08˧4f<  ˧4fRNt t˧4f@@<@T 08˧4f<  ˧4fRNt t˧4f@@<@TU ˧4ft`A˧4f˧4f˧4f$h ˧4f˧4f˧4fA˧4f˧4f˧4fA.˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fmDdP"˧4f˧4f˧4f (08@HPX`hpx8$˧4f˧4f˧4fX`hpxM$)˧4f˧4f˧4fK$(˧4f˧4f˧4f (08M$C˧4f˧4f˧4f@HPX`hpxFA˧4f˧4f˧4fC˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4f"!˧4f˧4f˧4f"!˧4f˧4f˧4f"a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f:\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f2\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f*\!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f"\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f$!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f:\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f2\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f*\a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f"\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\ !˧4f˧4f˧4fi!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f˧4f˧4f˧4fbpf!˧4f˧4f˧4f $˧4f˧4f˧4f=$˧4f˧4f˧4f$>˧4f˧4f˧4f$˧4f˧4f˧4f$s˧4f˧4f˧4f$˧4f˧4f˧4fA˧4f˧4f˧4fm ˧4f˧4f˧4f$˧4f˧4f˧4f $˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fo).jqK BvZ"/ =Fl&ݡYw`D/9[J6nJ.4",E(TY"h"bCOTaItgf)A|)%P8(\t*[EVhcvűwM4\xk-^ 냣d]: I_d1[QWvofN^=ͣ\8NOD1Z`ܗ}L2G7O> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4M"4 (?!?!q!q&q&L HHq!q&q&NetBSDlAPaXNetBSDearmv54H H D0P/!p@-@P`C`F&a03/T@p谖%p%A-`0`` 0PpU(pGpG@Pq`P03/T@0US ѭL%\@-lPQMK \!\1 P` 0 R: 8 0S  /S 0SP c00S5 0pp WI2I0@3)1*03/ T@pK0pWH2H0@3(1*03/X@ ׭L0d 0 P0 0ؕ%(h`o%Ho%G&@-t ttPl@dphP Lo`POU P @B'D Gm P@-@⌭O-`R`XX2@TtHLM$H00Ss 00GwP0p@tH$H) 3 R @PJp0: S 0`00SЍ@P0`0vw; 0xS'x0SP0 S0 QP   0S; 0   P 000s 8#8T TPF$X0  0BP 0 R0tJ'0B'O\#"фt"C+H0`  BR` pR RX X/0B'B'@-|{0 +"B' 000/N'G-؀P t0M@ ( X0h`p ' 0Vi%h PЍN'Y@%B'@- M @00@0  YP N Ѝ%A-` p1V0zP 0 8@P@TV 2PD . W@V2 &{0S@ @0;0P W 0Xp{V p{0-S T`@@ p ,P@0S W L&&&N'&O-5M R  @Px Ѝ rpp L@@5X`0S 05 ,500 5Y0S50S+ D$PD?00CS0B@Ĥ Pp  @YT P@0 @00CS0 )0 Y(0 p4x000rp pP300 b80: SV +pP  p* R@t Y0@@ 0, 003($05y00000 R00SQ 0 0  p)pE  p @ 0T 1(#I0  0P# xx@  P T @|0S !P XT@! (+(" 0R@D 0[0TT$@  [p00 R0S ll1 0S 0 9( _ P P @T f@P@0 ?oR20S 0  0 0R0P @NP ll@0S L%P@ P0Rt00!xP N'L&\#N'N'N'N'N'B''&0B'8RN'N'6&N'^'N'N'0@-MM@P  p  ;0U$C dIP TTGۍЍ08 P ,(0P X\&L&i&t&N'Q@-@ T&P DD$,P $ 0P@L&i&&N'Q@-@ XP HH0"aP $ 0P@L&i&&N'@-x0 &B'0$/_(0$/^(@-N!p(@-I!(@-D!(@-?!(s@-1   0 0 Ѝ(_(@-1   0 0 Ѝ(^(@-1   0 0 Ѝ(_(@-0   0 0 Ѝ(_(@-0   000 Ѝ䔢^(_(<00/@-0   0p0 Ѝ8_()^(<00/@-0   0\0 Ѝ8_()_(@-1  ,0 L 00_p Ѝ*)_( 0@- 00 8$0P@J[Ѝ6)P&,0C-`A!圁!ᘑMpW0 |! R0B=00 B  T屼0L!D!7 Q<A 84100ЍgPP e =CP 0p00S  0 PY0P      0 3/Q ! 7000@0@0L0 D0^(8_(_(h'#=)_()A)n)))*0p@-|@PtP00 R 0p800 p0  B0Sqs _(_(^(0 0 0 /_(^(@- .(\#@-@- ,(\#@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp>w0S 00\#m8@@-@PЍ@ PЍp@-(`Vp80@  03/PP8003/(Pp_*@-@P`P 80 (0(3/@v P vPЍp^(O-3 PMP`(P,`B  0SP0 0K S X0\ 0X0\Y0 P % pHp 81/qp4 D5 4?P p 04 v0S4 p0 0 0 0 "i0 0 0p0 t 0 %0 0 VU0 5"SR* x0| 0 x0| ! R(P0,`R!*0 AA 000+1 xpt| ii0( ЍOp0t 0 p0t x0| 0 YXx0| 00 0S04D0ݺ004 0X IЍ^(h*^(*\# **R/ R 0 0 /P0PL 0L B0R/S/  AA  AA  A A  A A  AA  AA  AA 0S AA@-tBM 0  \Y 0  @R / 0(ŸR(0$}?`& ? BA3c@0DRH0n&}??B3cPoPQ`0!!!! d 4 !P`B4h4 " Bhh `!d4B4h4  " B !d4nB4h4 # B  d4[B4h4 8p<@ !0oh/0o0 /odX p@4:B4h4 Ѝ_(MbH_(P+9 |++++S@-@P_bG- A `00P4 2#&P8P0 (1/qp $ 㬀夐pUЍ80 $0(3/P 0 `V`PE0S0C0<i0  Z $_(\#8_(P&+@-XAM P04 00#!8 ( 01/qp$ FP: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `^(\#m@-@L M 0Q   0   RЍ`(YEFO-xM0@S M. 8S+ #='0|LA0S( 000| 1" ! !*x00# ##|0 p& d%ݍ Ѝ0'|3" 0 X0 S 0E0WS06  S  S $0S0 600000S60 060 00 6Rm0 $ fl4m0 \l0000004 00 p}m9X㐺+40 ?X0:m 0X㐣$0吓# ?X0:m5!  0 @<~  0p I9`(9, A,p,,,-X&;[-F-/,#,e-Q-`(-.,2.-------.1.3,?.Cɺ Z.t.,b.{.@-pPP`@@ 8mP Ѝ`3MU@.p@-XP8@T`@D p P<opQ<Pp`(A-AP0P$ 0 0 SQ ( $0具P q{h d`P, R3HHqU``0``000Pq^ ew00CS000 `   0,`0CS0000 (00/U R q/8 46D 0$00 0$ P`(B'0Pb( ^a(0T0 S 0SP/P/S/@- !P`( p@-HAHD0040S*0! PPP P`04 0PR@ V04 ^000( P 0PU 4`0PEP P 0P4  P  P0CSRP40P 0  pPb(P`(\&a(a(p@-8B8P 0"pP`(/B')1@-8@P(P 8P &8*080SP`( @-@@JyP $000<0   Rd(0B'P`(@@-<ءTpp0pp00P"kr y 00CS0Hx10 t@p@P0 5 0p0CS0100 S0 0  X 000 0 0 0@ k* t1C 0`00h0 P`0W0$0T P 00 0B'd(Xc(Pb(B' ^a(a(d(Hb(:2E2O-PpP0 SPEUP ЍE P 0C0 X0 Ub000uPPk  00C0S.20 & 0 0CS0T200 ,j Z0 P CPEP 000S S  `V% V000'P k| xt 00C00 0CS0D100 0iX 0PFjP 0Z0 CPF V(崀VPP0PP00P jFt pMl_ 00C0m0 P0CS0<00hj00`6Hb(a(Pb(B' ^a(Xc(@1O-P@`p jP`T $. 0PSP 0@^S00\P0S \ [ h5P @P@+0P00W2d&\2e2B't @-T 0@D bP 0S( 0C00S 0C0 Ѝa(ht@`&P0 R  QQP0R/@- a( G-P`P@ X 0S@ @0S @T@@DT pP 0S 0 0 vPЍa(n2G-@P tp0S^`[PUP 0 @+P @P a(X0000@-@Z 40aA R    0/I'w2a(40000 0h@-; I'a(w2O-R蒟@ 刀p0 pWp0#s) 㼢0`?VJV$ V0 00 0S0 =D ii E1@s4_i0"S00 @∀ FQuO0R0R0RQR0RQ0R0R0ROROQQ4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q0RR0R0R0RQ^V^V-Vk @ 0000@^V-V00@R i p 1@s@ i0"SR 0.V@0 @R O /Fo@P0 R00R  G@PR 00;V0 00 X@} T0Sxa(I'Hb(2 0@-@00 005P 000 0 00 ,R;R 0S  S   0;SRpa( p@-PD0QS@@R0p`VP 0Ca(p@-P3@P h , ($" p 00곞B' ^Q 0Q\S@-Ao/`@-0S*  0@0S! PUSpP [PP @P 0 S</R/    3 0 a(rB2( Q 0@30/@-a(00@- R 0C30a(A-plA1SPR a00S S P0!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0"0 l W  QU0圁0CS00 pPa(0B'G-AP 0pRpGWR0`0`0$!` 001S 0100CS0H89 pP00CS0' 0S  `P 0Sp`0 0`0R00 00C0p00  $`pa(G-p0A 0RSXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*Pz`a(G-A 0`0P0 P 00CS0-0 o& 0FSSp P1S 0p10 PE0CPPBSP0a(O-TB`0pS&#P UC0S0001XPPPPPE 0Q0CS00LN weP[00`F`0^P/  S P) 0100CS0G'(BP; 0堑0 S- S   aP10P!pE S:`00  1S `WqP ʼ10PE pBR    Pp|000P 0q0CS00 a(2B' ^c(Z12( Q 0@30/@-Ga(`01S @-0@!S @a_P /v/P /a(27@-A00 S1 RUWʐ0\00ZPB5d 00CS00- 000 @P R0 R P Ѝ00!S JP r0 Sڴ 0R0CS00000  \00sP 00a(I'B' ^22?A-O0 R P%Sp WS ! GYPZYRWh{4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|4|z4|4|4|4|4|4|4| j4|l`m4|4|4|4|4|4|4|q@r4|4|4|4|l`x4|4|4|4|4|4|4|4|4| lR? 00 S1S"I'a(23"32p&l&<3P3d(B' l33X.n13d(c(rB3Hb(`&2D 34 Pt" 0"0" " P0PPgP\p PPW0S- `V0V PPp0 nR pR lR 00 S,1S945P0PP0SP0 nR pR lR 00 S P0PP QR000P0P0@l `P 00 00 P0 nR, pR% lR& 00 S1S0!S | 0S1Sq bWW 0 P0S0P0PP1S 2SqX<0S 0l0C0S 30 SL P0010CS 0nQ( pQ! lQ" 00 S3 00SK^` `S@p^0"SY`w 0  P0 nR pR lR 00 SP0xS pP0PP0SPNP0 nR pR lR 00 S.P hm2S~$P0PP0P%  p-@- 00-+ ЍЍ/'d(-0^S0]S0]S S]S[S .0A0S>30   \  R]\0G-霁`Pp0 SS'PG(!RJppU``0``0,0&@P.^0 ,(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A \ L0 0pS G 0Hb(d(Pb(B' ^a("4ca(p@-!0 PJ@p P@01S?0A0S S n@P P0P 00S3`0`00 lP0A l0X 00r0aP`0i], ($Hb(n1d(94d(d('B' ^O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``004P@ 0A0CS0p10H 0P \RI0P 0 S 010S P/ 00P S)  R [ U   P0\U \n00CS0L00} W0`00Pp8 PHb(e(3Pb(a(Tc(Xc(0B'B' ^A-@`@0@P X0@ p>P" 0 R00R000 1BQ\@ @X_@pw\0"S,@gR000Hb(e(2O-@cMpS嘳嘣00 0GS T`s000T3TPPPPhPC\( $ 00C0-0&SM0 L\  DQ<Y0 0C@p \  0;P 0\l hd00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW  B@ \  P AQ 0 T Tp p pp  忽P p BR   @e0 P0CS0,00 0 re(Pb(a(B' ^O-M0@ ]0P0ߍT40S 0 L0 000(0pP@Pd p0 S pSx 00 0(0Y01 Y  $ TP$.[嵿 |  B Rd30    BR  300S 0 0 Z 0(@P#Qb 0bppG XxlY 00 0P\Z_, (f$x00C0S0 Y( Y 1  ߼P1 Z? FX1  B  BR p100S 0  Y @ Q 000 "2 0 0(0 P1 0 0CS000SUW#00 X00S 0 L [Y < VY 0Sa(e(Pb(B' ^a(M4O-pᰡA0M0CQ` 01 00C S00`Op   0PЍ5 *P!` 00000`P00CS000  [  }0S00CS0x00` P  Pa(a(Pb(a(n2e(a(O-RB0M00bsp 0saЍܑ0ԁS 1 7  000P@ 0##⩟ɐ Y Gt10S 0p0000000CS0D41<  \$ \ 0 0#0L\ 0C000@000000 0C LN "a(l&a(h4 f(Pb(\c(Tc(a(A- `P0 0Cs 0p 0 h0 d   B 0CR0@pT s@ f(a(l&a(G-@p0 PR` 0 P(S%0  d HP p0 ,w(޻ f(B' ^@-X0 cx4B'O-eGM0PS@pM$Q403/P 岻GݍЍ0: SX00W + P8:X?0P0: S 0SP0: S 0S 0S 0/S&yP7~0p0psSP- P 0#vI% PvO+R0P ]<#P5%]AP </MP/MP 4S0P,I [)H Z& U9.0. 0PT:.0. 0P@D!0Q\ PT1RP o R00S$ 0ST 0: SPEPO 3  0VG=00 04K VG=00J0SP/ Hq7XG 8XY00CS0\p Pp  pYW >xX0 X p00CS0 C0 0S cPP 0 di R;c 00cf(\#25W55v K5B'~50B'B'55\\uR0\\qRX X0p@-@P@@DDT` U H H0Rp@\\[RppX 0Xp@-@P@@DDT` U HH Qp@\\@RppX X0p@-0P0@44T` U 8 80Rp@\\&RppX 0Xp@-0P0@44T` U 88 Qp@\\ RppX X0p@-PPP@TTT` U X X0Rp@\\QppX 0Xp@-PPP@TTT` U XX Qp@\\QppX0@-t pX0pt0\@ ^0@\\QX @-0ptX pt \@ ^ @\\Q5S %R R S R SSh -^L^S R 0/0/0000@f(O-QM\v @ `u @ 0@0 @0T0@@ @L@P@,@0@D@H@<@@@4@8@5 SS$ֺ\ P0 !00`V0SE 00吐0T0S{ 40D0800<00@00$0S00( ,00B?O$x #xPI,0S  @?C000`$0L0x0P08D0"x7I 00$x"x/I$0S00D00H0#0x"xI,0S  @?C 00 0S 000 0#x"xI0p#x"xH0 \ C@Q C003/040 0S 尸Y\ RS0 00 R0!0T0S XP,0x |S00L 0, 00PPP050L5[D1p0tQHD0 H Q (4.Z(.X 4 4 8  8 < 0<0@00@0 0Sf QA 0 !`H"`0$0Q= 0 !l>"l0(0$H 0S0( 0|H 0R  P <X0{@nH0S00X0 0X00۵PP\0.S}0Sz 0!0P$0 0P(0 $妵0( 堵 R X0嗵P000Ѝ@f(VUUUMFZl CфO-@a!80S 1PP" T4dpW  ЍOY2<0Sp|倡倱2@P T@I2T@T0SL H250CS ppp\P $. G00L0S \0.S0S 3@0S40S c3 <0?oQ20S X N040 Ѝ@f(55#$G-p㺸FP0EL0 vP0S%00D0H0kP0` Px0  `pZ\5T H0J0P 0 <8?P i5X0 s0X00 00dt |  ` `R`S Y c( ?R004(0x |0R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z  000Ѝ1@GPD```````````````8DX````````̨` 0``DX````````4Xl`,t|`ب $<`PЧ0PPL0 P 0PPH0LP PTPFX0s0X0 0PPLPTPHP<0 00PPLPTPHPX030LPP00PPT0LP P0`P\0%0\P`0!0d0``0<0080 `000DPh0lP 0DPhPl0004@p[l0 h000  L00S   E\#6B'5v #6f(f(f($0\ 0S 30f(5v \#0L0S/0 000/@-0M0S 0 00!xpxp Ѝd0d@ `0R@X0 0B?.E 0Ѝ@Lf(Pf(df(YEA6Q6lf((656hf(P `00CS`0p S00 P0S X0X /X0B': S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\嬼@T10S H10S. 00 00,10'p 1 ␼@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B?7K 0`T00S Hf(c6Pf(df(YEA6Ef(f(f(f(lf([6hf(f(s@- HP@@P `PU00S @GT CЍp0t  Q \0 \0@-T (P@$Uj6f(f(p@-P@Tp0 0C0  ,A @G-@0M43030S`V0Ѝ0 0C0w 0XPS !,Ի0S 20Si  4 "; $%pY  ⸻0 0 p寻T20S 8@姻 (0壻,20S  $囻0 : SG( 2"6000 0@0<01"$0ㇻ10SP 91 100O 10S10S : S0: S x`|P1Pq 1Rp@1 B?'J 0 P'Q p 4 <l^ 4300S00S f(f(Hf(Pf(6c6df(YEA6Ef(6`f(K6f(f(f(f(f(lf([6hf(f(f(1O-0S,0@010S 10S40 001q 1000PS ЍOXa0PQ !0P 0 `0S6p 66QPPU% Ѝ  B 10`    0S[  L0  ,R4   V Hf(Pf(df(f(t&f(&f(010G-S,0@010S 10S40 000 0000PUG_55p0눠PUG k0 0C0 W bp0S,4  `YpP R`Hf(Pf(df(f(f(t&0G-@0T,@0@SP 00S40 00@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S,4  Dp` Hf(Pf(df(f(t&@- M @ ᜲp ЍT P 0@  QQ  00T P S  B'0p@-0PS``B@P bIP PMA↯@P4E ?'P娹ʱpf(r$6\#C-CM@A `uM qMPȐ`T *F 0.pPPCߍw ? P@RMw0S ?@P?oP@F'@-_N 㦷6B' 000/f(@-ON0 㕷6B'@- M0P ! 00A00P!0 0Iz !p?  Ѝ "$ 0P @000 h0h} !pX   DHÒ"$  (0弒f(#7(77/u d\#0777<7[7O-P@PQM `Pn M0Sr   ` P 0S P  sd00CS00upp/`Ѝ0S P XP`P`(ծ1 44 Rt(tpx 0) =0 p W ̓00CS0 8p pYW 0 P 0S  tbXP `0: S P8X| P g`0: S (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPpP` `PWb0S x P@ P= [ ,/*P (0˯S ,!00  1q: 0:9! 0 p垸p|80H0 P 8x tP L0S ߯`0;`0`P ԯP L0-S  ǯPTpPh`V  <唷M`f(qI7'&B'0B'Nu YE7_7\#7Y@%6&7778s@-@ `P P0P U:8ЍpU \@,*0 dP4@y8&8r88u8A-Q~M0pSM @0` x0`nPHL\! p~,P =L4!j1@~܍Ѝ0 0`PP*L ~,@P!L ~,P `0 02PW !2Q \00 00PK0$ #1ꈞ&m8889A9q900CS0 0 /O-D`LMp 000tTt$tt000 0000SV04`0p Q 0SI\#KPK0#0V 0030p Q  #.P0 0K0d#0V00<30 #PqK0#030002P~P[K0"0 0 0LЍp(0: S |0 S%l ^P000`P3)0-V'V|ЩVrX2PUT  ?D0M1PP S0 0 00Bqp K0S0 0V00R V 0V 0d1\!00X!00@@D!S9~<0V 10S0C ^:ˠˠ\:PV0 ~,0 e~\P0 P ;  0 pD\U0Y 00V T0<ꈞ&f(i(آ&&9&99&,)g(9:m8@((&}D00S/@-4@~M0S~, +P~܍f(&0@-p@$0l00S Ѝ0 00PB0Q sJ, /Pꈞ&f(6:L0@- R88/P 0 0 ,/f(V:)(:A-p`P@ 0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p@P00T@ I(0( '/( .