00S 0@bAG-P@0 psp= EY UP:`P WVV `X< 0GE;<0 X<0 @bQA-Ppp `D0@c`  T<@@bA-P<`@ @V`f:pX# @m:0 "S V@0 A:Y:p@-P @H0c   }0S@<p0 S p@bP/0S#/P/ 00@o/@bP/P/ /p@-@P(v@0000p]Ӆp@-@Pv@P 0000p]Ӆd@-@><dP9<@4v/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` Z0 P 00 000 0P8?o2P0SP00S 0@ 00|03/P Y dbUAA@-P력A@-P P d``PL)[ Ѝ $;QLdA@-DCA@-@| ;p4Qڀ  !L D<, !  +7A@b@d`dddA-P@Mp1 p`y@T,0@400000 ,00(00!0$@ @ @00 000'>0<0 @P<0W0 00PSPDT`@ЍXPp@@bdw4dC- LM0.0 0<P`pA0D0a0,(P$  @p 0P  ⭌LЍD  I    '. a 0,(P$00 0S P X⑌PH0H@0<0pP ,<儌PU@d~AbAbAs@-`P 0@T T0@T  S  0D 0 0 !P, W o`Ѝpdb:Adh0#(1< /@ !΁P PQ00@0!!#/@b 0S(0, 0 (0, (0, 0/ B@- @ ݆P 0S,031!10P@bp@-P`|@Tp 0SP0 `00C0A@- Dp@-Q@Z0S P0S00C00 00 6p@4 \/dp@-@dP(Fbp@jp@-@803Q 0dP 0 0FMZp@b0P/ ad0S co `/P0`o@`/p@-@00C"0!300 P p !A\  Q` lX000PUR0(00@@@#pp@-@P0M  0@0@@@P|嵅0t` 000@0@ @@x㦅85 0(6 $Ѝp@ HA~4ccbc4~4p@-4` Q[ apT0@  z0P8}+ X`ccp@-@[9`Pp 9e0p@ (ccp@-4`8SpP0P @  I+W084@p@ccO-04`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@ bctAp@-@T 0 R X0 _PP T x RW0000@pt B0cc0 0S/0 pccO-pPP`@U#`V0[00 U00 t  W` @T 0S V x B00p@-@0PQp R00  )cc0@-@PPM RS   PP P 0   >PP  E2 1"  P0E"0A 30Ѝ0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@M04`pP,0 000"!       P0?S$P(P,P0P4 PЍ L0QQ 8QQL02 SR|0p!!!!!!!!0S ЍtA@-Pa@*7i?,10!(1T00!41  1 00000110010 0 ]@Ѝp0D"! 0#@0A-q01P0c?@0010!" !0 & 0`0(0  A210101A-0P`q k( @T  0 @P 010 10010@-A!  !!! 1P $P A-@ 0S Pp`MP0 8P0P@0D"0!!#  0SW00S@ p0>S? 0 0CS#0T P@G % 0 S 0 0000@S P@@  @@@AO-Z0M0C01@S F_P3 1,<00Jp"@03 qp[`) `P iP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  L0P pQ   BV *V .`P [3  1@P gP5 0@; B "Vx1Sp` 0lT 0p!x!ZR|||!x tZ0SP RU d50|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R !.1P0jWHAccbcG-P葐lp@xU" PP1@T' L0S` ZR`f 0  ``؃PX P@T P @TUЍ`0SL``: 0  ``嬃PX Z0S 0CSPnd@acbcp@-xM@!>x ` PB?0U0000`0 0΀(0$(P lP, 000HP0 f>xЍp@-P0@1P00Z00l 0000l@ A-p`@T$ L0SP0S@]0SP`PU ,UVA0PbcacbcG-1`pAZ0S'P\W 'P0SP0SP$40S|PP0S G'0 QU 0@bacbc0@-|M@t P>00P[ |Ѝ0p@-PRQ0@2  0$1\ P P P$8p@zA-P`p@TW [0  d@p@-xM@`Pt C>0 0 0`xЍp01 10/O-`P1Mpp0ALP0  ;(9~gS154c@㇒) l 0R[0"!> R (`pap0` 1RYR PX 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍO]YP k` 0 0  2ЍOЍactAO-p1|MSA!P0  hXN TɆ%@4|ЍO R (alS86t _=0! Rp 40堀尐1!` p$Q0  kWl`0STXP 1`@T 0c/ 4/|Ѝ\@bacAp@-@HP`50S 3p@0@!p@}acO-p`PA$MZ0S P R U 0 gSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000qPP߽P04P0ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` P !!  Rv UX [  l Q W   0 0!>P/vPPP p402S SU 000 000 000 000S0X 1<< HQL!`0S7ڠ01,0 [ Q , lP( $0 !>PP01 P07Pqo bcHAA-P@q` 4Rk`;2! !! ! ! !! !0  E2 1 U"! ( !, ! !02AHAp@-@P8`0` V` Ƃp@ &HA@-APP0  P08P0m  !p!,' :P0|`V0S 0 00囃 市00C0ᾼVP08P0üa7P03>!.000X j;0XHqL1' 䀟|P&  03/`00S P |z?V` 0 t`qVP02P0P0 :P0嘯Z`$]AʩAHANcPbԩAAC-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  ;` RfO1嬁p0P  1 ` X 0 8/Y/ gP  0 Kx |Ѝ@bp@-@ 314020SS \*Sp@<@P`Pp 03/p@@bRAOcp@-@P@`PN@  03/@pNcp@-@P@`PN@  03/@pMcp@-@P@`PN@  03/@pMcp@-@P@`PN@  03/@p@Mc0A-PpZ0P01P0!>`0Sl 00C0|@Tျ 0SP0 ᄻ R AV   ` p000G-`1SxMpA 1 0t :001Wpp00 0 0$00(00,0@ 0:0( S :!~P0  U>0 R (! xЍ%@ S]`40` 㠐p0`1R0N P 1 `@T 0c/ 4/Z@bkAA-Pp@ c0`V S R @0RXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/@b@d`dddA-D`DpP@O0S 00U@`00ccd00/p@-0@00S00P00R -  P 0Q 0 p@$;b 0 u~&0C0d0l2P $20 0`p@Ap@-P@6U Op@-TC\  P 0 P  &9~`@32@bp@-@P R` Q00l=#0`PP0 ع p@P0=P0/G-1`S0Sp YP@F DP@@D P @P0Y0>00P@ >볱U ||ЍQ3HPLP Kp pz|UKPKHo| =KPKd|bAnAAAgAzAA@-2@M` T} 0  20S& GP B0 rs |#PPP  40T"0 !& @0! 0"P| @PPKPc'>P@% KPVKPQ WPPM pt0 ps`g 0rbV9|GP4>T cK P`PZKPWK1 40 0000PsQ0FK~`KP ?a~~ЍF=0l`0`)K@&K7:!#: $ : 000@0d:cd;cAAAzd@AAAA;cO-@0pSM700770S >PP7 730:TQP>@ADPP 7 GP0ST I\70S ~?CSfJPm,0 000000000T0 0 ` 6{T J/{JP a({&{${( 0P00S J ((DQڧ0 0R`A*S 00B(0 0LPP0 0(0CPP 5  J 0P"zZ [Jzz(`PZ D%0 +l5 006 #:: 0 $0 `#4 1hV(fFP>   0(`P " 4$00[.Ȥ z(P0 FFPX4$ J@PXJp} JP 3$?a}<4PC`D R  FP hP(FPP( FP (5C0P D RSzx3[ MzPX(EPD0S T>zh 2 \+45z30S ЍPU:T) I NPP"IlbP40Lb I w bRWPI˱Q PV0%Zအ Z PP  PsIPpIV0%ZZC  0PPa " QI@PPVI}pIP 81d?a||1Pm 1 NP0 `y81PU 0P0000{(!0 Pt (?20*6 0 (1000 0y(uPP( yy007;cd;cXbʫA@bͫAѫA:cedիAAAAAAAA:c4 c«AA)A?AdbAgA+AAAJAgAbAAA/ p@- @RP` x0tPS|0|Pp@dx0Q0R h R t|0 p@tP|0p@-{봬Ap@- 0@SP`pP~p@<S h0S p p@pPpP00SD0P 800S,01@o/\cdd@b 0!< 04 0 (   !/@b@d`ddd7@-h@hdPx 00@0V 5000V H@@40DzV Ѝ0贬AcG-`P0pP&40sQ!D Bp@ D0@G0, ЍG|&Ѝ@bcccAO-`zP 0@ Ѝ0 P&40sQ!D   @ H0@0 0 $ EX@0@bcccAC-@CP  ЍCx0TP`  p <0P0$ TP  Ѝ@b0AD00S/p@-P0` D@c0 p@q\ccccL03"R  R P2@@-/@b0#202/@bP /@- @PR\0M( \ %*0q R!0`!x0$!0^z/ 0(``b`adad`0w\  0 0#0 004 0 004 004 PHP 0 LP3 0S @D0S 004 Ѝ\b[AZAXA^AC-@M Q U c r@p 2 p0Q1 0U0C?o20S 0 0 0S 2S(@UPP 0 02220l0報@0#0$@01S3WJ@S0x"2R '.|2x2U j 0S$!0002h2820h20l" l"X40\S R   WE 222,10S 103/  0rPSr% rd0S 0000X4Ѝ1Spc k0 02P2p2ZQ222@0#0 0@0}z282墰@bb\bDd@-0CጰW@@b@-(0CၰL282@@bG-pȁȡCRU 0S $Q t!@0D0@0D$2@ $dVʀ 0! $!0!!   !0S f 0000SPR0 0 0 282202;20C2@bc@d`ddd20C22S/|@-$02020CT@b@-P@[0@bp@- @0BQS05@ !>0S o000 R 0 0p@㼯P08P0000vw2R 0 0p@趯s0 ``'0 0Pp@sꬬAAA- &1aq@T. L0SL00 ^@Z R  BRl  00Z0|PU 3S hP0 P R Qg8@,6T  @SAiacbc@bO-030#0c$M[ 3 10100S0#0˾2PU L0S¾0p|@0T0"W50a2 R z/` ?uPP0H 40\ 0S؃0$! 0Pz/ 22  u40T000T0>0S P0  0S 0CS 0!Q500 # ?d 0500pA0S,0 P: ^:pzO@&0` u 0`Pt @|T  @ `00S L_uP$ЍOf`` 0Pc5U50Hdc\bbacbcNAZAXAAAԮAĽdBP00p@-0ll@lP R Pp0Q# R" 0RR pp|bD444P00G- @`p PP\㬀P½PUU@  `R0s#0"s#R Q0Vs# |bD444`cac/0$ R @- /d 00S/ds@-80`SP 000 89%U`q@P  Ѝp j@P ,,P` ,0`0P40P0 R8@0`y #A@-0 <DcHd@-\0#202hd@bs@-@PP  J<0`0S 0 {ЍpЍp@dRSA-Ѝ@P0p P`U`dV0 P`s@-@\P  (<0`0S 0 @ЍpЍp@Dd@-Q @  0R_ST`00`0P O-M@0P0 4S'Q Ѝ0s0S0 P0S0  0 P0S0p 880p 0 R  +s0 000 00 0oP0pU 000 0(]PX400?8000C S 70S@R 0`8PtUpa  4 [=X R 0P0S(0R (0R0S x0S60S60p ; Sy 0+0 p05   B 1  RlSPQh AA0C \Q-S_S_ R[0 S0 8R>P0 0 00(0 0"E S`P  BPR7  `[ ` ,` R)hX&d 0+0!0`PS0P  ұP `Qn *0Sx0S0SI80Si6Pc X ұ S0Sx0SH`P ;P`0S  㜱pP( `P*,0P ?[ ᬱ ` Z8ER*ᣱ"`0PE,0PUx0S `0 00 0P S0Sx0S  Ā0 pP t80z4p02` 0S c:00S?0P0 `08$ >$ 0^*`0 p0p0QS8F080`04  Rp B0^=`0 ?*`0P@4 YG 4 8  4$ X@P0 4 G 4;00x0H00800P@T( 0 SQ0 00(0 0#  R0 08P@Q ` 8,P 0 Q:8 R `8  P0R: 00S 0S S`000 S`000&#`0dkd00`( P0ꐯApbAb AO-M Qp0a4S  qЍQ0sVz@0P@T0p 20p} X 00 1$FP` ()84匐0尰 ThZ `0  ]Q4QB P 0P ^ 0  XP U X `  (=4 BQ  B8` B j<4080CSE+`  F)P4@@DT4@800@8@0PPU(00ZAp00$0( {0 000 00 0gmPo0pujYS 0$<P0[ [ @`00S @8! P08004Q (0PApbO-$MXp0 H$RLPT  Dp@$ЍUQ RQX`Y`X00S0p``V @  0 0 0l@P 00 00000 0l@P  00`0`S@90SY @0Z 01 ]@P 0H!@00CS0 U0  @P00 U0 0@ g U2pP @~ 0 @P Dt0@S@T@ U@T 9hU  <0 > U* J5(%AAs@-@PP 0 G<0`0S 0 EЍpЍp@ dO-M00$0p0尀`$R ko Ѝ0SQ0s ȮPP  0X8@00m (00 0$P 0Sa V `40, [ SĮ0 0 0lP ^ `0K$P0S ( S2   0P0S0p p 0 V X0S pPl 00 ;bP\ ၮ(00 XP v0( X00'000V0040$ S4r  ,0RX0 H+f'XPP0 00W0(00 000C0 0 0  S "Pw 0 B   B p$0s) o$0sQ0` ^  P V ;(07(0倠0 00000 0]kP`@?. 0  P +'0@Apbp@-D+<0<@! a v```P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,kYߍР010804 P00F0p<0,MP`BT7P H1R0!sR g |kPP1 00 400 80@8@UpP` `84p40SR40 8✦$@TR4`Smk` `0Y8 @T2Ǫ@P @ªP۪0S1S X@T01X0| 4pᩪ@Pt  28X@070l@ #00 0@0QP P0S p0 0R  O 0$0S !0(0, w0P$0 , #$0 ! 7刪$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@jvP 0p 0۰AAwAIA&A-C-M00( 00P00q0PE 000 0g@P aT@ЍCЍ/ S?@X X` p #4X001 ``\    p @`$0$@JBPP804 \@\CRQ f%PU Q@R0 0P @@`  R XP L0@3$嫩@P 0$ X37 0 X@' A-`1V`04S "jAPp`8@T 00S8@P 4p0p8pPPUV  0P 0p0 XP Xp`@4 802#T*0 R0 R P8@hdpbAA-P0 i0 p RAi sA S s `Ci@Hi@,i@0piT˱AA AAAO-`PM PU (.` ;" S(&00|Ѝ    p @$G 1( P,00 00J P 0 10P0 00`0 0@$0$ C 00 0hdC-` $MPS@p@ ppY 00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`/i00 T @00$R01 @00-AQ|O-//0 R/ 06S/`Upb4@- 0 c ЍHd@-@0 00 #3  0 0 0 0 00   0/dp@-P@03/0@0pp@-hP@0S03/03/@p Q \ :$0@cA-@0pPP`@0V P0ScO- `0ptADM! <0 0,p(`$  @`P<<0 SG 40p0 ,00!1 0 0 0 0(`$ "<040p0 ,0@0$00'!0 00 0 0(` <040p0 ,0T0@  00!0 0 0(`$ @DЍ(AT5 5dO-lQM @p@ `0`0` 5@000 000 `0@堰0poᨂPX $pP V 0S``Vp00  0dpP Ѝ3pP$`03/03/`0S 儱c\cdO-в$MpT@P0P0P 40PS 03/0 0 0 %(,0 00#0( , 0$ 0 0$ 0S 3/ 0 00PPEUPa0 0UЁ%1!80 SH4 0000 l?;#;0 #5;B%!!  埱 QP Z0Q 0 0 O000PEP0PY3A04`0P`D0 $V0Y@ 0D00-@倠*D`儐'@P00SP00P0$Ѝcc@Bʚ;dO-M0 SQm@0pP?oU20S奰@ ЍWp@! ! 0 0000p g [`0P0劰 s0;0S,p@I$PddcWAXAUAp@-8PD@tz@`D0Tpcp@-8P@th`0Tpcp@-@PTp0/cO-0夐@crW 02PP 0С*0  00#0  0 0 0 rX P0Sr@bc@-@  00Ѝʚ;@-@  00Ѝ@BA-@0pPP`I 0EV P0ScA-P< 0 ""> O!$" (@,$[`3# 0SP@S  "! ,   ` \@  U R   4 0 ![e0Ѝd Kcdʚ; A1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P0a0 0 0P0 R00pcO-@Pp`.0$(0,0 0#   \$0 $ $@ \ 3 Q\ P0 00"0(00(,40$P \ P \ P 0  L P0@ rPpQ0 jccʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P崬0S M$000Stnp@dcdp@- x㔬p0p@Q0}/’\ \#3$0P- 8@#4ie03/p@0/dbMbd@Bc5A0S0/0G-P@M@(p(0< 0800,p$@ @@ @`P0 P000'>0,(p$@ @ @P<08 @ЍnA,#5C-Mp 0@P`` 堐/t0 00  00P 0 0f?oY20S 0S0ńЍc80< 0S 800< /Kcp@-@ @0`0@0Bc,PU 80< 0 DVbp@2cPMb@-@PP@J@-P@`0S 44q4a 0S@0 Y( 0R0000  b0 ^㎙b 0SƂ 00"#! "#1)bP3 $103$!0 3/ᖫ0 00000@000@bcMbćcb@-c끳A0p@-`Q@P0 +0`, 6bup+0` p@,bꩳAA0H-@`,M0bP0S? T$PU? ,XO80< 0 80< 嗫 ]P@ aH  @R ppD ̱00P1D H员p-W  ] !0 Yxa@0Iqap00 0P00000pEbpm7J0S 0R 0(0 0 ,P0$  R 0(00$P 0-c7Pb%۪| Q 0   P bᚘćcAA$5bC-@,MP` 㲪0 $0(  ,0p@0000 HPD` @a@U  t000000 T0 PP `ሪ,Ѝᇪ00aɪϳAسA&5p@-@`PP9I PpP1I00p@-@X0M 0@0@ @@@ W[  00@@Ѝ@HAćcdc0SA-@p`B@T兪`H Ps@P `HH0V P@(@0T@SP P0PT TPX0\ P0 X0\ \U `H@@H V P@dc@-@dX0\ 0S X00\ @P0ST T % 6T@`Hc0SA-"<p8`۩@T H0P!`P P0S OH Ѝ0V @崩@0T@S 0 |0P 0P0 T0 0 U O[H@ V @dc$5H*5\"5d@-@h兩0 0S 00 @0S   $弩T[O@/Hcp@-@7OPGOpp@-@PO@p0-@- p@ 0P` 0_0`00_PЍ@Ѝ/p@-P@9`V {`_ 0  0p@A_&5Ap@-@8P则 3 $!厙5R`00p@b0S/p@-P@r5,0S  (0 0@0(07`p@?0 0R0000 000 @0S  Sp@-0P@0ި 0R 0(0 0 R5P `pp/p@-@PPp0Sp_@-X0@SHe@ ep0S/ R/h l00hdc @-(厨 0   V0cdx25c0 ,P100S//uc庨cA-xMmp`@T嬨xЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x qt0000x0(0\0\P0 acd0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0Y0 0000 0@0i[P H0L 0P0S 0003/(@ʚ;d0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0S&P 08gH \0AQ00\0`0S;,Ѝ06p@-PiF 0@   S%0S@#p VF@@- PcT@-@ eP Ѝ \Q?/ɚ;0@-@MP P0 Ѝ0P@-@ P P0 T0S000305: 0$3Pʚ;ʚ;@-@ PQ  _ЍG-p`@M00  0`@=eP <PT 0 00 @Ѝ R  T@0@C09#PPPU 00Sg  zdP $ 0 S (0@P0R0P100Q:UGeP !S R(QQ\( 0 BR0 \00 \0 0 Q R^ 0 R R 0u{Aʚ;0@-@,MP P0S00 0MPQ 0 P,Ѝ0p@-@(MP` {0P 0S000, PQ 00 00(Ѝp y0P @- R R S12S1`01 0b Ѝ@-0@SM 0Q  00P  D EP Ѝ0@-R@P$M 1` l]]T U  P  @04 S#*/00$Ѝ0A@B@-0 ЍA-@QP  Х0!`Ap0 R pW=) -` p`U嵥P0 S00 10\00 1 p 00 00\ @@S0P S0."? Aեdd@BZ{c /d?B0p@-0M 00000` 0PX@PP  0P@0S!Q Q  @0ЍppC-P `0EQ@P XP\ ` f HUp0Sp0 0@S((0,0,0p0 p45dd0`0X00CS/@-@8~X0S000S(0S, , " c@-@X00CS@<0@-@00S &R, l00& 00@CdA-X0@0CS8CPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0cʚ;ɚ;6ep@-P0S H LA  R5k9 SAUt $\RnA#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A: P8A@-0 Ѝ䰌 A-1`PU 0FS0!RX00CS 0S 0SxxS 0oHHL@LpH@L@PPp^P@HL@P0ɚ;6eO-4MX0YP4Ѝ0@S`p3aP/aPP`ATPW 8H0L 0P0S# X 0BQ%SR  H aP H0 L0 H0P L RP 0 H0LP p YS ~ HaP H0 L0S H0P L BRP T0SH0LP0P0S0 $0P0Pɚ;6eʚ;p@-@HM` P P1U(P0 0WPU (HЍpp@-`V 0@S@@P(P'p}"p@-@ M P  Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M  c P _$Ѝ0Q/ЍO-MP`_P_P@p0 0PW 01S 100[%T ?@W DpU0 @ U 0  0t pxP 40匐P@@Ϡ0H0L0P #0 RQ @ U U% p FT#>H_P H L d0H PL QP H LPV?6e8Aɚ;C-P`U@p,M0S U P ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@bp@-@`P20SpuG-1C0(q%@@XP`X R00Ga 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#3:xP(A Ѝ (($0P^W녴AhAAS5cpA 00(1 (  S !$00/@b@c00/A-@p`Pp ` Ap@-P@~ p@p@-@v0 0  P00%pp@-@Pe0 0  0000 T  ,03R p͞p@bp@-@`PD` Pp@@-@=@弞$A@@-@40@@@-@*@婞@@@-@!@堞A@@-@000@蔞p@-t1(AG 0XP0 0!` \ \\dPd\`dP:C$ `C/!P \\dPd\`(d( &C( `/!P \\dPd\` d #AU땴A 0S // 峜d帜dd@- *Pd0@-PM@U0 `|p#000p"P0S[VЍ00 R Ѝ@S@Ѝ@꧴AdٴA0O-,M  f00 Sp0 R0#p!22 0#002?j@T   T QT PP  R0SLK03/`qP L,RV< <2@ P0@_@`2S0' T0/ P?#1P0 []`0 ;f[ 1 !/0 0`|R,Ѝ0S dR`WXXR 00  PP03/`P ,hRV 00C S!00CS#0S$0;S~%0<S{i< t0`0@_U@n0h  T 0P>RHTf Ad)AAbB_cHA~AA(AQõAAD10S/p@- M P0E 1@TA 0S P< 00\?0`P0 MA@RQ%0S < 00\ 0R i`P03/PP $EA@QU ЍpcdblAyA p@-P@{p@y@-400S (峛P@Qi@i\cdAp@- P@0 ,U 0D P@\p0P HLHPLTPTX\^X05\5 0AǶAdA-`@ 0 0qPUT9@`pn YWp0SPT 9@d O-2DM0 S@3 #1U3`p\0A (0a800,$  P000㈱|< 0a0,8 ($  P0000< 0a0,8 ($  P000< 0a0,8 ($  P000< 0a0,8 ($  P&000L 0a,($  P<08 'DDЍO-3bdAk5g5O-p@Mᴰ0T` ^PP(`` 0 X J*AXX 0" 00 0000`0 0=Ѝ@TA@-@ @@-@@ @-@@G-@pP@B $`Y030#T00S d`4!M8#8#40Ѝ/@-`0F S#*@\Pb I0 0900@0<< 0P@TЍpA-@pD`@DTPH0U090E0U@000E-0,M$00 0 00 00 00 00 0 00000000 )P,Ѝ pPR @> /T`@ A@0@~0 @H0@x~ЍpcdǹA 5@-d@0P 0P H G0P ~0P  G@/dҹAp@-P<0@Tp0 R%P @cA-Pp@P`  0RP `VX00PW@ G0S PP00c0@-M@PPP, +0QPaUP 0S   p00S  QR000 !R  R 0PЍ0c @-@x0P@tp@-0QX0P@ @0Ppp@+'Pp@TpcO-,MP`PC MpP> P .Pf. 0@00尴00a00h0l0@P0<043\0 0PpST U0Wp00 01S PU 01S PuG@,ЍpW1 00S00C00 001 . 0S 0R d! .Pԏ!  G!00S  S0 Sp 0p%0%0 UC0PPC&P PE0S  H 00"0CQ 0 ⎏\E$0  X0480080<00<00S 0 P5.D0 D 010 D!'0H "HX HPep  .L.00SM  PPJ 00 X1 `P. 0S  0P0 epP   R   Q 0Z lBYC  LH8 0A Pc@b@cA6A>ALAXAfAuA~AAAp@-@P`}0Pp p@0/A-`0@Pp t Q A 0P1 P P O-`p0004PUX Ѝ@0SP  R@ 0S 0CSP  0\P tP [ 0 ;/P c d0@-M@P Ѝ0O-@P`p||0S Ѝ P @pU 05/T O0Bd(c@-@ =0d000uE@}dA-X`P>X A/p,@,%,0p P0@,@Accd@-@<P0 SP T0 0D X @T@D@@Ndcp@-40SXxFP`,@400(0P `L  @L@p@0ꤺAdcp@-h0P0Sp@/`,@4ԍ00(0` PT  @T@p@\cdc@-@LP00CSP0 T X0,R( X0D0X0T D@ddcp@-P`ᦍ@Tp@pV0  4 R SD   ٍ 03/M, 凍0@dp@-@$PHP(p@cp@-r`P@Tp崍={ R0T0 L 媍P 03/<0(E,QdcֺAA-0P0`SxpX@ 6/P0S 0S @T+@\0` P0\dcA-AP!A@0S-cQ0SK`XPUKV0Xa0XPI@L1@0 X $0S PyCAT!TA0B $CvAp @0R :<RP!`%`56/@@T 6//0t"#0RC6/T@3/P0 3/P` R0\0  }+dc0BdAAb<66AuAMbA$0$$08S 0  dd5ddp@-@PH嗌T 0S 0AT 0 0 @όp@c@-@LK,A-P`ywU㰀q@希嶌0S 0@T 0 0d0S\0S #S`0S (囌0BNd@c@bG-MP8 `p@PHD 0S0 0,20SV 20SR gCVQ5GE0E014XXpPt0 00r᱘A0 03/HT\4C4=-$P`6V<0ID77VЍD D EW 7/pP 0R   P0 4S 0S pdAd\cAcAdc dAAA- Mp` P @P 0 A@ ЍU H00S <00S B5/ 1p/Ed\cPA@-$M@P8 `py0 $Ѝp@-PM ` @P 0S0 0(0 03/8800\0qB zjЍpddc L0*dG-@pPPU`0S23`0p0{APP \RUL0 0 4F$(`P6B?PЍb0005=0S0S<0K 0SH 3/PPD0e0<00<0ӊx!L0z*h4P 0(0S 3/4Y.0S  D崊0`0A50U0C0   S(0S%_-P   CP  0R  P 0S0 4S "+00d@b@cdcAϻAp@-@Pp@A@-@P 7@-@/Ѝs@- P`@P 0 0@ЍpCA@-@P @-@=P@@-000 ЍP5@-000{ Ѝ䀁5@-000 Ѝd=@-000 Ѝ= 0Q/P /@-00 0XP ЍP5@-00 0NP Ѝ䀁5@-00 0`P Ѝd=@-00 0VP Ѝ=0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0<0`0<00Sʸ0Sp@躉@?@-@x0P|0S@/|/A-`@ZpȀ<0P 0S#Q003P0 000?00C0u@ႉ@bp@-@P200CS00d@p@p//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS A1'0`S0Y030#@D 0Shl`}W ' P0!!0A-P@l`hpT1S S@ R Tjh@l@NA&1GQ @p@-P @IP0P  $     PU $  U p@pDQ P  80R 0 Q }P 80R 0 @ccp@-Pڇ0 0S S, S@t@pm@P`F`i`V80S@[@P``W` 0V80S@@cp@-P`@P P p@@-0@Sl00@s@-A_P 00` `@t000TЍp L @P00P@@?d$A'A@-@8@x@-@0S,0@T   B B  @菇@ccp@-M` P@P U 4 @Ѝp R 0 R G0 QS8  %PPPP cHAp@-MP` P@ Ѝp U @P C-Mp `@T ЍTPaߍbpTUʀ 0! $!0!!   !3W@ 1r*Taߍ@- |!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`- B0zcbhd@b@d`dddd0b@-$008 @qHH Ѝc@-0( 0 08 <HH Ѝc@-(0  08 @HHЍc @-} 0cc@- }0 @$~ccO-t2,M@T@ `P\}50S D~%@,Ѝ050404080 80<0$p<0@0H@0`0S^}@H R 'BL\0$ R*0Pn#TH H L L $ p0Nc#H00H000W:0H[ }P WQ*HM&0 0S 0  BR %0Sk) ,0 0{ 0h?B3cPÿZ 0$ 0 1p,}(@Rq\cccMbA-\P@`T.}50SA<p}$0  B2#Hp PDPccp@-<0@P4}50S DQp@Q}ccp@-80P@0|5@TA}p@ccp@-PP0P`|5@@$U@T ,+}p m #}pccA-@`Pp|500#T0S l}$ R$ .HJ0} HU 0ccA-`x0pPp|5@$V@@T L|0S0|$ W%H |ccp@-80@`0P|50Sp@|sccp@-00@P(n|50Sp@|Ecc0000/@bP/0S/@-0\0000C00S P 1 !L0 @0C000P0 p@- R 0@ Rʠ4PQ BP P0 h00R Pp00000C00 0C000 0 p?AZAR> S$ @-0@(M0T (Ѝ@Sl03100P (Ѝ@0 00!4 Ѝ0 0  /(Ѝ/R>@b@b S& @-0@(M0T (Ѝ@%t03100P (Ѝ@0  < 0 Ѝ  0(Ѝ/R>@b@bG-p@ࠟW `PU0``0C00S 0WP1R 0S0 P0pG0000C00 0C000 0  cR> 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q  0R  ^P 0 @T   0S  R `F P0 Ѝ  R>@-P`pr@P0  @ Ѝ@-P`p_@P0 &@ ЍA-@`pzPPd.{@Ѝz<@"{, {T0 @nac\ '\ G-`p0S0 0 @P202@P0 S@20C22S ㆺ1 0@b/Ḱ/Ȱ/аװ/ް/M0P PЍ/  /M0PЍ/@- P P R:H0R 0R  0RЍTVRPA-` pP@Tl@lpT: X@0 8/P ЍPP XPPqBTqB0S 00/TVRP@-@ 00Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</0S= /<!@o/D0/P@/@/H/P/P/@-oP/P/@-oM0 Ѝ/   /@-PMp`0 T@PV 04/Ѝ@-0`S@ 0S0000000HPP000 @0100Ѝp1 0S !S_.B"B(BPP OPT10L1P) =3;0P? 6;0P`V) 0P 0P`V 0P60S ,P nP  00@T ꈿAatadrbmngnts@-P @$Mp`TU80pP@ 0$Ѝ WP0P@-`Pp$M@  p PAP $ЍPUP~ 10SvS q00T00p@-(MP`@ ` Ѝ P(0 0CS"00 "` UV000! R 0 1   0RS "(ЍprbmnxAp@-(MP`@ @` ЍP 0R  "30%(Ѝprbmnp@-(MP`@ l` ЍP0 0CS00 "` UV00 (Ѝp1  0RS "rbmnA@-0 0 0  00 ЍdЍ䜿A0@-@P$M ! PhP$Ѝ0@-0@-@P$M   PRP$Ѝ00@-@P$M  PAP$Ѝ0@- Ѝatad0atad@- Ѝgnts0gnts0@-,M@P 40P 0PO@o,Ѝ0loob@-o@-@ P@Ѝ@-!o@-@ P@Ѝ@-0o7@-P @(PP@ Ѝ0p@-P M@`$`P o Ѝprbmn@-,MP`p @w0p ЍPP@,ЍrbmnHHHnHHHHHA-`PpP P1 10RQ0P W4 @0 00RQ0@ AV ` 0  0 0  0!W\P0 00  0!V@%c%cPcTcd@- v@0&-dAO-M @ 8PRP@P t`v0ZV 0S $4$0S?0 SJ1- @*Q P 000V 0S000S00 0R0SRV SR !R @vЍ# !RVO!RR 0 S  X 0S P  0 0R P 3 !2<0䲟 01S  0  a0S "2"0S 0 Sh, @!RR 0 S  0S P ܱ 0R P 1 !p}1z<0儱 0Y@  q 010 0d 0!0 S @K P%  S! "+0 0oP}  K㌰0 +P X00 P 0 0 0 0  @PcTcd%c0B%cƿATcPc0BAXcp@-@Pmu@p@udqp (0 $00P00//%c%cqp (0 $00P00//PcTcp@-80@P(00Pp!Rp%c%cp@-80@P(00Pp!RpPcTc@-@uT00Sڰ001S 000 \^  R @PBu@ 0DP8AT @/ud%c%cPcTcPcTc@-@P@PtL0H0 0P@\@u 0dPcTc@-@P@PtL0H0 0P@\@t 0dPcTcO-PP' `@pt0S000Z.  P% 0 R 0 B RPUltPh00S\001S V  60@0Dt ЍpdPcTc%c%cO-PP' `@pRt0S000Z.  P% 0 R 0 B RPUlwtPh00S\001S V  0@0Dat ЍpdPcTcPcTcp@-P@ T t00S001S 00 0P\ 0S @P@l4tPp 0\ RP !R P< J4L @tdPcTcPcTc%c%cp@-P@ Ts00S001S 00 0P\ 0S @P@lsPp 0\ RP !R P< J4L @sd%c%cPcTcPcTcqpO-p Ѝ A Dp-10T00aV` .V @T! 4/ppU $0`Tx0 PU QU $@P 000 0;/ 0pS  0B%cd%cA-pP`P ^ 0pA/A-pP`P p0A/@- @P00$0 0000/cA-pP`P p0A/A-pP`yP p0A/@-kP(@-eP(@-@_0P 0S @/A-aPPP a0A/p@-PB@Pp 0Sp3/pp$Ppp@WqpO-p Ѝ A Dp-10T00aV` (-V 0@T! 4/ppU :0`Tx0PU QU (4@P 000 0;/00pS  0BTcdPcA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ P@0/@-@0P 0S @/p@-P`~P 0p@/pA-pP`oP p$0A/p@-Pa0P p@(0/pA-aPTP a,0A/@-GP8@-AP8p@-P;@Pp00Sp3/pp4Ppp@>/ 0 6/O-@P(0!夡M#&0 1 09 ⃡p@Dtqa` h(dq0`P@0 0 007/$08`68>6;6p@-P<A80@T$嘌pZP @(dcA-p`P@XP aHx0000 @  000n$dcp@-`P0STc@,R8 040, 00C0Sp@$d/Ac(dp@-@P  ߵp@>(dA-@(M`1x0P |PU0p SZPU=p  0R0 00?Pp *+P 0DP0S 0P=9C =CP 0x@(Ѝ@BO-@,MpxP `|倠PY XZPU=  R 0B000?P 0 P0P0弰ZP=J JP弰xhPl0PYp``XZPU=i m 0R0 00?P `0 P0P`<0嬐`VP=iF mFP嬐`h@,Ѝ@BG-@(MpᎴXh0l `PPp0`VZPU=i m P0B000? `0 P0P`0嬠`VP=iF mFP嬠`hX Y? 8 < 0# 0$ 0 0$ (Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /p@-@P@|0T00  0pc 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`ddd G-0 M P   @ p X@`lP X 0000 ЍG@1  @Pcc,dA-X`PpW0S8 Aq P@m@c,dNAp@-@P0 p@cp@-@0PD@Tpc@p@-@PDPpUp@00@p00S:/c00S:%/c00 R !uc0 c0 c0 gc"111/"111/ 211/ @-L0!0\Q S0c,0 0R/Q0 /c@-0 vocD0 0R/@- 0Rc <0Q/1S co `/ c @-@0^1 0 co ` c40@0\/@- 0\ c40@0\/@- 0\  c40@0\/@- 0\ cA-@`P$0pW@Pc 2 2A-P`@$p0SQ @cA-P`@$p0SQ @cA-P`@(p0SQ @cO-` Rp;:Pа$M0@T$Ѝ0S:?T@ Q; P 0 ?0@4'V`1  L      T: 0I37<c@-@0@T t0Ѝ@\P0 1 8*b0 PЍ`c@cdp@-P@P  p@-0t  B^\  @ŠP0 !@0. . )`c@cd@-0+00Z,@  0*Q@cA`c/-@- p$P0 P@~`0 P Ѝ@Ѝ/A-pP`D@j0P U @0p@-@`PW@P  y00p@-@P @{PA /R/qN/@-HAN/@-BA@->A@-:AN/ 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-`PS@0 0/0 p@Zp@-@`q`@PP 0 000 Cp@`0@-@0s@-@0 PЀ ``0 <**B`0 000ЍpdR6p@-@`Pᾞ0S &`0 0S 00 Xa`p@蝠/xldG-`MpP@ᰐnP!0 3 0000X0P3/H3 00P00 [Ѝld@bAA6AAp@-T@d_\00 P@ B?"@U$ `p 00C0/(0, pd@-@ _0@ @@_pdp@-T@`_ PUP 0 001`00 0RPP_ppda0@-$0P 0 0" Ѝpd@-@_0U@_pdp@-A@ <`Pq_0 0RpU@_ppdp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \P;_0L$PBU 0P{_Pp p@ !0 p@"|f~fpdxdA- pM`P_| 0R( p@T1 00S 0E0C@S@1T( T@# 00S0 Sph?