ꈞ&f((::s@-R@T` V0a@$00 ?00S 0CS1P1I0 S7@.@ЍpPڀ;;S! 0 00A0Q P?\P@@00" I0S @@I0ES TT 0$0I0SI0S I0S I0S $0STڄ00Q /Q`Q.T( HJ.lI(00 .$ꈞ&f(;2;t);:g;;`!0SN@-PQM0SB @100CS4:Q000SS60S0@pT0S 0pL AQo 0B T0pAQSQ00 t 0:P00 0S L-Ѝ00/ -f(&آ&;m!<Q<G-P0 P Ѝp@PڬAQ@Q` 0Q P 0@@@QH< -P 0Sꈞ&f(<@-pAPMP \1`0S0 SU0<900U0p0 ps@0QH -Ѝ P0S(0S 0Z@Q~H  Pڌ0U 0?B0 dF-0 P 0P`H 0, -ꈞ&f(<<=6=(A9mW=O-rM4M R0`RX0@FPK0 0S 0  0 F0S(0S l  \"X2p00 A08">00 "#Tq " #>⠳܍4ЍT 葟0S =! !!0`##*;# n0S1p1 00A0@!>0H!041=(&=C-TRTb0PBS0000 Ѝ00 00 0S 2r0S |2 & 0S ypP (0: S)0H p10S10S PP  00 0S(q<g 1 l&00 0S000p000 S(00(000 P@0S !000S 0BP 0+0P0 @ 0`凲3&Hꈞ&i(f()@))))>g(آ&\)H>t)O>(T>(A-MM4 YPF #+F MPF"+bR$0@S 0@̂0S2_+pAP| APw 0 t S( -xK+tI+p2Tr0h0CS``@+=+P;+L9+H7+DE+P4AP0@0@&+ 2 ލЍ+0S  R  sS SS YS|P+yS*0q儁*x*H+P8DAP 0SD @;AP4 g9(1P *0S +@(*APP 5P0@0@**)a>{>&f())>&&>>آ&?_???? @)?5?+@J@h@@@@A ;A@@ZAtA00@-@Rp]p`Ԣ&O-ql L|0S'P6@PXXLP&PV,L0 R4T0S  *@ET  A0d#0V`@P@UPh*PT0S d[*Pꓢ" <2/PL0!ᒣ#, 09Ȣ&&g(آ&Ag(At)O-騁0@`PpM∱ @FeQ PPPU3PP!*-PT,010S( $*P@!0$0 3/0P% 0 R T @ An 80 3/Py0Pp00St l) Q < 002/P0 " "Ѝt)g(m(Aآ&B(Bg(NBtB@-AMP/Mo:@PAލЍp`pP/0P0 UX0X )L0_"~/0P0 00 0 `)m(Bg(B00CS0 İ0 /0O-c$M00P[ P$ЍP0,03/P000 0卧`30S LCL7P5PPP 00 30S[ P U P!P r4 CSR pPt hL PzG:D8@"f);0/SaP`7 ArW w 10S  P0S !S 0!202 03/pP XU \! d1  0S HQ0S 01;00> Ph0D0 3/P2 0S 0 R 0pU0403/ MA00S Y'P0h0CP0PPt)h)m()X)Ѝ(Cm(m( ))g()))(@-@@<PC( (6g(5C@-8p @@C (RC@-@prC0 (@fCp@-MPip@bC0S  0C0ZC `Sp 0: S OC`S NS Ѝp@C-MpPЍa0H03/P0 03/P7phA]P@ 0AS0@0 a3/PE0 0)P)3P/P \P0/S0P/6 AA0 0006@ Bp (0(03/ TfZ~ Pt)m(m(m(B'0B'{C)O-MPЍhe0H03/P0 03/PP㺥,5p0S 5P B%'40SD]7P 0(03/  0 P 0AS0@0 a3/Ph4C00/DP 44 C$P40S  fP 00  [P 0R S "`Qd 03p Qt 0pP\P H9SP3` Qd 30/SVP U5 Ag  00  P0SU 0S "`Qd 02p Qt 00S "SB 0H 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100`"Qd P  t1 ,[ T RP (1 0 Q I @ 9/0S 0S 0S 000Y\0C00,4S 0S 0t)0)Ԣ&Ch)Ѝ()m((d)m(X)P)@(0(m(8)4))))ܢ&)G-Q@zP@T  T 0 &H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/P@BP 00 @0S 0 00QP@! th;P0 l0u X0 0S LPY }Pt)CX))@)m())H>))CT0@-0S^PP 00H03/P@X)t)0O-MMDp$0 PPG G Q/p@-JTUPP:0P ( PpP:4$  0 40pjGG)p@-`M@ Ph0PUP $ R\ 04 0R\ ЍpPd)G0@-MP @PЍ000S0: Sx5PPU :0D P 0:0 d) G)G0@-M@, 0000S# Q0S 10S rP'0S% X0 ?A3c000S&!h0 ?A3c0 P J:0NS F:0X rЍ0>:0< j0S ^p&&MbHGp@-@P`PP p P $0\:0 Cp)/H@-!@P 0H:0@ .)MHO-@0P/S`p/M/ P8 0 0P  sp /00 P%  P 0S  P P0 K pw  Ѝ()G-@P 00/S (QP u00Q  G1;ZP90 0`0S ]j뤀夐p0 _Pm90S@$<iP@D0 40 @WD)jH HH0))HA-M`P@pMP5(10S Ѝ 0RP  0RP 0: S&4P sP90 F PW P 9 P W0 @(d)H I!I0@-:(4@: SM=!R \000[ P0 p 0: S ,Ѝ000  u;I:P/  0 gA-`QFZDT@cP80@!81P @$<qP10SP+(0 000 0 00! "4S `SPx8`0 jn0p 40Ѝ(tS|(tHP 00 jG(),)&&jI)O-Z#Q30`@ (tKMMp 40CS񟗩$dT<,l3l13P \30S ,0P0 0: SQ [PY 3P @$< ?o2P0S(4ĢS22P PP|70t"0 + 0S<20S| 4m0C?o2 000! "Hn!_p70![7Y- Y10S- 0 !K>0@4@~z=0 Czv 4n6 Zu PF@$<P>4S(4R0(4o k$hR\00 X0S 0(4| 00H 0KލЍ0p)TH)(),)&O>J&I0)HII/O-p@M W 0DP 0S08 0<000SPP0C080pG0S 0`S * 0R 08 0 x x/  P8 7@0 X2@ @?.Q*7@0 ,0嘰 R P` dЍTT ꏗ  ` `@8JJ))*J))Rs@-Ѝp@ 0@`P.Q608  0P60 PJ)8J0@-@MPPX00<00S  = J" Ѝ0)G-z@M`Q M Y #P P 0P 0P=! SR J(?ݍ Ѝ}PJY68| = $ HL0RP J(DP 0P.QȄJ;68 gJ9|JJG- AP 000qPU+`00CS0ựpU 0 0S U 0 P 0 SP P0SP 0S0 0 S P ))T&0B' 0 0 S00@-@R00000S0@000S `zP LP40PH)L))<) J)p@-PP 0Sp `Q@Pd (@P0/S0080f R P@@@@pJK)h0 RX R  H R/< R/ $R/Q/ )\)D)l)l0A-0S X0XP@0P`PpT R S* ߠ0@))B'(KO-c@ 04MS0S zBPP P0 0P@4Ѝ50C S5!!!!L!!!!!!L20S 0X0(00!P0 000" " x  0!$!$! 0!=C X 03($ * RC 0  R<  R)  R08 0H! 0 J  !1/@P@ 0 R  R0  R $-0400S ̈́!!" # "040+04 $P40< 00  ))UKsKKK )O>Kp@-8M@  HPa0`P`oU0$ $ @ 0{P8ЍpKKA-t1hM0@S ThЍA`Z(\="(< p@1WpP0 0000p084 ⼟40CSH$0"60"$実0( 婟4 CR+x ᠟NhЍB>'P嗟S+<  Hy)YEKL L La@-@XM="p:(0 XЍL7@-@Pp $&P Q Ѝ0 0  PT Ѝ0@JT0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq/@-0CP0%S*0 ,  ^Ό!0W0CBPBb 0%2  0ΌC S*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 B^00 C@ T A C@T   \a0C R  @-0C0S0" ^":00NB\Bb 01  \@ 02W"!N ^*040@-@T@@  T)$LA-P0q0`Q VA-QQ@@TQ S AA講:TP0 dd?@ 0:S@ 0S000 @X.);'_LB'vL/d-s@- `+ P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* & 5#P00PG- 0S!`P 㰒0P  T@R p00T0pT0S ,@Pp=PP ۔LL)Ls@-@PP0@l C300Ѝp0  R R00`j@P 0 `F 000)@-  6R՚B'L0 Rr @-/آ&@-4@4#R( R RR㹚B'jMNNOO-pဠ倰 ?@ n0P0 p`o10, Y/   `% PO-@lM/`&밯PpPP 0p px/xx_00 \?\/~pL?H?A0s 4/S XB\   CRX0`F>LzP񟗳530353333353555533336333333333333333333333333333p5|5335535533333333304333344(53333 64533043D53L53d533333333P33\3h33333333334H4P4X4p4P4x44434><P q,PM>J=0 -R,Q0 00 0;h= |=l, 4dh>h>h>h>h>h>h>h>h>h>h>CCh>h>CCh>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h=h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>AAh>BBh>h>h>BBBBCh>h>h>C,CHCh>\CpCCh>h>h>h>h>h>t=|===h>=h>h>=>>(>h><>P>l>h>H?P?l?????h>A2嘃iPgꬃP2P_ x- 2P U 2P PP3P 82 J P2 P E(3" A 2@P < 2P 7 1\ 22\P,.20A00㨁圑 R[ aR eB Q P?@?@?@?@?@?@?@?$?@?0?8? !00000 00|[1~PZ P1Z  @1Y  0Y Xx 0 010L01Pe X)T$)))&P;'آ&B')(P g(Pd)&P(),)&\))h)LHT&&&&&&&l)&Qф) Q&QmQpQQQgX&RB'np)`)&Q)X),QQ&Gm \ T)В(RRP)?RDRL)gRg(H)@)<)8)4)ܢ&)X.g(Y) GRB89B'0B' 0.t)&;'R)& HM0@#d単L#t剘|~M$0   1W Ì1P0 ( 0,<W7 L1V 2(1\ 'P0V0' ,BP"x13PU 1U  1T 1 1S1`PS2PR <2R  L2Q  \2Q  l2p x222 22"2+S0p02007 Bbr0e0?o S c00CS0 n# R003XR0 B{Sv008300R ̗0 d0S3# S*SSʤS}0Vz PK000Sn30VK`F4POP20000S D4 Q0P  /)l0P/`0p@-0 PL@LPP@0@&P( g4)t)S7SB')TA-`  @PA?\. \ *\1  Q R+ ![\SPQU !\@@]^1!Lo \P/P00SP PS QR S0*S S 0PS 0 P0^ p-W p]WW UU @U l)p@-0@0 /SN00N P\*pPQP`Q*LC T030 00Q*pQcT@-1MP MAaq<P/!&P M0P0Sۍ Ѝ.S@T|`l @ @)TU>U`U iU UUUUO-cM M33 "@p`3]PW,0 00S 00 0 0HP{ 00 ;R SY @0 0;T* R  DY<5 cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 傊 0@&P\P    @@(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0S dd忕0S X 0 !0Q0 ( 宕K) V&VIVB'_VC-`PMM RP s\SP RW P0S #  P0S\SP R1 PgQ PQ' SQ GQ ֌ 0 0@pQ sQ00000Q0 R @@@ۍЍ00; P Y᧌tQ@P p 北P ; %0 $kᎌiVWV)VVA-`P 0StXp%@PP P`P80 PP p@ @@ @W4W)X0A-@0LPL`LpT  S( ݔ0@)B'aWL1p@- RE jDTA ,PU; P8 \Q Q 0T + 04#P  0S/  00P0S/  0P07 @0/S000 0DPpR0 )\)l)WW0A-j40@TPp 00S 00S0 00/S @Tt0o{PL0D0S sP040 )\)p)x2A-0@SP' 0`.S0.S0S/S 0hP 0 Q CR S.R  S.R0S/S U 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p 00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0I'A-Q@pW : ) ZO-1MX@ $PR4 84S00 {040 < 0T `[ @ 0SY $P ^ 0@0T ܅@P P  0000Ax Ѝ d  $0R  0CS $00 0) [ 0A-@T:8$R4 CSR [xc!AT0WV0 $P ^  @S0̇Aɇ) X0A-@T`D'L@PU pP嶇ᴇUT)p@-@`V!pPt{ @pd0dP \#P0p@$04  偮@)G5[ ))`[&n[@-<@ 0S $=P H )[@-<@0S $(P3 )=[  @-o`O-aM0Sq K0p40S W00 $p p0PP0 0+ P UY   0Q  PPD 0 ZY00W00S 㿄P5 0 " 00 RQ3 0S0 V0P QP LP `0 㓄P 0 `0 $`040,  Ѝ ")[1\@-<@0S $刅P)=g\C-d`M0S PHp0@T " !(@PUЍ)O-M`P$ %!0@pDW% @Y 0 QPQP (0S0P P `!! P"(Ѝ \ЍO2)=\A-0@T `pPT1AT  RQ( QP (0@ 00,*)=/@-p0M0PS`M 0/S PP ۍЍ(㷃@P  pT ۍЍ@P 0$p0$!#!0 00 @ ()\\)A-P`@p娀TЍ000S$0S  00 0 00! !A<00S w廅ṅ@),)&&&C-`@Q@APP@p!@ WT  0q ! 10!0` Ѝ !0p`G-鬑M@T- `P!ApT t0S! @T @PM 0D0 0AQ@ *P2]" 0`! Aލ00!(!QP J" w P ="   P ]"\ ı+"D X%#"(  )G&]1]I]i]]1G- `V@0P TpY  㮂@P) P! P AZ @P`P iP< քԄ@)]]]d0A- @T`pH P ATP @)Qqp@-@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSB 3b 307 0pp0 S  0 - R 0R$R:/A-0A Rh1\pP.@0MTaMQ 0  C0/S' 0 ! - ,P3ڍЍ *\0@C ?\0@C ಀ 0pC00C 0 0  P 0` T P 04 $ I'^ !^,^:^p@-`0Sp@e\ 1e #@ P000p 0@-E^ 400S  /)0-p00@^SQ 0Q00P) Qp@-!0PS   pXPd @t Lm @@T@p00@T&o^G-`p娀@PPvP  0tE`0X d@ dP  BR 0 $ 0 ^Pآ&^^ _)A-`PPЍ4":0J840K0CS2 `60 01 -  d_ (lX <tS @ |qp}  C=/ 0$  4 =CL2P ! 1P) ($5P/^)040)($84K @RKP  $ p++  @ 04(4 :(40/S04084(49)($ q++ l$) )C-j@EM0@S(8wPwlwww|wwww30S EߍJ(hJ(J(J(!L 0\ ` @ 3 30$QJ(| S7000-00 s++  10>L  Rp0<x P J<p0@ P J11   0 ypP J =<@TYE   |XM  |} 0 QpP J} 7P RP$PP P "P 0$p pt s 00bR c7P)aaaaaTZ k8aab !b8)%bYE+b0@-PMM@ ` m=X X 0P U+@0  $ $ ,  ݍЍ0$ d8)p@-@ PP hp@*2bA-0p-S0S) 'PP%z 0NЍ0` S0 BP@P,0U ᩖP` Hb0B'[b-@-0@P   Ѝ@Ѝ/)p@-@ATp@0 R P_P ` `HP`p)-P@- 00|0 x0 t000 h@0S X^`00L0L <圆 ,$ P` Ѝ@ Ѝ/)@)))B')]p@-x唣@Pl.hPP X'P p1ᕣ000S  p|brB)h)b -P7@- 000@ 0 000 P0S x`00l0l hE XoT2D 890 _ Ѝ0@Ѝ/)@)))B')]B't@-s #㺃bB'@-M@P" 0/SZP|ZP sp \np 0RP 0RP @ލqbW 000/)@-2 ybB'A-q`@ MT ttӅlAPD00CS0?ҕ@0*ptY0KСpP0 p)0}*NptY0FPo0 0pptfW0Kpn\ Y0 pz  PQpY  Y0 pz  PApY  Y0 pz  P1pY  Y0 pz  P! NPpY P P U W0P  WPPWp )\#@- ^cB' 0p@-@PT 0Q00S0P0T`00000{{{00CS000S p))A-pPd@d`0000SP'U`00CS0$00SA)))p@-@PD`0S@'T`p QP)G-0a000PL50@ R'QS \! 000CS000S \ 05 p㌀匠`DYGV50ST0U00CS00 S 0p))o)pԤ&0@-S R' )A-pP`V@ @P*Pp@-XP<@P hDP0P 0@00aT8@p)A-ppP`0004@40 04000@0CS000SA))p@-P`@T PV 0@p@@-PG-P&<0@T2 =P% P  S@0 Y  S(U00CS00  S 0 0 0@p`)ppԤ&Ф&C-3Sc0@  t30 0" 0  0004 Bh p3 3 00`G4蒟 0p Ѝ/RAR R7 C%1 B&Pꜘ̛`ԛ 0=S@  "?R 9R:BPD|R' ~R$ ^R  h; @ =R= >R @ <R =R @ |R@ 0&S@ 0=S@y  0+S'@p 0-S(@i )e&c#a@ ^I')*i))-p)rp0@- )p0s@-0P`0V0`0@S P 0R@P@1  P@)0S00S !0ST P000 R  Ѝp)!)ȣ&p€ *ip@-L ^̞$xL`<l0\T @@~, \ 1#P?0 C c0à?0 c0àΌ SQŒQQP0R0R0P0QPQP !pqqO-`pp딀P @%R? &R X(3! /[00  0 PP@@ Ѝ)!q@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F2P@$ P@ kT)p@-@P0)Sp)O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D  T! xz! r0  0@@P! e0  @P\VS'T@@`@P, @   )Xq/q=qO-p`M8P젟찟9!@ 50 X@0DS '00S^^* PU @ 0 V 0DS00SY Ѝ` pUU )cC-`p  0BS00@SP! @ 00 TPP@@ Ѝ)G-`dP0@S! p0 000PP@)@-@MP41`PL0P  IR NRpp PPEP@@0PS@ $A1Ѝ)jqPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0P@ 0,O0y1YE&&)!)S#@P/- 0/SSS00)@-@PMލ0/S X]p Xp 0RP 0RPꅫ p@-`\80@P '0D0p@d0c060"SP Vp/wq)qp@-T` RpH0@Q 8 "PP /pp@)0&qO-pW,S 0S)P v C000000000CS020S @T  #R RT/ksh2hb0d00@/SpG/pHHDPR0S 0/p0CS0p@0@ppW000000pA0P00 u00/ Q tQ00CS0P10S 00CS00W0@0 pR0S/S0@D00f0@0W0 s P  R*0000t/S0S  a P 00CS0p@C0@pK0S 00CS000@20@00)))qq&)& A-`p00@0寛P 00CS000S @ 0P0CS0X00S 1X @06 R0S U$0$p,N%))ȣ&)G-p2B`M6&0@T"TR@P$ 0SM .S00.S0 00/SSC10  PPB| ePpZ% ``VT?QPP@ ` .` E0E:rr@`0-S0S0@T@@QP.P0: SV{ P >PЍȣ&q)qdeq)qq q@-5$0Q @ P @)qqp@-L@Q50P000S LTPP 0S{@@L 1012M00CS00 L 0 L0puRT )r)#rԤ&DrG-pPp@R` V101  Pp  Pp `R\TQ @0Ti \0DQS񟗀괲HHHHTHHHHHHHH HHH(H0H8@00CS00 `L 0@ 0 @T0S 00CS00 IL 0 0SX00CS00 4L 0 L 1% 01 @0Q  0BPA0@D@@@ @ @ @ @ @\@Ԥ& OrA-@ ` PR 0R 0S SKp0S0 R TL0S  MLU  7LTBLt x'$Ѝȣ&)Lt)C-@?kM00,@D0?_00?|0,@0L@ &X@`PჀ0T0\00@T\0p@0$o `P0d@T 00.P0d 00X0S v&X0S 0@0>60S >0S 0S00@0 01C0\>0S 0S p`@0S700SC -000U0(0$00 0h$0P =&0S(7S%00S 0 0S\= 4  $=, 嫒p@ P , $= }J4 = <, R , ($ j$P000<<0S V0 0` @GU.P  @J 0 R0T@=<|;a/D`PUXPkUH0k PUX00CS00 eD 0 ;FDCT 00CS00 OD 0@@`P E00CS00 7D 0@E @PT 00CS00 D 0@lE @P v?P @P07H:x0P uPP@DP:x RL00L0 0P0S `-V`-V P0E0R9pPP \ B  10 D 0SL0077S 0C8#8Sx0)SS ?708#8S@P0 Q A!Qx0(0S0$00S  8 @  $00$00<080000,880,0Hn@P8 7D 00Rm0$ -= 0SL0077WS`G0'000000 7 0'0'00 (07 101x03/$, (7 DT7T' 7L' BH0S H4 6 6 < RN 0 0  I $Bx&@00CS0 k60S P 60S&,0剑S6t6$6d `, I5(,0$ 0000D(0$ k"0E$0$0SK($ |5 50S KD5,0S h؏l:4%0<50S 90 @0 *?PPEPt<0 0<0 0 0C00x00D0004 4TN00CS0t40S ~P% 40S8)P0STN=H4 4, 3  3 3e4D!)0093 , x0S 't0R\#CX#0LC`I00S0ڨxmM0 #0C00x00xNG4 3TC  2 2 (0, 02 P0S"00CS0 l2 R   0L2@0S|#kߍ}9H20S |x08"SS2 @04 H0D@&H020<0<0S 1 <0S2 1$ <0S  t1<0s1x R#0S1   B  <0S <0S7S<8 0 10S *#9@,0S0  g;,0S`@Q C0,00D x0D@T$0Sh0 l0喎(0 0)@FEq #)!))")!)ȣ&d@))Lt")))")Ф&|\@&))X.;'Ԥ&&ؤ&]t)()!) otB 0/)0 /)0 /)0/) 0  /)P@-@&P<80QP cR   t)0 S0/)0@-0M0/0@0P cP 0: Sl  S` PЍ0NP0 : Su" PP #)ԯ zctp@-Px@x`M$P)00S n"0`a00``007!`"$Ѝp))@-`@P$^&0S0S 0C0BS00 000)//C-LM)88 p@<(P@0` D, ` 0@LЍYEԤ&tA-@P`}pWU ]K! 00&'p) )O-pWC R``%` P0S:S2E@А @0S,W@  @0T/S/00!e0 00S00P R:R0:SPPP@DOc!S!踣&&$)@-@MP/p zP㨐I  0 R@ T6IpC 1 P 0pWZ0S 0 cT20S .0S *0 S!p @L! i`P T T T  @0 @@(T >0DS~ 0 $)A- @PM`Rl@$1000  6p!XZU l @? Q T?P?Q<? 04AS 00CS00 t? 0* 00CS00 d? 0 ЍQ ??U P000mJ 00CS0P00S @??4, #)ttt\#Ԥ&t))u uup@-P@@Pp 0S%SpoP @np@-P8@Pp 0R^Pp@4n- D0D0S RP P\ 0`&,)G-`P@唀0吐00p 0S0 S0S00#fPP|U00CS0$00SG5p),)`&)G-@Pp0`0帐0 Q :RQ :QR``R %Ru -$PPP0T:Sp0  4@0/PSu`P #)'0u`&A-`P倀000p 0Sp00Je@T`|V00CS000SA),))0A-pPS R+`a@T"W p000j0 @0 0 c00CS0H00S `wP `@$)))p@-P$@Pp0P0@4n@-L@000@00 Qe00CS000S@i)$))O-PM/`@ 0ZP @@@ (/P00š0 ,0S (0S $000w#   P@ AP @cP: R R R 0S 0   " R00 mpP B0000S. R  pl" RZ0 RH"00<0  pPZ Z 2 @] 0=00ЍQ  0S/R0SZs "P pP t"P R  R (wP0 * R; R 60@@D[ P R  pS@0000S R    BR <D R8 \6 t #)/u`&)$)Ф&/0u8u&=u)O-@`pM2%PP2*0S*[ 000`"0  p0Rz0#| 0Z8 RhB<01 P=PЍbPEU@tHT\dlt|p  `@Q V  00X!W QPYXV H1 0 0 Z0S& 0s1TP P*W 00SY0 [  P 0SLhXT 0s  P hp=TRu),)Ԥ&\u) #)`&p@-`P0000S S@3H000 00 00000CS0p00Spp@[))0@-p@M0 0000T0P>00G 00CS000S <Ѝ0)ȣ&)@-dP 0SGO-`pP@lM$P0cS    <:pP` vPP VP@ - RrYcS"  U;آ[&P VP   R񟗅 0R PU_@;%U 0; P% ;;[ 00S A00CS00 <; 0 0@ T Ѝ;/PVd!  [ZU!Z;;qPU{;U~HcU U UU>;0  g@000uuu)uYEufuvvԤ&,v #)u2v& 9vOvdvvO- $MHBHR C08@,2 `pV. VV:V#  V /V# AQ`  1`F QLLpLLLLL  D p+Q R Ta[000000S ?@P؇XP@ @ #T ~ [ /R0/Sp$Ѝ?XX 0 BR  R  BR    BR  p k &))ȣ&.kA-(A0S 0PS0 0aqP0S00 P000Ra00CS00S kP 0SRh`hp0P RP000.a000CS00S F))))s@-0!S1Ѝp*S@SP``00P Q0C RP00C S@ `a@0S00S=STT00 D0 R 0AD1U0 0S 0S괣&))A-dp`0PS@  R R00PH @)O-s@0M00S00 00,`000Т00<000000C {<`0 00@000$00CS$0C0S00CS0(20S PP(0Z00(P P [`(P 1X0 DC{0@0CS0t10S dЍ>0SJ$P 0[0. [`+ V , R1@ 0C\A/@`F 0SX  BR  R  B ~   B `FAQV  R@ @)&)ģ&))).k1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xQBP  `V' Q`:00Q@  @% Y0S" SP P@P P DoQP @@` )4#))&aA-XPX@X`P0p00Z_0p0CS00S s)))p@-P;@\60@ p)@-Qp@0` 0S*00DP@`(P@0`SP Ѝ `P0@P0`S@0S0O-@p [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xPS@ R0B$x RP R  \$Ѝ$fPX:$P 0U0/Sl 00EpP $0S/00E0S``0` xQP /000S V/00D x00SR00Q: 0 R @?q0P . B/o.Q" R  0P V 0 Z$) % )0  Q0@-0 @QC\0CC/x^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0S P $$$\0$000CS0L00S 0S 0P 0)))p@-@ PTp 0@ @@)G-p @00 ST@D0P ̀`V `RxP VP V V@ S`` S =RR QU  0P @*i0G-`@ M G0P 9(q000e U00SV-00E@`PIPE@T Ѝ00CS0@̸)O- R@@0`-SPM S! C R,,,,,,p,,\?So @Sy 00C Sh0 0 \`0S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P6솟p覟ԖW@A0S 0f0CS00  P6FBЍx6P6l6X0000Q00S 6 pR&V(0S 0 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 R L 0ppUppW~|0m R  R9 V} WHs 83 BR  BR j ~  B Rs `2 BR  BR  ~  BR   _ ~ Y   0S  QAQAQ   Q.)    ~ AQUd Ra 4q B R  `V~paQ 00S T 00 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00)).k))heleȣ&))&4#)&O-,M0$00 060=```V`p 0  L600`G6 @ V 0@P 00@S0(00 60P@  R@@0% T A % R *R@R Z  JRG tA@TZ   + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S10@8 0&  [ 0 0, Z R$ CR 0S 0[ 0F 0[ 0 0@S30S0@000J S񟗷 `P P llll\3 BR  BR  ~  BR  ~  K R  BR ~0 0  BR ~0 0 (Rx[A0lT@ 000SS @Z,ЍT TL aQ00CS0)0 儁$00 0I0 0P 0C A 0001 10AI0000T 0 00LP 00 0!&@[@R p R0 Rp Rp B\T   R0S*i))")&ȣ&v).kO-0M  P0 4400̴̔0@ 0~Q  0 pd匤0@Q Q#:Q =Q Q Q     BR  P AA  p A P񟗁T%"t%t%%""$l##X 0S@ЍQ Q@Q =R 0p(0  BR  pw w p    BR  u  l u  BR   [ ( R  0BQRQ B  X  BR  v p}7 v 0S Q AQ~@AQ  RX ~     A@@ P  7@P)  ~R&=Q0S! 00   @4#)&)&)!)G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S000`0`0CS0!0 0@p   0   0  R 0m00e 0p ȣ&)&)&!)) @-0n@O&O-XAX`0$M`F:w P wpFR  XMp;R !00`&]&Z&`$))l&|bwȣ&9)ww0S/p@-@PP1PDHASP0a 0(00R 0S"0D@=05#0s  0C?o2^0SP#pP hR#P p0S *00CS0p\00Spp@ Ao PQP$)w5rO)>x%x)p@-@\P0P00 P@00CS0p00Spp@))O-@`LM R0 LЍO)ؐY. PPY   t0 SPs   0S0P0S PP PQ 00SЀ0S@LЍ0S|22 F! 0R+  p  !R -  "t)np 0 0T"h) bp0 sR ,M0Vp ) 00CS0(0p W (e Z 00CS0(0 00CS0(0 | 00CS0(0  Ѐ YZw(000v ) #40  ) (P S#4QQ  0 0p@ gp  (Jzp0㓉(ЀHp0$)l&5rO`xixnxvxxxx@- 0 SS0C 0.^\Q0 @  C/o "P R O-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S @@1@YZT X@k1 r9 002#00S 0S 0p?Sp  +P T"@` A Pj P D \0@00SJ R Q !" R @l&xx$)xxG-$a$w0S Qq0l0@S @ 'А㼠0Sʰ00CS00 \' 0 (0 R  0 S !'$)YE)5rOxxyxԤ&A-pP`AP00Sʄ10P 0S hjPp pPP gP`W@ P$1@@A'PV QPU, 00SJ m'0 f'`00CS0 &0S 0 0 00S0 S 0 0`$p$yy),10S0000000W@00CS000S 0S @`VZ00萠d@ 0 Z}M@Ꙃ! P00B R @$)))ȣ&A-`!@S1p@!P [w$Tp1@WV2 `1N0SN U 0S0PptPsV 1WIp:N {b"_"060S$ X"U"R"Vg$d$U 0S PPr\rP LLNWT 0 V)))$)ȣ&l&wV w08 N R S  0S  P kȣ&O-`R0pMxB0  pP 0S0S ЍP 0@000 0 0!P):T 0S0 10S  160S  0TFD RD B100CS0h10S 0S  02,   ^ \ 0Q R0 ~. ^ {  No[^ Q  P 000Q@V{  No[^ 0H!))$))ȣ&Ф&) G-pPK@P EP1N0St `PH@CsT @?s-HpM P`㜠@0S0S 0S0S>`@Y 0 X 000 Hȣ&l&jw$)A-@Pw P PT0Q 0S tlP@ pP@ ZP@t|06 R0S@@Q`` 0pJ 0 0 Sk`y)\#ȣ&Ԥ&O-@cs$M0 PPT  %P )P lnU pUT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP p㴲jY  \   0`P 0S00Y 0STP f'$260Sj0`00\  \ 0?o2? TW B'\0#Q 0 !X R8  p"P0S 0S00 0 RZP S  R 070TpP/o" R 0 S0C0 ᣴ p0SYX X YPPVy)yydy$))Cȣ&p@-@p``Q000 R 0S <1Fp L!0S 0 00D1  S  Bo00P0R ` R\ `` R00 )0S00CS0000S cp)l&Cw$)5rO)@1A-Q40@SpR#P`q0SP00CS00 " 0 $0#Fp K.G!(#PlP000T0@0CS0800S $)xx\#xԤ&l&w))@-v @ 00YE)@-@ k @YEp@-`@0 0 p 0Qp\ PU"00p$)yO- 0@LbLPDDDr0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS\\[<]\\\\[$0!PU0 R$ \S0 \0 0S0 @ P   0@ P0#P"0!0 P  0  @}00 S$0)0 !"0T 0@ 1 }SP0  :0@"00  $)yyyt&yy0yyA-@dcdsdMTZ 0SW0S^l`^^^4_^^T_____``\```(^```````^^ R0S   "%#00CS 0S2h"!\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8 Pd Pa P^ P[ PX PU @,$)CDyф;zyyzzt) zzzz:*zX #zC0z\:z6z>zCzyyyyNzpup@-@P@`TpUPU 0S G@Nu p@-Pt`t0PP6 R@N0S@2@@0S. @D0    p 0 p$)ȣ&A-0P@`Tp R@ 0N@T P 0S@@mW\0HU 000000V0@ )ȣ&l&A-P`pp P@ 0 AI0 TzO-P 0qM00S 1a б100 0000 S  @PЍ~0SG 0 RS/Q ( C@nP 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S+@E) @00CS00  0 ( `0SH0 @00H)x")P)de")$)ez&)szФ&&A-M`$P4q4A0S O6V@oP 1Vj0^0" 0P!1U00V0S^0SP60S .0S PP P ЍP ^X8 0P0C?o20H!)ȣ&Ф&ؤ&&z8)0S/p@-P000'l@P00CS000S TpP@T` `@V0`0T0@0v0S V00T00p@))ȣ&p@-l@0P00kP I00CS0 Sp@00S X) w)p@-P@dPUrgp@-CPdz@-0 000E000PS V 00CS0l00SGb E P 0(` 50`PP)&))T 000@0A00CS0/00S/3)&)p@-PPP`@ P T @D{@p00C0C0p踣&)p@-(P(`@@Dw00C0p踣&)( 00C 00 A0C0/ḣ&)-A-@P(MHp@`DpPVP u T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@:B0 P pzO- 0@4MtT@0,`P3P0S pV@ rV00 dV000T P y!3P h#hhC p iP w0\Q"\Sr 0S!iPi R Q X BR )  "p JQO Q GP dBP~W p P{X  BR    P  BR 0@ ! P R   0 00 h1  `PApW    pAqJ0 0Z* 0S   @P,4Ѝ ѫP ̫oXPJ Wp X =  BR 6  1z)){|a&&)deA-PB`Pk̂000ipi00CS020S 20@T[UU  r0@0w 00 C@@x 00 C@0@0  0Dr000w  B0x  B0 00 Cr0P 0w 00 CPx 00 CP0P0t0E 0L`A01 H%`ЍP(: 1 000 0 0A^A0@ 0QS$ 000+mPP lpB00CS0H00S UXYD <h>)))@{Ԥ&{P{I'V{u{{O-f@P`sMS`P>Ls0SC<30@TDUP3X i 0 @ @ythX   X 0SB01 `ЍSVP aV HVP@ 0S4X0S UP\P= p 0/S9S W:*00CpïS  C P 0 ( :=ip(CL 0 - @0(ET0 S ChPC0Syw0tS x{tg 0  0P ]{d)|m {Ԥ&i||{ |{,|&|E|)^|S# BR00/0S0/@0S/ R /0@-00@00C S a RR R1\0* Ѝ||000C S0S//QX0 0@- ^ @P U@R000/ȣ&p@-`@`P6N0Spv@Tpggg.g@|g 0P p@ȣ&)Jy}G-pP@R`Q7 @N`r0S 0 c `V@A00CS00  0 @aq匁 Q  R  @@TPP,aHqH0 R R *@TP@00CS00  0 Q P @1@ST@Q@`Q PGB`V0 8 ȣ& }al Y}#} Ԥ&.*}4}j}Q};}C} 00\#P0@-ȣ&Y}\}0S/p@-@PPEPp@@@A-@1Sc`p@DPU 0@P00` P_)G-@P0LaL00 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SG))Y}p}ȣ&A-P B00`0QՖ 0S 00S0S006X pWDP @P6p60S0S60F N0 B/oS60"N00S R 0 0-S0F0 1 Q0CSRC0SQ 0S! P0   000S 0 0^0 PA. R   R0 0)ȣ&} )PG- @@P0S`p0C 0 XZ0OA0C R 0 0CS0@00S 0S V?})}))P0 @-\@000D00S 00CS000S S)))000C S/ @-@P 0 )G-0p RP 0S6Q 0S!0@ 0C?`C10 !6,g``@ `_0i `` -R \ -Q0S 0`@T0:SE 0R@/T/:Y  @`.@T0:S   @`@? `0 :\00Y00  T@0 CB!0 4$@ ЍC}}}}ؤ&YEP@-HD0P  Q 000CH Ѝ})) $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HrPP0k@:T  ($)(~~p@-H@HP080Sp0u`0CS0` 800C80ꬤ&) 0R @-@T =0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @謤& 0S/xQS  00 S/00 0/0S/0/*i08 0/=P/P/0/*i0 0@-0묤&~p@-`R`@PP t0 0Ppd0 Pp0-S0S0 0pV ($00080@p))~&O-RM0p0p R pl"l2lb @d 0SXy XR00CS0`2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B R @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { k Kph&e&&)&0-0@ P RDM`0 Ph h "  U0L T<0< A 0 01 0 ꬤ& "Ke`=@-P@M0T 0P0Sp`@T*vpPT @Ti;PLP @0 BPЍ@긣&&)p~l000S p@-XP@T T D0T@p8040@p 0/ᬤ&)YE")h& #)@-0@)p@-d@dP\Pp P 00008  P8 p@h&&c2G-DR0@T @ B 0S 0 @ 0r8 0 00CS00 `)V*V V v va G ` 0F Sd V@0000 @\V. |V ;V&P @0 ;P @0 N@0U PpFx&P@0 ?@0o|P@0 6@0@0@07p P  00P000K 0 ꬤ&h&))2mG-pc0@0 T T+P,0S)㰀" PP @c l@@`P  0RP @FDA@@T 0 謤&fp@-`0$P P g 0R$, (@R   RP9Pl    Q  00000S@p 0 BRp@ W080@ p謤&@-y0 000謤&@-@oPp@- @fP P @0 000p` P 0`@`ꬤ& O-鰑`P0  Pᔱ@APp0 CR00S00 s0@X ',100S @%X U _@P@W W- V- O0@PpGWPV oVP 000 0V p0S 000ꬤ&eG-PJM0 5@0 0 04 P00400D$0``P  0S :  40  |4 `t$0000 `SH4 ` ,4$ ($00CS0! 0S$@PU3 0RPPS p00SP Pv (30S l3p@p3p0pH00 0S  0 {`PPA P5 \P p'200pl PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 Pb@0000 X@ "00CS0N001@@PsH n@m1000S 10 A0 SGl!|V@0  70 @00C0,000&90 000CS010S =0 0 0 0 02 P B1 0R z0u`@0PEPUZJߍ5}00CS0`R {00ꬤ&)&)h&)&)0O-̟̯M0ϟ0 Q02202280?_@? 000"`00/20S@0Sʶ@ 2Pt4h|lL<L$/Q00S .00CS0.0.Q00S 00C00000P`210S8xPpVTP"PF SPMpM vU0@#SGThhhhhh8hhhh4hhhhhhhhhhhhLhؠ p00@ Sr0pG A0@Sr7pGa0@SOrWpG[Jp0 S00C0t00  P ('P 0p@W00@S p p p p pq00@0pGSq0pG`0@?o? @2;R0Sp ^\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp000 S0 0C0~0 0ĕ@00C0pW'*00C00'60'3?00  R~   B  ĕ?pAp000 S00C0~00•00C@0W$*00C00'90'6?00  R  B ~  ĕ  B 0'3?00  R~   B  w$00C00'<0'9?00  R~   B  ĕA0'6?00 Q~A•W?p00C00'?0'02!R \ @  }P0S h00C AQ 0~00@00C0 @!