_ P@L^T W 01_#@ЍO@P &_pddp@-@T P,0,h0^ T_pp0ApddG-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ ^ ` P@U`1^V @0@0Ѝ 0`` 0  00  00P 0 0廤@PEUP!U @ ᣍ0@S 0 㼗T0p`FP@pda0dQ/p@-P0 @AlP Q PP h @ 00H0ppda0O-P@p@-QU@`PpV 01p`U 1S 0 />A-P0QppU@`P `U1S0 V />G-`PCu1pS03/GP\ 1Q  /013/ @a181@b@-1R001@ 1S @_ @ 1S/ X@-9(0@tQ 0 @@b/>1 2/ 4O-P@80 S2Ԁ<0t`̠Wʀ ! , !8!<o S@@T`臁 13/ pddG-p0 @0 0 P  (`,(0, 0/X(0, 0Q r000C00Ѝ 0$ 0 0$ P@  13/P pV 0 xPPAR>A-@Px`Q@pPEPcEf804P"8%< 40R:AKQzp@-@Px`PH0,PU< 40R*p@4Qp@-@Px`P0Pp@*QA-`@xPpP? 00+0`@`PPPEP0pE8A Q//\00S /@-X <!t  L  R0S c@-P@PdO-PP@4M?4ЍO/lR5 pR5 cR sR` SR0 RS 0S! X4/X0V0l $ $00 0000000L0 0H00<0 0 4/4Ѝp0`pttb(4/X E4/<0Y0804 ,4/P00@$4/4/00-4/Z 0S E4/ 0S 4/ 0S 4/0SJ4/Wx4/X Pp 0FNP `` `0``` ``p$`0P Z`\P,4/, 01p4/U4/Yy r4/Q`Us  4/p0X:P\4/ r 0D4/p4/AAAAAAA&AEA8AAAp@-P` 0@Tp @cA-@xp`OPU  PUPU  lPP dP POP WPP@-M8PQP1 ! !1@11/ qQa 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    +DcA{AZAtAA-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/|d-@-T031[  1 0S 00 00 ZЍЍ/@b-@-T031[  1 0S 00 00 @ЍЍ/@b-@-0 0001Ѝ Ѝ/s@-P@`0 `"Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@ed@-@P`00 `TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <&!1 @P >`Ѝ 00 U00S`C 0S. z,@T@p T @@` 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 ADcgfffA@-< 0 0 0,0; }@ dtA t@-@@-?@-@P0 @ @ @800S @ @Ѝ0@ Ѝ/|d0Q   AA@-`@P 0 P000S   oЍp|d-?@-@P@P 0  000YЍ0@ Ѝ/ 0S JP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@Md0 4 0 000 [Ѝ@ Ѝ/A@-P`O10S A3S  lx~PT #T212@00@00A0S<$10SA0 00S 0 0Q000 Z#p0 Pb 0 pp0 0S `0` 0Q01bP/0 `@b@bddDcdtda0 AdAAA-@-`00/s@-@P`T 0 ,@J0 `Ѝp@dA-@-  ЍЍ/-@-00` Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 `$00S Ѝ@2 ЍdAd-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`BT 0 ,@0 `kЍp@9dA-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0  0SЍAЍddAA-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p$00S Ѝ@V ЍdAd-@-  ЍЍ/-@-00= Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_F8XF@(p F01 010101/A-a(P!R Ap@1!#880Ro1F$1 q0$12020sAE@-`R( q@_ET0  (0!R@D!!!R Ѝ@FA@F sP EE Ѝ0 00tP Ec_^p00S/@-`0`@0S@0D 0 @0D E@0D 0 @0D @Edcc|0P@-  !T LD.!      /@b@d`dddl 0CS@-T0 !< 04 ,   !/@b3A@d`ddd@-魃P 0P@bp@-9 0P@9OoBPp@b$0 0!0 00 /@b@d`ddd@-<0DT 0 !0  !@b0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@l DPp@-@ D @i00/A-@Pp` i00$0@p#0 rA@bA-P@`wp R0S00  0S00 Xx0SAA-@PpY` 400@000#0 <A[@b0@-P@`xpM00Q ` 0 T 0S0Ѝ9D {D[c6?/0 0 1PS/ /@- @D00@-rAG-@Rᜐ D PU``1S `V PQ pq  0 P00.D`6p@-@PC0S` p@D0U* `V 0a@-@@ Cp@-`PC@Tp00C`0S   0SCp@g s`p@-@`PC@T 0S@A @CpP/0S /O-p`PzC0S R 1 ЍOCCiC@X:C 10@XC@T R ACC  ЍO  R !  R   wCuCT  ЍA@- M@ ᧓ 0 R0 00CS0 R=9 = 0 Ѝ@- M@ ᅓ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ :0 0S 0  AQ0S00  00u Ѝʚ;p@-P@P@p@-PM@ 0 `\0` p^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00,ʚ;A-qP M3 BqBT t13AT \B@ ЍM@^B000 dBB 0 000@0 0@P! /00B! 0㨀!!3Ba4BT _2PrBp@zckB! @ 00P P@I̒ac@bʚ;@-P@ 0 00   `pP10e 6 0S0  @P0S0 0  00Ѝpɚ;ʚ;C-@` 0M0RPЍ0 QPP pYP  R0 AQ@XPP0 00S2TP Ѝ000 @ 00@- X( b0A*(P Ѝ`c@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@P8 X0P4 R0 40 Q Ѝ0@f0U @-,^ :@!!<  12@X0 0(`cX 0 p@-@P8`Qp@81S3A-@pP`80 00@8ЍO-s,M@0`PVP`$ 0+t3B w8 s8  o8404#C8("<pXw/ 0C0CVp40 2p8<000Td0a@PY `h A8d0H0> T`X` 0W0J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,QS1011410Q&3*`5WpF&8!U. P0`Pd PR0 5 0 PSD d0 $SP= K@,Ѝ`QH  B(`z`1QES 0 @AP h00<  W0O< @@ QF? P q`F pఃd0 qL7( @,0,@SI$1((0(17`c8ddA6D6A@dcA-@p0 M`00P 00 0p0@N0 00  0|0p0@0 \0\ &P(X00@0 p0P0  Ѝ 8d6A6'1&1`cb-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-A00@-M00|0|@| 0x00c00PP X ) 8倘40 0 Ѝ0@>A8d6AA6b,,00 C#' ,00/cb00 Q0000$  B',#  /@bbA-@PM` p60 0 0! 0?P W 0  \ \0P  $PP 6Ѝ$ 0  0 P#NA6TAp@-P@6 P6X$A-@P6t0 3R 0SP` p!VU A6S0@bG-0P3x0@ h$T6p `V 00 06`03/V>60 0 0 s@b@-@G@Q@bs@-0PQ0 7 0@S 60 `0ЂЄI 0S O66_ @Ѝp@U@b6O-0Pp,0 `0@ `F`! P ⬅(0P@0 0 PP PUP@b@bp@-P@5000PPp@50@S@-%0 /WA/G-@+ p尐Pd嬀Vʀ 0 ! $ 0  .!4/ 0!d!0    !4/@b@d`ddd/@-///p@-@P^5000CS005p@ p@5p@-`xMV 0@S x P r000(`(0=5 e5xЍpacC-M 0`p` @常P0 P 00 00 0 0@V{?o2P0S RR! %*ЍcC-M 0`p` @券P0 P  00 00 0 0@&{?o2P0S RR ЍcP  0R://O-0 ,p`@\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 0p@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 Rp0 0p R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`1@1(p@)2p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4MX1 0SPX 1`%ꔰ[Y( v@`@P  (@`$ .10 0`P ( q14Ѝ@A$@(`&Rl00& 0T0C 0Q `1h 0l0P$0hP P0$0M1 @100 E14 PU T`h0Ss`P@$`(Pp@-@ $0P0P@ P00P0@PpO-pP`$0@T @ 1T 0 1000p 0,pVp0 ЍG-@Q8@T80S <`0P@0U:0@8Q080D0@00~0GLB80兑P p W 80 0   2Pp@-PL(@y "0D0<8@0 <N008 8  0 S  @0F080S 0p8@0A-@`P$p20h`0l0@h00 00 00Q0m0p@-@$P`0 @T`0p(0S H0SV0p$P 0$0SI0@H RB0h07@-P @P@P 80S10@ Ѝ0<00*018P /p@-0P@ PP00' p@/A@-@/@ K@- @/0 000oA-`@p/ 0S P a00 00/A/QU q/00CS0/`/@-@~/X/@s/@-@TP 0T0 @ xe\ e0@-p0 0mPP@`TV P Ѝ80S /V  P@00TP TP0 <0@ 80}/V  lxe\ e18P /O-pp3TM`3@ -]P00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0^P @@ g   Hp p.X L尵T]`P@ `P80S .00 000.T`i @p`~D0<.80!0S0 80R1``80a8000..$ 1 P 0R,:. 0 5 @#T 0T0 W W  .T0T0TC0. G.0Y00000.1@bxe\ ec0SS  S/@- @P1@8@- @P1@8p@-P` . 0SS 0 000p@A.0AT -0S 00 0$00CS0,.`'.@-@-0TP0s0XT0.L$@z@- @   0 03/@P0W0>   X@ X3V0 0,Q *Q :@  0  !@001 1 000       @w#000 S 0* 00C 2 0 0 00 3/@PY 0  "  00 0 0 3/@P 00 3/B0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  (0`S10 0P@0+O\@ 0 03/0 0 0 0 00 @Ab~f}f3{f@|f@-@6P p p@-@P)0P @ 003/@p@-@M P WЍp@-`@ 0P @ 040S-@  3/@p@-$M@P @, 00`V-@% 0 10 !0S! S S@ 1 000 00p q* 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  nP0000Ѝ7@-@P mP @WP Ѝ0A-"0`p SB@ pP P`0 @  O-@oopb W T0!03SIP (0S0P p(0SY @ 1!H  @@ PU @+P-dM"h0 (00@#0 00 ,8;dЍ,67A-0P`p@0 TЍ@- #0@-G-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;0 ЍO-`0#MPܰ" 0$0P @Ѝ(0SppzW @P (0S0pWpWpgW @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 L-P@x  @q0  @P @g0  @PP ([1 01  0109 0PPQ`,0 @ @" T,67Ep@-0PS@`M  gTP0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqP  (0Sr[X\00X0 00 ` X  &0 J&%  0?&[ AO-0p IR@4M, [P  S@P!@T  S@P @  @0` @P "T@ 4Ѝ?@-@%p0t 0 0x0 @%p@-d0d@P%&r"0@3@#V%pp@-d0d@P%h0l (00, @@V%pp0p@-Q@ 1CQ 1CQ pPo%h0l 00010%p00f@p@-d0@P0S S p80`h0pPO%m%p0@`AAp@-@d0P=%@]p@%p@-@d0P1%Qp@s%p@-P@P  @%pp@-@P` >%&'00F= 00'`P000@0 7%pp@-P@$A` h0l 0H0` &r0`3:0@%p@bG-0SP'@  pPP srF $h0l Y^:0 h0l 1u$A$ЍX#x0S `$P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PA-0SP-@ `i$phl 0 y0S 0Q h0lt $@u$  ᧨PX!x0S P$Ѝp0t 0 p0t p0t P0Sp0x0 t S PP #PO-50S`5 P`P-00p嬰 0 0(0 @ #@ZH W@00y0hl`{t%+  @{ 03}00 ЍA@b0 0R0,00 0 0/ˍp@-P`@t  RZPppp@-P@L`#U<<{P@P PPP@ @#pcccp@-@`P E)ZPpQ@-@ k@ 㽒O-`pP(@T 0(  Y }#$Z # @ #IPW(@ X `#$[ # @T 0( q p,0H0@0,0#PPp@-@ⷨP@oЍ0P :0Q:///0/P$ Qp@-$PP $@*#p@# #0/P$ Qp@-$Pp@G#P $@*A#>#A-@`PUD,"jP@ 0S 0Sz00!#T0`"8P40S$p#"(PU "#P"""8 A@mF E1YPcccA-P0\!Qp# `!0  ᴋPP  PP0S Ѝ@9@P P0 0$pP^" 0Z"804P(Pt,0Y"0S``cT0`0 }PP`("U0S K@bLAcccO-STM@xp|N `PP#@E W 0S@P;0  00 0  R0 0200p f@P(P !,UH4@L@$ ! P  5"#@P ,B!TЍ!,048@<0P80,0" "@`!H@TK 4@TH VWm H`P0  RS> QQ< <`4@0p!40S@  @004PD0!0$L0!!!!!!@0SD  D 040S8!!@!T0@P0S 0AQ 0S 0 P  ,#P`,`ɚ;6eTAʚ;G0@-@M0@d QP#!0  aP@   r@ T@Ѝ0@bA-PR  p@P `VP $!0 pPU!(0PЍ@P/@-MP@`vP V0 ! 000Ѝ"RS+ P `V $p RP2U0!=0P  RR   .!2P2U0!P!SSp@- ( 0 @PZ p@VcLA cO-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO10P ,ЍO;0P 0 $07JY )P@/ [, $ @P&$P "Y 0 0 0` ,$`P > P :,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P \@Pa0+ S0&%&b"x1Y, 0 $0=@PM$ 0RXP 0 00,P[2 *"*kA 0 BQ    "0C?o2S0S0S000  P S00S00S wPP IPN@H,ABAGA|A0@- 0@SP$M  MP 0 P     $Ѝ0 0 R  //p@-`Q0@0 QFtPp00p 0@-@ 0P  ^NP XNЍC-@$MP 4MP 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V bPPPa_X V  A@BA@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @WP0P4Ѝ@bd@-P@`P 0 Ѝp0 ` O-R@|M PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@` cL@P V  8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @WW (( R LP0DWP ᩼ s@@bd0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0h3 5NP 0PED00S 0 @VX0P4Ѝ@bacd@-P@`P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@`  UK@P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 M9 (0X0B 0 R  @:V᣻ (( R LP0'VP ጻ V@@bdac0@-0 0I ЍO-1PMp0%P P @@ P @f  0 03/PZ  Q@f [ $/ Z  P 5/PP [ $/ QK P R 0 iU  ۀ0 S @㻀 0 0@̀ub xz/  A$4` 0 , $(    TwIf rdAedAedAd}f~fg~ AG-pM7 P ㎺0` SP 0  @,ᡀsЍ>    7K@P  07 000LP8'7  (P0S6  S1#U S1 #0 LP  7@P0@7 L@P  7 T0 @LPd ᵟ@PU @[P0 HP @HcOA@bjAA00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0@b/p@-P@X_ ֹpG- P @`$pX X X@(0WPP@ ?0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0 -c@#MkRЍlpp~Np@W02A 0 @  01/@A-@`Pp 0@G-pP@` S!@"0R  2  00@ 0@[0"(0  ,0`$0 @A-@`pP[ ᅉ 2`p0#΅"^0@@}A-QPp Q! Q`+i`@2` R`   Q`02S@20JC-Pp`2 ; Ѝ S @ R0P0@A`0 00a(0 #Xj 0R P A-`Pp S@"@Q  0" R0Q@H0 00a 0@ "%jЍG-`VP:Pp L @ [י 0 LPP$!i2 022PP 0 ( h @  &a  00Ѝ] AAG-` R P0S0R@9@ 0+L@P)V  U @$P0p sL@P}P`@ P0 Z@ FpW ͷʷO-0TMp$00S00 0G`P#`TЍ0 05L`P0a 0F`P003 ``3 1P00GCp$`W[3pWb Ⴗ~0`op@⫲W[<3pW4@T0,0 T 1 #0p$, G,0 @Tp00P00S Z 1 !, G,0` T00P00S U 1, G` <9VP P 04PG{0`$`P PPp0`$`P PPp  hi R<  <` E_i`` P  R , (l( $ , 0 0@@00 0$0000pu  S@0`S@ 0S@ x>10Ѝ0@-@M P  P & DЍ0@-PM C@P  p@P @p0`S  0W000Q  D@ЍO-@$M 0Hp0` HPP  PP<@ᩡ3 Py@P   (  , ^ R !W$  RR R0R PzԳ@ @c8`0j/ 0R( P 0W`0" ₘ1 00 0 100嬡@VpP= @"  P $D1 00? 0@0 4<00000 P  Py0 00 p>L0 T# $Ѝ0S@P^voe`rτn0X@Sk/1!p@@PFV0cAAAo @cc0p@-P @`M P  BPAЍp/G- p0`^PP PK@nd 0 Sj$0SD `V10 c /o 0b4 baQ  S  !R!0C31$00C$0[ PC d nU 40  FC?oW20SP   ;CP)ЍV   0P P` `0 20y0"20 #P<#(P@- 0000@uP 00Ѝ0@-@PP$M  AP 0 _P 00$Ѝ0O- 3P MⰰR`)0S: S: Y`  _@ A`P 2 # P `P  `Ѝ rdU(`; p 0S:$ 0REXc00 40h!  @ 1@1181$0 SfPU `x0S P x z|0 00$0080匰$00$0y A(`  VU 0 Cr[ 0A P `P   P0 #R< # 0S000@@ P0 0  @@P(`(`lccac0@-00 Ѝ@-@PM  @PЍp@-`0SA 1X03/5H0HSp<5H0HS p@ !p@QD@bacC-$M@`pHdPP @ \0 0@0 0h00<0p `0000@0@P ;d$Ѝ4A7A-`AMpI 1PT @@P*0@& (I@P! 0  0c? 0  0@P BA@TЍ@-10/10/G-Qp<j`P}@W0S P0 m @@P P @]BP P0P@@G R H@p@-PA+PP>p\h7pp@-@Q@P)@pFP0$P R J@B@.@s@-@Pa0 6@TQ  @@Ѝp@-p|M?WP$x AP` ̀00`0p 0\0$Xp0pPP W ?P |Ѝacp@-@aPw1S @T 0S 0QU00001501 0S  pPPO-03pP@`ᄠT P 0 S G y@ 0SPP02P0@b@AC-p`$MRP0P P0C{P0 4P0%@ RP0 0  0"@P $Ѝ0( .G0 ` eGp@ #P U<@ @U  @b@A@-`@V  >PP  ` 0S  PQ Ѝp jP P0 ?\C-@MT;0 p0I S@#* aV PZP >@P U PЍ 5@A-p@Wq>0P C@P ?T0003ak@P %@ $q$QW@@b@-0P@3UQa@nPPЍp$Q  Far 0R # C@b@-0S@P H?ЍG-pW@ PP F0`0Sp Rb@P0S at@/p@-@1P 0cs io$ Q$180p_p@-`R" 0P1S 0@S PpP0  00pp////// B 0@Ps //Q 0S P 40 P0@1S///d eA-@ut03@`P |0S 0 R0`h`d0P0U TpH0AD0Q00C0 R0 Qc@bac`cd eO-0@pPDM(0( <00,p$@ @@ @`<@{Y<0S% 0 00< 00000'>0,0(p$@ @dYT0P0000,(p$@ @ @P< RYDЍoAd eH7T7A-@pVW 㵭0 P`㨀0 V:,!T` V 1>@`嘭*WЍ0`1S 0 + _Acd eAC-M 0@p` PA$a0 P 00 000 0PT?o2P0S@.0S@*VPU@$ N@pU*0!R0X  H@P6@$ /@VЍd ec@-808@ P 3  @bd e7A0@-M 000 00 0p@P@,P 0R `40 S |u @ R \@0`80c @K=@P Ѝd ec@-0 000 0 000@tPЍ@Ѝ0C-Mp0 000p0 0\PQa V  0RI@P0P X@ЍwP w3pU W @0U@ PU0pPpU# Q  <@0S  P ӪP d T @ Q0S 2>4/ Q@bc`cac@0G-M 00 00 0`P@ hg pP L @Ѝx4143P@刀S 0S S@ u`q tp P@ TQ  j<@u`L@@@' |PUj Y W 1S 0ሀ03Qc@bac0"!S/ 00/P /A-L0C@1S`H1P @ATA/ pq`@@b00@-0BRUbPEQᆢBDU$XQW]YiP @Pa0X i 90Pg  Z  0!0ЍXWYPELD  g90P;P 0  Z90P.P  N90P"P   B90PTP   490PTP   &90PTP  +zW < 90PY 7  90P0 01 0100/oX" R0   :0/oW" R  90/oY" R]  ᕰ 90V y  y0U@bAp@-P@U`0M  8PPP  8P P 000Ѝp@-@PP4M  8P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PP l8@P81 00H@P t9@ U Eߍ@bA@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  )8PP P   8P0(ЍpE/08!PR/p@-SP@HanP@10D1@A `0p 0 pO-0`SP 0S 0@ Q @280SP81^0S ? @0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00~    0 b@UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍO @ PcAA-`唀p?`@T|@0C0P@PEP > 0 F0 f021@& 0@@Acb@-@( 1x@"p@-@!0Sp 0P R @1S0@1  0S0000p@* @-0M?SU1p`0@SPT:4c`P Z@@D@  V@@ S @Ѝ$`}V00S @@0` 00 @P@T  7@Tt T T 0 d0 Ѝ@80@acp@-@xMP` x w` 6P0 xЍpp@-P@xM`x w001`0 0"0$ uxЍpp@-@PaM. {wK 5. w7ލp0p@-MaP. S6@P 0@ / 5@qT@ލpO-A$M>ZL`0R00pPA 0V4U 0S31@0b .w " ㈋h H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 4W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[LH1H0S ,1 e[0(0[0됻H0SP2 v2 020܊00008`1 01 1R 0  04P P0 4P0 Ps0S 3$ЍP[H0 tAccp eAOcac0@-P@Pp@-P@P ;Pp:p@-@P 9q9000,03/@Fpp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@P1QB 1CQ [?0Q Pp@ 1R::1Ppu!0Q 0 0!0000c0S: R :SP0C BS000KKP s@DAs@c@b~f s@-@X0 0 0h0囸@Xp@-d0T@`X0\,0(@P@UXp0Q/p@-t0@QP d0QX\0S0010Xp R0*X0\0pp~fTf@p@-PU @d0`(0p`h0Xp6XppAp@-@d0PXp*p@Xp@-P@PX[[hVp㹟pA-@Pp pqX\00tp00@`0hX00F= 00'`PP呱唱 @-0 @0 hp$@A\  \ R/ A-0SP(@ `/Xhp\ 0R$S$X#P0S0 0 0 0 P0S00 S PP XЍP S XWP\0 PW  ˄Pcp@-A@ PW\0S`V0p@bWp@bO-50S8QpP Q1  @P)00夰 0 0(0 `@h⏶p*PWWKK0 ZW%+  `(0300 Ѝ@A@b0p@-@PႿP D0R Xp`W[WNp pA@- M0@ P / ЍO-P4M`UXpľPP EP  81R  4Ѝ@HWW [8H0L 0P0S XX0 S'-PH0 L0 H0P L RP 0 H0LP Zp 0\0X0SPP0P P WҾOAɚ;6e@-@LM`p -P P0U(P~?oU20S  .LЍ B 0  @o/p@-dPp@dG| 00C/(0, | 1R@0@@1B @@Vxpx eQQ03 0# 1Q10C2q0Cq0CQ0C0C3+C? R0//p@-@pP ,p@Nx ep@-@pP p@Bx eO-M0(0P`p` @|\$ X $  Oo0EBP@T$ЍOЍc-@-0 000QЍ Ѝ/0 0 00`,(P$  PpDB(0 0 0!?0 0 04`0P,(P$ .B1 0 00!? 0 0 04`0,(P$ B000X1 00 00!*>0 0 04`,(P$ B1 80 00!?0 00 04`,(P$ A 0!?0 0 800`,(P$  PpAh0 00!X0+N@0'> 0 ,`($ @<08 ADЍx e;0p0<0|Q h/$p@p@-@P s- Ic/0000`0001S 0V (p#x ecac| eA-P`p0| @@ @@1B  lAT 4/0 y#P@P x ep@-@0P#PP@ m pbx e@- @$|^x eG-DaP@ 88$ 0 4 0 T 4 T ( ,8q U( ,1:00%<$ P - 8 < 8 $ < $  R P @o l iU <0SPT_H\ P @14 0 LS 0000?Y$0!D1  L0S81  UP h4P000@1 t1S 3/P0000  P , 9\0+4 V1SSQ   ^kh090@W1SSQ D15 0L s xD15D1;T9 P1SSQQ1SSQ ViP1 S S  b0 3  1T!U1R*,R1SSQ VG   U1SSQ 0<0\T1ST1SSQ D15D10<0 U  P < SK1SSQ 0S H. U@ PM1SSQ# _ 0 R P I  DQ 000S0>;6RH L1 S S RP N1SSQ1 e P P p\ p0U P P  l p0D P P V  "@ Z1 S S R ,L 00 S   | 1R"Cy  PX^ U_ H1S I1S J1S* ( U& 0 08C0  :/0H1 S S R  P PEUP#U PE0 S = x eC0CU 8<U ,<U50 A<Q ]k0CQ$0CQ;0S л3!1PS &|;U;U0CU;+0S00p;U %40cS KS V0CS@{< bP 0 :/zCz MP 0  9//:Q ::0S[  S 1 0S [0 vP @ v S"( n:P Ѝ90AU? 9UPu S1 0R0[0- PP 9U908 @0;bl9U 0CU 0Ui, 1/10S 0RS 9U 80SQ8U" 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0嬤Pt eD8U >0Uu >C0CU 0R000U'U L7Un70 S' S00p7U  d7UY_ zP4  Ct I+70SL70S  P;07U0p p1S 3/P  4p }|00x0| 0Cr0;PUPPiK@c8vZ + RT 0H0HS G]PP  0D 80< 0P@bP #]!$.$]ZT@TЍO, Ns+$0S ! S c[0 0S00c0W 1 0R[0 0S00\1 0S[  $0|00@1$0\1(0S`1 i,4U D1 "    2D10D!810 R<1 0;; 0D!"0D1 Qs 8P D12D100FTx Ptt0D!  %<D!0* Q}[z   Q0(03/zs0<0{}P uP= 100100@[00[0xCPR0S ! S-[0* UUpePP 1 0R5PPQt(0 :iE P 0S ЍOvSL]([ЍOX( Petrtht@t0^t x et,@Bt @ut@bf@At@QcAWc ACt gtacbvtt nt ot st@jt@wt@HtH~ft&At, ecAp@-@P0U R  @  @1B  T0pR00Px eH/H!/81 - p@-U1@ C/oS" R 0\ <0 9yP 03/pT1 S S R 0<0l1S (wl13/#/#px e/p@-P,0@TppP @ c/@-@PTD0@PP  80P  R 00 0x e cp@-PP:L0@T 0S 408 CTT 00 0rp@x e cP c@-@P($08 CTT 00C 0@\x eP cA-@MnP/ pPP` J?pPa00|0p @R 07PQ 00400S  R  0?x eLA c@-$PP E cAP cA@-@XT08 CTT 0S 00S   x eP c/ c 8080 1l1S 0 0// c 8080 1l1S 040// c 0 601/ cp@-PT T0 601@0003/(d0lQ00p cx eA-pt`PQ@@@ @L0 @ S@P0/@(0,   AR SD1 WzP00Cx e0 /@-P0 @"6 0<  $0000P0:@O cp@-@Q@ x0`"6 0h Q0000X00X0 0$02p$p@) cG-0hMS~ 1P!0 & q`됀@@,   XY 0X0 p@P@  ,Q,#NqhЍ YY 0DY0 hЍGup|0S  @ Z; @P   ]p@T0@@ @hpdRd #A@Px p@\xT0@@ 0R0T0S3@#@@ cx eO-p@`x2Pt"0tM & 000LL @  I L Rh00 4 Xr 0W#000  ` @P R8m XaLPTdRd #AQ@!@1l\  mpPOL @000(KCT GT p RdR@1d@#;  LpP. @ `D!L"$ L\ "P R (d ( 2/H@D83( Zr 000 tЍ cx eG-PH!D1 60q0`A@ 0@ # | R    X0S  Y0S@ 0@  L0  S  0@ T@  BQSD1  @T Q sY 0n@ cx ep@-@p p0 601 R R p@ Ph p04Ig p 0P cAx eAp@-@pP50Up@wx ep@-@pP)Ip@kx eA-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @@W2x ep@-d0PQ0A TT 0SlA@OoBU $p@T@ c eA-q`0S3@Th90VT@ PQt,0TS@ g R P!*n0@@ S01S`K@0Pzxh}01S Prp`2}0A cA eA-P0` VP@P@ x0x0qPPl1S X@H0@`l1̀0003/D1;D1@E cx e8Qp@-4Pp@$*0S@@lp c e@-@ $T@ ׈0 e c,sr/p@-Pl0@"6 0\ \ a $4 0$0,p@4 cx eA-`A0` F@PpPP840101@0@$lj 1810<10D1K<@1=`1\1Il1S000( 0 03/P @ 0bP \PЍ00   h0PP0C0 x e c+p@-PP0 601P003/@@dp cO-쑟p3`!1 ر 60P@ @` \1 Q$ L0S1 8pL0SP@T:L`pV#51 0S [ X@P { [  S #P m@< f#@ X@]T @|Ul@dT L0S8@l1S 0 03/@@b cbx eG-`,$(4 6 0Q4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;esP h3R `3Vl 9>C1CV %@3Vm 0 $p 07/pp{ 0 *ppr0o 2 Rk0S Y`v2V, 1\0CV|h||2V" 0CV 0TR 0 00gI0,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>Sx4D1S0 008$|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0 c`t*8ft_t u wt@x ept tttut 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`dddp@-`@PTU VBKP0P0 0`p@-@P :P 0SB1000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP j0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0S<  0000`P  BR1 " 0010 0000S000pAO-`QI@p0 S> S 0S4 000 0R*PP P%PEUP i R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [ A0PQP/@P @- Q^00@S0\3 e X0P/@-0^  0CS0\3  ep@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P /@b@-[  \@@ W@- @ [0  P p Q  Q\z1P!  S[ @ [ @@@@at acp@-`d0@31[  10 PU 80 ᩒ@᳔p@@bp@-`d0@31[  10 PU 80 u@ᔔp@@bp@-0@1[  10 PU 0Ɇ ˑ@xp@O-DM 0P0<0p`<@ @00<0,(p$P PP P`;/*<@0 0 0<4,(p$P PP P@`'/DЍ eTAp@-@P0Upp@&@-@H $0S 44 0 S   0 )  eA-Pᔀ M @T fP$q\ TPP` d  5 p20S Ѝ@ c e^Ab0S/& c@8A-tp@h P`V U0PD 0 p@ fP ` c e h000@-@AM,P vSLA dQ d, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01"PLaPU 0S 3/P ͂ ʂ0$L1H/@-PAM@zU 0S"Aߍ@, `P Aߍ ``3pP ` 㚂0PS 0S ㏂ "d0 L1S0Sp0LQ:03/PU`P n k$^HO-MRQB 0,P|ߍOc-Q 0S 0 S 0 00L\0$00(0+`P+ pߍ00p3@00T 00PS, (0S)pW& 0( S"0$ 00S0 000,0p 0P0 S030#[0Sw >00S@000{08S 0 0`0p23w - PLR0 P 0T000X0@0\00XK 8P0p01 `00' 'QJ  f0S QE b f ) 0X 8p> "2 2" 2" 2" -8pᒡTPU000 W >0 =00 =C00Ks 0 0  U00 0 HO000P0001P0100 >000 *07000 00000 +0)0p,ᘣ0S 02* p\c@]c@b@-8C0C0$ C@0 C e eK8J8p@-` P00P0T0@Tp@D0DCP0SX@$0S 3/,P e cb ep@-h T00T0\0@Tp@L0L 0?0c}CP0SX@ 0S 3/,P e cbgfff0p@-X00@ X  $Rx01X0S 3/P0S P 0S00@ 08 04 0c0p0S 3/,P c exetee|eO-LMD@pl 0R!  0 00,@(p$  `1, 0! 0  D 40@,@(p$  @`, 0! 0   40,@(p$  @`,0 000! 0   4,@(p$  @`+ 0!\1P 0@ 0<840@,@(p$ P+ 0!1 0@ 0840,@(p$ P+ 0!00 0  0@84,@(p$ P+D0 S @dPd`dpU:T +LЍOP 0"S !@LЍdA eE8pBqB e$P00 !XP/ P/ R/X e c@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P 00%ӕ/dAQp@-@!@3PPP@p0S @-) G-MⰠ P`p ` @*c0P00SS00-ЍS0 000000@%?o2P0SQ $0S S S h 0QQP<0H 80(0$00bH e,AbbC-釟M|@P` pnNp0p $  s0` b2 020202HX00d%ߍH e@U8p@-1@SHP呗L0S0L0 CHLkP UpH@0100p@ őCUH  L00L0H0P @0` 峑T^ p@X0\ /kAH e 0!< 04 0 (   !/@b@d`ddd\ P/0 !8 00 (  , !/@b@d`ddd@-M`0@Ty Pp#2Q120@T ~ODT3"P%QR| 00 0ЍP0SX@(0S 3/,P0S 3/A c@beH e 0O-DM`'p!< CS P00 0,p(`$  `(3 ?0080 040`,p(`$  (83 ?0 0<0 040,p(`$  o(000 0 'Ȣ!0 0 04,p(`$ W(0 000'tŸ! 0  0 04,p(`$ @( 0'!2Ÿ 0(0 0 040,p(`$ ((0 000!1 0100 0 4,p(`$ (0 000!T1 0700 0 4,p(`$ ' 1 0I0 08 0嗎NP 0 P@< 劎  0|P &R+3'! P<0l  <0$,0DЍOH eAAAbU8bb W8lU8Y8d,AA-@`(pP$#!$1AjH eP 0 0S/p@-X0PP Lˏ@P 0 H@Q000 0pH e@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` 圏PP0L00H@40 400;\00T0X0H eG-0MZd0\ 0pWЍ@L\ T 0E0 0 MP@T 0H0 0E0 0 D p:` `FV`!  G`pG@0AAAP/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PAp@-@P 048900H00000p0H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ0/0\/ APQ /p@-@TP PP@pp!