$P "P1S 0~ 0C00  B \  @Q0~0A @00v0Q! R00C0w00@t0`"0p ! R !R0S F0`2 5R00C0v0)0!Qp R00C0@R 1 00C0v00`@50"0 !0`0C0w0 1 0`0C0v00(P05(P  0 B y   "! @ B 00pS 21 0`0C0|0000C00  00S 00C002  B )Pp( "1@0C8#8S10`0C0x0000C0p 0 i00S210" RR 21Sx0pW ~0 T0 00CS0R82pP0@@21S80 0#<R00S/ 0S(>0@SP P1P0U1 UP>X,UP/>P0 |P000P$@: 0ЍP0 ,  0P% 0&P00 0<P_ >P &P000p0p0((0 @ -P 0(0  p 0@0Hꬤ&h&0l)&))i6N))&I')*iuf&ʀ2m.k,j {P B@ < } p l {S  D  B p/#P0p*}P0$  @@   ? }P0 U0 p 0N$  @ Op0H! , @ BR #@lx!0  = BR@ Ĥ0T@0Wj%S` :S/ #S0[ 0 p@0C Q @ BR @<W0 0 @ R+  B 0*0=G#p0ᜲ AP H02!R1S p0HS2@p0 pXp~ #0X2 ` !r,!!m00S Go}S㫲[| p'P023Q w0 00"0 `!b$0 0 @ B "  0$2  `!G-`ЀР0@T@@0PU @ 0S 0 0   B/o"O`0p 0S 0 ] 0 0 01ꬤ&0l@-0P0@-2aM0$ 0 P10< 010@01|0000YPI@1| 1Q @@00 dq 0S $Q. 4QG Q ,4  8000<  ,`000 0 0 0 0 0 S00aߍ0  p0 `0 H0 D0 H00SYS,0 0)ȣ&)&0l&)YE G-Vp0 00 P" 000P6̻||ȷL0$00p@\P 0 R 0`     y0@0S 0 00& P0, RPY 000@ 00 00 R, RWP4 B00300 0000    BR   00p` P 0000 CR Sl 0 P P`  ``ys 0 0008 @0C 0 G00;`0 SpP \0 R   L000`0S0 R Ӻ0 0P 0 R000% 0  pP 0@S P 000c `@` 0P00`N P0 000000S$ T 0S }0@000@00S0P0S0S 000@Ѝ0$00pWꬤ&R&ȣ&A-Q@`Q` @ p0 P0 0X@p 0P R$@@`-R ( W% R"pl0 `4 mP 1/=`P 0 08 00C0%04`Ѝ Q  0Sh0 00 00 @ 0ꬤ&h&9 A-P@0 P/ 000`P 000p0@``@@yP 0`0 U000 PPe``0SU +Pꬤ&ȣ&Kp@-@|PP 0 @MP P 00000Sp Ͻpp謤&^ P/0S/80 P/0S Q/00)p@-@ `P=00`Pps@-` VP嚽@ PP UЍp @PU  WWLt 0P/0)RQ%VVPp@-@ PU P `U1 JUp2A-P`@XpT@Q00C0V PU/@0)p@-X@X`0P0000/00CS0p00Spp@)0))p@-PH0@TpU@`V PhU`0)@-@h 0 S000C T DMUP SU,0O@dA T @0@@긤&gfff0)p@-`@0 Sڌ S  ,UPPT /Upu0S 0 S UPg0S 0))p@-P @80Pp 0  0p0)@0@-@ P  Q G/@T00) 0 P/ R/0)C-S0SSxd R 00CS0L0 - |fCp@-@0TP R R R& 1S# 0 sPpR!Q QT " "D0600S0T0S 00S0u@)))ȣ&@-@P !TP0  / CL!)8QA-@ 00CS00 P `ppp E?U U P@U00CS00 `\#A-@`ptPt@0000S 00S *p`V@40`00CS000SA )D)@))L0P  A?Q Q R:///@)@- b@0pSM10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 pp0 0S" UEop$ W`RUXS0@D>T000 0i00 O Pt0N R  DTR 60SЍQ Q2 1 @D@@))ȣ&)lPO-P@p :P `4P /P 0PEpSUpUX@@(` PP`Ppl44PPEpU]X P$d$t$ 0E0 10ST@ T@P@UT @Pcs1 R 00ST|z@ TL@P@UT ,@,s,Q0S 00S kY@@T`X `Ȣ娲pGY P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP *PP QPP1 ` c0S^ 0E T0 S R0T00 &@1 R 4) U@ ^00CS010S FP `PP@ᘀPq0S 000 )T 700CS0t00S @@T00/u -=:8Ԥ&@)Gm Ʉӄބɺ )~ Ф&ф)G-PP ?p0@`吐 D0S 00S Eo0D0@000CS00S pW@UG@)H)))p@-H@P02`S@20CSp7V02p@),0T0SP/0S//@)C-p@`1010r!Q0@S10C1 ЍqXPU X2ǿWPᠸh(뺿P 0S ὿@))@ 0P/!!R /@)p@-8P\2Sp@xur\Bp@)0-MM01`"R !R X"R   1 1d"1!d2S ,NPl1, ,NP L!0,00N@P$1, U@T0d/O`0P, U @T 0S EP#00CS0 ! Ns00 0$0(00D>S 00 VMNtM"!031@)))) 0@-`"dy@)p@-L@'PΏ0PPp0C/U00p0gp@-T@TP0 0P0 '0 0000CS0p00Spp@諴)&)A-p`@PU L0PPEU` XDi0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S JsDP`0000 0C0!)))p@-@P@0SH00Spp@00CS00  꼤&0꼤&0꼤&@-@P*&Ѝ-@-   Ѝ Ѝ/-@- 0  ЍЍ/ἤ& -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`ᾎP$ 0S! h劫0S00CS0>0 "  u00CS0/0 " 0S vpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 ,0g&0R꼤&@-@@꼤&@-0rS.1Q0G-@0 p0R(0帀P0=00=``F@V@p@DR000 S=S B`` R`ť` @G,P&)&0@- 4@ 00C00 0 0ᅏЍ!)v0P P PR /0@-PP@^ ^ R0L00/*iA-鸀' 0S RV'p`@PU pWp0 \ 0S 0S   3/P@P00!)0SeA-@'PgU p`pp0S'SSP@DAL';PP(  EAۄ~\#t A-P0`Sp@    3/@PP@X "W p0@=SPUP00 00CS00  0 00CS00 w 0 T oԤ&^O-A0Sp 00P̀ 0`V S 0p@PU* ЍY   R Q ʁ m <0aP`0 l!)!)p")0@ R P=R/=R/A-Pp0S=SRpGp'dh0h`!0aU@`T 0S  >IPU``@!)!)@-1`0@S @  PPV 0 `$$ K de  `C Ѝ@$@q   R <0 2/0`$ 0R , R  c0a00 0000@!L @UP U0 e00CS0\00S ЍY0#L 00P P ȣ&)!))@-@P= `&P pTpP pp0  BR = T  2!`\ Ѝ00@0곅-GML000#JP00$0 0  Gߍ)p@-JX@P0`m#@0U< 0U`00 0p@!)҅˅Jy}!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ^$Ѝ)م) )ȣ&)p@-@`TP000T 00CS0p,00Spp@'@))7@-P@T@ PP0 P00p Ѝ0 yP 0 @d00000 00Pxg!)A-Pp` 0  "0"@TPUA@ 0@00`!) @-;@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =ᅊ@@)O-p@`0QrSP W 100S V'>nP pPW`0I?o2V0S Ep`VD10@T0  ЍOf @0P=S7 P( PW0 00 0  姯`U 0 X  ЍU0 00 U 00S -W FP,,PPPP) @-` pk@P@ Ѝ0  R@ PR000 00S x0000   ! 0 !@@DT@00S )de)A-`pĀ@TP0U0  ኽ !!0 R R   0 02/0 h!00 0000!)&ȣ&A-p`P@P 0`0PPEPvT` eTp` fTxTp`X $@V Y@")PP@- n b'C-ؑp000P0`-S㰁@TQ @ 0@00`0CS0d10S  Ѝ @P=P 0 @0 00  0 00 000000  RP 00 00=S l0T 10=S010C0 PPP)!)&ȣ&)  ")p@-@PTpv@p@-P@`P \խNP@ xP@ IP@#P(P0 P pWYG)00@/ 0S0@/s@-@d0 0P`[0S W0"S U1r0!l%*0S`0T匭000 @0C?o2R0SЍp҆I'@-M@ 'GP ލGP@D0 SQH0PP0@-M@ GP ލFP@D 0RPH0PP0@-M@ FP ލFP0RP 0RPA-@`FP13@ 0SC PFUA FPPPp{FPJ! 0RA@- 0-RS# 0S0 00t& Ѝ0SX0 0P0S00 040,僷P$ hhih0@-0P!S@M0SPЍ0P{ 0SxPUo U U 렮Po U KFP? :FPPEUR (0HXhx O  P  P  P  P  P  P P p0St00@FT @E0(S0)S 00qop@-@`P(P} 0Sz00CSt,<L\\\\4`ᵶoop᭶P᧶ᢶP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(Eb/0S0!SPpp(S0)S0S pp@-@P4PPE.P.U)  ( < H \ 0op=Pp0\0!S0P p(S0)S0S =p/t@-劫0@6Ф&@-$0$0 00 2 )Ф&X@- @ሳ R1P\0* :ЍׇO-P@,MU0pE `-R lRF 8R -R| PE@P 2 000J @P RFpe pGW` 吵PpW ````F %RX mPPx8pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\ Fp FP h幪dl㗪X1D:@P E@P0S0Sp@$  ֲ PY0Q 尪 RP!p0*Q RBpu`  ~TT{BwYEI'/u  - Ԥ&€ <0@-DMr0   0@@DPU#JB@0 Ṇ    C0P x, pp LdDЍ0=ʄP "k)$) .C&|u7}Jy}yp@-00S 0x 0t 0l0l l@0   PU L@L0L D0D P pt Pp))))&0)&Ԥ&&Ф&ؤ&p@-@Ǡ0@劶S 0 0@0PU@000i@0\ PB0S00CS0400S \p@i@C)&,)ȣ&)X!))P/p@-@PTp000@p@-@P=ELSRY`_gfoxwÒ’}Ғڒْ@-铮 C늓B'@-,0, P 0 0 3#) B'#s@-@`ᔮ000 #S@7Pቮ0S  0V00S 0 VЍp\#0S/#Sp@-@,P$pp0P 00p#)a@-PRP@ p`p 0R" ЍH0"S0SO 00SS  00@OI'p@-h@P0S 0S 0SS <<< U   S(000P0p#) 4p@-Px@Q dvVP L0    P     pp@ @P#)0@-@PPM 0SLD00Ѝ000 0tP0 0 i#)O-Pp`llM 0S ];$ ,  P 0S ߍP/1 Q 0S =@s?0   P P@ P@0ST WpU: 0S  P 09/PV/` 0 `#)UΜ@-Z0S S S8 4 ЍIS$ Ѝꫝ\#Xӝ7@-lP$ R\U;@ H $0S p (U U Ѝ0#)))@kp@-@P 0S D0PS 0P0  00Spp蟞@-ެPD@D D`DpD0S 00 ؗB'@-TPL0 p@׬0"SJUЍ跞#)Ǟ@-TΗPL0 lp@0"S/UЍ#)@-@PPM 0SH00*`/`0 ;P$ /Qp0` `0 0+PT 0`2# 0 0P!00 00Ѝ i#)#)G-@0  R2!<#|( t`, hP0 \@8 P04 D #4R," ( "4S "4S !4S !4S !P0S p!T0S THqh刡P8X, W ЍGH0S> a``  0 0 0US, !S  13 y0USS0C S\FF\FFFFF\FFF\FS 0U  [ 0lVP2B'ӟ]dkry-YEǟt ϟޟt O-(Q ,@Q 0Qt=P Ѝ4QPP3PQ<-80S,00 80<0S804 <0P=PP=P1 QB": `p㴡崱8W0aS R   <0R hP 00< S  P0pS;`(DQ (=Q @P0S0 BS `a 0h R R * \*a 00`0(S0<-L#)ΠIv_͡O-;$M p*bP 0$S   ߍS uP@T[D@P 늤40 婫X ZS' ("$0f0Qf/ j⮩,2!S!R !SS0䡟1,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2 S 0 \p,"b"!4b4##> 0"448#8 R* 0S 0pjX P 0S 0 p1Sq j3  @1S jP f/ j901T T %Hl ))#)VEW}}WEVYEB|֢%)B'A-P@`%Pp5S$ Pv $0f0Q hnR%R 0R00000( #)))#)p@-0@P  P $p@XN 0@- 0S, P#)@-P  #)O-@:PkMM 00(p @\P @PXP00@⤷@00SP : tP( 6@00p(勷0dS (儤P,X 80vW00(0( P  P:HHἂY9 0  ,0P,0S( ,02 RP,吙吩,([ 0S,00 !( P,00  P,00  P,00,0 @  Pฟ,& , c^P(,0S  S;ƑZ0;s 00 0P, 1\  `@ ((Y= 0SX8(0 S0000(0P () ۣP ( ң P00(,0hP,0S ++RP0 (0|\$ p巣 P 00(,0MP,0T0 4姣 P 00(,0=P,0`0 嗣 P 00(,0-P,0X0 凣 P 00(,0P,0\0 wP prP 0 0,0(P,0d0 0aP  50(,0P,07 P P |50(,0P,07 @ P <50(,0P,07 r x0 P 40(,0P,07o b <  P 00(,0P,0x0_ R  P 00(,0P,0|0O B@0 aH0 S0S _0Y: Y0 h*/(0TLSH &H 2(0S 0> |е 0(0S h@|pݍЍ30"000 00S D $0  QP;$0 /P$04\  BB! ̚ ( 0S(0 0SO 0C RSXNXNNYNXNNlYNNNNX t 0(0 R000S0 H 0 ( d2000"0,0 0 0 ,0P |@,0!S 0,0, 2 N(0S P E(0,S 媡w:(0 S Pm 0(0,S 啡& (0S\z(0 Sr PQ (0,Si yF #)'[ +gcmx}Si#)s#)ֲ$)ģأr"&1;HSg#)iI'äs@-`0PU V  PZ@P hVЍp`PD!᫥ 00U0@⒵V ꀘ!<$00S 0@-鍦00$&p@-@5S4 0PSP p@cPp 0S 5S 1S N|Pp5S T \Pp< HPp{(( PpN#)#)NKedArdAi@-$1$AP(000(p;ge V5 5S P&0S "0S 005S  PT 0P*5S ` ЍX XkPL` 0aPWEV#)fdzmd$&$^#)gd@-@P f/@#) 0 C$&))md0S/!  -3@-PP pP 0S S@@ <P@Ѝ0@ Ѝ/0B'p@-4@4PQ9p@`{ x @,&@-t@t0MQh  `P0cS CS SS 4usS00ۍ0I)r-=@-\@\0MQP  HP 0nS yS0 $R00ۍI)ƺWCf0@-MM@` PP 00YSP ,4ۍЍ0PPꜬ 0 p))B'@-@M0 XP )ۍ̬Wp@-@$P 0p@ OB'%)))x @-YMM@p ip\YލЍ<0< S <f%Pژ10YS<0<0rdA%@-PM`p=@(: ɏ8`1တ qЍ<@-P0@ 0$S0S 0`Sp8 TQ-BQQ-pQt10S 8@0 H0000 ! ЍC0ASccccLdccccc,dccccccldc0A RQO8 0 0廑`(p 0> X0嬑 L0 80夑 ,0 0ᜑ 0I)P_@P `00CS`0p S00 P0S X0X /XD0B'G-` 0pP0ē@P LpGFT@Y @ 0@SH#PF~pဠ 0  Q} V #PU PP pXЍ裭5taB'O-@M MP`Ų%u倅倕0S0#!pO P P4 0!P(p0 p3 P  ndtT(p  P 0 XP aZPd 08Hd8tDT( p P 0 XP <0(0csS, p P 0 XP $0,0cxsS0 sp P 0 XP  000@csA;H#BLXelw|ճ1Qy` \O-销MYR S@`paZ 8QW ,[T ፛ ማ0  @0" ]m 8 w,0 0o0 ߚ`@08" Dm ( 0  !R 2 !`   0S 0C RkShuDvuDvDv0vDvuDvDvvDvDvDvDvu0 0 01 0 0p 8QI 囚T  <0P+8Q* 80A0 @ 2<0P+8Q *ЍOv0 0 0 0po  dj 8 T ЍOЍ腴HYEuʴ۴A-@Pp(DI <>`8SA~ 0`+ 0`( "4`#/A-P@ "440 "440 ⏞ ⋞((,,004488<$<"444$D"444$D"444$P"444$\"444$\`"444PTTXppXQp`pQ("448("448h0`@PV@P  |0T0E0T0E T"440E#)@-@l40Pm089f/WEV@-@HP TP8#!0@0QWEV#)80@-0@S C08f/ݝ%)0 \ P0//@-馞L0 DU <<J8@8P(` R 0F tB'&P7@-@ P 0PPP 0(p 0 ,G(噙P0 Ѝ0I)vd^0@?o2P0Ss@- `P@候P zP0 tP0 |nP00U`eP080DPD y(p0 $FЍp?RrBõrI)ud0@-PM wdP@` ](p DF 0 4 00+ + Ѝ0I)zd@Ƶ׵s@-@ =(p F0  0 0`P   0   0  h0  P0  8ЍpI)td@ 1IYEgڶ ( p@-@PM`P゜ 'p  ( vV V dPЍp (KH( 'p 0F 0zI)}d(@7/~d(I[0@-PM @ KP 8E4P 0'p0 EЍ0iI){dЀC-P0@`p!嘁嘑,M00 p0S@dd@@  y'p  <EeP qP pP $0Q `0S*]@P E@`QUW TU 0"L R00t` 0S,Ѝ00* *  P@X.;'I)|d۷@zYE+O-PMM *@P4040}=|S|s$0(,0$ 'p P/4@,`D8V (0, 0(000SڍЍ!# !!!P! !  (@`F店P B&p "E嫗@PdR8&ppV @0: S \"\\)040}=$0$0(@,@0@0  &p ,4p`V1(000(S?0P0*  0P3@@D&p  ;눁刑刡T ! x /`!R0$@(P(pD (G`F@ @p  0Q` 4 ;$qp 0`p ,$ P \ O{A I)wd-Atxd e GzB',B'pA-PM ' @IP D IP $ODܛ  h0`0PS Λ0"S U1r0%*V  0p0S  0"RspDPdPd `尀p%p0 8D0tЍ>fʹI)ydC-p`@P Q CၖP 03/ ЍC&$@@ R; 4p C뼥&0I)\# 0@- CI)P7@- P@TNP DIP804 _%p Ѝ0WCƺI)wdP7@- c4P@, I%p Ѝ0I)d@D@-(0   9B'O-,M00@Q`pP0000 0$0X,Ѝ HP  %pcC$ P  %p $0 S TP@㰐尠$0S"  0 00SW   尩0 S 0 @0Dɻp Mu oԻp@-@PP 1P' 0P, 8>0P  B0P 0P 0Pp@p3p@ 0xP>@dJp@kU@@YDPptcidyararbmngntsu pS#\# @0R/#B%B$1 4! 8</M)p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @M)0"!#/P/M)A-PT0p(,`@,0T@@DA??@@@M)?0@-<@< (20,20kP0  P*0 002M)> 0R//G-`0(,Bp PK Eऔ@PPoW ,20CS(20CS G`0M) p@-@`42SM%^ O E@ 82<"H 0 (2,"AЍp@<:Q<"82El@-`D,"(2H0"X"\4Ѝp@M)|&Cjx !ys@-P`0   0SЍp00S@0"S1Ds@-$M@G00  0 00YEB'A-`0p @TʰdAP Ϡ~,0d  ? ࿐qp  RЍAw!L`t!0S`@D@,ӗ Ѝ|&DZM)A-0ሀ`Ppp@h!14P S@ D d" R S R 0G@bqwUM)p@-4@P0S( G0B1pM)O-PLMx0 $0|0#(0p0@00030儠s,4000S; (2,3~$ 0(` 0 0<8 ? 0 0 000  0 8 <0,bd"P @ 0$ 0,(0 D`) 0 RD0 $R0 S h2000#1-R0" ,DD`P@(p0P00S ᏀP  剀P  僀P% D`0D00 S< 0g24 hhE%KUD1}A$5\"0yP@\2S@0p0@XRp0 XP@p0 XPU@p0 XPU@`D`$0U(0000[ 00S $0 0(00 0ho @ PLЍ P @M)|&8P)0B'RI'a#8&*H-s@-@K00CS0 P` Pp pp?0 P00CS00 Y@oЍp@Ѝ/0B'lRO-a p?Pp?C$@0eO 0qp Ѝ  R ЍOt`0S 0 qp `BE,  0S |&rM)p@-@P2S 0p`n/(21!41#41U &"U 80U p@@PC @ⓕ@TpM)HW)O)G- r@,o`P  t B B$|a00C0M)O-P0p0Q`@06 0 4 Q %C?C0V$ 021S 02/ .0 1  Q 32 $4 (5 , T02SlN Y) U'PL 20 0SR00P[# S 0 2S Y 7PA>Y 200@@PA`0S Y0S S01S 2SL-PD Ѝ`b/. $0(1,SR[#ZY  0S^   BN R@1SO148<$`00C0@@PA`d!R 00P !$(,     Q "R. Y 00a14a8a<0#d1a#h#z 0?Í4"RNX2 PDTY-pW Q) 2Q Q54 32S !1?  !<0 #!1?  !< 0# 1tS"0@R>ʇߍ@ hQS/2SrW#, p` 0 ಟ00 q 0`p#W0 002Rp`"Y p wp< T"QP20H"Fi 0(>1 RS Q0S!Q10!) &p12S  ?01DP& |!Qp10l4!?h0 2S02S 0 0S>0)S Z0)S  "Q  R  Q !Px;00 0j0<   0S<(M)؎`YE|&<^Bt`\dUP0A-4RUP@P@ZЍp(0PPPB1P@TaTaTS <ЍA0!14!8!< |1!1p n 1i1!1<0 ` 1[1 ?0U1!1<0d L 1PG 1@?0ЍA?M)YEfvO-BTd:\& "!R &/ .0 1  T 32 $4(5, T @\   Q R P H2,0L2000&0S- 1S* 3, T000P0  00ST0!14!8!<!14!8!<T0,@0p,0`\T (`0 S( 21S$ / .0040 81 <T , S  PT 32 $4(5, T0\,0000`P$p 0 0$000`S 0 S00$000` P  HW[ $0P0  ᨎ 0S pL 0S 0s X2 0 RS  $0倴xo((0 E 4 0 8 0&4 0&80 &< 00p `0 @2Sc RU 0c+P[ 0 1<Ap 0PP,2`0C 00PP(2 00p d? 0PPpp0`Fa ??`1`<A` 0 PP,2`0C 00PP(2 00 0PP? `Fa?`?`` 0SY 2SPU PUSJ041SM)%FYE P)sj yk5\#eM) O-HBp42MgS0 P(r(b42S 0P:U42S 0S PЁБ 42RSfP:42S]1!$1(1,ЍO0S `Sp t04rdW2S 0`lp ؠ0OP"PR S0SЍO蘝M@ D0ЍOSPo 0ЍM)M)*hnuN@-0@M0@ pp`Prpkߍ\ m0  0YP \ t02S 0S " ` PD)!SR U0P bqM)0@-Xa0 0LAP d2S8 OP(%!p! 2SP0U  $pt"  Rp\EU$p0 00P d2SP P@ Ѝ0P0!!1 |&M)mdM)WHW)yA-@T2 @PԈP ψP ʈP@ `p@T 00S p`V@嵈PD00S @@娈@PqõHw)&A-Pp`O"@,")"000 0@@@A-@pT` ᳀ᰀPPc"0@ \Z@"@O-MM0t4 P@ T\D ]P @ <WP44 00(04QT(0 ,0!4@ 0#)Z0@,0S @@((@`@,0s0000CP匃0P@PP0 l!41P430 (3Q,#  $ s4T0> p@: PE ,0S ,<(00S<(00@1 $k`P'0FSʆ`!P0S -S@= WP00 @@P,0S ,܍ЍA0 fTP ⨇8800  w0 R00S' ,10PAPQPa400C0 pYCm4~0S0Sw0S0S C i0S C _CZCU$0# t PS<(0  PHw)YEI4k ^ )ƺGm 47 &5v D 0/$f vY0S0S0 p0 0X@OpT  0S" P%5 *uP嘅eU \ 0XP0PP#@ލ Ѝ 03/0P0  GP gP@` ; 0S0SV SV tP0O.000; #pp P( [p g}(40@0Y0C @ pW*p 0  0 0000 0p0p00 Y!  00 )0 $0P$0 0S pP Z l@P ZG Yp Z``0S< f Sp Sm pWp 0S 0S- @V 000 B' 1 @K\#i{zd@I'?@- CB'-p@-QCM0S 0P?o20S@@Cߍp@ Ѝ/<>!0U0S# 0S,aQ-h00CS0"@ T 00CS0!v P @YT Y@DOoB 0Q   @OoB` 0 @0  0 0 SNT|)0B'B'WCƺ0@-M 03s0|c00@Sds 0S2PP R*PP i 00Um `Ѝ0S 0S @  0S\0SO\  0/1@ \0Sp 0!@u0 @9kp 0S0S# @\0S  @"  @0Sh @D <P@ @0 @ `0x P|"%   T    P  @@``C 0 @` }G H D|)|)|)/Rh5L~G-0@  0P 0S< 0  Q*u  bPPn  , 0`P `z !URQ 8Y l 40 p H0 0W40p rP C u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0pP  P 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`-0, 3$.0 (/0,8 001 42 00$4 `0~00 QP  `Ѝ   0P P y`P1S1S1US1S 3S3S3US3S, X P`P0`$ `<3 043 1,31300`0~00 QP     0P`00S !14!8!<<0!14!8!<@040  0S~40  QP 8  0PA0O A0  \P 4: 졟 0R  1 eYRPNXpW P0EĀ 07#;;S``XP $ R,0T T0,0T0 R$CीD0P 2L0#1\0\0Q 0P 0L0000P 0L000h00Pdl0d@*J6Rtj RRaArrAaU(Lo@-p@`P P00 P0} 00QP  Ѝ Q0P< !@ !0 P0} 00QP 4 0P*Jts@-P` L0@ R0!0!0%^l00l0 ~p00p0Ѝp^ P ^3# ~P L ~H00L 4I ,LP000{K;uO-Xp `PP 5 Ѝ00! 0}Q P D$ 2X0  X0 P~O-P,M0pPlP$0`P P@BpP $ Pi $0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p 0 0,Ѝ8(| L0 Q$2 q(@,"  P "  @P*"*  P0P S "!"0  0P@P $6 C00P s s// /OK80KO-`P@M衟 0P0S Ѝ p W  G r0A E00 s0 q r w qpp` TP0P@0 `P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P *Vj G[R0/0@- PBU02S0P^0A-p`|Pw@P  PmP P0R*"R0R0%uO- p`0P\PPX $P  qQ 0 0Q\@T(2 R@0 P" R S C0BTX t0D s   0 TX  R 0 0 n pP [P  J BPTR2 Q PE@z%O-X`0pM@PP`Ѝ チ0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/CP ᔁ  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0!  0"z0 QP 2  P~-O-@`Pp㤡失P0S00S <q.p@q8WO$0S  0S 0S,0 ( 0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0Av|j 40o@-?`XP\@#@3P@T@TpW @@T`L~)O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2"00咡 0My Q P  P 0W:0 0 0:y Q P PLJ   P<0T 0qB})O-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T: d0}) A-@/p0%B?kP0Sp p*t0FS `C @@0T?  C0})0 PK %/})O-` 1cMV, 0. SP0 S@0P`00D@H0(0$08@\D0$ R! X0p1#r#@@ ,40}x@04 QP r0P@8`00D`H0(0$00` p0C##  ,! PW  q2<0pGLL0< SD00S   <0@ 2<00,040>x@04 QP (100  RR R0(108H0L0 p0L0F A '*P1  (1 0(11 K  , 8 0B0 H0Pcߍ0H S180S  S:I@(1  0I0@;+ } P(10(10@8 80 0Sb 0@ K /oD000"s R`( $00P `, $0~000$0(00$0D0SD0! 0CD0 0D 㓢"X 0X  PP  :X R: U$0`(00`P0 4h | U?0(00`P^0D\Q U`V$  (   P`( PK/\P~ h0x!P0poQ P P0S*0hQh  01 U(0$0 `P0l P P0 00 , P@`  Q .b A0 b L L b @G?LL0CS \Q*V 0 $L0|!s0<80|1 0V4 8 <1 , u!-000000U\`0& V0 0$  \T0P 0P 0(00T0 00 ,@Vt 0$ S1S IxQ1PP|!hR \@8P PPL0sPP|! ,0I|1@|QUP0U* 0" 00 0x 1S \P@ 0I 0000@1lhyPP 1|!R1 @,PP 1@703 0P 00RP U$0`(00`PH1 SRhyP0S 0S \pVR P0S 02S 0S0S 02S\V(\Q|!6xQP 6PP 00I@P s\ ; |1P 1XP PPPPPPL0Is0PP@1K@I,hyP=PU `|1VS P@ |a``L0Is``@P !SP hPPO 0 1|10|1#40L0s_?00010PP<6 K/\|PP05xP'U U0@Ih00h0tP0U* 0RPd01S\0!0P %4QP0%8%\0 P0PEd0U03:\0t(wP P|!d1 [b" :0 0|12P0P`"< ,<0P I 02S0P0 S0 U$0 P(0S000 000(000 ,@ D00S@ 0,40u@04 QP<0,R80 PI 5P0c})Nu~)1NC fzMz"G-P p@r W p\aPP Pp $PK/{D08QP0Q:" 0PS00  Q poxPh`P 80"8 R 00 05 !$x})<`Y,p@-@5%SQ% 5 %SPR UU}{QQp  0Q Q0})A-lP`5p@ @ 0% Ņw@ŕ\})O-POMp(P> b5S5夢05ET0  0wP05 ET `T 5d 05 !dP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0s JQP d d0P Eh0K/0h0 z0 @!H,qr0d  01(z  j }z  yz,10,1#40L0sK?000/1001001#40>000310 00 000T0 Cvs(%,5QP Hd d0P{ ]})0)g{Zl @-@ P }0 5})0/0)0/0)0/0)-@-$@  'Y B'G-P`pZ{@0S , 0S X|# SU TY0S 0S{@ W0)]yt-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  (C-@M Mq` @Pݍ Ѝl!r~p@P=0LLD@rOP,0: S0RP0 00PPP81: S`P% S  R  rPPppPPPU rn PP @P0)% @)\#@-a.0P  0 00dG$Ѝ  [G+@):0@-4S 3/ 0)@-^z0 @( 0$yRz@`0)@-Lz@1SyyBz@O-PMM@`pP>P0 P: S3/oP 0rS %z00P 0#0@0@G@ U  uP  P PU z00@23MP@ S @X帰张P60: S)^0"F> P@PTP X+ S R"P-P U Tv@\ SZP@-\RP@ UgAPXp!t0#JPU0000 F 0@P  Py0S8W iPPth0 PLPP dV80% ܍Ѝ FF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440 $(0 $('x XX#xddhhllppttp p@-"440 P"440 @ mjgDDa@@[HHULLPPTTXX\|`\ `wp` pw p@wp@-`@"QUpf@p@-@P(%"pA-P@M4Q->C->CBX?X\<\99>9>:>C?n:>CF 0? AC>}C>GmFEnFE~G 0X J~X pW  $$((,S>,}S>GmFHHLLPPTTXX\\O-P ! "441!"441 $$((,,0@4p0T`4Vܑ\5 S L5spTԀ0,$ $Q p W CwTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 PI&10S; w0 0G 0 000$? 0 88a 00 0( 1( ,0(00h,0h( 0,00U  > 0 2P0@00 0R Q'' 0'P_ȄP8 $(?4 p0 1( P( Ph@h|)!X))&%)9E)A-P`p@o4p0S i40S !SRp^4p0S X40S!SRPj@Pc@A-P`p[@ `$P`PS00@AO-HMQM $#0@2`0F/ Ϡ _0 LlQ%6P(0,P\r 04PA`P `(0, 0S_(0,PۍЍ20S,  1qVQn8.#4n4#0 44.4 40P 0 0(0, 0S_S(0,P0```00@DQ"R0 P =0 00 @Є0 03/`)  0 0 0 0  000 0C h=0〠* 0a=l040S b%0 0|>LX))`))))`))@-P@p`AMM(h$c 0 P@ s3U0:t0 R0*d F$#@}0P M40  P,, 4$AލЍo@)eo 7@-0 Ѝ0@-\M`PpX @ bp0H0T0 `'!D0DPQp*QLt% P\Ѝ !|)PA-`:L`p`P#3RP3R#\@A@)O-M`@ ) P0F: 0 0@40P$? 0 n622Q p{ q B("(sQ0<30<420S0 P2pQ 04  0R  @P.( 0_<1б  0 4 Y: 10S0<00D0v`e2 `0Ѝ 0/<1 0O20S I20S 0^` `$824200/20S 7p&2p"2000 & "g))&X))|)O-@PGMM X `Gop:0 5 R"0倅S? 0S! 000S<P_00 1000( 0}5pH0 \00`0400Qp"Qdth2 " 4 0Y"/P|4GލЍh"0S$ @ L000 0t HP $0000S ~0  03.P0K 0 E r@ n  0 0S z s-[  P1 (E"$.P Ѐ袟 L000V0 H   00`02  0J$1  1008r10SXeT2r0"0H000H0H 0p 0 S 0 RC 3#004 S 0040P!l~D 0b  0{b 00  c  0 0rb000C00 S %<   0 0001    0000 _0 !0vs  0 00S n)|)xȆ)&R))Н@)1YpG-P`M@zHXpAZ 10S t10S 00 0H P<ЍG(@PEU> 1 RP1H I0  PKG/V08:‰ V- PlYFp 08,80<00<0S<00<0ЍFFFF`F V   R0K Q  QІ))Tp)h)|)))l)G-1P 0p` K_0  0^0@ 0S 0 0 80PS `P` 8UH0ZP000PSf`4gQ$,$ (,`(PP8))І)|)@-@8P 080І)G-쑟`0PSpM 100 B?e PBP 0@8@P|1 ?^h10pA0 G   000 0 0 Z` `1 `#"p(,0(pV Zp`0PQ*d0S\1@@ 0XP\   0^P0d000 A|)))))))P0p@- P?@t^800P 0 !SRp꤉)).p@-X`0SpL0LP@1D@A0SCA000p;갉))) 00 /Ἁ)O-H0MSP` M 003/ ލ Ѝ40 pPࣟ00 +0H00@0 t0 /  S 0V 0 ^0X0p3!0S' `3QhQg  0  0励0J0Z0 02+ 2R820t0S32 Q o   Z`"$7$+P@",2 R  ! ! t R1D+࡟W000c1 Q5 10000S1H  B/oQ" RK \!B0   +B@80)P:!P R, P By 10S0Q 10S 03/     0P  0p`V0*)d)|)l),mE)f)0O-S0 00㨄RM`PV@#M (, : SL \p(5R<R  P  RSV !0 ,hx0 PB?\0`s 0 0S0 0000 0Z[ 85x @5D0LT 0 b32 RhgV _08001(P Y 03/ RލЍ]0 1TP+U000H R00S 0 0G *Gl'PG0@S PXw P0 P|))))f)@@-@q!SP80< S0 80<  D gp@-@@PU DcP NP 0 R0:pp@)@0@-P@80\U< S0 80< 00p@-P@ 0 [U0p81 R0p8@M0P0S 0Sp 1P0Sp6100S p|)0S  0\ 0S(Np@4@)ć)|)o` )]@-p@`MuWP 1  P  p`V( w 00S0H0S 0 0 P0L -00Stt, fa)00Ѝ@L&P0S 00`Ѝ )0)|)Ї)Ј))0@-@PM \"8 `7)Q Q0 $0ASЍ000O-d5,Mp0 1@P`D T02: SR+ $0Ḱ0 Z%刡  !  Q0::` V `3 V `! HP @P(0S @P(0`S @P0!20 0S:R 0U40  `(`!\Ő\  ? 崣 ? '0嘳 5f0S30m Sm p3 R #R TH3 R ,s( ,3  R0\ 0㵯 Z0 " 00C 0L40S$40 0C$0娂*=22)|20S = 0 : S( S,  Sh000 00r+( 2p ZN *o0N0`S 1 00|10800 0ˏ B0X0 J0T @ 0`; < 7!000L00S 0C&  ,Ѝg*P( 0ˏ  d r 0 T @ 0`; 뫴 h괉)@)))T)h))U G`))|)0))O-2@ 0lMp`HYP!\P  ? 園 ? &0 $et2t0S0 S 0X"S 3S @@X d(20p`R 2QpQ\tQ`Xd   X 1 R, dP'00X0S  0 0 `0\ *L!00ST06 0 !S0\ 0㵿 X0 " 00 04$0L4R0@ 0$*0002(0S PN8 P& PlЍSq  ^l))T)h))U jН|)Ї)Ј)0)`))O-p|2t2PU@P` 0U0  Z00 Ѝ0k Ϡ?R f4F V@WLQWf TU A0 %&00100 @ _ @T`T0pGT Q 0@`K 0 @Q `  T 0D >0僁 0 %P 0 ^0 ^[@` 0 000x000 %0P0S000 0U000{00)|)O-4Pp,MW pWhb`p0 00`?00S VA3@30000JT D` 9 @000_ @TT00T S @@S  T 0  0 01 0PV pP 2 000`?0l20SA 뉑 0 ]00 ]Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0Yld= W  $p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 IP  ,Ѝ|))@-c IB's@-@P `0S 0S 0  ЍpvO-EM` MP0S 0S PpP P 0SPލ Ѝ000S  P k0S 0S 0S M0Sy 0Sx 0Sdy0SP)0S 0S0 08Sd s/2#' 00 " " 0D@1 !! 0\ 0\d!! 0\0 lpP0SS "04 0 R0  0"? 0 ,¯ R*( ,4ï0AH80/R%' 8`<0P V Y0" |0S lhbPUt V@0S HDb@PUn K,0SP@PPDPRH0S  `Cn* l-xl/%|0S llL0p00S0P0E% 0,0UA:000S 0S P H1 H0S 0S,0S P  *P   000(PP 0SP "P PP :P)Bf&p\)% 4k 7O-H0@Sp`M W0R0: 0P 0 H"p`0<"0 S0 p20SW pЍP 䱟䑟  BR 0S#/  !.V  R.. P x!`T  R0 H  gP  @@" 8 < P8 <`MP0 h P 0 O$ RP `  ^ V UV U  h)))C\)T) X8))rO )00S 4 /ጇ)00S0`( "4`#/ጇ) 00S/ꌇ)O-M,Mp @"P:$Z 0  0`SEZ ` p P% 0`VP!00 0؍,Ѝ0 (P  X0`VPh0S  0l mh P  G0S, @@_ 0; ([(+Z054%00! ?0S S00:00/0S 0 S00 :0V00#03  R00S :0S;  0| 6t: 0S R` P 0@4[< Q0 4`?0: :R00^0 B?SQP%90S  0 ] 0 0 ` 0IP0  90S, ((n_0N$0  ZP00 0 S_8Q<90S8 0 V0;R02*h0S/ 8((d0 #0 (P `l80S (00 0(00t 0` w@ ((m+70Sh0 0!7'(5S[/V V:'<V  3 #P  RJSQ< !0E D U0$000(p i0 U47PP0X 0ZP] D'000q@0P|P68P"h0S0P%Q_!1Q 0PQ^100 U0 EPP P00t @?1#R 10S0>0 P d Z$0S 10000S p50S $0S 00 P0Dt ?Yw$Q  40S $0S  ) Qa 04 0 S0 0 0 0000 08$000 0 #600S040S T4 PP `@pt3SQpQLtQPXd00H00S1 0S p30S* \}P00  0,;(P 2 2 0\00Q&&:0 @00x0S828040/<0a0#PQ8`Pm 0@S H0S"  0 #  P0L H#Pc8h|)@)))()Ї)Ј)))h))))7)p)))0)O>f}P)T)x))* O-p868F4V4f|M,0S&40AHDLTD T0FX  \5 $00P尥  0@, RG5@|Ѝ0\."Q 0 P0  0/ SRQ0 ?00`1>`U`00S 00p@30Pp7X$\5SR%Ϡ<# LD ?(0 m\ 40S40F SF 4`V0`@0x@S td0, W 0 0030SC 30S? 0 S( 3 S? T!. 0 / s\@T` 0 Ń># 0S  0 S\000 T @T`VT0? @`1 020兑A0[ 1QS  0TX ᓽ0P0 0N  [000Y 0<* 0  0VT0 pW`@p^W@ R00!03SQ@1:0Q@4a p0嚿 00  P C0TS YP 0 0 坾`P 0  R00* A #[`괉))T\),m8)0)d))h))|)P)PB')$)U x)h)O-` @ 0Mp̰̐ 0 0  BRЍ PP U QP Y` @ pQ RP Q @pꀊ)T)  0`( "4`#/O-plMX Z0P`X0L1L0H1H D1 0,0SlЍ0S @d0, fV0 r00@ܰ 0D Rp`T0#:P 0 ARpQ R\tQ `( R @P\) )P))B')|) 0000@/00S 4 /ጇ)00S0`( "4`#/ጇ) 00S/ꌇ)O-:M`PV`@@M90S 0P )S0*`00#0.唉Y `VpP 0 WP \)X PP9p`0S 0S ) P00 8 #R0ĸp0,S00000 8 00!"441#0"q    0P@ fcfj00C0U Y100S 0z UP 0tM0 S$ 0S '0h0P\7}`{60,S000007 00!"441'p0pp00ppP*0S  lPe 0 1%`]|`PY @ ` % %80< 0 80< 0@0C0ş l0 00 R.*0S  $P  0"pWVލЍ0S 80< 080T5 0< S @-i0 00$001 z%`P 0S 80< 0804 0< S i`0 00$`S!  B("(p U% ⴁP%P 80< 0 80< m00C0@' 80R<.PSR# .R #P$PP3P`080<>L3 R0* 300|P(3s 0 0ppW P0Sp000AS񟗢|PPS2 002t0S04000^P H2 ;#R0w|2 0#R0mQ" 0S0S@ 0q 8Pp  : S000 !0 #R0 Q   0lFQF?\!\  010 S$ D h#R0 š!ʡ0S  0R 1 0 00p0P``000C0WIPpBn % |))@))  ))2!R@).=M^m)$)tiaO-WM ME0AS񟗁ꀒ pl4 hP X7 zD' @P k(7 007@0  6qP 60S  60VF6 X DW0`06`00圦100V4:6 Rpxxx0S/@6@`aViPVo`Wލ Ѝ( .P*P   p 0S d @5p FL[> 0 p00@(0S Shhu`%kpR(P* 4 0  B, ! ]50SW 00(000]/0q 0S fp(0GwR0(SF @pQ(Aa,pVd4p0(S9@0W78O,0 S1 #0 R( S000000W!"!"+Wdx&hp2  (  ]/&  ,0 S1 #0 R S) )R * ؀ p0 S( R , /V"2 pR)@ W(,`0@'x aV!W"Wdxh A aV @0 (0S $ 0 s00Q P0S"0`10S x10!)!00C0! P0 00000C0!" Mpq0S@0 0 0C0 00@)!  O)))P))`)  8 Q m B'|)X) $)* ))  0`( "4`#/O-Pܢ1EPMQ@Tߍ0S `dp@EDAG@D<0 xxp000@   B 0    S,"[ "[ "[S[ P0:000S 1a  1R R@0 S 00"P X100C@<P X T X ! ! Rph0QbT0 e R\tQ ]` h00!{P\ p00_ {000꜉))P) B'))$)T)Ȇ) PR|))G $SO-40$M⼰0p4 `@?OP#\P  ? г ? 0 T30S30X SX 0#S 3S p2@ 002P00 00CSFTY! P 80R0L003030 000?