$00$/$0S0$0/ 0S00/@-@ p@-$PUp@Qp@@-@0 ( 00@Jp@-@q0 0P0 p!R 3100 wkAH e RA-@P;bS`:pc@P PU0P SA-@P;bS`:p_@P PUl0(PPp@-P GP@ V0@pp@-@PPlTp00 00FS0^ 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 ^0@DJ0000CS0000`VTT`pH eO-pPU' `V':S`F' 0$ @P 2V2(0 0C(000(( 0 ` 6P(@PHV@` [@P 0 0l 000 000HLfH0H0`0000+ ^0O-rMP`@0 ``(`0 0`S`F 80000U Vn0  ( R(|pPEWY80 fXp000<)0" 3SH L0SP0\ 0fX, <Pp 0% 3SH0L RP \0  <  0CSS10U 1 !0I0PI00<,00 BX 1U  1Ip@Pp@ppWm 0j 3SH0L0ScU 0< pP7Ѝ<pP U)0& X븀V0008000T   #RH L R!X B/o" RX0@0C0pfV0 X 1S  0  00HAQ00@0Wp!S  \000P`V PU @P@-P   Ѝ@-0000P7 ЍP/@-rPQp@-t ⴑ`P@Pp0 0` U PTA@-@P@Ѝ@-  0S  Ѝ0bSG-@9p`PP2 0 0 0  I,b0W`!V`! V `!0 k\0pGI0000CS0000@TWW@xPH eO-PR``Ap0PPPM 0@P 2 (`200V [ ^@P P Ѝ00pJWp!fW{  W 1+#  \ @PZP`F R[ 000R000 pH eA-0@S" `;(0 S8ʸS C< 0CPHPZP (00 AQ(0000PP 0 ?0W@ [OpP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP o[pA-@pP$`V@PW0$000@$@p`p@-P@ 048900H000$0p@O-M@0r000?` `0 QPp000, vVQ@&U #0SPpGW0pUv  :  0 $ P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S000 0 00HLcH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! ZpAqA@-R Ѝ@-L ЍO-0P0td RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 o0000H 0CS00C R0 0000 Y00C0P0PX 0 YDPB ` Y00C0 00 &000b00rAG-0P p@P: ;  0 0  000HLcbH0H0`堀VrYPP P  0  0 00HLBbH0H0`UYy@A/-/-/-//-/-/-/@-@b`-v@-A-PUp1p!0@W`DS W c cn_PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  NDXP  XWPp  X`G-4pPPP8 `=@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T U @ 00040"(P 0  0SCBT D@DT@(P U1V< 1CV VM `@4TC@@ @T 2@H@0` @T*`1@00C?o270 T:0 `T `V4 `V1 m T``P @ U( @0@T@#C  Q4@@iiip@-@PPPU@` W`Pp Bp@- P`8@Ԅ<0P pф@0PppPp@- p0Pd00S P0pDP<@|80 @l 0Acecp@-P`0` 0@ 0AT 0S`0S @ 00 0pccA-@Pp B, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0K$`P@@A-P@p0`,PVU  AWG-41p!,10RC*Q`= S PP<*P00 /R0S /vTPPr@ a$`Dr@ 8|◉0PP 0,`8$0 Pa<@<D9$_@P?c clA@-@P q00@-@<&9l7 0S \#0LS   x,P 0qQ@Dqc@cp@- 0@0CS`P 040,PP_oR&U vpp@)p@-@P 0S 80 31R00  p@bp@-P40@AT ,TPp@c@-0 00 0P Ѝ0A-0SPp` x@dTPP (0S ԑ@| 00 0@P@c0@- @P ,0S@uT p ЍЍ@D@-@ P$0 0[  |Ѝs@-` @P)P,0S(0S@ 00S |0 31R@坑4T <00S pЍp@Ѝp@@@b07@- k@P@P$0sT@ 0$0(0S 7 Ѝ0O-@PDM TP^DЍOtQ @A@AP1  j @88D4q@0 a H(00<0,$@ @@ @0 00!00'>< 00,($@@ @ 0\! 0 P0< 0 ,($@@ @uFPP DЍcc܃8qAeA cp@-@P8@p0 @P 7pp0@-`PP f@BTP ЍPPp h P0XS   @00C@0 `V40040V"ccA-p MaP 3/@P@P 0 (00 0<1R 0ῑ@ Ѝ0 @P  寑0 PQ"03̀1 0:@BP 0 @0@ 0QPQXX   803/@P   PbADRSP@b@ccc@-00 0 Ѝ G-p`0 M 0*@Pm@P  Ѝ0 (00 01R 0 @@ D H03/@P% PhaP cUZ0@@000 P @  @ FT  P G`P 00 0V @x0!0R:@@1PPS0P1@01@Q00  PƐAc cc@- 0000 00gЍ A-Mp yP@$`'X``P$P @@$(0V0(0  0 @P  ⊆@(0T0C(0  ЍW` #@0 0@-@MP P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0pP 00 0S 0080( 3/$0    P A1Tpp$0p@SmT]W qq 0SVqT|0S 0| 0090#0@bA-pP`@0 0S@0d00T T0T H0'&@P9$ P @e c dbe@-@ 0@bO-ؐؠ`PUV 币Հ00뜰0H0P\@P `N@@ p @@D! $`K"0 ,0}UOe ceR>L eO-TMP4L0p0L 00RZ(Y`|    "200 \20\2x0S@|0x@3080|00(05<0X008 P z4S @|  $+ +LxTЍ00 ?o2Y0S 9@40SN " <0R0 YFTD0S0ST00à R0S  6|0 3  8 Pa0@0H0Z|0 L 000L0,0?L0S 0c~ 0`(0 000D4 R8000S3# RQ. $ 0  0 R& S 0!Spx 00 N@H0P$0  H0 `0 .@P(6@00 $H@ 0S@@ [fYD0 T 3 0{b W p00K M@C0`H01`a@0 Dj$06D0@0S00$ 0H`\p:XP#:0 P000L L"4040T 00 0C0000 00C00 R0000C0 0SK ,0p`L(00(08p_TY,`C|00001`P LR   Y;( 10R04 D0x 3/0@S000Y1;ò10PL02Y[xY Y p{p [ 0 0 RppR@@TKd V`0[00S  @@4 x04/'@(@#@ @0x0 cR>eЖ8I0O-@`'~0y@! !@-@xx@x P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0~0d0 0!T!0    !/@b@d`ddd ce@-@Q Ѝ0l  R:` <P#!, i` @{'P 00@H 0TD@D0<0RH0e@b cG-RpP`0=  ( 08`y  0R<8 P/D @R+ @ BPS@P P PP  0H@L 40B300\00T0X00 6W00 DX0ST0S@L@T@PAG-`Rp 0 PV T0SPLPT0XP0Dy@P  ODUP`(0 0(0@Q`Q@PU7AA-@R0 yp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PAA-`@PpTXUZ 0000 0RX 0SUG 01QT0S0T0q@U8  R0#&  3SHL0SP0\00<0CR1Q 0C 00080 080@P@0P00@pL@Av"A@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@rQ/T RT 0 0Sbp@-@QL0LPpS00S0T@@0Q 0 00000 p@D!R R0P00p@-PL@Q``U`QV 80 x0S0C0000800C80Q 0S L`L0SP0  RpT0pPEL`:A@-@@0S87@-@P1 < @p%0D0 Ѝ0A-0Xp@P` U[<S !P  P71 S010S0PR 5 cA-4$P 4p0?RL1S(@8P ,1S 0,1010:01 01`A@P 00000111010044P0P041418181@1@1D1D1H1H1姿00 P <00111100!1.01 0.000003/P&f``& 1R 101u@-L@Q0L00P0T0PL0SO-(ppP U [  u@`(@@P U U xPP  H@L BÌ\PTX0(O 000P - G|-PA@-P `@P   AЍpp@-P@0Tp|@1p@-X0,`0 ( P@,  t0@U pt@-叾P0P@-醾P/ R/@- @@ž@eA-P`X0@0X0V,@p Dt@0W T It@#@X0, 0X0up@-P`Q ]t0@V p@t 00S/dp@-@P᳽0Upp@o0BSp@-P@`PP  $0S0$S0ĕ`p|Ap@- 0PS`(M  @P- (Ѝp0  *}@P0V" 0;;0@P R 0  R ! @P  @ 0 S@ R  h@P |p@-M0000`P @P }00Ѝp@-Pp`|@P 3@q| Ѝ0@-AMP@ fP Aߍ0s@-P`|@P ,@P|ЍpO-`MpP8< e|P (0S <|&@Ѝ }@P 1| 00PY ᐶ00 v 0 !* 4S  #@k,v@Pd!401  504DT04U0S ⃓0 1Pdu0J(0=0@0  0, 0  ::1@P@mPTP z0000弼*{3 }{Y U~*.  ~ /~3 |-@{40 3|@@ @]ATA@b@-Pp`{@P'~1%@ @P 1 $@Q@1T tT 101t@Xe{ Ѝ$ R 0@4 @ 0@-AMP@ NP Aߍ0G-L1p30Ma0$000P 0 @P/$0 (00000 0 @P*$0r,0 (WP@ !@T (@P , G|( C|0Ѝ, O| 3( I|-@bG-Pp|UUpW @0 S0S``F``T@PzP dz@O-`RYPP Ѝp@0 T    R R @ 0P0l UpW@@IYW 0JPpAO-tM  ᜀe 0X  q_ RL R(@WYP RD 0!  0$ (\F! RL` 0 0 0$ 008A 4/ 0@0BPS 0C pP  #P ROV= H! R   @)Y.0P @P 00U YtЍ0P  #J WP gY `1>VT `0O0X` `@V@@AdA-PM`p>z@P 400000 0>@yЍ7@-P'z@P w@y Ѝ0p@-`PV M  V00 R0S@"  y@P0kV Q0@0    F@P dxy Ѝp@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1#010 S;305<0@T Y$ ozS iz $ Qz Mz 00$00,Ѝs@-`Pmy@P19@ 00003/@xЍps@-`PRy@P 00403/@xЍp@-pP' c@0P0  P ЍT@ 0 S 1H05 PV00  |A0p@-M00000P0` H@P #0@P PxP xލp@-p PP`IM  A@P0 0000 0@P # 0@P PxP wIߍ@-pP* c@0P0  P Ѝ RT@ 0PR 0% PV00   |Ap@-0M@P` ' 000 00 00 0 0`4,00002PP #0PP 0Ѝp@-P4M`p @P&043,0$0 S0 0 @P$0S 0@ P T @ @4Ѝ @PAO-PPlM%  (}@PnB00S@i8(8_wP- ( 80,00< (0 @, Q00(0H2 , 000 w@PG0DT@0` S;# p0 @ts0S@( 10@" H7@P 0冲*S`  ? @X0 S$0 00  H0P #0@?oV20S@ P &TV0`D@ DwlЍX0S- 0HL@P H0 Hd0 @P`0`0S 8V(,08< SP00@ S00S p $ HA@P P000ɚ;6eĖA@-@0M 0P 0# ܍@-@0M 0P 0#܍G- pW`P_R/R-?U@zPP 0L00 H@$ B# \PT0X0Y P|`P :W@ W ` 0 R $R ÕP`0311  U`pV 0 0F0ER8m000  R` R|A@bAO-MP 0S 4qM Q6 Q(@AU` R. 4  0$0 8^4 Q Z R7Q=@20SF 4WP? U P`:8@` @P @0V UvtЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* [ tT00#T0S  T 0 0$; |n h屶U T00S 0@ 0U0K@@AdacA-`MpP u@P 0 0 Ѝ000! @u0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` $P3`$00 (ЍpO-DM`  u@P0P S;# p0 ts0S 0 P03u0U@DЍ 0Pⅲ! 8p0P ,0 <00PPA-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppeO-P0㄰U`!R `VP R@ R R ppG'qZY08/0噵p@-@PL0Upp@0R0 0S  0Q 8A @- @-p@-@0`PVp@0 ``p@`ep@-@P0S 1`0D0eHe@0L0@0pp@-@P  P @PS@-@-p@-@TpP0P R  RpPp@  R   R4Hm Q  101pZA@-C-@MPe` 0` P 1 p`00feeefe eee0S GPЍe`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @0(00M  X ЍplqAjAp@-P@e Pp00Fp@-@ 000S0S P A-@pP`V (pmPp0S 0`VJ`x` 0S  0S 0SD@,+ (00 0>P0` |@TX 0#0L0R    ^@^ 00 000$0l0 PSp  p p0l U A%)@ce@bHdep@-40P (ajZ@P ;UP00pe@-@"^`@^p@-@000l^05000  岧00;00)000 Q :0`P =>09#900S? 0 0R9ڜ  I S `P 40083/w0` =V0 $$屧^ 0S 1pp@|Q t  | x x |000900000 0S"ʂ^x0p@ ZxS0000 |  @|    , 0C1p@Z^e@ccecp@-@POp@X@cp@-@ 0  _<00 0F PU 0 0<0p@/0 3p@"^p@*>Ap@-[  P8 &l0Sp p p0l X  @P  0,P Hx E4 PllpA d0ic1p0 9P00@ce@-pM(ppP,`@P" 0 "0V060000hS0#T20T20SqP V 0 0 0 ЍV 0 0 0 @b@- (pP @ P@P $0 O;`P Ѝ`q0@0O-@0@Dp8<P @ Pw4` T庣@P@0 !;`P Ѝ {P L夣10 k,T@``10@0@cA-P`pB 0Y@P 0 p 0 0(90tAcAl@c0/e202/@o/ 0R:****,//p@-@|P0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@+@cA-P`pAT 0S *,P A030#A(0S A- P$`@ZV Z Q+ a 0R010 %` D"ᥢ0 S(0 1D 0 (00a@00C@0ۢU *AQA 0R010 0A CU@cc@-@x2Sn D!1,,N0 N 40N48 N8< $N $<@(,N(,@D04N04DH8<N8<HL @DN@DL$PHLNLHPT(PTNPTTT X 0%, ,0,0=@>c@bebcep@-]@L _!Pp@Z PT0QP3Q/p@-@P|@0Sp(@\DLP00L0P00CP0T00T00Qp@cbc20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *LD!000@ Ѝ  0 0Y "!Wm0o 0jP'D!00000  xD!000$YX)0W0WPPU D!@000t XD!@000g >PU D! 00 0D!@000Q80c@b@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY P D0s: 1sT 6@@T 1R" I  .  @ : #:0 1!Db  0DT P T  mD!(00(0 0PP T ZD!000$`VPD!000Y T@0@`@D!000c@bO-T2P 0MS ao@ph@0S; 1s@1R@"T 1R" I  .  :D #: 0 1!b 0T P D! @(00(0cЍA,1T !D!$00$0R/ @ *0.SY Y+0.S (0S X 0 0CX:00Z"@ *j# f=@MT X0 0000$ D! 00 0c@bO-p00 0 0S:tRP0lbT 0 @Sᦟ`0cV`V``V:HZS ߟWq 'R` $@ 0 80)0  *# V tq P0(  0P0D00`0D0<嫟T a_zW 0 W7 .R4 .R1  ! `1 ЍO 0=0P0 Q L  L 00 L0s c$*=!R 01a@ Ѝc@cbG-`0 S@Pap! ZPp` Qq arGo0 S00 ///0S/9@- 00 ЍPA@-0)  0SЍPA@- 0  ЍPA@-@a`0,($@ p@ @`<08 DDЍ0eAd( cp@-@Pp0SpP`0S  ! JQPUQ 0L 0000 0C0p0S  ! I(e( cp@-@TpP`Pzⱜ 04R00 0 I00p0ee8ep@-`嚜@PT ?H@ 0 S0S 0R00 0 0 ,000R 0P0@弜@pe0e@-@k0 0C0@譜eO-`40@SPp0E  0S>Q  0RP?S 0 ! I 0 0S 1z7100P+wGp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 0 0 9CR:0S 0(e( c0eeA-@p`PUddG0Pp `P00S 0 000$ 000 00P(e( cA-@ `PX00pQ7T0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAA( cp@-@0PS`"00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`8868X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 7U 77Cߍ870 <P@@p@@0$ p@W`<0S hJ@T P$<  G@Pp81X10  hG@P HJ0 0 :800<024 @00D04RG@4J T Xf p0 W|00 0{9 i<@P ~7 0 H%,,H0pLXp\> (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* $ I $9 @T($0S C$ /  C"701 P0CVS @@01ڀp41p@H X;T(  .G@P" I0CW IDeA@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@8`F F !p$@ 0TC0@0 |@ ]T0 F @8$ЍC-P`M0F000Fp00 0h@P t@Ѝ0 C /  C07s0 0pB@v6T8 1 !S X p  P000`F 00 候 e@-@,僙(0 R @0@™ e0 c@-@TrP00S@ S @R 00婙0 e0 cp@-P8W40@Tp@嘙0S 3/@ e0 cA-@`Tp@H0PU4備 0S  3/@PP e0 c B@-  Q &Q  FP-/p@-@@P0S0 0S!0Sp00Q!7` #00`00Q \R H  vO<YQ C0\SA)AA Ap@-P@@0Sp0700P 0S!!//O-Q48 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00c8 c@b A 屔cp@- v3@ r3PP m3p0P00p@-P@ `APp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P !10P@1O-PMU@  CPC R& R#     TP 0T R@0P@**P W *pW`/oU" R 5 0Ѝ `P  0e*V O-p2`M0 @U Q Q 20S@0000-   R  w5P Q P``zDz_P0 P Ky0 00000P @0 Ѝ 0    0 0w0]0 0@000 0S 0 .5 ?PP) MU  5P BP@U 0 0  P<00Pu0 7SP PUPPT  000 B 00 @bDe(A H0R  R/R20R/20@-@1@ 1@-@ 1 @  p@-PP@P 0+P 0#pp@-P`?@P P 0+?PP@ pQ@-@@P 0@-0@S 1%000p@-PPEUPp@1PpO-MH00@,00D8 <000 ,0(P0SP00000000PP  0$PH0S! x?0S 00P0n/0 k/00000 0 0S 0S E/0 00H> c0 P 5/0P 0/0001$p@w`0V  x.`C0 /RI 0S  0 0 ` 0 0S !/0 P /0P /000妹0S =|P  `pR0"  ! P !PS Q0 e0 TvP 0 S !" 00 `Sv Lr 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S {.0S00T0.0 X.0T0S P X  Q   P S0S [.Xm.0 0000000S 0CSg| J 0 00 00C08+  Q~  00x0d0 p0Pm pP\0 00 c03Sa d׸ (.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S -0 00000,00SQ 0N <0< (000000,00m,0(H0(0b0S .P 0p0p00S 0  0UG U- .dl[/ -TP0S p00Sp吰[ o.P 0 pP0  _.P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU (Sy-zX0 0T00 0S 0S0'0-00 0S S0S I- [-0 00000[S009   R S R S0+- 0T00US0S 0S0?0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d 1 000 40@ .=P ?-B .\0 p00['`0\pp0`Pt`P40p  +? ?X .ꀀx.80Sh50S 1@0.80/P$0 `@R0 r {R`" /U  0X XP@0"  0 S o*000/U  ` `e0/P$000N0}P 0X0S 0/U00S 0S*0S 0'P0 SC*/U 0  L00/P 700`$0L0 /UZ Z2* 0S/ P) 0 S*/U  `0 00 /P$ X$ R  $0$06. 0 0 S:..?//U  X X 0S P 0 S */U 000 ` s/U X X 0S `P @0 1 s 0 S */U 00/U [ [* 0S PX 0 S *000/U   `6/U [ [* 0S xoPh1 0 S*0/UP <1 `00g/U[ [* 0S OP  0 S L0g*/U00 000#/U4[V 7P1@?0 d}E 0 S 00J*/U deDe@bddAA@D ciAvA~AAxd|dAqoBAA+nBAtdxdAyoBAAAAA[ * 0S /U X @PU@H?0\  dAE 0 S */U00[* 0S /U X X 0S P2@+?@ }U0 { /P 0R00Ǘ 0  0    - 04 0 00/S + 00S0 00 .R  .R0/S0 0 00 +40 0 /R" 0 T0*0 00S* 0 00`pd0  P0p0gP 0  }  { -4 0 0 0 00C0S *wT00 0X  900S00@TP *T@T0 0X00(0S ,0Ѝ*6*Q** R 0CSP S0S m*X*0 00000u*00 RX R=0S0 X R B/a>P: X 0S /U[ tPE?@>:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@s P?Pq/Q`PPkP(f ,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0)0 0PS Q<00U0S R 0S ,0  0 PP )U`V ,0 v.``4ЍA- 00S : *E0pP`0900@   0S P k)@00WP@F.@P [)AA 0@-@DMP\, 0\ 0\ 0\P  D 00 0=>T4@P00DЍ0@ AA-P`pO@P P 0 P10 A-P`pF@P0 @Ѝ0 G-P`ሀ#p'@0T00/ 0P0Tb(P X@ ,PV  6/P 00S0P00P0=)P07@- 0P @P  VxB Ѝ0`Ap@-P`@`` TP@͋ @ɋG  Ë ⿋ 0!p(e@c5@-@Z:PU<0(G0ywuP b@!(ep@-P "@@ "@pp@-P!P@@@ !@p@-@!@A-P`P 00up@T巋00 0S0PPP@ 0S@@墋V P@K@c(ep@-@QP \00SpPT ` @ Vplep@-P`('@#0 R000@00P0^@pp@-@&P 0P /R 00/ 0P0Hp@>'0A-`@VP p/R 00/ 1UP p0000@@@"VAO-`M@k'$P̡̱$00K?PڗG?@!OCAd@8 0P p- 0 S   s'4 pW Q,PÚ 8pP# !(7p 9W Q'W' kPUPW00S XPrX R0 R 'P &P ڔ  BR)'''PW Ѝb@bgfff@-@@!0 !!|0x0t0l000, !  ! 40 o@P@A@b@d`ddddAA 0 F(e0.F(e0(AF(ep@-P`6 (0P0P0P@0㙊㕊㑊`0 40 0@0D'pc(eA-PpՉ0`V@ 9@Ph`d0l0d0PP @ 00 N/ V?U 0WI=.lPc4 c0(E(e 0 (E(e0 (F(e0@-0MS@PV@P@ 0  IVP V@P@ BD&Ѝ00@-@P0UP0S# S  Ѝ0` @P Jqp  0LP 8`&VUP0P (`@0@ R/"A-P`@ 00Q30Dp6@0@ 0ShaAqAXA[ Q TQ1@010(e@c4ep@-P'000@ 00,0$ R @@0@/@p@c(e@-@P V0ۈ R$ 0 @'@c(eJs@-P`@P !0R!0RЍpA-`p@PPЍT$ P*R0*T  @A-sMPx% P P8 P L?@,@3 sr* 0" "@2qp@R P* 5@7T >Ѝ@2P `P' PPf D0SO@ 3/@d00Cd0T\7`dPK0 (b90d00d0 @Pa @PU D0SK d00d0XD03/@ d0T0Cd0<AIU|0S2h@Vd `>L@T)84@> 0z> P0 r>p>O@ PP) 467$whPh0`V>h@0P  $ 00$0$0$0@A]dAA;cA Ad8AcA:cA(eDA4 ccAAAA A6AAdbp@-PP&PP@ P$凇 0P  @@p@Ƈ@c(eO-dM0P刀 00 0`0 p:P  dЍ0S   H@P 8x3 000 0PM80 |}pP` 02 2PT0P00L$(08T$Y8P #P ?0S # 0!P 8#0 000b0A8@#"PP  gP10SZ L R$[ U UD@00 U # 00 U # 00@/ Z |#Y x#婆Y쐟0Uk# # 00 Q#0ކVP S#00 P0400弆V$-wAeAacbc(ep@-P`b\0@T Q   4 垆p@% R R @@c(eG-@#pP3 P000;`@00A  0'00& PP( 0@`000`A`0cWR "0P440OPP !PP 0E0`0V0PW.pW <I4c>"V "AA7@-`0P @P  P 8N?U.0 V? > Ѝ0(eAO-pP`0M⁩Ё @P Є c P N?U.0 V?A>p V  lV,<V T&<[ H"<@PЍ(eAA AA@-@ < @JA@-$0C00S@@bdd0P0S R0 R 0S 0S/00(e@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00yЍ@- 0 0qЍ@- 0 0iЍ@- 0 0aЍ@- 0 0YЍp@-@H0  9PH0 0S010H00A PA*00Q00@@@pHeP c"0O-DM@00(00p0<T00 ፧Y  $ЍF P1 ! V0[ V I08/P 0V+cV  h0UNR@TPPP 05/P +` 0V8/P | L=De0@-p0MPU U@ UPЍ0Ѝ0@: v /00Ѝ0@_c0 0 $ 6::70//0/He00w/hA@-@/0 0/00/00/00/00/0 0/G-Q MCka@Pa}_0p hq0S@0@0@T&&XY0!,1 (偽0  0 R8 R BQB03!`P`k P0   1-`0S SV(3P cHe@bbPeA@-0@/0040/0H0/@-L@/0P0/T0S000/p@-T@ $00$0$@@T@Up~le@-@~0U@le@-@,~ 0 0 00U~leQ3lO-M  @ (R0幬@PBU1# (pU< ` P``0 @P 0宭@P( 0妭@P  ,堭@P@  ⚭@`0V "0U ߍ`PC-$M@`100 00(00@ 0 ( 0P1 0  !000p p1-p 0-pP  h# >$ЍT   @p @Ap@-P@`M$ !|`+Ѝpp@-@P`M< !! *@G-Ѝp@-DMp `P@P 0P,@@00P/4S@P DЍ -@pC-p`Mb!*PP*0@S+   0P0`'01PK0  000`0&01PK0S@$! @*P,ЍyKxA-Ppo@Pdu` 0/S <@P0 6Ѝ0 du@ 0/S <@-`Pgdvp 0/S <@P 000dv@ 0/S |<\ ЍC-1@3p MaYP9+ 0]@P, @P'L10S 8 BV0<00@00000.D@P (0S" ,<,,(0P(@Ѝ  bP @Pf0P0$0,( <0P0T0< P0+@P(,m@bd A@-DMpP @P`P0~ @DЍ ,  @0 0a.4I@Pp0!0S RW# S+R@ , 3+@-OR@, *@,|+W+@G-M⨀`P pd@P ^@P0@0 .@@P($pY +H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0-L|@P}0d``PSx08x0V o+0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `$@P<U `PU 0R'S)XD X 0S#YH 0RD@P 0 8 B*0@X03/# ЍS@@UV  + +0X03/ *cU _8 * ZX@@@8 @-P !M`#q @P 0,00@0000;-4#@P E@T ,w*T &$5@Ѝ @0@0$0 0 00+8+D 00, @0)@P@b A-pMpP`.@PE?`00\@4@80,4d@T pЍHP0S@00000 00!0$0100! `(0 `*@P !'@P 0`F0`@-Mq` P@P 0,00000@0,4@P 0S ,)0P@Ѝr@U0@0$0, 00:#:D0@0N'@Pr\@-0Q@ zleO-5LM@P $ p`tUP P p$P$P NY @ LЍA8, $00x0PYPSPUQ |PUPoU00&8pP|P|P0E S p!#P# *| p nP6 0S U0 (⒭P T X41Q (O<(uPf0((0P 00 ((w(P pP pG |0S 5$` @ 0000{-P0 ZP0y0 M85 0|0i 0M( 5zd[x0S |  |[By0S Pz~ $0  @002 00   0S 00 0$-P] PX0y M8M( 0& 00001 0! 0 000 |0PW  <p [* 00M(  A +%R-0y[0dV 0 oP V/040w    R 3Vj 0 RPb tV/00|00 0$PO-PA ADAlew]HApA@- 0 0 0000 yЍA-`PMp @P0@00<@@0*D@T PЍ(P.X(0 @@0P 0Y,@P 0 0@ @ T(Px0S Oyles@-`@PЍp0xP @00!-0@P000x@-P@pM0 0 `P Q! T@/0 /!bR 0ᳶQPU @C0 lSЍQAbA9@-@-T3\M` @P04#P0 S0, `r@P,   \Ѝ Pb @P _@$ PQ @P$ ( PD .@P  @P(  p@P( @P  @P@ `@P@ @ @Pp@ `@P @P@ 0000p@ `ӥ@Pv @Pp  `@ @Pd @p\+`ᱥ@P TP @Z@DPAA@-@M 喥P ЍG-@!S$`p!M WP0O80-PP%W$! P?@0Sp 0_<P0@0 P ᯞU Ѝ iP@ Ȑ  P00/S S 80SP +4@+ & DeA@-PX0M`p @P 0 0 0}@ ЍPAp@-@`L 0P@P  @p @-PM p`^6@P  04 00#0I@6Ѝ@bp@-@`Ls 0P@P ٥@dp O-1MP`@0DT`@ p0 0P[0$0P 00 00P*U!@UT@H0@0 UT*0 0 0P@0 3/0P` P P@@0 3/0P 0`0Ѝ A@-0 000Ѝ  G-p`5@P.0  0S@ ! #PPY {%$@@)0S&   P  PxP @K5Ѝ L@ T  k@ _TG-0Pq$@(@`P  PPP7<($( GJ@b0@-Mp 00000` 0)@P25@P0`PJ0S@@!"@$Tl4Ѝp@-@MP `@PU?000,@@0>'4@T H@Ѝp00B0S@@!L"@P$ 0s@- Q@P $P@`a00帜Ѝp0 0p@-M 00000P 0`(@P0 @PBЍpO-5,MpT @P= a$$5@P 0 00000 0P  000 0z@P$0  5,Ѝ R  5$0  7@P$00P@P?$$  f5@ C-p0MR`P0'!sP 0 3/@'sNT T+ du40000 000@S 3@ @P0/S %4@P0  gЍPc@-p0@ @`mPP @ (0 T@M Ѝ@b@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR000BS` F00S03P R30Ѝp[! ! C- pሐ)P@``V`31P01 0@PP  ЍT0p@-0P@00P 000S 0 p@Fp-p0ASG-Pp@ `PP00S!3 T` TS @P0p@-`M 0000 0P*'@P@PT0P00L@$@(0v%T$3@T `Ѝp8`{p@NT  ⫡@P`0 0S030帢@P 0S@3:客@O-P0!M0#q` 0000 0&@PcUPd  b4@PX  a@PF@T0SG  .@P  @P  3P 0S-@+" 0$  , @P  0s0X  X Ss 0 P@Pk" 0  3Ѝ-@@@b@- x Ѝ@-M pP 0`R&@P @P`@!T%@Ѝ@-M@ 0P ЍA-M P` 0p&@P @Pp@T 00 00@DЍs@-P@PE 0`00@P 媡@ 5Ѝp C-P0M 0000p0 `%@P  n@P{pP0/ @Ѝ @ @0<$D@PZ(`V@&P$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<)!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,< ,,P0< (h@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0-@P+X@P$0`800 @4`0`# <H@P 0$S@0S 0R@4 @$ $DU@HЍp@4 $ 0P5 PPAXA@-; 000c0 Ѝ@- 0;0 00Ѝ0 c" 0c000@-DM 9@P$P0@,P0000"4@P 0S00,4 0P  P @DЍ0  , @P ,  0c I0F0 cA@-0S@`@P]00P @ 0,Q@ 0P000 1/@)0ЍpC-pM`A0PP 00 @Ѝ 0,Q !!1/@P Q@@/00@-MA0 0@RЍ0C-pM` 0PP 0/ @Ѝ 0,Q !!1/@P R@@/00@-MA0 0@RЍ0C-SDM@`p.  E_U_`V@P#00P,@@0"|Q4 #P!!!! 4P@T W$#DЍV@ `c  @P @0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P!4@P @ЍpP>@ @-0 c Ѝ0@-MPP @@0cP Ѝ00@-MPP @0cP Ѝ00@- 0MP00P0#@3P מЍ0@00@- 00 c\ Ѝ@- 00T Ѝs@-P@0` I@P w@/ ЍpPA@-P`/@P 0 pb@. Ѝs@-P@0` @P L@ ЍpXAs@-P0` D0D0 0@P D@ ЍpXAPA0@-0 c Ѝs@-P`.@P0 '@i.Ѝp@- 00 Ѝs@-P@0` @P  @ ЍpXA@-P$0` L0L0 0v@P@0 +@ ЍpXAPA0@-000 c Ѝ@-PH0` @P00 0 @ ЍpPA@-P` H.@P @0@-Ѝp@-00 00 Ѝ@-P` +.@P 0 00@-Ѝp@-PD0` I@P@0 @ B ЍpXA@-PH0` 3@P00 0@ + ЍpXAG-M0`@S11\p @T0s_ 0s0Sp 0PPp?X!(.PP 0 SP? P0UPP(0 s` 0 s pUZ0!(00PeW  0S  PP Ѝ 0s◾P0PPPAXAp@-PM`b-@P @0 @0c0 f@-Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S (⮛P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` ,@P @0  00@,Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ @P!@P #!)@ ЍpPAp@-P@,0P @ 0<Q-@ 1/@P,pp@-PM,@P0L` 0 0 @K3,ЍpG-PMj,@P2 0 @+ 000  0- @`@0! 0 J R@@`pXaP0  @ +Ѝ@p@-PM&,@P0L`> 0 0 @+Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp+@P 0 @ 0 @@P0 0@0@0S 0 u00m+Ѝd@-,0@31!$ @bp@-P`Mt  @cT0@&0S00P0@PЍp07@-<P @P@ Ѝ0PAO- ` 0M&J0 S1 0C 0 p P+@P 0  @ PTd 0S@  0 8@*@Ѝ@G- `@ 0p%J0!S B   +@P 0  @ PP4 0S@  0@ *Ѝ@@-@(hk$0S( ( (0$ @kc@-@, 0Uk,0$ @R$$ ((0kcte0S ( #P QS//@bp@-@p3k 0S0\P 0 %0Sp Q R$0y!u!ctexee0@-@ 0 r%H"@Pktec00CS0/@-@P $ 600C0 @  te0M, 0S*00Ѝ/tep@-Pp0 0AT 0S P 0SP@p0S00   @teA-p䀟3AT j`Pj0S @000jPU PPhjX0 $%3`U3@103 P000 @@bcteL031S  R R0SQ 0/@bA-`@P 0S00p$P P 00 $$V DCjP 0$0 j cxe0@-0@M@P j jz w |$0h 0 \ \0  00  , $0  Ѝ0cteA&:&:b1S/p@-P`tiAT`7j\@Q p0S `` ```@` $cteA-p` P0@PP0PpPP$i 0 0! Ajctep@-P@`i0P 0 1S 01  0S 0 0000p@icte . + (G-PP0S0C04q0S $0SB $$wi00 Gi`li3}?