=O` a2! Q,S Q0B* 2t20S P/ P@B P$ЍS  = Pv?00 1>!W 00S>>0Q#b ! RQ T30 0|!S`0?00 ?NS  R.. 0" !00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L30  ^Z 0ؠ< 0Pp1))T)h))U o `))\) )8)00S0`( "4`#/ጇ)O-`lMX ~Sx2x0tB0,0SlЍ\r0S Pd0,/O0 $$;000Pp@1 0 0D R`T07:!AXpX\tX`Xd  X  @RG,̤X %P 10S  07@PPP 00S  0FQ SR  00: x X! 0 P  H 08LНP))P) B')|))     O-oMM@P00 R0|2h?0SX0S $5SD0SY8PZX0S $XnS X Rg>`0Vd2 P\20+! `" d" BR1d"\000Bh`$lPl0A^000p21`t2\B1l2>V 2l20CP0=SLq Q\20B   0S 0 8$5@> * > >0S <0 0lS0$5  B11  !`0Q00B1- 00 S  ${܌0S%  봀 -⎀Ḁ$1BP`R!B@ L[PP d ]` PM 0S  <P| *堀o|<p<0S o0 0/`0 bA?P0P<5A?\0 =<0T0.L0Q ;0VHQ RX0h0@ @0Q8 84<ϡP b${ S Q,0 Sa?^ @P= (;0S @0 # "@0A!" !@0 ! @ @0 ! AᔽP: @ @Q0009J*:8t:0S T0 0؍ߍ0<00<``!.Q  R  `0" |i0S pd,L 0 HH 004y+\0#Q  0 X ?蘟 MQ0phS90y Sy 80S 0)S 3S 0S 0 080S 8 0S@(0 04( 0Y $8D8o;\Ş&"\ ` 0 0Ϣd h pB  `bnj"36+?H "D H D 08T<XTRXX07T `V=S((0H 2T0VpC p,00C S=Sy7{S  +\0#Q  0h倆 ?eY \|670S 8P#50h $60S 0%\Q\u5P50 S555;o\Ş&"\ ` 0 0Ϣd h pB  `bnj"36or7@K ?! |"$5S8Kx0 2,2$2(0 W002,0("W04200R0V82b x0R"2 O 2$S\?< O 2t$Sd??P OV=SL5s045 p`?ൟ0S/[ 2#Sd2?/0?  (2#0C(2 2Sd2?/0?  (20C(2`H0T SD0X 02 0d0DH0^K <0AS 20 2(2"0C(2 2S 0d2/0 "!`pV0: 0dϠ ΌdP \^̠  L \h qzq08\\$20$2<0S4 dJ 2!S\2/0?! ! 2!S?pPu?`rpPXd]K먐 YK0  0 SKJ000$5S `0t63 03080H ` H D /D L))))D E|)) [ > u    )\)w P) B'Th) ))l)); e )8 x) )  `))))) )$)\ ) U = R,2 ," 2, lSh2/0^>0Q0^0/I$5St2/`0hppWS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0P3 !D0 R  "0 0000 0 0iP1  "b2* 2,20S ,0 0T20S _L YP 2p"S\?"0STT< HP VxP2 L 0"bST 2"TS\?< 0 0<30S 2@#S?d?0`#S\P P  CP 0#S\ 2#Sd??P cP\0 0 p0S $S00pW`@$Sd2?/0?`$0S0\0000p`\ 2R`嵟` 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7囡!"TpW`l嵏X7 0%S 0\000S7囡!pWO-P`@DDT(Xp S W @   G-A0 5 Pq0#R%%r`!00 0SP 1/0a *|at1h10S 0 0U/03Q0S6 #]A 5*< 5r000S r0 0@TP[UGVPt0Up Pd0 0S L P<0 0S ))& `)))  )10/ᄊ)0/ᄊ)0/ᄊ)-@-$@  + B'G-P`pM@0S 喸 0S X|卸 ὸU 2T傸Y0S 90S{M@ r넊)]yt-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  㒶C-@M Mq` @XPݍ Ѝl!rp@P=0LLD@rO?P,0: S0RP0 00?PP"P81: S`P% S  R  rSPPpPPPU rPP @Pꄊ)% )\#@-0P  0 00$Ѝ  +):0@-4S 3/ 넊)@-L0 @(A 0$RLL@)@-L@%ELBLL@P/00@-0@S z@ )]X0QCoS  R7 -S SP 00PP0 0x SS  S R X0X T0TRP0L 0000/TTT8 ))`)d)h)T 8t0 p000 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/x))T8 T 8)p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0EH3H3L3u/L3P3P3T3T39 5h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0 H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5 5d0d00000P5P5H5H5 @ A H5h H5S>S>p@w0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//|)O-4M@T t儤儔儴pqx+l[ :PdP0_ 0 @ @P @Ѝ`\XP0S. 30S30S O ?D0P } P`\2P3#0Sx t#S4l P `0S T/0 CS 4s*0S 0\%R\\5 0C?o""20N`h YT2 0S#P0Pd 4 002 ? D:010S>,A!Ϡ\<# P  0Q ? 0SU0S 0弑h 0S 0p\%R\P d10S%X~PQ- D!0 08! 0 *e 0S g0 0 0@0@XPh`Ġ``IU* 0R A δ꬇)()`)p)mh))))) )8 Tx)|)#)))=)))t)zO-@9*@0MM08x`P IB 呴ލЍ80S L:PI, p{ 0: S T fP@888X04HSP 0)00S  \00 7 7 8   x s8@ mp8 g[WppTpPpT7WL NDP 7@T P  8H8P 00 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p(np2S )CP )CP ).[4PZT-`Y 4[ 0S0A<관X| V.+0G  EC 0,P %Q$ f Q춝C ?XBxP`u 2S<4$040404qX02P#W20AT2@02 Br0GB B 0l BH  ?p0l3& 8 S20#"20#209P` 2Sd#0P\@Q=S00P 5@ ) 2RT0 S @x0S JC 5*< 5j3 30S j0 0@20S 0|3 0 S@ T 10Sd"d2QXk 0De3 @= C ,0"0000t @DO.0 @7'4p0 @S葟0S0S0=S0S p/8000D p 0L%000P%X30,XFq  *+ 10S G0 0t))))))X)Ȇ))) w"))N4k {%LT{ *G`T) r,)Ej ))Q6f]))|))`)))AH)\)Y)})@))))))p)h))l))O)=S%0S& <0 p0P%<<00*X30T0 00S T0 00S5 0 >0S ^PLq 5*N> 0:#: 5+p1s $10S +0 000S(:P0q0* 1S 10S  o0 00<cQdyP 0`r<0*p23 $20S O0 00S0L%r0L%r0H00q" P 000cH00SPFP$s*43 20S 0`# 0 00L40q"  400cL00SPs*330S 0$ 0 0t4pW. 4E ^  \pWR 0SPt*_4T40S _0$ 0 0t0Q,%R0%45S R! lm004E0S|PP*/`5w50S /0% 0 00(0Si xQ$ D0Sx < 0(%0S^,P*6K50S g0<& 0 08%<5HSR$  H00850<S6aP*6|60S 90& 0 0@%D5LSR$ t L00@50DS3Pp*7470S  0' 0 0 7 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*P880S P0) 0 0T PYd P4TQڨ0QXڌ [ 0 0S Py*9e\90S 0) 0 00S3 6 S0S0QQ*P )0 0Sl wP`z*p:3$:0S O0* 0 0 S0S zS0S  tS0S0+ Q^ NQ L bS0SQLd \S0S{v<Q TS0S NS0S HS0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*kp<$<0S k0, 0 0<0S <0S(L*M<<0S M0 ]h << < PRL PM\= 0SP @PL [ ` Bpd娭@PUVʸ= "0PPQP_PP¨.P 6  eB,Pq,>P8) 3@^ S;H.00 0 S 05x>> >Q>pKPW>ppY@>@000PEUP8HLd  BL 0b03"(P P Y) P?0S   l?8 H4L0d P B b"30 S?0S   k0`00p^ P?M@ *6P l0x& 5000h60S 1S P >P @6 86 @)Q$ )V @ 0`P@@  04 8 <%c#!$c4"%S 50S BP 0 0  ``T0  0 0 0 05a(!"4a#Q  &0SgwPh0 $"448#8 S 0SidPj0 $"448#8S t0SjXQPk0 $"448#8V:QQ  /Q R 0Sf4Pg000 4000 Pz c0SdPe 0 40#40ht3Q0S 00 0 0 00  $Q0S 0 0 000  0 Q0S 0  03000 0  0pP0S 0``&d``000  0`pP0S 0@00o0  0 1 1Q1Q,+ 0S 壬A 5< 0 !00!@0|!0pCS #0p R0 !0B88#80WP y`@fa0P[UP0Qc R E/ !0!Y pG  Q괉)$)){))ȉ)p)LBAL ) Ecy*l])X)))())FYE|00S!4!: S  S :C / S : S 0P/@-茇))m1A-0`S lh(<@ 㺫T L10S@10S0(1 10ST00S ޫp@׫= 00CS0ᐼP U 00CS0ᆼ P PYU {YU0 P0  0 0 SNU)O)l)))0B'B'p@-PD0@0`S P 0!Ppة)OO-,1 $1 100 ᪥P`p0 ` 圥P 0P  ` PP&P(* @ ㆥPT00 ZT lX h  [P @@` 00))))ȉ)@)O-P1$M0H Ϡ,"ʼn  pP ` 0 @w >,@$T ƪ 0`P$Ѝ? 00 ?   P 0/& 0 0?QR0 0# Ϡ?90  <Ϫ`0@p 0ƪꐉ))O-pM0P8 0PȀ`0Ϡ," 埝Z 0 Ѝ 0|x垪@Z ЍOU ? 儝P % ? 凪0@`ꐉ)X)#C-P`U@ (1% U P0 PP0 0T2`p܀*0 L@D0T@S   8HLd  B 0b13p@" }0S   0P00`0@T Ѝ萉)OYEZ`)))l) 0S/A-@p d`V F0 fP2Qf00 SR P00@00 0` PЍ))l)p)@-0P@T@T3d pL `l0p `̠V W @ 0 0 0P00@@000 Ѝ@))p@-`P@XMX  = `P @XЍp @-Q |ttH0@S T00S HM000/(P00)\#p@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT)h))\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,TP440S/($0G- DP4 40S0 40S, S0SB 3`3 30S@=S= 4#S*X330S X0D 0W`XSHSDsPUU00Q AP 0S ??@6͟˟P`"\R0"00S7 `r002Db0S) l00S) 0R0E>0*X42910S U0 00SK\P10S wK 1LQ X1*P1 D10S )0 0D10S 8VK $1P 0*000S 0t 000S d0P`\" 0 0Gꄉ))l)p)`)t)))K))|)))ȉ))@)i))~5)x))))O-PPMp80S#C \/ " / Q @aV``  [ΑYP !d \P  ?8 , ? 0 :2r0S0` S` 0!S 3S 0!? 0!0! !0!S`0 0 0` U\/0ϬL3 80S30Ð0C03` 0S300CÀQ"0 0P*00S ` ` `Ѝ kS  ,$0 0C$040S 4 $ P@ P V)H)\)T))h))U o 8)`))A-Pph0``ATR כ@P<M0S @ 91p0A蔉)80 0 1S/ 0S/ᔉ)`0 5 /H0P 3S P 3S P///)^FPO-0(P,0@4p8`N P P0P` 0S 0 S   000 00 00S 0 S L0 v0    p p()))Q 0`( "4`#/O-`@8 0P1 008Q ЍS ph Q 004 0p8pQቐሀ@` R p L 8  P/ 100 P000 L0 0 @-P00` R$    o/ 103/C!000P3/@-\00` R   t   /!  / C! C!/! !/@-l00` RP4   /!  / C! C!/! !/@-Yy0O-$5S[  l@`hT00! t pbR$ B,Y  !$P p  R !U101Q+DP 1PAC0 2 @ό R&@@00Z   T   @U  @ Ѝ ^000 0S0 B0O-pRMP`b @P D@4 mPpߍP(  Mpp&90S <08 (00,0 000040!04 04$0D0(0P }Vphhp 0 7 DSn 8n ,n  }n yn p p Q 7 p 0p?pq8S;Pr 0  *0*0@0d  0* *Ld@edAc{zd@A-PCMMPp`;8 p@P  P0<P?U00 ## CލЍO-PMM@`pPyP0 P: S3/-P 0rS `800P 0#0@0@A@ U  N3P  @P PU =800@23MP@ S @X帰张%P60: S)^0" yP@PT2P X+ S R"P-P U T@\ SP@-\P@ UPXp!t0#ᅲPU0000  k@P  P70SsW A'PPth0 PLPP V80% ܍Ѝ FF F@00S 4 /ጇ)00S0`( "4`#/ጇ)O-pp1`h10P0ɯ 0|* X 03#ˠ121@ R` 0n*0P As00`RQq00S" ;F% 0%3CC(0ZXp000Z X00 <P00薉))0))])1 ) 00S/ꌇ)O-,Mp0`P@ᐱ0V000,Ѝ000/U0$p$00 0t000P$00S [00 ?0$000 0 P00T0SpP8P)p)^F)tOR/bG-P `$ 0p%@V` 0%@`` V`@&!D( `G-@0 4Ppw1 X00000`0 8#8#$48#8X00P a40 "% ?Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@Pp02#U 1!/ `R ` J U c9# S!V Q V3  P! I P` 0 c9# S V!Q V3  P 0 P$` U P `` Ѝ2 0A-1àQ`P |0| ||/0@Sp࠱ P$` p@QL ࠁ PQ e p@-@P0080P 4 PR*SpL0L LS@04 <<W/0C800S   0唔0  ,0S/`0@-0@  Lw@,倔0,0080S 0  -/0@p4)G0+ ,0@-S ,0, ,,/@TP \@Y`> O-dMPpU`@@ %88S0@ @84@D2@D1@DS@D50  0 00P  U0#03?b[[U^Б@D `#0P$0P5Q HO0$0 CD 0XR @Β"!$"!L0<p008p$0 0H(0 0 `,0`4  0 4$.HP $0 *Pd40  000h"P  0᪛, 005RSUSP3S` ,4,$,`UQjV  0p/ 00 D040`FH00C34`80E%DHPQ@0 % 8 ,P0e@P,P|3Q 0Q+ 0CQe 0PS %T$PP@ T@dP P0&T`@V !v/oP` !T@m/0`P`p0?L00T X tPT X\0RP dC?|` 0R3<0<0S@p L0)0 (0 0 P  0( [R 1!<#! P <`Ȑ(0 0#!40(  00Q80080p0ȿ0T`0 S2(0(0S@p 0) 0 P 80Sʼ0 0C800S   0Ւ`嬚O@  = ^$@$dЍ0$04)yLBAWP| a NBAWd 1 t  C G-0,0S0 [-P@J`00qW40S*ᐒЍ!  0Q@P   l@Ppa$ A-`0@c,0Sl0l ll"-Pp}Q L0< H 0P@DT@a>  ? C-`0(Pc,0S0 ,p@PQ |0l x@PEU  0P !  0 P P ЍaO  Q X0sC-Ђ0@ P@` 0 00 0ޙ 0PЍp4)l) X0sC-Ђ0@ P@` 0 00 0Ù 0PЍp4)p) A-0PQ N@`p0P R   T0! 矙@P 8+4P%꼇)8) 4)P!0!O@-,@P,0S 5008)@-,P ,\  D Ѝ8)p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp|)))27@-0S S+,Ô2 R0 ELh `Q tp PCxaQ* Q( H<P 4,B 5*< 50d30a3~210S ~0 00@ @7.Bp#x3 Ŝ & 0P xzXPA 5*< 50d3I01$10S I0 0@ d3S+ CQ+aQ# 0AS"NP S0@a3d3*|0dp00S 0 0@S Ѝ04)4))}!O!!`)))8)!! "O-0p M##$0@` H(0,0,봃 ᵖpPs0S |H0P- $ 00# qp),x:lU tU bU8CpP*,c HJ P@0( 0)  H0S 00040(` 0,#!G0P P V0 XqЍVp, F  p$P `  [$0 pP$0 `P V:P0V 0S 00$$0 &!N Pl2 0 !@ P<  H+0 00$ 0S X(0,  $ 8x+p Pp H+0 00$ 0S X(0,  $ 8[p} X H0X  < X0 Pm//;'&00=0X00C0G-p@P` 0P V  00 000G 00`000O-0` mM$0P@䄟004080 0 ᐕpp40S+ mߍbW AW LW x8V4TcW iW0p8D 4@0 0@4: S@ @0(0D08`,0000400*P  P 0! QT| 8p 0Q= $ 0! $∡匱@P 0V$0 0/S ~<<Y, ``0"<:P0<0$劌`P uP%< l y ဴw <ŎVD <"$*Ἆ 0#$0@0P!Sp `VHɵp 0 n?C0 n?< n/ 40Pp < 0S `0S   B/oQ" R 0S! m0$H 8Hw&Pp`G0$pJ 0$ pC qp:0S ,( PQ S RPQ \T "1;' &,1zd@J1_15v 11H211 2(2O-`Pp,ML$`` >p@)$0S0$020S($00 P W 00 PU 0 0 0!%fT AT PT lh@pT$p@,Ѝp00` 0pP ,) ? 0o 000 00  0 p4 p@0 00`Mqp p V@p@`2;'228&2U2G-Pp`l នp@<P10S<* & p" o0< 9X $$ )mp@- `&W00S $$ )\p@ Y``V @fT rT GX`$$ ( ?p@$ZM;' 3&3B3_3P&{3 @- o/A-@P`pP 4)\ X嚕T  @@唕 0U  A剕 A@o]B'=@- R0ЍpP `@pnP 0 R SR  R $Â!!BRP0 P X. (P/00#01"$#("O-`@V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! 0O-P((@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR 3O !'00O-0P$`᳉@P 0㘹z'0 0 Q P @ Ѝ 励PC-`$4 p咓P`品(@ 0 Q P Ѝ OP404-@-0  Ѝ Ѝ/-@-00@(@ 0 Ѝ@ Ѝ/-@-P 4(偓 屓 9Ѝ Ѝ/]O-MPp`@PЍ ~P P 4S  0HtT0P$ x#Q$VP 0S 4S $ X0P4 S $JSG0!!p`000 0 0  @ 0P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڀ 0`  L0 @0  "vPb 00pP0Sp$3333334\#04O-,MXPp\@P o 2R 4S  0Ị,Ѝ 0@Q Q0 '  PS[  "S 0X000 00 @ 0Pᎊ4S 0S6  00 000 @0 0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3 1  #  0,$0@S4S 0$R  @0 RS 00 0 000000PV P0P 00000 0  P1p>3U\4x444444G-`pMMPĈ@PЍTC^t# E@0$4$ 00;  p+p  ˉ@ph @4$$: S R B.D ۰p4 $4S( ($,40-B. ˰p E0"dR04<($$4,40$tK>؀C 0 : 0  &00E`d$t؀E0  & P0`P 0,4S   0p 0Jp 0p pup{ p 0pps P P 0"I Rp5E*pA_ Z0"455 5d@,5C5d@Z5p5555@-@P 4B BRP 6p 8N4  XЍ@躮Ѝd@6&6p@-@PP PP \ p4PS4 P Pl666A- @pP0TP ` Xp@0 p@@66$$ - Q EAQ0 "(  0T 00 /$4 0T0 / $4 0T0 /O-`P@p M6T%`s P̀PP `00000따 V:Ѝ 1 00 0P0`P1 0 0֐P UP 7YE7B'%7LC$$0A@-P@- t`R@`_ЍpP 1P 4 R 0 JX.;7W7g7O-Pp_o!R0`@|MR(0S00S "R0oU |ЍP P`U 0SIQF (0QSB!RS R9"R S R0A -00S00P0#  7/p  7/p 40  m0$80P P |P w7A-@pP`|P 5/p 4 5/p 4 7C-(00pS4` Ѝ$T@ 0 0 0dPx 00  0 PW0 777O-0 0`P5p@ᜀ圐吠T Ѝ0  0P 0 0S 9p @ 0 X.)(&8A-P@ ` p0 Ŏ@T(&.8O-Pp$M `@Ȁİ0     Q  p0 p `p R0 X p`00P0 { w$ЍYE(& &<8O-M80`Q@<0 00 PЍP P0S* pFaPP  00000 040 0004 p  p#p 04p  C8R8q880s@-ST`@P fo00SP  tЍpX.W7@- iR sR aR p` ,X8p@-P@P (`9Pp 9pX.8p@-@T 40`PP1ppX.8iR@-- 0 aR bR LR( sR% tR@P 0P0S`00p`(k0 9X.9 p@-M`@P`P0 0͵0,u0S o +ЍpYE.9tG-Q@PM Q  ЍA~␀ p$@`P phB~00 0 `PP W69bqQ9 p9O-$M@P`HP 0yP`$ЍpP 0 0 0 $ Y># P0*/Q  p0 0?Y S0STp Y0 p G00 pW 0np $ P 000 00 lP 4  \$  0U,S( 0 P$`4 80up{ Ĕ$'!#, RP P T P R*L0Sg 0p^ L004 0 000 0PL 4$$   4  !4 "4 $?2p6 9999:3:S:00S 0@-@C^M E$<E$$0  0K0 PD0Ѝ0 @x("(!!"`#XT 80  @P8;'h&z;;;;;;;<C<+<0$ 8O-PLM@p4 1嬑嬱D0 0p  0S$ ! R p!LЍfR lRJ  I@1` 0S  P 哌P  #c ރ蠟 ㇁P؀  ЃZ  0ȋ @  Z   ` 0 ` P` pH<l<ф;'qX.&0B'8V<A-p`(P@^P0 p!`P @00 0$0@-@P$0S ~@{O-p`$MHLPPDT   V  \ D@=x` @SR00 Q ^00S P UP 4 0 lT0P 0X0$0sP UP000 P1!!U111S@^P 0yPPJ QPT0 0X0$0 00 @R P TP0 \ 0 0@;0 0ZS @R PP0 V00IP  0 0   0R00 0P0@SP@<4$$Ѝ<U=&<q==<O-4MFTp0X\,! 0 Q0 0 J0 p 0 @0 0 90 ,0dVL 0Sk     R b A  [  ]00[$000(00$ 0S 0(0 0 0S 0H 0S0D 0  T0  0  0 4Q% 0 0$ ( 00 000 0,00`4ЍT0$(p 0(00$ 0 01#$0 R$  0``O-M<pP 8EJ@`MU 0S 0 0 0@   0@`@ `000Sp`.  0  J) 0`VT@ ` T0 P 0@` 0T0 @ `0 00 S0 00 Ѝ ^0  0 W J)` T'U@ ` Q  R0P UpP0 0S 00 0 0 RU Q T0P|  P0 T@ 0000Sp@ `=====><>g>P/0S//P/0S/C- `P R Q  0X0 RU@-@,MP@p`kP<B,Ѝ ( p`P0  4=29@-X@P HHH0Hy@@n>@8P8`@^T R?o??B'?&-=R R R @-@R R/////? Rp@-0@P! R8` RXtttttttttpp B R"S@d dp\0 T pppppp 1 pp@<)@<'O- M0`P@PPЍ0!S R J8P0p (P\4S 0P0$$8P000 8S %Q QP0 4S ڠ0"S1 @0 Z <03/p 8 H0 0($zP  0P 0 0 $ P (, PpU@WEVi@@@<'@<)O-0P`p4M∃,0  p@`30S,`wP 0!  pT AT fT /@4ЍsT0 0,Sp00 00@ 0>qp 4 `0}p0ᴠ0 00$04S 00Q-$2!0  R8 +R.R+ R@d!d0\1R R8 0S4k 0S$1 +10` 0`Ypsps rpo 0oO@@  0g p@@\|EX 8 H0 $0  8 Z$ (, `@;'@&'<'@@|)@\~~AA-@ĔQp Mp  A^PP`|t`RP \PЍpP ,0 P bq7ARAnAG-@`pP& V4 t" Anⴐ崀 ` $$ 0 P ! p" $ppP  H00p$Bn 0 P bqAAG-`@"M℄p ЍG20SP `pPx $R 4ShЍ4SbP R 0d $ RQ  NSPP 4S P P 0Xp 0 0 08  0P ,!?o  0;0 00  0 \pPRP P  V0p 4S 4S  0&;'AABFB22U2yB@-0 0800 0 0 0P S  Ѝ0C-@pM P`" 0 00 00 0 000sS̀@ P0㓔$ p0lS|p@ P0㓄$ p Ѝ@T r@Tpp-G-pP8M(@ 0S  } wP8Ѝ70 060050040030020 0100000.00 ,0 P #00R R 0S T `PP0c# BXPHp-p@-PP@M `8@ @ `  5/V@@Ѝpp-A-`P$@$p0 >~PU@p-$Ip@-`0P$@@$ Up p@p-A-PP` 4  04000 00:#:900 @0<<@0 Лp@p fЍ ớ PXZϛ@@ R0,CpWΊoI2ILIfI|I@-HPU 9V"80xx HP P R2"(|GP  lkP 0`PU  p $ 02#W: (dIPE `PP? [1! BGP4 0!xStx HP) !0xH|x HP "^HP "pXHP #\RHP m0$ 80S lP  U  aHPp1L0T ᆌ3t00ЍфKX.;'&K/KKB'rBHKKK[LLL&L4LCLPL^L2nLxLCLL/P0LLLL/j l:O-@`pZЊЪM zp :0S ЍOk 0FS iSPC>`C$P Y H ЍPP Y00  9PbP `P0$$%[P U `PP `P (0A[Pl UX0 EP $0    Q4 GP 4P0P 4 Pms  0P000000 0S000000S 000$0_P p_0P(0 jPP TxTT&V`P&&V$rPP, 0`qp   R$4=,, 0qp 0`A\4 $GPd 4`BP `P @ aEPS XH [EPM @0 SD00H0 RL0$ 0$} i$4P `$$^$4P`0V <_`P" 8_P Se&._P TjP0#8,0 U`P UL&?  0`qpu p EP2ppro  EP   EP  EP   EP  4 EP  h DP qP DP  8 DP q/  DP r DP 01S 0r/Ss?, ղ Ѱ  DP s/ DPy$$峗$4P(ipPܓ{  U`P  U$$0 ` qpS p0 < FPi <p<P < H< < FPY <,P  DPN  DPH X DPB D< EP $ <|8 GDP2 8 X*0a$ Bp $ BPp$4`  0qp$ ,W$ a  H 8 00\!08 00 $00,`(0 000$040P0 0$00P00T0 X0$$`RqpU$$$4P0 00 00"0H00`L0$4`  0-qp0$$ɖ$4P `фLX.;'Ĩ&LALMK^L'MLxLIMP0LdMLL[/j MMMlMM2nLUNHKKKLLL&L4LCLPL?N:N[NyNN0@-@M P    l  \p< <p 4p$h0Ѝ0N`b'ilb@-SM@P,  0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`pj  f D Sߍi@|bib!ib@-@  T   0`( "4`#Ѝ1p@-0MS1`0`SMj@ A. H013P A!qAxJxP 0`0?oS cP 05P PP(5x0 0A. 00`0P A DAxux0 0A. 00`l0P AX X%A\w000D 0ԥ8wލЍp耗)?)YEbbbbbbs@-;PP zQP s =`@TЍpP  00STV  vw@Ncq0 R ! O-M@ P~p'p # ;`P"  嶺  岺\P+ 1b\P8 \pP %bp\P bp A0P0&h 0R0 0  p"$ APx 0SuhQr @ 喖pgl a0 00! R R R[  0PW p [ \忴X (p@㶴W 0g0S, @ h[P@ `Upd HQ L 40R !+ $ 01Sp0S 3/p\ R 8 X6p \ 0S 1@ `(p ЍN`bcd [cc"c\#mc1cQccA-pZ@P@ZPU Q`P ]q[ P RP@QT Z[P@- BP ЍA-MP pPA@P00p`ЍpP `   0 p !0  B)ci@-@p @A-P`ZpP 00`P@x ?0` u  F& A-P`ZpPc 00`P@:Z ?0` W  F @-( @PD 00 Ѝp@-8M@ (P@P1! ZP# `0 Q0s0S00=`PP"  Z@O$`8Ѝpl e  "`8 PZ`kOVck Ncci0@-@BM M   >p 0S 7  /  0(⚡P(@0S700$0/ 0h (⋡dP(@0S Bލ Ѝ0u@u@icd)dp@-xM`ZPP `P@ VP0P PM`   ,pЍpc9dOci[d@-@M  /   p@oЍi@-M @?P0 x p 0!Q0s0S08 1p`Ѝdk O.diis@-`Pp@ @@?P0 J@Ph喲B_ P@ L㍲@YP 4  mЍpdk Oodddc e7@- P@7p\ \mTWY PH08 DD0<80Y ` Ѝ0O"c#e-ed[c7@- P@pd dD0P7H(Y P80$ 4u Y ` Ѝ0O"c7cc-edp@-M`YP 0P0Ѝp_P@UxFj@Pd 0 D#p<8 P@ PP ~lSm7eLeeei|e@-$MpXPo 00$Ѝ^`j@Pp 0 XpL˱P@ P`@ p$űJljeeie@-Bt Ѝ+YEe0@-M00 0  PJp `i@P㕱 ` @9pp P0 `pR00bS sl0rU ssPxi eef\#s@-@`%PP  (p  ^fr(fp@-Pp@`@@=XPD0D DS^Q P>kpd -eOdd@-8f@-M T@ >P@0@ @d04 0 p kЍ k Pdiof@-M T@=PD0D DDD08 0 p$}kЍ蚹 k Pdi}f0-M $00 P  Ѝi|e@-@8W P,0, ,,$X `#e-ePdc00@ P/a CRWC/A CR=C/@-=00@- M@ 0( 0 p堰 Ѝiep@-` MP@WP ] Ѝp Xm    *]( PW@sL$`ivi 0@-,M@ PG=P0  p,Ѝ0 0R0 s0S 0   0$ \PP  0W@9L$`fk $Pddi@-PM  X@@q 80P0 0 {rЍUYE?+ff @-\ @<P0@0Ѝ  p@@  vjf.P\#@-S@VPP mpPL``P00 00rt0@`Vm`p\ PX0d0X @ @@@@rKmp03/`P 0@p(&@-p0) 0`P/ R/(&0 O- 4M@@!2T0*  D`厐pď+ P(0$!pSڰp D@T PoS@ڀAP`@ p00L\pP` R  P Q R/6 0TS $P\(P  1/P  @0S  4p "SR(0 SdĮ\0 2/P W0 [  lo)hɚ;6eČqhO-MMPp  Y p`$㛮 pP$ 100$0 ̞-p s| )plh fP p Q 4p p8 p# Q p$S賟X@Tx ?X00@0 0Pp@Q 0 0' l,0@4@ڏp 0af0PH0h 04 40,@ˏp ^ 4~ph H0S=I0S:Y`@T 0 3/@: " O렢M0S:00 % p"BpM0S  Jp@ Bp@03/@~ JI1PJ/rpNI!1Q㽭a`"%J` 1 0 d1 |tp 1 `T!1 Do`<#%J`!1 @ t1 x!|1  oP@Tc 03/@ 03/ݍЍBP`bi!iiii~iiii(&ijijjj)ifjxjiiiwo jj rjjkkO-@PpP  p 3T FS@DSPT!lS`P \PPU D1O0S 2oI INmW P.Z  P' ;P! K0S 0 L0S 0M0S 0 N0SO0`S %PPV n $(fIP$kq)B'@-,MP@wpP SP`(  p00S h㣬 H99P00< <嗬0 $剬,ЍcAn)8i(KnYXnun@-P@ܔ0 PunG-@bSPP0 `@ Y㔀pYpcYpPP  Rpp H H@@@f@n Y2n)s@-@{'S@P00ЍpFJN@@@F Yn)n@-@ \8PP0P PPL 0 S@@00 >00Ѝnk Yn)#B'o0@-M@rRPmRP hRPpcRP d0P P P P 4PMp _Ѝ0F pnn)7iPos@-@Ǔhm P LmHPH` P! ,mЍpm@\#]o0n )foO-M`@PK ap pP"(  Z   廌p% (L( px" <@T t8P`ml2P\Ym UR TiЍ0 PG1d@P۪ $@倌p +1mt 0R (mk)l lP ``mtqttt` R#Q\m lmSP8ЍO(eP\ 0P   Q1   l0! RSے ll" l0P R ` V 0P `\p\\cZ`b8i(isooYooƦKnoNu )Z YE0n 4ZoooPp@-P`@^PP V  Q`P ;F`8F 00pJPTp-Fp@-MPP00Ѝ`0 00p0@ 0 P V0P 0 p 0 `P0G-@(P00p( . P1r0`*0PU!V0"R0 b"0_0"SЍH0PS 0 , vp 0 @0@-@P E@ O-`@pP,(0V0S 8aP$P$P 40S 04S 0S(0p(`8P0S$0(PdO-M00q W$000Ѝ`Q Q 00 >6PP0P XU 0bP x,,C,h4@[T /Q@P00 Dz0800@00X5{8 "10#Z0 00o 8 ]@ 0YPpG@T 0CS0 0 xC0X0^ :T 0CS00xC0 xRaDPW@DADP7@D@S 00@D@ TSS0Z`T@bTh lA OP:DU8 @ 0 0 0`0)€ 7p@\?pd eA-X Pp@`P00z=0P 0 p 0 `P0O-P`,Mp@ P 04Y: P X 0  0P` 000   0P0 0 0   :R@p00C⬀0 0p0 P00ݍ@ T0S P0 0 0P0>x ^2sEsi8vsMsI')Vs0@-0Mt @p` `РpPL   Z 0p Š0Ѝ,x^ssisB'sA-@BM`(  XpP 0 P P PP  8 ! ll pz l RblmU#0P 6bp 6S30S |b0`P 6Pp 6SP@30S <b 0P 6>p 3Q? bI0P 60p 2Q8b8 | p 0S0 Qb8 pu p p p 0@ TPpD2Q <tbBߍ10S lb10S ebbb0  `0000pNbPU0``0` Rڬx1000 0:S R HP8,b`p$PQ #bV pWP ,a+bH0S Lb a~ bob`0Q a a8i(ilttit8)ttt) tti8iii#^ utttI'Estttuu0@-@PA+a-)a\#O-`MM@ 4=0P4 lPgE7EPx7U'S 0`@ 0 @`F( 0RtPy['V: 0: 0 : 0:0:0:09*a(@!!0 P n0 /C BRV  0  00=C$0Cɟ"!``F 0^l d9EIcCP S@BA`p80P0 p` `!0@"0$0$0S= `0 P0B'S 0؍Ѝ h(S   BS>C0CH(S  $ȟ"!! CR   ##9C0C"!% 'S>Cǟ>C"" N=C0C00Q0g*S SS<       2SK Sp 0SC R< )SS0C'S񟗶0&(&%%%(&(&(&(&(&(&(&(&(&%(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&%%%%%&&&& &0S 0 th t0`:`0$ 0 B$ @^ R `0&S,p$(`  pW>_ R0 0 ``0S `0S `p000 `00C!唥娀XP0  @ _p` _0S 8WD 04 8 <%S8_0S 0__ ` 0dY)1 (  `pG0p,0l4値Y$( 1p, sgqpW!ևӅ|H_yW-0S\ ( W (( _4I $( P  #P# ß P# q_pl3I#S0S c_0S%  l\_ STV_0S @P_p>Ѝ衳 k f^rw 0 /&/-@-@ M,00(000 P  Ѝ@Ѝ/P00  @@@@0-@-  5W1W ЍЍ/@-@Wm|px 0S/@-)-@-  WWW ЍЍ/-@-  WW ЍЍ/@-h0M0S@ 0  0000 0 p@@Ѝ)x@-@{Hzzp0`|p`xxx@-tMPP2 P0S 0@P 0 0 00 0X̞p LiP@@ ((@,P0P4P8Pp0S @T  Q 0SP 1Bz0S @{ XwtЍ @n @TSS S000 0$0y)xy%yq2yq yy&zy-)z-s@-P`0@00 0 SЍp@Ѝ/0C>SL`!031 0@-Mt 0@P \㯙 QLPP @ (@@ 0P 020Ѝ0&i)Ʀ@-@0P ,\  \9ZB'{O{| P@-d0 !X !T@0 60\ (0000/zzzPh0h@-`  !TD0 60\ ,00 00/zzzP-P040#^4<\$0000/zzzPD0 40#\00Q 00/00zzzPL- 0:# ^4 0Q$0000/zzzPL- 09# ^4 0Q$0000/zzzP 4 <# \,4Q00/00zzzP@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00zz}%}z@- 0 00xYP Ѝx1&A-P☐p`@WЍ P 3MP@ p7@-P@U0  (R Ѝ0aA-0@nS0oSp@ pSP``PPR0nS0oSTPPTPP')@-y0 '[XB'O-MM<(0<,00 0D@00 l0otp0S SH O 00,00 m&T_ qLjp@-@P¨P (c0/Sp/p@/x@- kVTLB'O-`@ Pp(,000 嘐嘰00 Sp0@DTq oP\0 }P< }9 O4X.;'܈KX.؅@-M@A>0 0D@00 l0sp0S SH }O 00,00 S4k qLjp@-@P6P (ג0/Sp.p@.x@-  xSB'ԋO-`0@P(,p娐娠娰0 \Sp00@DT oP0 |PP埒|  LSA+OKX.Ċ;'؅@-MM0An H 0P0 $@\sp s%Sp@-@PħP (e0/Sp.p@.x@- mUS뽍B'O-P@M P0`r"Rp+x2 0S00)0x0& 0 x`1p0 +00*`&0`k spY  uPfPMP9 9P$ GP g@P(P|O|O|O|OO0PC@P@(0L BH`q匁( `L0opq0KSh0  R< (Lh0O T06Q%0 ͎( h0^/P  0PP 00 0,@.0T0@ P *0\ $00X 00P00\0|00x00t0 0p00l00d0PRݍЍp,):p@-@PݣP (~0/Sp*p@*x R R @-a/ᣔ0@-@MP`p 0n000 oPPЍ0P0 0 0o0 xn0P Rs@-`/P0@00 OnP0 SЍp 0`( "4`#/s@-`@P00!  P@d00SP`P @~@| 0SP@Ѝp舙)ڑ(002P0/0@-@CMP( P41010 0000000 0P KI< 8!PDH00Cߍ0Cߍ0@o꠆O-M`p8@@PpЍȠ,̠Č Ƞ,Ƞ D<4$03 00<D h4<408 b0_,\D0(00x0@E 00K@`p PH00@DP@ PD Oꈙ)_]O-M  GP@`pP0ET0<0p0Ѝ 0 3/X0p G0PP 0@ `Q P* 0vOPH D @03/ppPGp0PTP@`P꠆C-MM`p/(  P@1L#Pd8$#4d4# N41eD0@@ 0@00 0|@pOߍPHڀ@Td$ d 4)O-`[ 4MP*@G@P :@P`(4Ѝp p 00t 0 &@P e T(@0D 0 00$00S X0S00000 wpp cP@0Sp!0!D0D00X 0 000  L0b"!4b4#@0@@ 000<0Й) p:)@- :OL렖B'0@-M 00@08 +P   ត뚐Ѝ O-P@M$ 0쐝70p 0@4#400#@0@@ @#Lp3 0BPa g@bPhhhhhhhhhhhhhhhhj0 0%0@0 Vp T㰋" 0 8uP$壋u0  0OP0!`(v(0 S Q  る  uP   w^"! p0OP0 `(L(0 S Q 0  MP     DP  p 0p0W+ ( lp |~ 0S 0DpSH0p0000S0@ @ЍX.B;')X./`؅JOzܗ6@-MMCN@800 0@(00 0kp  0 VM"SM!PM(=<0P( lIM,:0P , TBM0L?MލЍ48M(4MGS`p7@-@P (F0Lo S? 0 嫊 Ѝ0P@-@=:0P@@-@;0P@' @-@ E0S 00S0?  Ѝbp@-@P؟P (y0/Sp&p@&x 0`( "4`#/ p@-"440 @"440 P"440 "440L $(0 $( XXddhhllppttp p@-"440 P"440 @  DD@@HHLLPPTTXX\|`\ `op` pk p@fp@-`@"QUpf@p@-@PƅÅὅpA-P@M4Q->Cᮅ->CBX?X\<\99>ᝅ9>:>Cᘅ?n:>CFᓅ 0? AC>ኅ}C>GᅅmF၅EnF}E~Gy 0X J~X pW  $$((,S>,V}S>GQmFMHHLLPPTTXX\\O-P ! "441!"441 $$((,,0@4p0T`4Vܑ\5 S L5spTԀ0,$ $Q p W ⸫wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUxẄ0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 PlV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00030SUd 0@ `?50"ST0T00  B 0"PSX000Y0.d 0@ `5?먠ʿ 0 0Ϡ,00 01#0  0 ! ?0 00C000 xS p10S  ) dϠ 0@ `Ì0 1! ! NjFJ40A80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30ꤞ)L)U #ťB'ز&O-MM̵p, = 5O_R0ePS yrሢ儒 ?D 0S``/~D? 0?D4PP p؍ߍ52dd 2@ŒD 0L 04;2 0d04 0^0 00@4T@:T @:T @9T @ 9T @8T @8T@@048#8p0?d4`0S7x 000 00p 0 0`  0S 0X  00S ``a ,  0#\0Q?9 4<D 0?0 8 @ (,0PHY (0@Dő, L00 /4;0cnc 0d0H( 0o 0 R 0r `W4 pVc{S< yr /~D!""#0ODD@HL0 ? 0 04^0hl 0@DE0 L 0/4d;0 0 0@$ @` 04 <02yccϠ $$%%9 0d?`hl400&0 # @őDL  0?$+4#Rc$b 0(d 0@ `Ì00 1uز&D))(&8&Ao)L)TO-)MM,0=0?0$8 0bT0[`  b0 RZ QZ" Ϡ  ! 0 0S  BB00P`0/2"0$ 0 ?V`1V`#T0`10F 0I ?B@TP 0ἐ똀  00B1  B[!0`0Y3B 11 0S B!I0B ?e0 `똀 0 B[` S2 B Q 0S sAOr @P`x1 F084<ĔCP`0S84<$-0BPQ,`QɑRB1ȁ@L0 0 0000<20S|0` ?L4 0H4 0 01Bvpt'U\#R2\3PPT``0 S.~H1(\50? A00!#4t x0W0(0#T a2!, A3 31 0  Pꜞ)ܲ&& 4d)p)g@h){&x)Qԧt)&`)l)))^Fo>D)P))X)L)MF0B'ht@B'C)L)T)TH)ز&U 04 P  0H$4  R$ (  B, @%LV.  R*h  <  X ! \ ! E.?.XT+BA.B,-8 HU Pi0 @40K P஻0 ,p B8d i A YZQ0 哻Z 0X R A  pW?΄$t<4Q?D480P@04 0H4(0Āp 2 R 5#< 523儂r0S8q q q 3w 00 d AQ\ a6Pa`$Ph? @4VP`RR 3X008 0,? 0  R0:1P000\P2#00@P` @` 0 0tp00 R00\&hD0 0S7d R? vTP0 dy K  ɺZ⋰ 40Sh 0 #$  岺 0+V. <50S  ; 0=S,30Sڨi0S0 0" ,0 0CÁ!%\^   0 0 0/d A! a,3 1 <&0: H6HH p g^PP04SP0 0R0 S  B S0 8$00,00P0F 0,0Sc p开8嘥ȿ+" < Q \%0R.@(00 @DU`40 @4A|70 @R40 `0```0T0(w 0 ` p7$[0`0 I9pQ80< 帀 P0x0 0Sx0x0t\0\ 0⨁  B`[dڐ HQ   h ` lS2  B±dd 0R%WU0   (0 C00 0 0 R , R` ` I 0$5S  l01` p00090S2d0)ST0T00! !0)SP5bX0`P5`S(0dV먰 R  L(000080` IQ K+H0H $%P+H ;H0-ᴐR㰑 ,  BU 00%0000T0 10X0岁0= LR\ ?0 d 0  B  R\ ?0   00C 0  080 C  C 4400CS T00C@| 0`4 8 0 RT:  $5SdL $`$`(0V<0S ,4 I d,04  0,4 $U 00`  Vj=0S   0帀0 X#` x0\M`} X\># P 0d?