@T iV @ $#` R   R  R R R A 0S  B 00 0003``}?00G#tece@b@-P0S003@oѠ@b@-P003@o@bG-`P@# PpW@ Ѐi `d#@TW% V@ @00\@P Wt% `.i0U 0S  3R  P $@030tec@bexe@-K0@-E@i@cp@-00S-@ `P4@P V\ 3iP#@h@P (hp@@ @e@cA-@t`ph0@00LhDPp `E0S0P0P0`cA-@`pkhP|h,@TXIT0S0 R @S    cG-0 PP;0`0Ss5P $10S00@S00 " 0S' "h 0S00\hpW`0;00S0C0ʍ" 0S "ph0h06XChLPT00" 0 3/`Pp0"ecexep@-P}P@1S  DPdTp@p-@- RA-@`PPp_vVP,H035@Ae0P R04/p@-0@S`L Xg0SP P Q  - `0SPE 00@0@@U04 @ V @ 08cU@P@ 0R08<W0S  B2@ S * p00Sd% 3 @0T"#!p@,g0@(00PpVccebbMbA@-@g:00CS4g HL>@0@ lep@-@@P0SSpoP@-@ P ET@GpP P p@-0 l@-  g0p P>T@P:x0P00 00""00,peXAAcp@-PX0t p0ATp 0R 0RP @eG- P@· ྷU `ἀD`t00@0$V0:Ppfp01Stf0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P0p AAe@c0P/@- R  0 RP <04Q0 4R/00C-@2 TMc刀pn0S @=00vfH)fH0   . b?PH0<9H0cf响 00@SPP0S f PHff0 000P T BP 80S ;40789/0 00CS=3`P !0SP `0S h`e0t p 1S01  0S00e0U hep0 0000e0DP00eTЍ@b@c$Ae eeO-@`Pxxxp 0R0S TP1 U V eae|PP e=`P ! Pݛ [P01 X0S "r0S$U 嵌V e3e`PP1S  EPⷛUQU \0R|Sz ЍL 3S00SV 1P RereV P VV `P0xH0 0 U 堌P,edPbH0   . b?H0#d1Q\7 m @P 0S^\ 800C00S\ 00S00@Ѝ0Q 0S'0H0 @0Q@Tl0 0 0 ? @ 00400S@at ac@bf@zfzfG-pP,0`S @0@L0S' 0$ MKJ   P 0 = 0  X > L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVY[ 0S [ Y[ 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000 6 00UP48<40=  , L06   03 00zpP * P RP[P2 PV UG@0@01[D00, 00@0P by[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P ZX  X B[, 0P0[P0L P P@| 0&@ P -OY 1PZ- 1y 000 20 @bp@-PP@`e ZX00CX0Z oPZp O-,M\@`ကP`dpP>0 0%!X0ЍS`! =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡D0@00<@@07 D@T A(`> 0RP  0  eV@ TA@-PGM`p0 ⒊@P@P  @0 0 0@Gߍ@-PGM`p0 q@PP0 @P  @0 0 0@GߍTA@-PGM`p0 N@PP0 @P  @0 0 0@Gߍ\A@-PGM`p0 +@Pl@P 0 0 0@Gߍ@-PGM`p0  @PL0 @P 0 0 0@uGߍTA@-PGM`p0 @PL0 ]@P 0 0 0@SGߍ\Ap@-PBM`0 ȉ@P  @P0 T@Bߍpp@-PBM`0 ⬉@P@0  @P0 7@BߍpTAp@-PBM`0 ⎉@P@0 @P0 @Bߍp\A@-PM`p@P 00D@jЍ@-PP0M`p @P00,@ЍTA@-PP0M`p @P00@Ѝ\A@-PGMp`0 &@P0 @P50p 000 0 00Z@T0 -T0V@0GߍTA@-PGMp`0 @P0 k@P0p 000 0 00+@[T0 -T0V@0Gߍ\A@-PGMp`0 Ȉ@P @P0@0p 000 000 @T0 -T0V@0Gߍ@-PGM`p0 ⚈@P\0 @P 000 >@-TV@GߍTA@-PGM`p0 t@P\0 @P 000 @-TV@Gߍ\A@-PGM`p0 N@P@P0@] 000 @=-TV@GߍA-`0 Mp @P'`00 0@PppU0PV0 `F000pP P@p!00-TV@ ЍTAA-`0 Mp l@P'`00 0@PppU0PV0 `F000pP P@p!00G-TV@ Ѝ\AG-P M@P)0 000 @PV0`W0 pG00 0xP P@!00-TV@ Ѝp@-PBM`0 ⃇@PP0 @P 0  @-TV@BߍpTAp@-PBM`0 a@PP0 @P p0 @-TV@Bߍp\Ap@-PBM`0 ?@P@P 0@N0 @1-TV@Bߍpp@-P`!0CS@V3Pp0Pp'.00p@-@PS0 *p@Sp@-@PS00PPSp0@-P0M 0 0P@P0 03/@Ѝ0A@-000 03/ЍA@-000 03/ЍA@-M0<00  3/@PЍA@-M@000  3/@PЍA@-4000 03/@P~Ѝ A0@-0M00 03/@{TP PS<0 0R 0)ZSЍ0(A e@-000 03/ЍDA@-000 $03/Ѝ`A@-000 (03/Ѝ|AC-0M p08@P% 0"sr`@ P`R $S0 ,03/VP T 0"Y0 3:UЍ`A@-M@0000  3/@PЍAC-M P 0@P @ 0 `R $pR@0403/ 0P Y` X0#3Ѝp`A@-( "!0 803/ЍA@-( "!0 <03/ЍA@- 000 @03/Ѝ$A@- 000 D03/Ѝ@A0@-P0M 0 0PT@P0 H03/@Ѝ0\A0@-P0M 0 0P<@P0 L03/@}Ѝ0xA@- 0 00P03/ЍA0@-T0M0 0 P @P0T03/@XЍ0A-00$M0"!#!0 X03/$ЍA0@-,M\!#!@0 00P @P0\03/@,,Ѝ0A0@-@0M  PP 000`03/@PU 0QT 0p( 0QЍ0A@-@000 d03/@PЍ A0@-,M080\ 0<0 $0 0P @P0 h03/@,Ѝ0^0PSP 0PU,0%V Z1 S\0<=0P0 A!⟸00(0S#0(0fI`IX 408  (0(\*40X803/P  0R \ $0S40S  Zp"R 0$0S  0R \} 0 V,0"&0:808 01<0D0 000<0000 0 0P $0Se <}p<< l0& $0ST P<` 0P0 00S8 00l08 Poo 0bp @4\  0P$0S* 00, PYV`` 0U`V <\ 00D0 0000000,0T0P $0S p0`@00@PS 000 $0 P0<731|0L0S  0PX0 @00`V,0P0U`PY0 `@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 vI P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ  _L0S4 00S ?@XT0X00S 40S 0| d0  d / ,01/Po@0S`oG$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C Ṷ40St 3^P0x >0 PS 0%VZn0H 40U n0T0tPx`F)0 0, RS00V00S000 u 00 E 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 000X 0##@0 080UDWY 0@ % 0  SP0SvnP(޾2 0D0 0p0 P  0<!m$0SL3 L00 mX Cnw$0S0`0~ W,A@b1O-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,00`S P00 0 FH0  d0SFW ,0S 408 03/mPEߍW5@12 0 SpPP) mm`눀X `,0 0om 0p,08P @1 40/0\3/PP 0 0ḹ$0( 0` @1]V` @1 0S 00<0 0@`D800 0 0PP "$R( 0XP FX H0  0S0000 0S 3/H0  nP d0S/cmL0+ gH`*Fi&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0*P (`,+m뒅"l 0`! 0  D1 SD1P P0  S 00(`,S Xj jt$^(0 T0,0X0040 X `X 80` 0S4`080 8`qP @ x⊴ 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000d[ `x0 A !id` B[x0x0   @> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`000d `0 0`0`0 \0`0S"X# d (`,0C6`ïRl0` x0P 05/PAkU 0xP`0dx0X p@0PD0  $0P(0 R \0S  R ּ ᡼ `40S  ?  <0 0 S Ἴ ᚼ ּ0 S\ 101T0S@` T0S k@bHd,AQA d@-0 000! Ѝ 0  /A-@0MPb ỿ,0F00 00hЍ1A-@0MPb ᢿ,0F00 00OЍ1O-$@ @` pLM 00 0 00 0 0 0AOoBBLЍ06 ?\0uk@@ok|13100 000 ` 0`p[k N0S@孿jQ(T ᙽ1 0@  @& (  6, ?(#<@$8Q 0(@P8 R  ֲT 0@ 0 0j˻ᚻ׻`@bG-@0(MP3 聓0bFa@Ѝ @ 0qCT0 0T0C ፛0000 0$@ b62< RW1Q00Wrp @0'(Ѝ@bO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+pi0 @20>00 0  .p0 P(0 S00 ,40P1~pp p,00 00pG<010801 1!&ЖWK8?|1 0(0` 000 :#: 000 D8*0 嘖 ,XE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H < 04 H|R>,A cb d:p@-@P1B0 p@pBG-P`$0@p3/@PZ@00@800 4/@P 40T00S omVx P P$03/@P P 0Sf P @0S|00S@0SP 00L0D 8/PP H0U00S @2@ 0W4 V4 P 0S m P 0P e 0S0S PP 0S P P i<0 P0Ѝ0P PPSSA-`Pp@ T BW <AO-P @`TU  (T $0 0 06/@ ЍG-销@0H?oP20p`PS V TXTYGO-DM,00000l h 0 @P QPሠ$0 3/@PF`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Ux X880 R R<`VS <`0S0S VV86<P @8-DЍ8pW0S@; x0S@7 U l0 0Rl0 @P*   03/@P0 @t 4/ 0tPp@P 000,0p 0@ 0 t4/@L00SF0 80S @@400 @ 0 t4/@P40S,80 0,0B 0<0 0p0@000l0P0 0 #P`@p 8p40<`S0 `p@4P Tt o<0 0p0 000l0@080 0,000V9`@ 0  4/@P`t0 @ 4/ 0Ptp+0@t@P000p00l0` 0,0 0@ 0t4/@Po00 00g 0R S@`@ 0 t4/PB@VS@RA-P `@0pz0S 0rW 0kT0S A0`p@-P@ \ pp pO-pM0<0P0H00P0 8`@DL 0t@P& W0V04 P0Y04  0 ЍO  WP0S NP @Ѝ /A-@` Pp8P W $0 Aj<@- 00 00! 0!""##$$ ᭾@- ?d?Qp@-@ Q  8PPpp@pXAQp@-@ @Q\0@$0@0$0ppP>$@7?Tp\0$00$0$@Qp@-@ @Q ppP> 0"? 0"p@-Q@pP @Q@p>d 0$ 0S (0, 0@@>d 0$ 0S (00, @@p 0S/S 0 / E/0S//0S-/@-A//@- G-`@0S 00s  r Pl 0 r 0 pW S S W   P UȀ- //@-0  @-   f  1fo    eZ400C0 J 0S00Z<1T4ZPLoD 3R 0 0CP0S l 3R0 0 40PS \300#4Z400Sd4X4000D0 3噯PPZ  Ѝ,1sac@bx ed(eYBwBD D0 4S 40 60CpS//h-B0S@-0/@-@  @B8:(eG-p7`3Pn3"? !@T0@@0 @@@AP0p00 0` l 3TG0 R\ \ @0@0   d(eG-`Pp .3"? !@Tm30S0 SR3P Z|X3S30@V 000S G300@2@3P$0@(edp@-`P20 @T 0@STQTh#3pP@T P @23gP@pd0e00/0@-M@ P PT0@ D0D 30000⬿P+(ⶃ%Ѝ0@bzd@p@-P@`2  Q 00C0 0 2 Mx20Sd0 2?0!0S 4 0 p@20 0d(ep@-0@HPZ20`0@,0D02Tp@ d P  800P////p@-d 0@P .0 p/pO-P1S0l*`@PP @T@@}>w0;*}.0d 0P"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H"Ꮰ@ ` 0Pㅠ2 S n2@`{? x!2@T`0!n!:#@T`0!b!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @20< + ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@AQ<0S00$00V (`嘀?`aV $'0#$+4?P W8P< * !%!  (T$0 ᵟ V (00100 @ D@-0@00$00ӉPp@-@P`R/PP`䛶 ᢁPp@-@ z00!( :@ @-0@a0!80@f0A-P?@ `!tpR^0 W\00\0  WX00X0%0S`00S 3/0500A-@`PP p:0✿έ{0p@-0@pP)0ŭ@l0Tp@-0PS@p 0x 0000ᖾ\` 00 $A&kI00@! Ѝ@)XB^B0/G-P`t@/U 1P0I{0SG$00S0p SڬP嬐UiPP /003// Z#Z P &00C0Z $00//@bp@-@PPpp@p@-@P/00P 00$00弈+p@/O-M00pQ  (@`TB  0 h : 0a 3㺰t 0U0Ѝ0 @00D0 0(I 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  up`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/ҜE/0p20S-0 700{`P1 TT *600 0!00 s?`070-f 0R88@9S}E/@U-P`  d~`-0$0> 0S`: 0w`P3`8-@T 00v-T{ ٪xT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp@ 9!%6000!0 0^>pP Pt` l~(0S00 3/v0%  (ЍGm0 (p(P  Wpt UPT<$',P * S8SЍR 0030#  P0l> 0$0 "ǃ Q0* 0 (a ,kByBBBBO-@ᄠ?t`pP Q4,0SU`V` , Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU//A-@PKSkSG-`p`@,0P N`PO00kP1,01U,agŶն0   0 嚩  0 t+ x00Cx00S  . t',匩'T5R 0!400HS+R!`BBB4eA-@|`8 P X0 0 1@01?::0 5:1<,Q@p``  0㐚Wp0G0A A-P@᠀呱0 0P`tpx+lRdPR+{ sh++ᅺ᝱00B4e Ξ cG-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC FPTP1#pBp@-PR@DP0Sp@0kR0Q 0S |@4eBO-M`8, N-tDN, R 0SS  !ᩪ NZ 0Y ,&N PZ)8ἐ0(, 9P, P@嘁iNU &x0P0Cx00S  . '' &劤$MwPP$  $@M 0 4Q 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 p]P$ p,0 60S0!L0p@-l` dT0 r@H0P*0n,Pp  0@yrpbcR>c0 60S#3//0 R@#0 Q /R0h0//ԎA0( #&0  R /WE/00Su/კG-`0 00000P@P< 0 @@@@p 㪼P@TT ,ʂ᜼Y ЍG T1# )@PW01H B^P0 )KP @Ѝ@b`e4!  \ / : ) B`e$0 0!0 00 /@b@d`ddd0S  0 00/p@-|0pPd3@1`00u0/(0, 6Q 0/(0, S @@Vp@b@-@Z0 00R 0(0,000@p@-P` @P @ `T`@0S $0CS@ R(08 8@@vpep@-PU @`00p`h0 P>cpp| Bp@-@pPP1p@Sp@-@P`0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $Uᔻp0ep@-40@SP 43\0!,0S S 00 008@Tp`0 6/@ep@-@P` ˋi 0P6 #::0t $00000@0`0AD: 0p BA-Pp@k3A`1`00 b`0S60S50S 0S E`LPO Q 50S0 xu}050@bec;@-@BqD0S 2UP$@O@-@&50S0500S @aA- pPPFҺ9@0(0@P<1``00lx}P SPPPPPPPPlPlB9 00 0`S 0 r, ` 0@UPЍm;e B B@-(@,0SS0 DP 0S @T-\M0Q0 0S 3/\Ѝ G-`1@p31`00l 0RP[50Sx|0550Iou멒B R  00 0S#P< 0 0 0  幟PY0 0000&6Q  R  R   0 0  pPP #P 0SPU  P P r@b 0O-DM!0p`hA0 <0 0,p(`$  @P<]e<0 SE 40p0 ,01  00!0 0D0000'>0(` 0$ Ae<040p0 ,00!0 0O0 0 0(`$ *e<040p0 ,00!H0U@ 0  0(`$ @eDЍ B cl;Dk;Pi;O-QdM@0 | PdЍdЍOydQ0 00000`0 HPPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@ _ RH  H nk X  IP `J@ GrpT @DPeO-造Mx@P` p_0` Ὕ0v0l ,1 0(10$10 1H00XT` 1?o2P0SЍe(s;C-M 0P`` @卝|p0 P 00 00 0 0@+`?o2P0S  BP Ѝ cp@-@P@T $@DT\TpP 6A0S(@0 (0 0QP0e'Br;A-0pP@TU, `T`1 /@DP0xBD0S/0@-0 H ЍA-@dp`P0S$0C(@@ R (0S $0CS `PAeBp@-@P T-p\P [@<0@ @$ } pe Bc ce@-<0DT 0 !0  !@bO-@Mp,@T P0b0@DTЍD <0RTSM (␥0 0 0  @0\P: Ui000PPPEt;0 0 0 ؾW  0R H/  0 S" 0S#,O娾0 0 0 峾P@T @DS00 6P5Hoᨂ0 pQLa :/0X0 geMbA-@p `PBM 2SJ@ @(@0 0@S  ⭇02 100 0 0P`9Bߍpm;0@- ! 0 !A-@`XpPU 00`0S 0U0  03/>ep@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#212@T Y 0"0#!"4Ѝ00 030 ^Fh`P0S @D R 2x# P1  PT  C\0 : :0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ :07A>?00A0Q01 0ۛP00 R 6: b:  P( U 0S40S 81  00000C0( @D0P0*>(  2 К80S 40S 0 @PU 0 3@PP220:00lp\ 7/U P @p03/@bc< Be eeA-P4,a @T @DT@T $@DTA=0S 0S1.@0S&$SB008P0(00S pP ZN<ስ080僵00r=(@ec@-0  Q:0 0(0 0QS Q  ] Ѝ=pm;00@-AM@0 0 0 0P00! ! 0@ /=Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp p A9#RH L0S0P  <-CM       rCߍG-P<p@|` PPl00P(P$P,Pi0$008P$PS( (0 z 0P pGEecp@-@,00,0PS0z0,P@8PUp`0 6/PA-80P4@`pxzT  0A/ c080/ c@-@P 刴P @ 〴A-Pl@`qTH1x`31`0050Sv0500S 00000P IP D P ?P 00P 0000vPh dM-+B"e@bO-鼪@,M3p1P`00O50Sxv050`V `:W 42090 9W 1C7CW0SY 00#212Z8pWW `Ḹ$pGW(r#2!128W Lx8Wp8W 2;C?>CW >0W >C 0CW H,ЍO8(0 S008(0 Sz007W 0Wp0S 00`7W:> W`x0S  `d7W  ;CW0CW5C 7C0C07WC H,ЍO6W^ 97W >C0CW1`ܖ W 6W)`VfX# 0 W0@P0P20|&0`W`ppxPVhfV N$6W! 17W 6W 000 RV 5pW $pGW`5W 000S0Sp%0 R01 5:S 000%#` XX  ᒲ `AP ኲP `~00mVf0S4 R6`P0400 R0S 0 S? `00  05  B` 0 (pW $pG`Psqo0S R0P WS R (PU $PEU`4p000PW l P040  0 B R`-0 E0 0A0CS…R'X1 g`P,0(S(0SݱP ױP`` б7`,0S S 4000(pY1X*,1`s{@?P 01 1i{ P 0S 0 00( , 0 !(00,00|060y000u8000S080n<00S<0g0@0d@00D0@bwt@HpB@~B f@pBbbzBecoB@|B@oB@H Bd BfB@{B@}f|fvtgBBfBwB cB@B/P/@- 0`( "4`# Ѝ0M0000# Ѝ/+*/Q02 //0p@-0^PN^00p@A\" \ @@T00 ^< ^  80p00p 0p pp0\ @-L\ 0 AS/P 0000S000/AP/G-Q@1 P`@A0pS S0P@S S S @S S 0SYS 0SQ$0PUp(0S 3/XP c@-5p@-@PPp0S00P00C04@-@(p@-Ph@1 01  hp@C-M 0`p` @娑P 0Q 00  00P 0@ 0 EToP@@T0SЍ 0605o7G-p 0P`M !` @oP0 X0 000000@P T?o2P0SЍԘ;@-@u0(@@-@ i0@ t0/0(P/0S @-  0@/e@-<0DT 0 !0  !@b//0@- !q 0 !p@-P@p@p@-A`k 50S 6PU 4 R040`0,p@ 2S 0C8C8_o2RU0ncbA-P `Gi|<0@TA00S p3/qX@ cp@-@P`03/,`D 0S 08 000 0S0(DNnp@O BbG-@d`@ 0  +PP0 0" P00@3  Jp@ 1@DU& T" @ 0S  000 @ G@SUQ Xl =$rX 80S  3/XX 80S  3/Xc cA-@P(p` *R'7PJ30 0 0 UhX004 0  004  @0D 0 @0D h[3 000SP0PP0P0A-P`p*@T  R    B 0Tp03/@-!K 奾0 |;BcT;C-`M  @0 @0 p 5OP;J00߀h ?0l 0@0GD   80 q ЍCWecBcA(;; c0-DM000,00(0P0 0H0000<0$ <0< #VDЍ;B㍪㌪@-0   ЍBO-|0DM S4|00^@S40p0d(00,p$  `<0UP` 8)440S I<0S/ 8H` px l l0@a 0pc(00,p$  `<0UP Tx0L#LLcSSD3x0O 0000@000S ~_S #S1!~_O@oPDЍO~ 0!<0$   ,(pzUP 0!.00<0$   ,(phUP|0 00!<30 $ 0,(p80SUPg0 00!700'>< $ 0,(p80=UPQ0 00!0>`0,(p$ `80< (UP? ; 0!<0$   ,(pUPg 0!p00<0 ,(p$  U0PU    '.y` ,(p$0 @ 0`< TPB >P1S ~?S?11~oS1O@)oaN|;И;B B c|;DB;ce;e;O-LM@c 8`d` P@3B  t埰~ 0@Da<00,(@$  `D0TP <LЍ 0!<0$ 0D0   ,(TP 0!00D0$    ,(rTP 0!L0>`0P,($ P @0D _TP 괢;;B B;@-@PA 6 @ 㹨;p@-@PR`彯 Q   į 0p@P   RP PP  尯B0 <0x 8RR00R0S 0S/ 2B갡;;A-`pS oPTP@ p jA0V`` B;T;p@-@Pap0p@/A-M`0P@Txp~OD*ЍA -P AT ~ODTec@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@갘;;;;;Ș;И;;;l 0@o/ᰘ;A-@`pBTD@D A0HP0UDPES7/@T@-@4 00( R @@0000@T e c@-@0 0$S   00C0@B e@-`pP@MPVP@2 ЍT@UP\0pWU  X0S   8@PpPE`?@e c0L cO-0M05p  w3PP, 0 X`0@"40i300  _3 w$0(0`0`Ѝ;0@-@%m0P m@,/0p@- 0 `   H0D0R@U DPU ?D02DPSH H0 lR0p@ҔPH0S D0SH0D0H0D`SH H0 lH`0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S MPP0—00 Ѝ0p@-@`P5 0 503Upp@0i0 L Kc0S/ L YcA-M@`P>p0MP00GWPBT D@DTs>ЍAh ->PH@@-3M@03XdXp-`RU DPEUIPP70PUЍ2' `HP0S00P00C0+.,0S 3/XP cG-VM@V/ vpBT][ }?8c !L3"02Q  ! R!{0S Q-050p h, Th8ߥ䁄刀 2S ?  ե0 2ZRU DPEU RU& DU# 0ZHP %0 RS | R H0 3/0,P0 8P-&U$1PU" q  8/P Q{01wL!Vߍ40S 01Q 403/0SXP0S    H03/,cc ceB; c0L PcA-00S P`~CW l0SB 1S @0 R H@T D@DT%P 3 P 0S %P~Ce;p@-@`P@P HpA-0PU `p~_EU l0SQU@3B T D@DT 0 0R H@Q x%P~_Ee;p@-@`P@P  pG-pW0S !S* 1S l QP0PU ~oEPVl0 SB aV ~oF ,  H@T D@DT 0SP 0 S:UP3.P c;ep@-@`-P@P Ip@-@P\P@p@-@`P@P .pP/D@P/00S/HA-@p`P@P tA-`P$V00l P0S/PD@@T0S0S $P Q $P  0S*p0  H@TD@D谘;A-@p`ᦿP@P $P/@-(0pMPL0`  @P $(0, SS  3/Ѝ;p@-@P}  R80S U U U00 p@ 00R  00000cA-`p!P40@TA.80S 3/X@ cA-pP@H-W` 40 p0H0(0B AB#P H@T D@DT02S D0CS   QH0L0S Q$e@-@p@@-@g@|0/0/0/0S/  ɿc0 R0/ c@-Pl 0R谘;C-0`M `00Q@S 0`8`0}?`>Caaq cX,aab pbT!0 ʺ 40!` 0$10V!0 $0 p䐟00S0 SW \pP0Q:0PSp`W !V`2$AЍ0 ccBceB@-@n1@0A- P @0L ^U 0S |0`@Tpp~OD; 0S0@A;l0S …P AT ~ODTe;p@-@`P#@P 0 ƾpc@-Q@MP@`YpPP@ \ V  @LЍ0<S %0! :F@0A- P` @0L ^U 0S 0p@T㈀~ODƽ 0S0@AAT ~ODT l0S FP0 \e;cO-`0M#0|8@QX 6^0Qpu TXGP  03/LNZeX8P   03/<NZUW(P  03/.0S  PE `@@P@pW P  0# 3/00880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @qP 0?S@ Ѝ@c.S``iui vi iiiO-hq@Q`PEM L1Q-YU4⊷ݰ0 00 0`0屲P Eߍ 7X "P  0R ArBT1 ᐹ5EPV14  41D@DT 0Q H@i i-BC-qM@`P)  03/P!NU# 0S  8 4Pp@0S   m  0SЍ7PpP  @Xcx0/p@-`Q@P R 0 0 0 "%47p000SP0PP00pX*R 7P %0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  .mR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PPp0@-@0M0S0=@P  WЍ0ϖoWBp@-Ph@ၣ1 01  hp@芣@-p0$M03`A0AS P R R R1  $/@ ?$MRY R @  000 S( )04 0 #RH L0S0P   $ 0 001   01^000000000 0 00000 005@P #T@$Ѝ3  "'0P0C@0@ 001 0 S#0 ⦀< 04"48#80CS=10 001   \110000000081000 00@P @j0 y 0H   C Rw0C0000P( 0 (00(00   X0T0 0 M0 @P| Qx 4@u2@7@B33@-3A0@S AS S ;<2@S 3/4P@.O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20 `HZ2Y HYRpUHp0 0pW0\c(1O-0 QDMA00(0M?0`p0<< 0 0a 0,$  <@0 0O?0<< 0 0a,($ @ 0$0\0QO@000'> 0 0a,( P @< @DЍ\BeB;/c@b@d`ddd?c0 c00S/je0 c@-@P Tp@-PP@` 0 @0S@@1@ @p1g@@b 00S 0 0C0 0/@b@-@ \ 0 0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`p@0 p`000@@AWA-pP`@V@D`0 S/,P/0A-@`P pPP+` `v PPp㗏P P` 00PPP pP(4 pUAupBBRPG-@  Q R"pS`F #B'BS 0PS  P  0S &P0 S` 1 VP  0S  P P) 0PP `S  0S 0S?  0S000000000S 3/p0S, 0S,  PU UP , X 0Sl $U?o W20SP P pَ p0pS UQ 08i(p@-@P` P:ps@-`@P`Ѝ0S u  "U R `Q  `  000P @0T00  僎Ѝp@-@ 0S y0 00l0 S@- T2S@# @ T00^02 BpBG-HbHHBTDrUʀ 0 ! $ 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 81 p?]x0 p0Tx000X`\p1A`p0t`0Gx!O,03/d1`0\1#$C,03/0& B0R  ! !/0 u]@`` BϠ ,>o\࠳ࠣSp^ 0(0Xp\`F>P|p @0X@\`=>0T`!C`@400o @$ ⻦@`yeBb\kPq00Ѝ0000@T\)4  0 :  <08 ,p$` `140AP 0@00 ,p($` `P<08 1DЍB+"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PR{ T @(@ЍU Eg Dg0Y`* sR `FU T`T BT` 0 ` @  SoP@0m@P  0 0T g0  `0pS`P 宜p@U *PQ pI Q`FBo B10P0 00 00TPÏʁteH cBBp@-@Q`P 0 g0P @pnPTp0SpPO-P0M`Q@0  HpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUff0 S0 0 T婛VV 00 0PO P4PpPBA-P@k`P p   BnP TO  mP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@+Q %  BR  \R\Q 0 Sl!0 SD 0S0S0 0 S0Q00 R Q RSR ՚0Q `U P0P0 RPPQ AQ  0 B)BteuBRB0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ 0P@  pteH cA-@`pp R( `0PX 0 0`0d0(0 0 0P0000 0te@<G<90UpW01X㾁V 000 W"010 D(0SS`AUpXp㾁@bBX cBx!e\ P/0 !8 0 0 (  , !/@b@d`dddO-QM`p @tЍO*\h^e崕t00px0\00`00d00ch0 0l0\PUU27[x@6T6tP6 pt0xt@p0 ER 5034 | 0NA43!"堌4@00T1 ~OD0T+ ḌU `0S   0S \rP@0S T @\ [P\`PP&U`0S "Se2Sb DS` 4L ~0 0 |0,00\0Pl0吰S8 x[5 h0S2U U UD XPE D ,0| \;/ [ N[20S 2 030,M|0 0 lPl0 0l00Z DJZ+00004ATd ~OD`HP8  R  Q^ H$0i$00U00000>000 \0|tP%l0S" x0S h R " ,  4  |  R㸰 R԰0 lx$ ^Pl0$ 0l0娋H$ 1[$0 ċ4rP  0| \3/ vW HxT pod h00 R l  BR 3 Ѝ , ?A1c0ScB@be0|KpO-`A@PA pP: p( 0  pU E|?p1GS ! R``B``00Q  FL0Pp W(0S0P0 Ѝ@B@-P@`pM4 B?  >?2 0"!0 qЍA-@PP`@pD0W ⊆H0L P0 H0L 5A0 `0<0SP@0P8P0\03@P8 1@P`0PpH0x0AP 0 T ЍX c@b000S/0@-@PM4 > 8>2 43H@0B08 1SS0SЍ 0C#^10SY0CS!23 U !5% !D!C ▇ayP  03/`0 D`0@00800L01H0.>2040 0,00131`000S0 S000 0 ,zP 0, V W 0`x 8000`400`=d03` ,1`0p02640h00x0x0bbX c!@. B@Sc@b0@- 0G Ѝ@-A Ѝ0@-  : Ѝ@000S/-0 00 TP H0SL0S 0 R00G0S  $4 $0@<Ѝ0` 4 d!Bp@-`@P@THp@0U@w$ *H_hp@3|#e#ep@- PS`@(M 0S0 @fT!>0000!>0000P @ 0$0e(Ѝp d@-@0S00|#e@-0  @0X0S ( 0 րЍLc!B 0 0 C-0PM v 0!S1000ⳀЍ蠁\ R00ЍC 03 HgTq@=`VT4~ G 0!S10<000U`jT HЍCg  9*P\0`` 0 0``0`@X0 @S p ` D `0peU00 @ @$1 03/@ЍpO-`0Mأp P@P 6 6S 5 J@Ѝ3 T V@1T2a$1 0@4/@X T060@m0 0 0  m@n'P0!  x~@꬀P  *$1 03/@~T,@ 0 8ЍO|#eg#Bl#B`#BO-M0( P0`pW08 0(PP8 L}l`0d 0 `0d l0S@P 3!  OJz $IJ00  |l004 0 004 l pW$pW8C#+$00G0P @P(Y Z!2 50R% <{Ql@0D 0 @0D \l `5 0 ` }U L{ pQ Q Up L pPـpP LW W LZlX0\ 0 X0\  l5 PPZlh0l 0 h0l l `;`0 }}P0 帙4"48#8000 0SlxkP0T 0 P0T k$Z @9kH L,9 H Lk\0US 0 S SZ00 - 0* PP U OP40"` P P ( U`  0 0_`0C  (`(0} 000 0 Spkp0t 0 p0t {k\0S ` 00,x0` |0$0000 0@0 cPZG !.T0  ∰ 匰PT0Xj0 _  ajLj0  P PVj 0Z R Z &o᪢ R" R&{j 0$ 0 0$ &j$0QP0P  G00 GL= G $G<0004 Q0P<<00000(00,018i0 0 00 00 i 0>8ⒿЍS!>0刐匐 $1  03/RY 6ᬰ  Z   \G XG @ <00000Z4LP(|#e d#B#BLc;$B$Ba$B$B$B$B %B@%BG-aqQ@PG0 |_i0 0 0 ji0Sa@PI ~-P 40 ᐐIoᩒ S)~Y ;i80< 0 80< ~0iX0\ 0 X0\ ;i 00S+@P  4"4x ;C R 4"48#80CS?i@0D @0 @0D  iec|#ec%B-/0@-(0,0@<,00S 0S 3/0000008004000 $ \ R0@ꜳ<<ج4308P倢@0 0@P0V{L <\P< \⊁`P8`VMi{U 0bh@Su Yr  $09/  |Ѝ 0 X/ R 000h  ${0S<L0 <{ $09/{Y  ${Y U h{ $ | @P 0S 0 X/ Rh  ${ { $0:/zZ  ${`Z U h{ ${ @P  { #e@cO-$M pp@P0 `nP 0倐hS [  $0;/@ {$Ѝ { @ 2@@cO- qdV Q ʀ !  , !p0^@p  /00  0唀0 0$ h*{ R g$@ !d1000  ! Ѝ@b@d`ddd@cG-P`U U9 $0pp`^@ \^0Ud0 P  C C$0h(P 0(0$0 00T0z 0< bT`00`00<p#e@c0SjO-0S,M"PPP@1 P t10S T, 0 0S0U0Syp4`Vy B,Ѝ`` 0 vP 0h z5X0S" 0 S S Rh0  0mz 0S  0R y 0 p$07/yp hnz`/[@@cA-d0Pxq@M0D 0S S2T1pH1p(@< ṀU`F00< <0奀@P+PĀ$y'hdzz]pw]@Ѝ`0< 0C`00(<0S `U0P@S  0 h@x=z@c#ep@-H劾DP@`L@T403L0$t@P ¾pc@c@bc@- @@p0DL0u@@豾@c0L03@o/@c@b0 0 0 /@-@ ]O-p 0M !P``  @AP0凈 0\ d0 000000@Pf?o2P0SЍ0 P 00 0 0 p@?o2P0S 0 S$  Q0Ѝ#ed 0O-DM(0 0Pp b!0 ,p0800P$  @80 <00!00<0 (p,P$   0'!|1"< (p0 0 ,P$  0!80 (p,P$  .0 0 0!08N` (p`0 0,P$ `(pp'㌠ 0 8 a,P$  v 0',0 0 a0P($  cDЍ(B<@- R0R0 *0R \ \ 00Sn`\ \ \00SL00S0 80Q L\00S(B#e R0 Rp@-0@P*0 R .P@D T00SpT @0P \0P0 SpSp(00S0 00S(B#e 0 /#ep@-|P xSkp@ lkk \k L k <k (kp(B<#e<<<<`<@-0@kk kkk@k#eP@- P0@ P@ dd 0 \ 0L@P DoЍ0L@P o#e<(B)B)B@- B 0RS d00S Q PQ @yjP4 0LPЍ#eL*B@-B B  \03< x00S @OjPX 0LPЍ$00S ;jo@#eL*B 0O-RDM(0"0p`008 000p ,`$  @ 80<<0)000 00,p(`$   0!'>P Z'$ZK Z'P ZC ZC x>P Z$Z3 ZZ- Z PZ% Z% >P Z#Z ZPx & ZPr  ZPlZ Z >P` Z#Z ZPU & ZPO Z ZPG Z Z a>P; Z#Z Z Q>P+ Z#Z ZlZ Zd <>P Z#Z ZP & ZP  Z !>P Zj#Z ZZ Z  >P ZU#Zy ZyZs Z!Zm Zm @=P $@B4@BD@BT@Bd@Bt@B@B@B@B@B@B@B@B P0C /@-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/@B{AABP/Q //  00  00  00  00$  (00,  0004  80<0/@-@Q@P @ "G-@MPXp @p P` 0@DS @Ѝ@`Q@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@{QP000//o/00//p@-@M P@ `@,Q@T@@YQ@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ QPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU/QO-R@M2 `ᡰ@[N00<0唆+00 0<  BS 0 KSP`F0V6*0PS㔃'!F<0pG   RVKЍ蓄% 8 09/P0P0'8 09/P0 Up0V* p꓄' 8 09/P 0p0% PEWP8 <9/PpG0 Q /@-0s Ѝ\= 0 R/R 0 AB0R/@-0CA @R A@BT R LP^@- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @@-p@-QK @\@ ,0CS @PUT S @CP U\0^ PL_UQ@A,à0@ 0@ 0@ 0CSQ S`p\\QPAQ00@p000 0@0 ! 0#2 /UUUU3333 @-X// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00 / B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?@- ^ S@-c0o @-@oQPO-(p@@@, P`T @D.`VPW:/@P WRQp@-@@P@T@ P`Q@!.PPPpQPp@-``` P@.@T`PpQPA-`` p@P-W PU`@@@-0 0(0000 0P 0@Ѝ=@-0 0(0000 0P 0@Ѝ=@-$0000 0vP Ѝ=O-`pP-  ?L@P W  1 1W 0L@Q A-HR @P,30 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,U @k0@P`TF  00 0S !,! @D ...|.q!!,/,AB0A-@R0@P0`?S + S# *S, R& M[S0^\PP^4 ]^F S -^>pQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  l/Ѝ@-@P $d/@ ( 0"0aBO-@0$M(`00p 00P0$00D2 0@00  @/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0PaBaBA-`P@. $QY ?PU(p8 0 8S($)8 c7 `.7XPP0Q`pDa(!"$a$"  .0Uh ЍA@S )@ c8 7 )0(0G-PR2 p@q?p` @g(U: S. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (4. 0$ Q0 0$  0$ @H< 0$ @ .  0$ @H< 0$ ?XG @-Z@-@P $.@ ( 0"PbB@- @-@@-@P @ (- P 0$$pbB0O-P \M@000 0Pv00 8`$000 : #R?0V FAr#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@teB0`( a!"$,a c"/G-P`8 p#T0.@``T%0  Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T $e-M Ѝp@-@ P` !LNC! !@ApA-PP@#*pj`P @  }@P }0@PWP )P )PkUP@@-MP@@@`@pT:Ѝ Pp0P00 QI`qBqBc00yara0tcid 0 :c 0 :cyara 0 :ctcid\ 0/\ 0/yara\ 0/tcid0S 0 }/:c0S 0 r/:cyara0S 0 f/:ctcid@-0p3A5+`P @ 0*.P 0@PP @P0(֔ Ѝ@b /p@-@P4)0PPptcidp@-@ P() 0Ppploob@-@@ @-@@ @-@@ @-@@1 @-@@H @-@@T @-@@O @-@@J @-@@E @-@@@ @-@@; @-@@L @-@@] @-@@k @-@@y @-@@ @-@@ @-@@~ @-@@y @-@@t p@-@P((0P pP pgntsp@-@`pP(@0P pP TpatadA-pXPu(X0P `ߓ@P  P @gntsp@-@RP aP'pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P  p@p@-@P p@0!P/eB@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  LSP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`P@pWY FWl g:W =W *W # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8ЍL3H3 S R 0C# M0   Q S@0S00S > @ @@0 SbW' fW ?R0@SfWQ ` b6b` B@S8a8  C# c,1 c0 0 FW'Pf0?Sp Rm  P  c5S CP2QPU 0  PU H  0  Y=  0 fP0U08  0R4 XS+=W 0  Q  @U 0S Y 0 P  @0  0S @ s $0S,R$00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` Pp-@-@`P P@ Ѝ/p@-@P EPp-@-@`P P@ Ѝ/A-@`Pp P-@-@`P P@ Ѝ/00/:c0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

0gBP/0 SP0//gBC-@P ЍPo0 RQY0 p 0pὋ`P 0H S00Q mL p`PŋgBgBC-@P Ѝ0Y0 p 0`ᎋPP 0S00, pBL `PPꚋgBhB0P @-?o42 ^0S0 S@I /gBP/0, S@-P0o/gBP ?oH 2\0S 0SP00Q|/gBgBfP 0 SP0m/gBf@-(0pSM c`@V `0P PP 00 0P S Ѝ`0S 0 "R00   6P hBP 0 0#/@-0 S RS R RP/$0S @-i7@帔:c(%eD=(%e@- 0@a(M 0l`S A  bK H% P(ЍЀ`, P @ 1hB@hB8hBp@- @P!Ap(%e @-q06(%ePhB 00 S  \: P03#/S  \ P0///p@-P0S 6<@P k|y?@P tZT%LPP T4e0[A@p$@:cD=(%e,%e@%e`hB@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@"`hB /P/ 0R" 0 !SR* R0*/@-0  ^: P*0  S */@/ //@ `hBP 0R//`hBP 0R//`hB0P L P ! R0* /0 \0://`hB0P L P !  R0* /ɒ0\0://`hB0P \ P  !R0 * /@-!0 ^0# %/`hB0P \ P  !R0 * /@-!0 ^0# %/`hBP/ 00R!  S //`hB0P D P  !  R0* / R0://`hB0P D P  ! R0* /R0://`hB0P 8 P  !\0/1 //`hB0P 8 P  !\0/1 //`hB0P < P   ! /!S //`hB0P @-?o42 ^0S0 S@t/`hBP/@\   JQ\//`hBP/D\  Q/S/Q\//`hB@-@pMPW ` `0S$(0S!0+ C 00 0S0xSW  000000SЍ  pPhB0BR"SO- JP`0@ pD TWpp-T@p` +T@`00T 00XS0 A B0C QR@`9U70T PPſ 0  000D ^aD\WDAD\7D U0S0:0QP00\00S 0!0@P0 pY ЍY S FhB0BR"SO-@ ` J0P pE UWpp-UPp` +UP`00U 00XS0 A B0C QRP`>T<0U @@gĿ! 0GbW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0ShBH-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@1P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0 `PO PU# 0S P@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00Ċ=<====Q@- o/@-IM@pP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 wP ` 0 0P0 5/P 00hBA-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S DP0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@hBA-`[pWR SSS P PPP܂قP(0SP 0p P V` P PP   PJiBYiBDiB^iBdiB{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P iPP@pPH 8@P <q0 P`000U m0&eiB同 'e$0S @-.@<:c 'eX=@- @ +  0&eiBieG-@pP`VU@ 0@焑QPU@ `F¦`@-@|@yp@-P@@wPmpp@-@P X0R@PP@p,00$000@00 0iB@== iB0 0C0s@-@P 0U S ށزl8Ѝp1PP`P 0 0@PP0 0C0PP0&eA-p `Pᘁ@P V  !V @pᦁC-P0pS`@M>0}S "S ፁ00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0SH0h P ,0S(0S  ,bP \PH=iBiBp@-@P `\0 R@VP PPPV @pgiBO-0bPS00@00SS ЍO WP@E Ѝ@P pP 0IF0 03008P  00C 0P [@U R\ Q ` V x` P 0SP 0 03/P  0R#P P iBiBiB0,S<S78'e((e)e@-@ $'ep@-P@Pc 0 0 0p@踱G-@P 0R@ pLPP`ᢱ@ 0冡ᆁ!S Q 0冁 0` 00V:000iB0P 00R@-0P   0/iBp@-@P000p@ip@-@P ,0R@P@ZpiBp@-@P L0R@P`0S@#*+@@piBp@-@Pڰ@2pA-@P x0R|PŰp0S `VP 09`P piBp@-@P @0R@ P`ᡰ v@piB P /o00"\ R\0\`/iBO-@Pi pl2 R0t  .PP @p@L0S +A PP p偉0Q=P8e/s h P,U<UU p4P` `F k 8P ,PP ?PPGU@t Ѝ*` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@iB:cX= 'e$'e8'e((e)eiBG- pPW` ~W 00@ >P 0S0,S  0 G0P @-?o<2 ^0S0\ S@/iB@-@P+ 0R'P`㉯0 @P 0 0 B! 00C0000 Ѝ@ï ЍiB0P/?o( 2\0S/0\ S/iB0P @-?o42 ^0S0 S@/iBP/ 0R/iB0P @-?o42 ^0S0 S@/iBPG-@6 @`TPp P*  0 S @_]  S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@}0P@ A /iBp@-P(F3@P 0P0 0p*etjBP 0RR @-bo//0Sb G- 0PSGtD h@PR  pPWW(G0 0"!00 Pa#C<`P%c?P6 09P0 `03P* P0-P$ pGP唀W%10`` P R0P&RP0P Wa<`=0 P =P/jBtjB@-@0P (}F4*eO-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR30jBA-p`PV@Pq|PP  P `PQp@-@@ P`[|@P0p  0P@ PTh|PQPp@-@PP@PP @p@-@P D0R@00S _ @P000tjBP/ 0R /tjBP/ 0R/tjB\ ?o@-H 2^0S0 RQR 0 /tjBp@-@P D0R@ P@ {PP@p j tjB0P @-?o42 ^0S0 S@/tjBP/@-@@T ?o 2^0SotjBA-0S6 (P@U2`P& 0$!P( $0S%  N$ 00 Rp{PP 00  0{P { 0pPЍ 0X PP X{P@PP U v{@jBjB/P/?o4 2\0S0SP//kBp@-P00S $' @U 0D@dp:c=+e@-((V0@ 0PkB*e0 SB4kB@-@P 0R@?kBP/ 0R/kB0P @-?o42 ^0S0 S@/kB0S(0S @-0@ /DkB00C0/0 P R   //A-`P zPP@PP[0@P Dpp0 P`000U z+ePkB@-@@ PG-@" @`TPp P* ᝫ ᚫ0 SS 000 0! 0 0!@$0  ᄫ @۫٫@p@-P@@rPʫpp@-@P X0R@EzPP@p,00$00m0@00 0PkB=8=G-`0DQS@@0SᘫG P@ያP PP 00 0 1pP  00C 0dP l@[P0 03/P  0R 1#WPpkBtkBs@-P@ T R y` 1ЍpADAP`@ 0 0OP@00C0@@+eA-p `Py@P V  !0V @py@-0`SP@p0]S @0 @P  Ѝ P 000$ `P ,0S$=kB0 /p@-P0@Q  0 Q000pPpp@-P@PW 0 0 0p@謪qpA-@P x0R@ @bPP` ᖪ@ 0qJ 0q`0V:000PkB@-P000p@-@P ,0R@P@npPkBp@-@P ,0R@P@\pPkBp@-@P L0R@P`0S@#*@BpPkBp@-@Pܩn@4pp@-@Pϩ000p@%p@-@P©@@@pp@-@P @0R@ P`㮩0S 0@ApPkBA-@P `0 R@pP㖩0@0S@ 0 0a000 @PkBp@-@P <0R@ P`l@épPkBA-`PV p@Po m 00h 0Sx0,S00 AA-@P 0RPp30 0a A臩 0!1 0S0C0000xA2 PkB0P @-?o42 ^0S0 S@ /PkB 0Sp@-P`@P (0S p@:p/tkB@-0!!00!1Q100 000000 0#0, 0#000!R0Q000! 00000p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0}!000p@t000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG- P`pX@0Q0000R0000@ @SA@@ @H :/P  1P@0R000000@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/@-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!00000\00!0000000T   0Sp  T`"P P- 3 T!, ,  1000 T R`T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-7`P0@ pD TWpp-T@pP +T@P00T 00XS0 A B0C QR@P(V&0T ``f[ 00D \a0DSW0DA0DS70DV P   S  R 0 @`  X`EXRkB  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/K  0RR! R/P/0@ 0A0SA*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//1A-M Tp @00S 3/P0`7P V 6/0p `Pލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0`` 0R,0 @0 4/@P T p0  P$ 0 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@J@0kp@-P0@Q .kPp0< 0 Ppp@-P@AQpPp@-0@APS`0q< Q< <Q< >Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 w+ P  Ѝr@t@b@n@@T(PkBkBkBkBkBp@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPUi@P  iPi<WP0 Pp 0 03/P P 0S PP|PiPiX 6P P(VP PkB{lBlBp@-@P` Ppp@-@P Ppp@-@P`E Pp@-+lB011/A-@pP`P `iPp` P102 P @-@\& P QRS  T00SiLQ R S "  T  00 A-% M222haS1&'e`8@21P&~:a-몯-%]u??clpq(pqS?}Eb&.K%띏ƀyb~.8峨4p{d(^,@re .mj 4;< 3Q% 30S#* :3#Q% 53#Q% 5Q *c0)E szӄ Mwf띪tozo0  08S )}~?!ʫ[*T' 2R o@00@0f44U p2p,QHO;X@.fbozfhJ!뻫|20X"  000SZ@P4;0Rr}ryol"닺a~Aq]P']1܁4r1@T(vr@1U  1Q @ |1Pd|_ P. *`(0 000rs/ r!( A0( ?A3c01|pW>r@[b 0abq0AD 0 C_P!Xq0x0)@r@bc@bbbdb N'dA\cc4P2Aacd;c`eMbbcAÂA1Ax9cmd%d: internal %s image area dkmatch_bootdisk: can't get label for dev %s (%d) mainbusno mainbus foundsdwdldWARNING: double match for boot device (%s, %s) boot device: %s iicziicnonei2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!@ 0A @ 0H @ P `@ p @ p@ @ initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller couldn't map registers scoop%s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopunable to acquire bus. error=%d output write failed. error=%d : GPIO controller ioexpzssp_init%s: not configured. can't map bus space couldn't establish power handler zssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846%s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferdefaultSharp Zaurus LCDC(.}Tbcouldn't establish power handler zlcdstdSharp Zaurus frame bufferdefaultSharp Zaurus LCD̂bcouldn't establish power handler w100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) console E F F $F ?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ couldn't establish power handler zkbdD>> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    : pseudo power management module zapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller couldn't establish power handler %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %cconsLwGl >Xg Xh i j |j 4Tk <6k t4 base 0x%x-0x%x irq %d drq 0x%08x core %d mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus**************J***************f***_***U***Z*gmv******C~Y$&/4~mxo>sI^ 3!!!!!!!6>0x%08xr%d, rrxlsllsrasrror, %s r%d, %s #%dsplrpc +>,>,>)>,>)>,>)>@,>",>P%,>",>`),>)>_M-,>1,>P 7,>;,>?,>C,>@ E,>J,>P M,>J,>R,>W,> [,>W,>_,>W,> d,>W,>h,>m,>p,>m,>t,>y,>|,>y,>,>y,>,>y,>pP,>,>,>,>p,>,>pP,>,>,>U+>,>U+>p ,>,>p 0,>,>p `,>,>p p,>,>P ,>,>P ,>,>P @,>,>P P,>,>- ,>[+>,>[+> ,>,>,>,>,>,>,>,> Y+>Y+> ,>Y+>,>S+>,>S+>->S+>0 ->->00->->00->->00->->%->->*->->/->->4->->:->->?->-> E->)> I->)> O->)> S->)> W->)> [->_->b->f->b->S+> i->m-> i->q->/u->x->oz->~->0/?,>x->p ->->->->@->->->->@->->->->->->->->->->->->->->->->->-> ->-> ->-> @->-> `->-> ->-> ->-> ->-> .>-> .>.> 0 .>.> P.>.> p.>.> .>-> .> .> $.>-> (.> .>,.>0.> 5.>9.>?.>E.>K.>E.>Q.>E.>W.>E.>].>a.>g.>a.> k.>a.>0o.>a.>@s.>a.>Pw.>a.>`{.>a.>p.>a.>.>a.>.>a.>.>a.>.>a.>.>a.>.>a.>.>.>.>.> .>.>0.>.>@.>.>P.>.>`.>.>p.>.>.>.>.>.>.>.>.>.>.>.>.>.>.>.> .>.> .>.>.>.>.>.> .>/>0/>/>@/>/>P />/>/>/>/>/>/>/>"/>/>'/>,/>1/>,/> 6/>,/>0;/>,/>@/>,/>E/>,/> J/>,/>0O/>,/>T/>Y/>`/>Y/>f/>Y/>l/>Y/>s/>x/>~/>x/>/>x/>]-thumb insn eqnecsccmiplvsvchilsgeltgtlenvund%s %08x %s%s%s aif, #%d)>)>+>+>)>)>+>+>)>)>+>+>)>)>+>+>, #%d#%d ; #0x%x%c%dp[r%d][r%d%s, #0x%03x#%s0x%02x%sr%d!{r%d-r%d}^f%d0.01.02.03.04.05.00.510.0#%s.%c%ddaiadbibedeafdfafafdeaed, #0x%04x0x%04xspsrcpsridie_cxsblsdeppmzp%df%d, c%d, %d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown] lu tu 6oshstoshnshstnshishstishstsycpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxtmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxundstrtdaWldrtstrbtldrbtstrldrstrbldrbpushpopstmYnWlldmXnWlblimbimbrangeswistrhtdeldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsdpmsrpFmpF2bxmclzdmbkptkmovwdZmovtswpdmoswpbldrexdaldrexdldrexbldrexhstrexdmastrexdstrexbstrexhandSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnmulSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsdrfswfcrfccmfPRghcnfcmfecnfevandNuqwvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddINuqwvtstvsub  "No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxmachdepdebugbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() -1single-skdb-k-dask-auserconf-chalt-b-2-3-4quiet-qverbose-v-xsilent-zw!N_bus_dma_busaddr_to_paddr%s: curaddr %#lx not in range_bus_dmamap_sync%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botch?>?>?>?>?>?>?>?>@>@>*@>9@>?>H@>`@>u@>L%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x VA@>I>2PVAA>I>2VA@>I>2AVAA>I>3VAA>I>3 VAA>I>3pAA>I>3qAA>I>3qAA>I>3qAA>I>3qAA>I>3AA>I>4D A>H>4D A>xH>4i B> H>4`RfB>I>4 i B>G>4qAB>I>4TrAB>I>4TtA&B>I>4TtA;B>I>4TAPB>I>4T AXB>I>4TA`B>I>4TPThB>I>4T`A sB>I>5TE`A }B>I>5TE`A }B>I>5TE%V B>I>5TEWV B>I>5TE iB>F>5TE $iB>F>5TE0$iB>F>5TE ,iB>F>5TE0,iB>F>5TE .iB>hF>5TE0.iB>hF>5TEAiB>E>5TE!iB>(F>5TE !iB>(F>5TE)iB>(F>5TE )iB>(F>5TE-iB>E>5TE -iB>(F>5TEAiC>$E>5TEAiC>$E>5TEAi#C>$E>5TEA 1C>I>5TE A :C>I>5TE`A EC>I>5TEJ`A QC>\I>5TEJ`A_C>\I>6J`AmC>\I>6J`A{C>\I>6ZK AC>I>6KPAC>\I>7ApAC>\I>7AAC>\I>7A/AC>\I>7A?AC>\I>7AAC>\I>7A/AC>\I>7A?AC>\I>7AOAC>\I>7AA D>\I>7A/AD>\I>7A?A-D>\I>7AOA;D>\I>7AAID>\I>7A@AWD>\I>8A0AeD>\I>8ApAsD>\I>8ApAD>\I>8AAD>\I>8AXVD>I>`AD>I>XVD>I>?AD>I>@XVD>I> AD>I>@X/VD>I>Processor failed probe - no CPU ID %s%s%s (%s V%s core)@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>A> A>A>A>A>$A>+A>5A>+A>=A>BA>LA>SA>bA>iA>sA>yA>A>A>A>A>unknown CPU (ID = 0x%x)%sHz: %s %s : %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DunknownARM2CPU_ARM2ARM2asCPU_ARM250ARM3CPU_ARM3ARM6CPU_ARM6ARM7CPU_ARM7ARM7TDMICPU_ARM7TDMIARM8CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM250ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15D>D>D>D>D>D>D>D>D>D>D>E>E>E>E>E>step A-0step A-1step B-0step B-1step C-0dE>mE>vE>E>E>D>D>D>D>D>D>E>E>E>E>E>rev 0E>D>D>dE>D>vE>dE>D>D>D>D>E>E>E>E>E>step B-2dE>mE>vE>E>F>E>D>D>D>D>D>E>E>E>E>E>dE>D>D>D>D>D>D>D>D>D>D>E>E>E>E>E>dE>vE>D>D>D>D>D>D>D>D>D>E>E>E>E>E>step D-0dE>mE>vE>E>F>D>D>D>D>D>D>E>E>E>E>E>(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)4G>EG>D>VG>gG>xG>G>G>D>D>D>E>E>E>E>E>step B-3step B-4step B-5dE>D>D>D>vE>E>F>G>G>H>D>E>E>E>E>E>step Bstep Cstep Dstep Erev 10step GE>LH>SH>D>D>D>D>D>ZH>aH>hH>E>E>E>E>step Jstep Kstep Sstep TE>H>H>H>H>D>D>D>D>D>D>E>E>E>E>E>*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15I>I>I> I>$I>(I>,I>0I>4I>8I>AI>FI>KI>PI>UI>E>D>D>D>D>D>D>D>D>D>D>E>E>E>E>E>userkernel M>D M> M>D M>8 M>M>8 M>N>8 1N>RN>8 cN>N>8 N>N>8 N>N>Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=%08x, Invalid, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x data_abort_handler %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap badaddr_read%s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)  machdepkmpages@````` ```pmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx,b  dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable %d device bad device not ready area improper i/o error aborted from console error %d succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)# !!!!!!!!!!!!!!scsiverboseperiphdisktapeprinterprocessorwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storageunknownscsipi_dtype: impossible device type22@wuQa~>uuw>\bb\\\NbbR-pp },scxspl%sunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer 0x%02x   %02x DEFERRED ERROR, key = 0x%x OY>fY>pY>}Y>Y>Y>Y>Y>Y>Y>Y>Z>Z>&Z>8Z>, requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal) , data =Sense Error Code 0x%x at block no. %d (decimal)ES-6600 request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d q  polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedcommand abortedsearch returned equalvolume overflowverify miscompareunknown error key"/++-scsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter probe%s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d)async, 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueing tagged queueing N(8V]]]Fsoft error (corrected)ATA illegal length indicationATA volume overflowATA command abortednon-media hardware failurereadonly devicemedium errornot readycommand abortedillegal requestunit attention%s unknown error code %d probe%s(%s:%d:%d): \gg\gggg?wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d !!!!D!wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: %s error (0x%x) wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out }!{!t}!}!atapiscsibusdetscsinitqscouldn't establish power handler : SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info%s target %d lun %d: <%s, %s, %s> %s %s%sp>$p>Lb>@5p>>p>Lb>5p>Op>Lb>`p>ip>Lb>5p>zp>Lb>p>p>Lb>p>p>p>p>p>Lb>p>p>Lb>p>p>q>q>q>.q>3q>Lb>Mq>Vq>gq>kq>tq>Lb>kq>q>Lb>kq>q>Lb>kq>q>Lb>kq>q>Lb>q>q>q>q>q>r>r>r>r>!r>*r>Lb>!r>;r>Lb>!r>Lr>Lb>!r>]r>Lb>!r>lr>Lb>!r>}r>Lb>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>Lb>s> s>s> s>)s>8s>=s>Fs>Lb>Ls>Ss>Lb>kq>\s>Lb>ms>vs>Lb>ms>s>Lb>s>s>s>s>s>s>@s>s>Lb>ap>s>Lb>s>s>t>!t>t> t>p>%t>Lb>*t>3t>Lb>s>9t>Lb>?t>Ct>Lb>s>Ht>Lb>s>Pt>Lb>s>Xt>Lb>s>at>Lb>Lb>ft>Lb>nt>Lb>Lb>wt>t>Lb>t>t>Lb>t>t>Lb>t>t>Lb>t>t>Lb>t>t>Lb>t>t>Lb>t>u>Lb>t>u>Lb>t>#u>Lb>4u>=u>Lb>@t>Du>Lb>Nu>Wu>Lb>kq>hu>yu>~u>u>Lb>u>u>Lb>u>u>Lb>u>u>Lb>u>u>Lb>u>u>Lb>u>u>v> v>v>Lb>$v>-v>Lb>$v>>v>Lb>$v>Ov>Lb>$v>`v>Lb>$v>qv>Lb>$v>v>Lb>$v>v>Lb>$v>v>Lb>$v>v>Lb>$v>v>Lb>$v>v>Lb>@$v>v>Lb>$v>v>Lb>@$v>v>Lb>r>w>w>ms>w>Lb>w>'w>Lb>w>-w>Lb>$v>>w>Lb>$v>Iw>Lb>Tw>[w>Lb>gw>nw>vw>{w>w>Lb>w>w>w>s>w>Lb>w>w>Lb>w>w>Lb>!r>w>Lb>!r>w>x>!r>x>%x>!r>(x>%x>9x>Bx>Lb>Sx>\x>Lb>Sx>mx>~x>Sx>x>Lb>x>x>Lb>x>x>Lb>x>x>Lb>x>x>x>x>x>x>x>x>y>r>y>Lb>y>"y>3y>8y>Ay>Ry>8y>Wy>Lb>8y>hy>yy>8y>~y>y>y>y>Lb>y>y>Lb>y>Lb>Lb>y>y>Lb>!r>y>Lb> y>y>Lb>y>z>Lb> not configured LUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X VGENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307PiSCSI SCSI CD-ROM QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA Virtual CDROM !\!t4t4t!4T7<6"3t4scsibusscsibus at %s channel %dscsi_subrLwG,!z>xw!pS!w!x!xw!pS!w!x!z!xw!pS!w!x!z!xw!pS!w!x!Tx!removablefixed%s drive %d: <%s, %s, %s> %s %s : %d targets scshutsccompxscmdcouldn't establish power handler atapibus at %s}>}> }>&}>}>0}>@5}>}>E}>@K}>}>R}>@V}>}>`}>e}>}>v}>@|}>}>}>|}>}>}>}>}>}>@}>}>}>}>}>}>}>}>}>}>}>~>~>}>~>~>}>,~> not configured ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibus"&) J-88c&&&&&&&&&&&&&&&&%15:9&?&&CHN&R&&&&&&&&W''''''''''''''' &,065':''o>o>o>o>o>p>o>o>optical mediaread_cd_capacity: extra large block size %u found - limiting to 2kByte cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cdm8!!!!x! !!66c8!!h!(!!4T7<6"3!66ccache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack >>>>>>>>>>>>>>>>>>RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry !!8!!@!t!|!!(!4"!!