། @ `Œ0 1| @=\%R M0SP+n\`/ `ƌ$  $ k0D.`S`0  0$5S  l01` 000>0S/d0.ST0T00! !0.PSX0b``[d먠    y00080@$ 0C400400T#*Q`?0@$00$0l0`0@hppT:S $S0p0S $S00pW`@Pel倐H)eP00@ྷ8p`0x 1pZ90JY!@@el00 @ T: 呵@$\`Q  @080(0  (0d O@ LL lB;  } p0S30S0 000S.;08C 3R3 0ł."\5\S 00 0 d 0/ @ `.3,00  <0000P0S2 0,@0P0 20S ;0S ;20S $  ;00l:h*,8dPL20SD#(B C ,20S3030404040p3pGVW*DyV.PaV.GV0S  |10 PS1\5=S,ot1?^ E?]0 0S 04 B dLĒH 0@ `Ì014 ,$0S0S 04 * d ,04 0Z 04zZ)ݍЍtZ 0  \0Efpp@vS`YTP)Nu YE)D)ز&ѩL)T)8 X)O-pRMP`b y@P Dx@4 PpߍP(  SZpp,0S #3<08 (00,0 000040!04 04$0D0(0P Vphnp 0  DY 8 ,     Zp Zp Wx  Yp 0p?pq8SAjPr 0  *0*0@0je } 0* *Ld@edAc{zd@A-PCMMPp`;8 hp@P  P0<PEXU00 ## CލЍp@-@POP (w0/Spp@xR/sG-P `$ 0pj@V` 0c@`` V`@&!D( `G-@0 4Pp X00000`0 8#8#$48#8X00P a40 "% ?Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX0p0\00``P0 0,:, 0S% P 0 wmS aSMSASB0C0b0C STLLLLDLLLLLSS@U@@sS@ @ @U00 0DT dS$ 09R h"P T 0U8$UQUDT P 0  @@@ X 00 l Pv0S00 0 000 00P4Ѝ`Ú@- ,@ (9I7B':0@- @    O-@0p |Ph`G0 00000B_I0V W `B@ ᴐ)T)P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@p)0P  C @- vco`/᤬Эs@-@PH` 008_+V @ uЍp))s@-PX00S@H0`ă5#040<>+V @ uЍpܢ))) d10 PS/C-PQ@@MPM``@f a 1p P08 0 T:@6S/ D6ۍЍC+ 0 P \ ;0 S a8!#4a4# 0^ P;0T 0+ۍЍܢ)))))G-HB` p-PP$"$bu 0F050( 06# R 0 !Lu0 70C 0 !:u0006&0>06 0  B 00C0( 6V0:`! `Vp 0ᵿ$&0? ୿0(  J 0j00 &$&?ᖿ0`L0V&S %0: S `0d  &ЍGn/< ((o)*NwH&A-Xa00S@FT:p-PP  0 @1AT@T@/ P @C1@1 S  t R#/2106&0/06   B ! ! 00C 00@) O-@PIMD`Uxx? R`$$ t k2+ [S!Qq 0BG 0 콟0 S 0008cS05=0$00ᓊ (00UC(0 ,P(0,   BQ 0 0 $0 pF0L000 60 6< 0(0, p20740<800`U0@l $p(,<0DHH LP\P`PdPEUT 0T0<0Tp5(T0S0r p';PU 7Pf  x0L VR0400$ ' \`$  AŠ ^!p11 0B F0DY0$ATpepeC 0CP!:P`\` :j p+P@0%  s 000d0p080\00<0<@0008#8(02`40 0C8#8,00L00PC0SNLZI0 pS` H!*&A 7 D \5) 0 ( "*R5 6 !"0H& 0 09bjPpD iH&0SS 9 R0?0Lr`pL00f\0.L0 $0S 80S _P $0S <0S@0  0U0f 04 XC,000`0100 p@@|Q(0R'0 @x0S 0S0S00 0  0C##'0ߖ7X p  TPPpuWPp 0R SpG SXP@`8 00S PL0S d0 P" 0D4#S +d E&0# 0H4# 46 K% 0  S60CT 00C0CS\: B >|XW:d刁XS:X 0686(㫱 ! H TB  06 05& (6XS:0TSL0S d0 _P UH40S`V=@` SPTȌ01 210! !0 S30##$0/]$0d$6$[:06 0&l4z.3hF 0V4#0003 3`P0SMVPEPUI h30SA 3V k3@3PUBL0S \08`0h ޮ PP1 P# p38R60`0000oR096 30>Pp`t3q 峮P )3`W C\28R`0000ERf & !?<#  0R *d "} P0 0PPP!k v)`Pw!a (P  6t!hX!PU:< U*!:0U:5+0 ,+0 p(L0S]_UB: =))Ѯ))$Q{L&H&))P&QSNJp))b)zآ)ٰܢ)'MF0B'ht@B'YENu AVԱ:$xҲd&T&Al&3T)))0Q:BS! 0 G6Psd  0P0 S %%* 呐 0p1Pn 1 !=P0 `U&`<1d6T0U/0 <L0S `0  1#'$/%18Qf`0000/Q090& 20P  & :0&`Pl2& 0@0DfS0;+0U8&0#20Hv`pG6c20 HDQIߍVBO-pRMP`b o@P Dxo@4 PpߍP(  Qpp0S )<08 (00,0 000040!04 04$0D0(0P J Vph0p 0  D 8M ,I  E A Pp Pp o V Pp 0p?pq8SaPr 0  *0*0@0,\ {t 0* *Ld@edAc{zd@A-PCMMPp`;8 _p@P  P0<POU00 ## CލЍ@-`p?   @P700S0?0\$ 0S 0 nS\F\GL \ hgL0 SDKT ЍE%KUJ%FZO%A_0  @-P L1DDvP<@i/0Lp  zލЍ@X0@ S@00 |LP p1't 0 @-ad@P!< Lp >NP  'YD0S 1@X : SRQ\7   0PP Pj VPrPE_oR00b =ph00P0U p P  P@D  ~3m`Tb408 0 \04 0 80堻408 QP  80dt@ r00SPD`A|0 S10S10S00S$11011p0 0 100S|0 RS00 R0 R0S / P ; 0@S 00 T @#P U0  |;0qP<;P 1 $11(1000VWT 0`S`Sʔ0S $1S 0S 1S 1S4X0@ 0@w->0  0np^ p`PxC0S L*Mp` p1S?V?`#  *ApT a1S )7pJ Q$1S$A0 48宼$1C0$S X0 0 X0 00*00SR3#*:Q0<0S+ @DY<0T Q!P@ T< l Lp e "B?;;@ DKP?`|  0QX# X X H XP0S l600S P0Sd0h 0P0 @0D00 ,h0S 'd0S ! T*,000S0 X0S010S"  0C 0T 0#Sxܼ0S1`0S S <t$0S $ 0C$00`01P0S1p0 x0Sx010S(1h0S01d0S41,0S /C,0P 0&: :⥱0P 0  Jpl -L0P!* RbR ᯻V000S(dR0 1S01XY$1aP00V`U50!A( Z(Z ,rh(GO0UH0EH00S:Z9( 3`U  ?) 0 S:01SD5 R 41S +,0 00l000 X P00101$S3#SQ4PPQNU  4Q41S 3 #S  RP!RL X P3UP1Q X 1S<11CH0ֻ`VX  0D˻pP(10(00A01 L010t0$10UWP X(: Z8:0C?oQ20S  PPR*? X X ( 02#ᎻL t0 X0#d"d X΃6#0\0:pP<0 01ZPL01 !(003 ($q W 5t:( R"P   (! t  Gt(  ۳ Xha X\abV1t 0A2">Z( 0@R"0P(\0G1( 0t 巳0@Q!0ZW*>ݹ'K _6\#wAI'}أͺ޺mA~һ"wNƼϼ/? |'Q(+YE[89T*&B'JgfffUcRRaArrAaǾϾؾbZl  X0 X00Q*$0 ?oR 20$ \  X0 X00 kQPE0!$1$Q R0QH * 1$01S$0S001 X0,1$00S03$15$1 q5 X@0 0 X(1 p0-^ = C0 D02` PP VhDI =CⰈZ(( L0\2#P0` X00P <0D0001|0$40\0H0#40`000#40d0@0$0 Q  h "    Tp  0t0 3Q0Tx0D0 S 0s0S d0DD00 0hh+00,0S( X04qH#W030#W0 W00S  pR804 lpC0V0S  lGpL T  ~ 0S X41  C/oS" R \0 X 00 @ 000(00H00`00000d00X00010101$00@0 0 (1$00(0,1,0>03M?03)0 01 01100 04T"/@!b$ 04v 08 0#$ #(#< 0h0%:׋p:>x R,0S00t0T 0o0 00 ST ٽ$&?   KGp T]  T R 0 Q  0!R R S 0S60610110P LQS*L CਹQX000| R X  R   0P0 <0B?oQ20S (0 00 25 010P C0024 01000pX@0S9)(00 L02)H0S ,) 1S00 ,%)14X0 )E?0Z0 \)F?0!0G?00$0 )@0S )Z,!()(x0hXQ((4Q( (D0S Q2800S#x 0`( "4`#/A-0 0P@{ <0ի`pTrj 0$eA@00@- 44@4P\P 0B"" X*-@=B'*@-驽 Y)&뼿B'G-@P ` q!>0 P V0 0   PP Gk pP`0+ 0Pf0S 4e0 匼V X*X.azs@-pP@ 0  v8X 0TT^LЍp E P `f80 MX*\#h*@-044JQ   #( Ѝ[#@-$MPp  @ @-1 00@ 0! 0 ())(1 p' 8`'8P'`PDpATV@D:$Ѝ' op@-0A0MP`   0 0 010R  2   $0Ѝp@'R  #   $R ѻ0S 0!$$("( 18#! 0Ѝp@'0ЍpX*"Cdy @-0Epe뀪*P@- 0 R * 0 #  @0x*P `00CS`0p S00 P0S X0X /X(0B'p@-`q@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h啛d哛`0JPp <10C <1$0 810S81X*&B'B'*O-@ ^"44"P40pRPM=p3 204+b!T0 L< aP0? 4  %z00?D+<+&0@-@0 0墦0@0Ѝs@-@P`P @TZ TTJ?0 00?ᇦ+"+R  + A7Ѝp6B'G-2@`VBMy a@0DXBߍpTW B/ C0 S'4tx'xpⲡ w@PQ  L1b",4b4#0 440,10S 0S Q0000 {'{{gW:0000R%*0S 0 0S 0 000R*Q p`0S Hx`X0`S ! T+++B'Znp+p@-<6p@ P(@P0P06p& O-l3P0_MS XXTsTC L0D#Dz0p#' (L L<S"GVuUR 0"z00RS^ 0"z>px"|\'?SX" \x<PPBLL0PS[ : SXH< 0[pP ؠ/0 ᖠ10 0q0?S$ < 8P @ 0 D h  X  `d  \  آ`  @ f`P 0:$8!88 pU/0>+b! L<N`P L c0?0H @L (P$PD 3 P z(P7P|_ߍp+B'+H+`+&<+rBD+/&=% +Rrd[p9;+B'&@- @ 00: S갹+G-@qaP U+ 5P00S j0 S00P R GRڀ00S |p\P Y XçP Y 0:0S $D+\+B'% O-AMM`P@jpP8 0 840 AލЍO/0 009/P) 0`!` qy ⸟PQ D D @P ,zPD {@T pPD q@D `ࠟటT AލЍ  0A. 4B   R ; 0 0 D J@D k`0 Z 0 D kp <+ qB' HC-M Mp p0 /R @`㬐嬀 GPP 0S P@ۍ Ѝ00 D 80`D @P 0V P`% <+p@-0@ @P P @p@-@4@O-3tM0 S ttSp300RS`3 T3T#0PxHC0#S<88tЍO:(U$P -  4 00p`004@ԢԲ?` _0@ W6 ! h`V5VW u! @P p0 l?0@! $a \ ?0@ M&tЍpJ`1P0xSiS@P 00@ 000 0C0X10S 0`S$Y \` )4X)4h0SS    5850S d00X0\ 0`0>0P![c0 8d3p+B'`++H+/&B'D+d+h+4Ugx+R A-M`MP@pP 0p`$d!d^3@P TTJL볪:< 0AۍЍ Q D D< 3`PUQ3O3 Up{ +3p0P 녪  x0S 2p T0TP 8 l8 [E]B'<+d++!Lv@-#P@-L@0#S 0A44#S 0@74궾&&0A-@P` 0 P0: 0tpp ?50@$aH00S$`)#lЍ 0`0V@ 0 0/Z 0` @T`$ r000 0 0($00S0,00S0(0 0S000$0S0400Z@0 1S0 00Zp+B'd+rBB')++++P+VbC-20MS Y܂r 0u- P0 009000Ѝ /PP L ` \ T8`1P = 0   @0@D`P /P $   /1RQ rQR $ 1 RP P0d10 /P X1H ! "D @10S0"(  0 AD@(C@\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t"P  p+B'++ B'L;`++]w++L+ 0`( "4`#/@-@MQ 0 3/00؍/(/ )!Z'7' <0@-0@MT[0Q@X0T L0LP H  Ѝ0@Q@+I+B'0@-P 밹+B'0@-Q 0@T0 R ||k0AS@ fЍH0 DR0P, ( 갾&++B'&m.A-D@p 0 0SP(v ` PWq P+?L0@-  Q0 0P ,0$ Ѝ++YB'@-0xP 00S@%*S` P@` 40P , $  0cЍp++B'0@-0@S 0$P B5/x00SP`P 剝qpH0P@`ᩥ0  0((@4 ЍX++d++B'p@-hPh@4S 0SP LLeH0P00080 4Sp7/++-=++0s@-0@SP  40B3/p00S\0 -pH0P`@U  0((`wЍpX++d++LB'p@-P,@P@p P @p@-X0XP0SpH`@P %P  H@pP+&+B'A-@ 1 a051q0S :p!pPP 00@P@&#PPq  0|whpPܤc P 0Di000A(eP+++L+0B'ф|bV +C-`aM! XL HK F 08! X (A(?08!Q  0"P1/-X, , sX " F 0`  gX 8#`Rp00"0F t Fd00@ LLЍ0+B'+B'h+G+;O-鸳@0EMSP8a  0 @|00T*0 ?o2Q03S L30S @3 T<#<  0S tEߍ0S3 00p0"q0S 0"p! 0 V V V-    0 B B B  0d-h"p+ @20S L0@   0 B B B  0B-"   0 B B B  04-!0S  0ŞP 0 忞P. 0S x>V V V     8!A!p0S       V V V|      x p z     L p+B'\+WYEmp&bq, 0P/00S +&+P0O-dEM940`SM P < 850SppލЍ90 Z O 400RSp 40SppT)9S140404$04렴堤 ? B00  4 S BUPLuZ0 S 0 ᔩgBp)R)  0B.` Ba Y pp pPhES PHH B_ P PhB⬝P u $ R B 5 ѕU $SR O Pu  P_&+t/2 005P 20S )800A,0 S x  l#R QPSÝ\U  /V$   )V  )a#0)90S 3)  0S 810S.0S 3 #W3P) RYPER00PES @!U<1<0 PUJBJBGPEU 0S 14S 04+3P UB-PE+=++`++B'^6+N al  tD&P+\+B'&++b{+YE++O-hChs5 SW0 R_`P44)0SW  0PS9S00P0S 0S 09Q ?oV20SKUNU5E Q5 IY`Vq``\2 RE R; R< 4<820S?,P;  %+l909909 ЍŁ01 )+"+R ! R  t EUY0+5`LlP d8 X $ `e ӟ0S 3 P 00 ?ۘqp V00S x0S 905 ;#;S T%GK+X )l+P+\+B'B'*+At+&p+Xq++@-07M0@SMWPP P P `ۍЍV0S60S /00P 60Si  ""4h42DhD004488<<HHLLDDDxx|]|D9^EDED:^EDE""442""442T0ASwx8wTww8w f Pi PJ wPb|T0Sp40S dd00fc` ] Z!"441SP""44"2"44"2"44"2"44(2=(,:,T7TX4X\1\`.`+ᄞ0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,d⠞20h0005/(0, d20=S" " \" R `LrVCDS@"@ < #3 (  !0!x30=00 1R 00# |# #X0/80\ /`0d 0 %0L0<040h0T! AQxxyyx帿 9-0CS   i R0 R R 0N\ \0Xx0=0- 9!`ET+lT+p+B'k\+&v f B'&>WnC- 2 B P000000 MQqM0S a쑟=聟0=P  RP 0AS^ |@{|z{{=0=`|0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ 0=ۍЍt0 h0P0`0\0S H,@=++T+0++T+RB'+9O-AM0L(0 "S e#r0 (#AC5/0(0#R00 #0Q0У dZ0 (0S  @(C#5/0(0,0S3,0P0?0!#0,0@' f'P Aۍ<ЍP(0S #r(0#͡AC5/0(0#r0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B  0S 8#R00SQ 00S \0l 9P tlx3  P8P0S갵+T+T+&v+\+B' 0 갹+d[@-@0SS갵+ O-@M00@b 040P<00 0 8 0a  0@ c@ H0LP Dp2&`P* ` R  R  R;  R 0 PL RM  R"  R`60S  PPL60S &868PU)-$~%P"؜_ 050S  ^P% R P 0 t% R  ddD PЍ0HU00L%HHV0S50S  $'40S &  PP 0 0 8&~& ^% ^%W0 0040S 0 d J%$ R  8#PU# R D& :  0?%P ? 0x =% =%W 0 0 8"&&\30Sc X \T 0 TI"0#P0 0020S  2PU-20S %$Ps 0 $ $W 0 0 8%%20S 0 $"Pz0 00e $10S 403/ $ $!PPXW00 0AX10S00S 0 0 8{$x$00S 0 0$4\p 03/PU 4   00pP \$갹+B'p+VB'l+d++)&<,\$]|]g$+h+} Md[X+(+|^_3O A-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-;P- !0 010000 QP 0PT 0$M $P ЍPB!0P;C0P|80S050 000 @ 0@0 0갵++T+)+Vv;@-cM0S pp7lClS0S Y_0S#0#0,,) R0.# 2r 5 0500K Pr5"0C590C990C9000Ph|n x0S \2d"`2Q090 9Qd\+++-@-  gw ЍЍ/B'x07@-0@SP p"P 0 <<! Ѝ0000S 0  Ѝ0@d+B'p+B'x0p@-@PT 0"P m 088p,00S  @d+ B'p+1B'p@-@PP` T0:pMP 0S 0@P꘵+p@-@PT0*p5P 0S 0@TP0@-@  0  xh 0 dP0 P80 < 0@ ( +ENW`ek+p@-P@P @0 4 0D !0R3 mp褵+tB'A-Pp` _ x00CS0`@ T 00CS0V P yTnTyDo0 @00  0 0 SB'+-@- T VvL00S @P@0PgЍ@Ѝ/B't+W3R@-p`P0@T$=!P!n0  ЍR0@T@!P Y0 `T@H00S <U8 0 00p@d+B'p+B'@-@   P   P  P  h$P l H\0QX X ( H@0TB'1X@Pbw 0@-@MPPPP8  P$0$ $dЍ0P+@-0@ M \0 00K Ka> ۍp@-0@S g/t0P0Sd!P 0@00ፗ p@044000Sp p@d+&B'p+7B'C-/`b@P p/@D0S Ѝ/SpPP60 8P000@-0@S  0S 0 000h0@0S  P4 @044000S @E\d+&B'p+|B'@-0@S 0 000d0@0S !P @000,00S @d+&B'p+B'@-0@S 0 000ud0@0S Pז^ @000c,00S @Zd+B'p+B'C-0M.S`p4P4A0/SS 90 07U  )  #  %      p  x X  d 00@ <>Ѝh+WYE,4);BKT[b;@->kC-@`PApp P L>0 S000 ЍW00+kp@-BM @P`0E CR V  lP|0FS `0 AS ?P0P S00@$Rn>aBލp+kA-P@`$<0 gpW S>A+k@-dBP K> d 0SP  P/>0EPP `@`PS 001F0S; 0 00d1d00 `V$@1@a0T0 0d Dop+]7p@-P@U U  0<Yz $Rp@sT  kB'yP 7P P / //-M M?  -ڴۍ ЍB'4`00CS`0 X\X0 X /0B'O-pQDMDЍOus@x `pP W200 RR00u0PS00C00@@ Rp@T+ W-Y* U U %   ᰒ  0.| `   ᠒  .0  p W8B'p+Gm \#3<0S/@-@QPM PЍ@ p31Q``X00CSHxxx"l2PЍ@M `!0S S/   Pd0AS& $PhXHA <8407 0SPЍ@G * & "0G1hS fS501 0400030020j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q ( xVPЍ+p]YE !@RO\iw+|U2{:\eO-@`pRP Ѝ0 @P .^[PP ?P;}0+0+0@-@QPM <1a! 4aSaD@ @$0d@Oo@ 1e% 4eeT# ! "Q  R P Q ,>Ѝ0T%< @\%(T h X\%T @ ,\P" $ @\0+;} Q0@-.Pd0 @X!P@QR00 000+0+0s@- @R`  P.ZP ,=0S ,=|Ѝp l0!PU U 0< 4n\Ѝp@Ѝp@&0+;}0+@-@T T 0( (R\ ЍЍ@+Ѝ@0+p@-@"1Q0P Tp@@&  p@0 p@\#KZ.O-\M00@0"0 0(p @@0$@,0@;PP PP 7 @@0;P``U]\Ѝ`P0