$!! %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectors (%lu bytes/physsect; first aligned sector %u)drive offlineunformatted mediacouldn't establish power handler sd _CK.A\M%s: not supported ERROR TIMEOU DF%s: status=%s wd_flushcachewd_trimc>>>>>)>7>>̊>>>>>)>7>P>, %s: (error not notified%s%s) wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %x %s: disklabel indicates BAD144 but BAD144 not supported on this drive%s: disklabel indicates BAD144 but BAD144 table not found%s: invalid BAD144 table%s: error %d reading BAD144 tableT""l"("4,"'"'"66cwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed DMA errordevice faultdevice timeouterrorrequeuechannel resetwd, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcacheIDENTIFY failed >>ɋ>%s<%s> SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jd)WARNING: block size %u might not actually work l""T"""(" " "8 "$ "couldn't establish power handler hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate wd_standbyT""("X("("4T7<6"3'"66caddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS(2"<"T1":"0"wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwaitrecalpiomodegeometrysetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq H0"%\%%W"@0"80"J"atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqataatastart%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout ata_thread_run%s: unknown type: %x %sunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atabus_thread%s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d,32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusQ"pU"t4t4M"4T7<6"3t4atdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxferxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't establish power handler , " "%s%s%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x)%sat %s function %d%scouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed init failed sdmmcbad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short #(-27<FP d'CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: SpectecSDIO WLAN CardSDW-820writereadextended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz pauseerror waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't change bus clock can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d e @ can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostCardHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) v>a>P>> ,>@Pcan't get SD status: %d  SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenance can't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x d' #(-27<FPunknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d error, retrying ld_sdmmcldLwG"ܝ>>config_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270PXA250: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxaintc pxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dpxagpio: can't map registers pxauart %s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostC CCCC !Not supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d unable to create new screen (errno=%d)console lcd_free on active screen h########: DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmac couldn't map memory space unable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicsss: %d slot%s can't attach failed to map MEMCTL pcmciaunable to map register pxa2x0_i2c_intr_sub%s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't map registers couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer sdmmccouldn't attach bus   CW[jM_a8]o ]#Z#apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM : %s reserved>>>APM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %s : Power Management spec V%d.%dget power status%sunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM defined[#[#t4t4d#4D\#<6\#t4apmdev couldn't establish power handler pcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) , %s%s (manufacturer 0x%04x, product 0x%04x)%s function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! pcmciaJXjj[  "$CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x , %s%s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS 5>|>5>>=>|>=>>V>>V,> >>>>>>>Ǵ>D>8>Pи>ķ>ɴ>ٴ>\>P>>ܴ>%s: using CIS quirks for , %sSVECFD605 PCMCIA EtherNet CardNDCEthernetAPCMCIA MBH1030201%  8  @!!@! ! #/ ''w0 g'' c0c  >>>HT>*>z3>@>z_>f> _>f> >m>t>{>t>>>>@>>@>>>>>>>>l >>>H3>>><>A> >Q>f>@IeIIm>r>I0I0Et>z>>>@&II  I>>t>>@"I0>>>-/>>>>>>>>>#>>8>>N>f>m>>|>>>>>>")>>uE o@o @o @ >>>>> >>>@& 3BI@>> @(#0can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAEthernetAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETAdapterSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAETHERNETcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0NDCDYNALINKL10Cne_pcmcia>>TBcouldn't establish interrupt configure failed, error=%d %scouldn't establish power handler MEGAHERTZMODEM XJ2288com_pcmcia >-> >>2'E>>&>)>A>Z>b>m>t>{>>>>m>>m>> configure failed, error=%d can't subregion I/O space memory mapped mode i/o mapped mode wdcattachunable to establish power handler Digital Mobile Media CD-ROMPCMCIA Portable CD-ROM Drive NinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEPCMCIACD-ROMIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmcia>>>>>>>>VVwh+>7>+>K>`>l>>>>>>>>>P8soo P q q sMklt>>tt3>> hC>> h&wiinitcouldn't load firmware configure failed, error=%d %s:failed to attach controller couldn't establish power handler SMCSMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC Cardcorega K.K.Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11coregaWL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaFILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~usbevtusbrhxfer _?g?o?s?w?{??: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hc%susbtask-drunable to create task thread: %s usb_create_event_thread task<#P#usb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s couldn't establish power handler usbusb at %sunknownpre 1.01.01.12.03.03.1p#l##t4 #4#<6D#t4usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach usb_desc_iter_peek%s: bad descriptor %s: descriptor length too small %s: descriptor length too large addresshub-addresshub-portclasssubclassreleaseprotovendor-idproduct-idvendor-stringproduct-stringserialnumberusbverbose port %d configuration %d interface %dusbififusbdevifvendor %4.4xproduct %4.4x????????*?1?9?I?R?[?c?r?z????%d%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %d%s, %susbdlyusbd_fill_iface_data%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@eaQ@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@o7@O@R@T@a@c@q@}@@(@v@&@A@N@j@o7@gO@%@+@4@>@0@`1l703% bU bU b9 : %mZmw`%  2 @@watchdog timeout usb error on tx: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) usb error on intr: %s open rx/tx pipes failed: %s tx list init failed rx list init failed Ethernet address %s couldn't establish power handler usbnetLwG$?hub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d singlemultiplesselfbus : %s %s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s couldn't establish power handler uroothubuhubuhid at %s reportid %d   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u     u ;u )%u&5Fu 3 4u&6F  0 1  2 5  :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F  uhidev%s, iclass %d/%d couldn't establish power handler could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lockuhid_usb%s: was console keyboard too many Variable keysbad modifier sizemultiple key code arrayskey codes not on byte boundarykey code size != 8 couldn't establish power handler attach failed, %s PPPP@V$PV$M$L$@M$ This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). 5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;< =>?@ABCDEOMPJQNRK ukbdPNNLN#9_@_'T~unknowng$\f$h$n$m$o$ %s L@V@Z@1@6@<@@@D@using %s over %s quirk init failed could not read endpoint descriptor endpoint not found %u/%u/%u %s: Get Max Lun failed: %s unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=%#x not supported bus attach failed couldn't establish power handler inoutINOUT%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s SCSIATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumass s$ ts$  % L Ps$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ fc 46umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbscsi}!{!t}!x!atapiF  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |%s: reset failed %s $Ԅ$ȃ$@}$}$~$,{$z$z$failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out if_aueusbnetLwG4z$@@aue %s $Ȋ$2VZP~" `"'`{%1no union descriptor no data interface setting alternate interface failed could not read endpoint descriptor unexpected endpoint could not find data bulk in could not find data bulk out faking address if_cdceusbnetLwGX$ @ @cdce# # %s: reset failed %s failed to set configuration, err=%s Đ$$$$Ѝ$$getting interface handle failed couldn't get ep %d %s: read MAC address failed if_cueusbnetLwG$ @ @cue@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0 %s $t$P$|$failed to set configuration, err=%s %s: warm boot, no firmware download %s: cold boot, downloading firmware dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!%s: failed to load code segment: %s d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^%s: failed to load fixup segment: %s d%s: failed to load trigger segment: %s %s: reset failed loading firmware failed getting interface handle failed couldn't get ep %d missing endpoint could not read Ethernet descriptor if_kueusbnetLwGܒ$:@A@kue P@9WPurl_uno_mii_read_reg%s: %s: bad register %04x %s l$ $$$`$̛$p$ $failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed url_uno_mii_write_regif_urlusbnetLwG($@@url( B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn media change failed read PHY failed can't read rxmode %s @$0$P$$p$l$ؤ$$failed to set configuration, err=%s getting interface handle failed couldn't get ep %d failed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axeusbnetLwG$"@ "@axe$u$u$x$x$Pxmue_csr_read%s: reg = %#x: %s mue_uno_rx_loop%s: packet length %u too short %s: rx_cmd_a: %#x %s: invalid packet length %d mue_uno_tx_prepare%s: packet length %d too longmue_csr_writemue_read_otp_raw%s: not ready %s: timed out mue_eeprom_getbyteLAN7500LAN7800 %s $$h$$T$H$@$$$failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints mue_chip_init%s: PHY not ready failed to initialize chip %s id %#x rev %#x failed to read MAC address mue_uno_mii_read_regmue_uno_mii_write_regmue_dataport_writeif_mueusbnetLwG$$@$@mueF hF  %s $8$P$`$$$$ $failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed if_udavusbnetLwG$%@%@udav42-# s%s: %d silo overflow%s, %d ibuf flood%s  !)com: unsupported I/O width %d$$$0$$0$$$<6$7t4device enable failed timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTNXP UARTDesignWare APB UART, no fifo is_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO : %s txfifo disabled console Could not create workqueue: %d unable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain(%%%l%!%%<%( %8!%%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector %u) couldn't establish power handler %s: not drained %l%(%l%%t% %%l%%P%l%4T7<6"3 %lddk_subrLwG%*@*@   +-/, ,Lucent/Prism/Symbol 802.11 controlswisysctl_wi%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed wi_push_packet%s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d wi_write_txrate%s: tx rate %d -> %d (%d) wi_start%s write fid %x failed init failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout wi_rx_intr%s read fid %x failed wi_rssadapt_input%s: null nodewi_tx_intr%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundwi_tx_ex_intrtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%x wi_scan_result: unknown firmware type %u 1@1@1@1@2@>2@g2@2@2@2@ 2@ 2@ 3@ 3@ 3@)3@)3@)3@L3@L3@L3@q3@q3@!3@"3@LucentSymbolIntersil could not establish softint could not get mac address, attach failed 802.11 address %s %s: using %sUnknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d device enable failed yyyyyne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete THIS is A memory TEST patternwhere did the card go? setup failed 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT ##$atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1 atapiatatimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdy%s:%d:%d: setting PIO8_EN %s:%d:%d: failed to set 8-bit PIO (%d) atacnf%%T%<%ܰ%atardl%%@ %%@0%%44   @ @ @  0        @* Root hub ) 2%%%%%%+CP]j 9999:OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %%%%&D% &d%%%%&&x%4%%%%&H%%%ohci_setintr: 0 interval t%l%&,%&&%%% %%&\&%%ohci_device_isoc_abort: early return ohciabt2WARNING: addr 0x%08lx not found , legacy supportohciabtohcixferOHCI version %llu.%llu%s unsupported OHCI revision      SMM does not respond, resetting %&%T%D%t% %4%<%reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so/libexec/ld.elf_so%s-%s%scompat_utilLwG&W;@invalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow?@?@?@,&z?@?@?@?@n@ b?@?@?@?@JڧoI?@?@ ?@?@a6?@?@ ?@?@Q?}-"?@?@ ?@?@@ZC˔ ?@?@I;0@aes_ccm_selftest%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaesLwG>&>@>@)dÐ=*oVQq-=F%p{]#NSen>hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6cryptoaesselected @@C@ \A@C@ ,B@D@ AES is bustedaes: self-test failed: %s AES self-tests failedaes: %s  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN%s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed    !"#$%&'()*+,-./%s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed 1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }%s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed   !"#$%&'()*+,-./%s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed cryptochachaselectedchacha: self-test failed: %s chacha: %s LwG@d&#O@expand 32-byte kPortable C ChaChaO@e&q&n&Xv&e&}&u&@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[xchacha_streamexpectedxchacha_stream_xorjUS_&)ûIt~._dyz,(4y:b,ia /A&chacha core 1"3DUfw̻wfUD3"-chacha core 2  J1AY'A;B'{BP}sՊtS.&hchachab@b@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Qb@b@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHb@b@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHb@b@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@b@b@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rieee80211_crypto_newkey%s: invalid cipher %u to@}o@o@o@o@%s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s ieee80211_crypto_setkey%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! ieee80211_crypto_encap[%s] no default transmit key (%s) deftxkey %u ieee80211_hdrsize%s: control frameieee80211_crypto_decap%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckipieee80211_hdrsize%s: control frameccmp_setkey%s: Invalid key length %u, expecting %u p@&&8&&&&&[%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEp@&&&\& &&&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize%s: control frame0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-out of buffers with data_len %zu tkip_encap[%s] Discard frame due to countermeasures (%s) tkip_setkey%s: Invalid key length %u, expecting %u [%s] missing ExtIV for TKIP cipher tkip_decap[%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt tx@&&&,&T&&&TKIP0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt ieee80211_hdrsize%s: control frame}@`&T&&&&&&WEP333,*,**F$(Kc & = ieee80211_hdrsize%s: control frame[%s:%s] discard %s frame, frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: %s[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed null nodetoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6D:too short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xdatamulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued WEPPRIVACY offmulticast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xrereassocassocWPARSNshortlong, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d authdisallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s  JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 maccompat_20link-layer statistics and controlslinkIEEE 802.11 WLAN statistics and controlsieee80211ieee80211_sysctl_treetop%s: sysctl_createv failed, rc = %d client/peer stationsnodesdebugieee80211_sysctl_setup%s: sysctl_createv failed (rc = %d) vap%uparentinact_runinact_probeinact_authinact_initdriver_capsbmiss_maxieee80211_sysctl_attach%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done %s[%s] %s replay detected [%s] michael MIC verification failed ieee80211_load_module%s: load the %s module by hand for now. operating mode %ubogus aid %u, max %u_ieee80211_free_node%s %p<%s> in %s table node_reclaim%s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u ieee80211_free_allnodes_locked%s: free all nodes in %s table ieee80211_node_table_cleanup%s %s table %s: %s[%u] still active , ieee80211_reset_scan%s: scan set:%s%u start chan %u ieee80211_next_scan1%s: chan %d->%d ????essibsswepno! %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s _ieee80211_find_nodeieee80211_setup_nodeactivepassiveieee80211_cancel_scan%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULLieee80211_get_rate%s: fixed rate %d (%d.%d Mb/s) not in rate setieee80211_tmp_node%s %p<%s> ieee80211_find_rxnode_withkey%s: add key map entry %p<%s> refcnt %d ieee80211_find_txnode[%s] no node, discard frame (%s) ieee80211_find_node_with_channel%s %p<%s> refcnt %d ieee80211_find_node_with_ssidieee80211_free_node%s: %p<%s> clear key map entryneighborieee80211_create_ibss%s: creating ibss stationshortlong, protectionieee80211_ibss_merge%s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s ieee80211_end_scan%s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %pieee80211_node_delucastkey%s: delete key map entry %p<%s> refcnt %d [%s] power save mode off, %u sta's in ps mode ieee80211_iterate_nodes%s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d ieee80211_node_leave_11g%s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble ieee80211_timeout_stations%s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivity%sstation timed out due to inactivity (refcnt %u)re, QoS[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated ieee80211_node_join_11g%s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s ieee80211_node_table_resetunable to setup initial BSS nodeieee80211_node_table_init%s %s table, inact %u scan$$hhu Penadis[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!ieee80211_encap[%s] no default transmit key (%s) deftxkey %u not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!ieee80211_compute_duration%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuPPPPPPPPPWPA IE too big, %u > %zuPieee80211_send_probereqieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u null nodeieee80211_send_mgmt[%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u ieee80211_mgmt_output[%s] encrypting frame (%s) [%s] send %s on channel %u ieee80211_beacon_alloc%s: cannot get buf; size %u no space for 802.11 header?ieee80211_beacon_update%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued >{4%$$ @@@@@@@wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl"%c0x%02xieee80211_newstate%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%s(%s)TODS %sFRDS %sDSDS %s(%s->%s) data %s type#%d WEP [IV %.02x KID %u] %dM +%d   0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x        ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparams%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon miss%s wlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtsctsackcf_endcf_end_ackassoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocauthdeauthreserved#13reserved#14reserved#15linkieee80211rssadaptdebugexpavgctlieee80211_rssadapt_sysctl_setup%s: sysctl_createv failed (rc = %d) %s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d -> %d %s: dst %s thresholds %d-byte, T[%d.%d] = %d @external%hu.%hhu%s:%hhuigmpplinetigmpstats.7}>]J)JJJJUJJJJ ??lla_lookup: new lle malloc failed inmltplinetmulticastipsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinternetLbX}(((̇(LbCU(pM(lM(@Q(Lb)hM(dM(@)Lb((`M(\M(T@D%)H6)5)Lbx(pM(lM(@LbCt_lastm == NULLtcp_output%s: no template%s: %d < %dsackholeplS tcp_inittcpcbpltcp_new_iss: unreachablesyn_cache_respond%s: impossible (1)%s: impossible (2)synpl @@@@@@@`[) ^)H_)`) 1DW]e_ace!!rfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlavailableselectedwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localidentdo_loopback_cksumpcblistkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesmaxholesglobalmaxholesglobalholesstatslocal_by_rttdropiss_hashabcaggressivemsltloopbacklocalremoteremote_thresholdvtwentriestcpinettcp6inet6)T)<)\)lc)t)8)))P)q)c)@)D)Б))L))) `)D)P)))reno)D))t))newrenoģ)))))cubic""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwudp_abortudp_acceptinetudpchecksumsendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunction8)))) ))) ))))))))$)))<)j@)n@(){@P)@0)@)@d) bsdrandom_startrandom_pickhashdoublehashrandincm_pulldown malfunctionm_pulldown malfunction8BZ $>FN2:BJRZbjr/7Um%Ybx[<<(src=%s dst=%s tgt=%s)m_pulldown malfunctionicmp6_redirect_input%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_reflect%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d _icmp6_input%s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) inet6icmp6statsrediracceptredirtimeoutnd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknd6_gctimernodeinfoerrppslimitmtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtudynamic_rt_msgicmp6_error%s: ENOBUFS in icmp6_error %d NYIPv6 address: "%s" is not on the network lla_lookup: new lle malloc failed in6_update_ifa1%s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s in6_get_llsol_addr%s: in6_setscope failed in6_join_mcastgroups%s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlin6_if_link_up%s: %s marked tentative in6_if_link_down%s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headerin6_ifattach%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback%s: failed to configure the loopback address on %s (errno=%d) get_ifid%s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal%s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6db)d*0)))db:CT8*t*p*D@**dbh+l*h*@@+db)d*`*T@D*H6)5)db+t*@*D@db<)db++db,0)dbCp<<*@*D@D<db)Cp<<*@*D@D<dbsCp%s ip6_get_prevhdr%s: off < sizeof(struct ip6_hdr)ip6_nexthdr%s: m == NULL(@AAA==(A*/1inet6pim6statsregister_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctioncW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aassumption failed: hdr not splitip6_output%s: refusing to send from invalid address %s (pid %d) m_pulldown malfunctioninet6multicastmulticast_kludge ))))))))%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timernd6_init%s: workqueue_create failed (%d) nd6_options%s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt nd6_resolve%s: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest%s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 nd6_na_input%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %u, NA packet %zu) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_ns_output%s: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer%s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_input%s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %u, NS packet %zu) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) nd6_dad_start%s: %s: starting DAD for %s RSRAnd6_rtr_cache%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: src %s is not link-local %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, %s packet %d) &.3;CKS[cksinet6raw6pcbliststats+ȋ+++T+L+܋++̋+0+|+ԉ+h+T+܉++t+@++m_pulldown malfunction  sa6_recoverscope%s: assumption failure (non 0 ID): %s%%%d in6_setscope%s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s @@@@@@@@@@@@@@interfacelinkunknownsiteorganizationglobalinet6udp6sendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunctionudp6_output%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket ت+\+ܥ+ +,++ا+Щ++++++p++++P++*&Rik  $ "BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d @@O@@@@7v@@O$@ @Z@@!@A@v@@F@@u@ @J@P@@ j@ Z@ "@ @ 8@ @ @ NN@H@X@ @ @ @[@@U`@o@ 9@ @ @aAcCeElLBAnNDCoOsS[ZuUxXzyzZ|{"5% mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0), --_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\5$#"12< 3>!(4[")5]#@6^$+7%-8&/9'*0-=.%`bB|_pP&oO`!vV  dDlLjJ/zZ0wWaAuUiI eE ,;' cC' tTsSrR3nN4mM2\yY{xX}.:kK~'?qQ 6gG7hH8fF(, _d/^ q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ 5 12 3l#!4>"5<#6$$7%8"" &9""/'0""*----.' xX.vV_lL[cC]wW^kK!hH<7 gG>8fF=9qQ&+/f-0uU\iI/aA{ eE} oO* sS? nN(4rR)5tT-63dD:,4yY@.#$ |pP~ zZ`bB+:mM%16,-"27..'38jJ;;2 9 d .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>|  9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm ++ : input=%d, output=%d, feature=%d uhidreacouldn't establish power handler +(+\++(++4@+<6(+t4D6d:c addr 0x%02x(unknown) ()%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlisti2c-indirect-probe-strategyinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-bytenoneunknown probe strategy '%s'; defaulting to '%s' WARNING: ignoring bad device address @ 0x%x : I2C bus i2cdevstcouldn't establish power handler i2c-child-devicesi2c-no-indirect-configi2c-enumerate-devicesaddrnamecompatibledevhandleWARNING: ignoring bad child device entry for address 0x%x iici2cexec,i2c_subrLwG\+@@ ++t4t4+4T7<6"3t4i2cexecLwGx+@iic at %s bus %di2c_subrLwG+B@     mii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4x OUI 0x%06x model 0x%04xmiiaut!A  !@@@@mii_phy_setmedia: MASTER on wrong media, no media present HomePNA1%s%s10baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXauto couldn't establish power handler RRTRRRRRRV@@"@E@h@@ @ @ @ @;B@.e@@@@@@4:@_@@5@6@ @ @ 4@ <Q@ ?n@ ,@ -@ @ @ @ =@@ :]@ z@ @"@6@$ @-@ Q@8w@P@##   1 @,, ,,, ,,, ,,0, ,: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX  22     * #hhu hhhBCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyA L@: Media interface : %s, rev. %d ',#,P&,DP83840 10/100 media interfacensphy) 2@@ @ @: Media interface : %s, rev. %d +,H*,),DP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyter) 2@: Media interface : %s, rev. %d d/,,,0/,QS6612 10/100 media interfaceqsphy) 2U(@UF@U2a@U3@U1@: Media interface : %s, rev. %d 3,1,+i82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphy) 2 @U5 @: Media interface : %s, rev. %d <6,(4,+i82553 10/100 media interfaceiophy: Media interface : 3Com internal media interface X8,,$8,ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexexphyM V xX@{ v@t<,,<,t<,9,<,: Media interface : %s, rev. %d 100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphy) 2@;@Z@y@@: Media interface : %s, rev. %d @,,>, @,ICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphy) 2}X@}z@}@: Media interface : %s, rev. %d C,A,E,using Seeq 84220 isolate/reset hack C,A,+Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphy) 2vXAvAvAv Av Av An`XA: Media interface : %s, rev. %d H,F,+DM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphy) 2X9|A: Media interface : %s, rev. %d J,8I,+Am79C901 HomePNA 1.0 interfacepnaphy) 2: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d : Media interface M,,+ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyxor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zero[,{,@],Z,t,f,_,],[,^,t4%s: emergency X server detach screen %d-%d added (%s, %s emulation) wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted dmux kbdmux %d: console (%s, %s emulation), using %s wsswcouldn't establish power handler wsdisplay at %sloadedwsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDID =( dumbA,8,,,l,Ԃ, !!!c        BBB257#A^bgejzuxwsemul_vt100_output_c0c1%s: ESC in kernel output ignored ,,T,,X,4,x,,p,,,,vt1008A$,<,,,|,8,|,؎,W\))GhntLAu  "$&((((((((+=????????B`/[>24;20;0cP2$u%s%d\P0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" , A2 A8 A> AD AJ AP AV A\ Ab Ah An At Az A A A A A A A A A$ A( A A A A A A A A A A AOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_versionwsevent_copyout_events%s: unknown version %dwsevent_readh,,  mux %dcannot load keymap: console keyboard, using %s attach error=%d couldn't establish power handler couldn't register as input device connecting to %s disconnecting from %s wskdetwskbd_detach: %s didn't detach P,,,t4,4h,<6,t4wskbd at %s%s: event queue overflow wskbd ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmuxconnecting to %s %s: disconnecting from %s ,,,,t4\,4|,<6,t4wsbell at %swsbellrasops_reconfig%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported rasops_init%s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary @`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????cwccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not lockedb&b&b&)A)Ao+A+A                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(-A-Aa-A)<.A2e.A.A.Aͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠBoldfacecd9660nopl.0679 &..RRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991APX4-7-TFH5-<5-PN4-RRt3-CE3-ST3-NM6-<:-CL4-0PL4-0RE\3-@RRt3-CE3-ST3-SL:-RRt3-CE3-ST3-SPER<-CE3-ST3-cd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] :CD001%/C%/@%/Eroot_deviceL6A4AL3ALwG\H-2A cd9660_strategy: spectag VT_ISOFS, isofs vnode ..(dT3AAo9A,:An:An:An:An: An:An:An:$An:\An:xAn:An:An:An:An: An:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥmsdosnoplmsdosfhplp-o-loadvnode(): pcbmap returned %d :o-:o-:deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld updatefats%s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. .. msdosfs_rename: updating .. in root directory?- --(-آ---0---msdosfsmsdosfs_sync: rofs modRRaArrAaUmsdosroot_deviceh=ALwG-^?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zbind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d BDZ\^`bdfhju_acknfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpw7.X6.7.5.nfskqpollnfskqdetnfs_sillyworker%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_init:.4:.:.:13/nfs send error %d for %s nfsd send error %d nfstimertimer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s  @not respondingnfsrvdescplVAVAUAUAUAUAUAUAxUA\UA@UA"UA UATATATATAzTAnTAdTAZTANTA ?BEF   build > MLENF''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  nfsumntnfsnfsstatsiothreadsbuild > MLENnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%u/nfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for root[AHZAXALwG\.VA build > MLENnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)dXAAo9A,:An:An:An:An: An:An:An:$An:\An:xAn:An:An:An:An: An:.8A:TA.An:A4.Al:A,:dPZAAo9A,:AX:A,:A,:A,: A:Ad:A:$AL;\A:xAl:A8:A;A<:A,: A,:.8A:TA.A4.Al:A<9d[AAo9A:Ad.AI/A\I/ A.(A.8A:TA.pA0.A.A4.Al:Ad.A .A,:4A@-PA:ffs_mapsearch%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%sffs_nodealloccg%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%spid %d, command %s, on %s: %s uid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s ffs_freefile_common%s: freeing free inodeffs_blkfree_common%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free ffs_blkalloctrimwqtrimwqcvffs_blkfreeffs_realloccg%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %sffs_blkfree_snapffs_freefile%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_freefile_snapffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataffs_truncate%s: unexpected snapshotitrunc: newspace   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblockcAcAcAbA        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffs_snapgone%s: unexpected snapshotffsdoclusterreaddoclusterwritedoreallocblkslog_changeopte00:0:ffs_newvnode%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mountingffs_reload%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty20 0 0X/L%0l[0_0 %s: options QUOTA2 not enabled%s root_device%s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' ffs_sync%s: rofs mod, fs=%slAkA %#jx (fixed) uao_putuao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultt0ubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object udv_detachudv_attach00(0p0flt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmemkmemkvauvm_km_suballoc%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainfltagain2loanzeroloanuopg*1Mprocuser_va0_disablevmmpeplP61|61vm_mapuvm_unmap_remove%s: kernel object %p %p uvm_voaddr_release: bad typevmmapbsyvmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressguard_sizethread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %dsA uAXAtAemergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! pooldrainfork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slabuvm_page_physload%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.uvm_physseg_unplug%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG  U]rr:r$swap_off%s: swapdev not in listswap_encryptswstrategy%s: vnode type 0x%xuvm_swap_init%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedminirootswapctl: miniroot copy faileddisksortswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiodswap_on%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d done 4421t44T7<6"3t41t42t4t4t4uvnfp1uvnfp202,202,22copy-cred-on-forkbufq_disksortLwGd&2Adisksortbufq_fcfsLwG'2AfcfsNetBSD-CORE%s@%dELFNetBSDexec_elf32LwG072A#!exec_scriptLwG8H2+Avmcmdkillsextendscallsinit/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit pathJA/A;AJA (default %s): haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d pgdaemonfork pagedaemonioflushfork syncer%s %s (%s)%s %s %s%stotal memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/init  maxvnodesmaxprocmaxfilesargmaxhostidvnodeprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetroot_devicefsyncipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timeconsdevmaxptysmaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrlwpforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetiddumppathownergroupmodeno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionversionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvmvfsnetdebughwmachdepuserddbprocvendoremulsecurityA,@A#7$wx@g`8@O@Accounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptcv@2t444deadcv" """usersystempid %d (%s): %s write of %zu@%p at %lld failed: %d %s%d%.*s%lldcoredumpLwG|2\AToo many CPUs. Increase MAXCPUS?cpu%d444424T7<6"3t4fdcloseincrease kern.maxfiles or MAXFILESfilefiledescfile2dup22t4t4t4t44T7<6"3t4entropy: ready entropy: best effort <cpu0entropy softintentropy intrdropentropy intrtrunc<WARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) <WARNING: system needs entropy for security; see entropy(7) 22seedH3entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategatherneededpendingsamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)filt_timertouch%s: invalid type (%ld)A|4|43 33t3,333 3kqueue 3 3org.netbsd.kauth.process03 3 3 3 3 3433 33 43L3,3 3,3 3EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY 3X3p13T 3%s: %s is suspended by %s (delegator %s) pmfdebugeventsuspendsuspensoridletransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classdriverbusPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.self%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: giving up done Suspending devices:. %s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueue@APAHA8AAdAAdA8Asystemdrvctl**** RVY\bc@bcfailed to reserve PID 1 for init(8)procplorg.netbsd.kauth.processexpose_addressprocproc2proc_argswaitlwpwait@@ @@ %s (pid %d) changing logname from %.*s to %s reboot KKK]UKKkorg.netbsd.kauth.processcurprocpaxflagscorenamerlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememoryusememorylockedmaxprocdescriptorssbsizevmemoryusemaxlwpstopforkstopexecstopexitcoreschedcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x rw_vector_enterlocking against myselfrwlock`a5$a54@p4Reader / writer lockcrashme_sysctl_forwarder%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashme_mutex_recursion%s: locked once %s: locked twice %s: initialized crashme_kpreempt_spinout%s: disabled kpreemption crashme_spl_spinout%s: raising ipl to %d %s: raised ipl to %d, s=%d crashmeselfdebug_crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s crashme_remove%s: unable to remove %s from sysctl panicplain old panicnull_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabled!!sigactsksiginfoorg.netbsd.kauth.processAD 0  trapsignaleventswitchpid %d was killed: %s sorry, pid %d was killed: %s sigexit 1sigexit 2pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) sendsig: bad version %d proc_stoptrace44}4WARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s/%usoftint%s block/%usoftint_init_cpu: cannot allocate memorynetbioclksersoftint_picklwpparsediskhaltrebootuse one of: %s[a-%c] %s none halt reboot none%s%lludkswap dumps on %s%c genericmdmd0nfsroot device (default %s): dump device (default %sb)file system (default %s): ?use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured root  sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesleep@H4t444kpause@H4t444 %pWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU\sched44 44A  ( *$/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_lookup%s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content version %d type %d len %d: %d end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings %s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destruction/%d@%dpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone 15callout@H4t444calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system todr_gettime%s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! todr_settimeCannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcntsbsizeAA AA A%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%ssched4.4BSDnamertts acl_posix1e_mode_to_perm%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %dconfig_devdelete%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachrootlocationev: %s %s at %s in [%s] deviceparentcfgmiscbootstrapautoconfdetachallconfigintrconfigrootconfig_finalize_mountroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namedefaultlocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported swaiting for devices: %s done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-registerAAA%sconfig_detach: forced detach of %s failed (%d)detached root device %s not configured detaching %s, success.failed.unable to detach instance initinit rollbackfinifini rollback not configured unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected range NULLbufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcpu0%s/%unist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testkernuserurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? corepkg1st%s %s has %d %s siblings: %s GAVE UP %s first in package: %s ureadc: non-positive residureadc: non-positive iovcnt   device-get-propertydevice-enumerate-childrendevswbdevsw_attach%s: block majors exhausted cdevsw_attach%s: character majors exhausted readwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorgeometrytypedisk-infodkopendisk%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%c%s%devcnt,%d/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extentextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not found hashdone: invalid table typehashstat KMGTPE kMGTPE %qu%s%c%sB Bdisknamesiostatnamesiostatsiostat_free: iostat_count == 0kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS AAA A(A0A8A@APA`ApAA$A/A:AEA@PA[AfAqA|AAtAA A@Akmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %p,V6T6klogmsgbufsizemsgbufU6\U6W6t4V64\V6<6X6t4runoncepcu_lwp_op%spercpu%s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) poolpr_phinpage_check%s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u pr_rmpage%s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocatorpool_init%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s pr_item_linkedlist_get%s: [%s] page emptypool_do_put%s: [%s] page header missingpr_item_bitmap_index%s: [%s] %u >= %upr_item_bitmap_put%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pBjfqTqVX`bCd ݻ*,,,,,,,,,(null)0123456789abcdef0123456789ABCDEF%d[% 4jd.%.*ld] |/-\%s: table is full - %s %s: table is full %s: Skipping crash dump on recursive panic panic: %s autoconfiguration error: mismatching pserialize_read_exit()pserializeexclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecific66btallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehashvmem_rehash_start%s: workqueue_create %d static_bt_inusestatic_bt_count%s/%u%sInvalid IPL: %dposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_pool!77\777H&77$'7aiodoneaiost_process_singleton%s: invalid operation code {%x}naio_process: invalid aiost state {%x} aioLwG@7lA"*FI8;L67 47`?7=70?7=7!ApB7A7@>72@7?7?7>7X=7efdreadefdwriteeventfd _X$&( $fqabortfutexG7pG7O7D7invalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit WRsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s nist_hash_drbg_instantiatenist_hash_drbg_reseednist_hash_drbg_generatememfd:A0m78l7g7pk72j7g72 2i7h744i7memfd compat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgpll7lv7 z7}7 ~7|77؄777org.netbsd.kauth.systemA22 22u7t7y72 2mqsendcvmqrecvcvmqLwGH{7Alwp_parkH4t444parkedpsetpsets_maxlist%d:1,%d:2org.netbsd.kauth.systemdirect_selectselectXselect@H4t444pollcompat_16pauseposix_schedschedpri_minpri_maxorg.netbsd.kauth.processTR"OsocketLA 747L72777X87l7777T7d7T7A|72727p7(777tfdreadtimerfd5&.17&%RMEb%s @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@(7877ttyrub: would panic c = %d, val = %d found only zombie processes not a controlling terminal no foreground process group empty foreground process group iowait ] load: %d.%02d cmd: %s %d [%#lx/%d%#lx%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreforg.netbsd.kauth.devicetkstatninnoutcanccrawccttyqsize/dev/consolecompat_60compat_43ttyoutttyinttybgttyopnttyclsAAAAAAA ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlc'8'8T'88increase kern.maxptyspty,8.8|.88088<88<6$7t4*8h8 8"8084<8\%8<6&8t4t4t4t4t4t44T7<6"3t4putc: required clalloc b_to_q: required clalloc ?840?8>8=84=8<6|=8t4inetaccfaccf_localstreamseqpacketdgrampcblistj sockaddr_copy%s: source too long, %d < %d bytes(null)unix: inet: inet6: link: atalk: (unknown socket family %d)%sbad family %hhuWARNING: mclpool limit reached; increase kern.mbuf.nmbclustersmbuf %p already freedmbufmsizemclbytesnmbclustersmblowatmcllowatstatsnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)m_prepend%s: len > MHLENm_copy_internal%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]m_pulldown%s: m == NULLm_copypacket%s: no header (m = %p)link c 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_statsG9G9ncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table ..vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultgenericfstypesmagiclinkstimestamp_precisionLAABorg.netbsd.kauth.systemfailed to attach file system '%s' because it shares the same fstype (%ld) with %s #lf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../machine_archmachinezaurushostnameosreleaseemulkernel_identdomainnameostypeuid%uruidgidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags AAAA%s: failed to start extattr: error = %d syncing disks... giving up done vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system ?root file system type: %s WARNING: No file system modules have been loaded. Supported file systems: %s no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncdelayfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pinvalid specnode type: %dILLEGALAAAA AAAUNKNOWNXA_AfAmAtAAAAAAAAAAAAAAAAAAA A)A2A;ABAMAVA]AdAkAsA|AAA)A.A3A8A=ABAGAMASAROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd) %02x %slrulisthd %p %s:  syncerACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADVT_NONVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFS@` !.AS]issymlink-targetAAAAAAAAufs%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %d%d syncwait/H999 ffsnfsmfsmsdoscd9660fdesckernfsafsfstchgfstcntfstlwpvnfullvnodevcachevnode cache hashvcache_reclaim%s: cannot reclaimdead but not cleanvrelel%s: bad ref countvcacheplvdrainvreleholdrelel%s: holdcnt vp %pvcache_make_anon%s: cannot lockvwakeup%s: neg numoutput, vp %p  *,.024vnA(e:d:a:W:W:|a:i:W: 2X^:\:\:[:U:4[:xattr-listsystem.user.security.trusted.xattr-namexattr-valAAAAAA AA AA pA|A \AhA HATA 4A@A A,A AA AA AAAAAAAAAAxAA`ApALAXA8ADA $A0AAAAA AA A A AA AA AA lAxA TAdA @ALA!(A8A"A A#A A$AA%AA&AA'AA(AA)|AA*hAtA+PA`A,8AHA- A0A. AA/AA0AA1AA 2AA3AA4|AA5`AtA6HAXAAAAAAA A(ADA`A|AAAAAA$A@A\AxAAAAAA A p_size (%llu) fcfs%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) dkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d wedge:NAME=%s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dkswap%s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFSBgBBlB%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfsEFI PART%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC (s*K>;i B2IчHo B|nQn- q+o BZIчHt B|nQn- q+t BSFU0eCt BIчHx BIчH| B-чH B-чH BSFH0eC쬎 BS'@ )Ѹ B*1@ )Ѹ B1x )Ѹ B3Dh&ǧ B=rGy=iG} B|nQn- q+ B%s: wedge named '%s' already exists, manual intervention required %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTmsdosswapffslfsraidframeccdcgdhfsvmkcorevmfsvmwresvntfsext2fszfsfictitiousmdidlefcfspO;`3couldn't establish power handler %s: cfattach_attach failed mdQ;P;T;@T;\U;4T7<6"3t4Q;P;pO;\U;t4M;t42KaaaaaaaaSVLX;4X;X;dW;4T7W;"3t4/dev/random@[;d[;t];4\; \;4[;<6l[;t4J3/////91?%wwwwwwww_;8^;c;t4t4t4t44T7<6"3t4bpf Be;s;~;2xb;a;L};_; 2maxbufsizestatspeers_bpf_mtap_softint_init%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterLwGn; BBsuŇ! Ȗ" % ˊ 6 C Α Q ՚ ] j w{ MO 7\bpf_filterLwG;hBbpfops%.*s/%hhu#link#%hu]:%huif_%s: watchdog triggered org.netbsd.kauth.networkifnetifaiflnkstifwdogsdl%s%dinterfaces%s: could not attach sysctl nodes sndqlenmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. ifaddrpref_ioctlinvalid argument to %sinvalid ifnet multicast command: 0x%lxether_outputether-get-mac-addressmac-addresslocal-mac-addressThe multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooksd n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ezyund_set_timer%s: invalid timer type pfil`B\)B>B>B>B>B>B>B@B\BX?B(>Bp>B>BP>B|=B ?Bl?B>BT=B>B?Bmd>BxB4=B>BBYBK>B48BphyL8B>BYBYBYBYB; ΔHWIn(l QrYTᯨg?RPQrYTᯨg?RP; ΔHΕ#w.jRmQ3h8UQrYTᯨg?RP; ΔHΌQ3h8U 5,+Kыͳw'F3%s: %zu bytes @ %p %s   0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG@fBGfBLfBOfBRfBWfB\fB_fBcfBifBmfBsfBxfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBfBunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs  gntsv=$y=|x=v=v= hBhBhB%s%s%sstring"propstng $e hB%llu0x%llx%llihB==rbmn=t==0=h=integerpropnmbr@%e(hBstrtoull%s: invalid base %dstrtoll%s: invalid base %dliB=riB=wiB=}iB=iB<=iBĊ=iB=?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelYU bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif>}[FVLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersaveSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchanSIOCS80211CHANNEL%sSIOCS80211hidessidapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragIEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAADIRV[`g mt |@ @  @'1; F@realpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableffs4.2BSD%s partition type is not `%s'Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point E 8 U |     !A!i!!!!"<"\""userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s: %susage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s ~Y+#Y YCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood gggg h2h\hhhhhiBijiiii j%s: #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: %-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s UGHRBD M@dmCLS1@2plbunspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260718NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260718NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverUnsupported redirection Location `%s'Too many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c1421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)xz~ ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEY  pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgzFTPSSLNOVERIFY1/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.8 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.8 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.8 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.8 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.8 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.8 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.8 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.8machinezaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxyOW_g`#nw##4###Ζ֖##!#.7#;ӕ#DҖ#N:#W_#lf#szH###O#ȃ#—ϗ#ԗϗ## #"#=H#Y7#b/#k.#u<# ;#:#<#79#ɘW#՘V#%sFTPSSLNOVERIFY/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7FTPSSLNOVERIFY# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed/dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eulaMy%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5pBGftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalida%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:863: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF P$xD/sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS|Aíʭҭ׭߭ #'/39=HWcsunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%   "#$%    "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmd%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700modulesbaseetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugxdebug  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s ]=1Lcs%zu%llu - %llu %s, %s/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSºɺغߺ #(-15?EIQU[_jy//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD11/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/etc/resolv.confpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%a, %d %b %Y %X%Y%m%d%H%M%-30s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s%c/dev/r%s%cr%s%c%u%s (%u)fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sghx5!E!M#Y#A",i%Uu#E(1*Q9+SA%unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS(/4>HQXgnt{$@Uxp%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %s%s%sUser answered no to destroy other data, aborting. %s [%s %s]%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------   "#$%@//tmp/usr/var%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s !"%*s %s%llupartman%s/%s##T#4#rrwlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s%draid/tmp/raid.%d.confwCould not open %s for writing cat <%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sgpt destroy %sout of memory<-a  ,gpt %s %s -b %llu %s%s_%lli@%lliNAME=%s/dev/%s/dev/r%sr%sStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1181: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnused Pri GPT tableSec GPT tableSec GPT headerGPT part - gpt resizedisk %sunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs $)05:>GNS]afouyHqݸY/eɹߪѩ,m=]GYͫKwindowsefibioslinux-dataappleraidvmcorevmresered``hhl q|] !biosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLSFH0eCIOSFU0eCYcHah!IdontNeedEFImr(s*K>;||nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOO$/yD<#*=(:DYbBRuoqrN]3Dh&lt\ M}-@Mjy֬-чH-чHZIчHIчHIчH(-2IчHHML6 %?aY^S'@ )Ѹkr*1@ )Ѹ1x )ѸST.qBHo6֯i/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/%u%s (%u)%s_%lli@%lli/dev/%s/dev/r%sr%s/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal error%d%d%d%d@`TugeIQ?o-I7,A)E }NetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionX _rA  +usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s| %5lld %-3s ^ %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA ***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiB-%u %uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x ?%s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu %c\%03o. --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms pollrecvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: unknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)%s%s (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Host UnreachableDestination Port UnreachableDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededFrag reassembly time exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr9F, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(%s)(invalid), invalidNode Information Reply!)1, %sBad ICMP type: %d HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid maxwait time: %sBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -s%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address%.2x/-4-6./var/run/dhcpcd/%s%s%s%ssockcontrol_recvmsg%s: no terminator%s: no arg buffer%s: no args%s: dhcpcd_handleargscontrol_handle1%s: unexpected event 0x%04x%s: eloop_event_addcontrol_startcontrol_handle_read%s: getpeereidcontrol_handle_datacontrol_handle_write%s: writecontrol_handle_listendhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %struefalse--version10.5.2--getconfigfile--getinterfaces--isprivileged--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:dhcpcd_handleargs%s: control_queuefALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.5.2 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid.main%s: asprintf/%s: chdir: /%s: eloop_init%s: signal %d%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_senddhcpcd_control_read%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.5.2 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: if_init_ossplitv, backoff_cutoff (%u) is less than initial_interval (%u); raising backoff_cutoff to matchnd_dhcp6_invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled out%s: set_default_allow%s: set_defaut_allow DHCPoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %sinvalid initial interval: %sinvalid backoff cutoff: %sinvalid backoff jitter: %soption %d requires an argumentoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:default_configread_config%s: realloc %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupreadgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosysloginitial_intervalbackoff_cutoffbackoff_jitterallowbcdefghijklmn opqm rs (t>u05v;wBxGzWy^AdBqCxD}EFGH# IJKLMNOPQSTUVWXZ)114:6CM|^~j}sz  !+8BQV]ckx (9HW{ { (Uz Uz ((null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt_new0addingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedz z (rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deleteAz Az (link#%d $, - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%sifxname=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceifxnameprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncated%udhcpcd%s-%s10.5.2%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt lo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)++++++,if_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif( PT@P HEPT$ @CDHD/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkeley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initfromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s77777 %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s8 888 8A51/ $8BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated lease%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAKIPv6-Only Preferred received (%u seconds)no address offered%s: message: %sreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %sipv4_deladdr%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics ---     : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc  : (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B.(> .> 4> :>! @>9 F>Q L>i R> X> ^> d> j> alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646tolowertoupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>T>BJ>FJ>>>>>>>>> >@>>hLHASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincs_pathKXK bc_base_maxK bc_dim_maxK bc_scale_maxK bc_string_maxK coll_weights_maxK expr_nest_max K line_maxK  re_dup_maxK  posix2_version K  posix2_c_bindK  posix2_c_devK  posix2_char_termK posix2_fort_devK posix2_fort_runK posix2_localedefK posix2_sw_devK posix2_upeK stream_maxK tzname_maxK atexit_maxKUnknown error numberUnknown signal number%m (%s)zTx TTTdTTTPTTT<TT[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%ld ,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!  HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C059N13xfr?tZunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`K #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.2 Copyright 1995-2026 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.2need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist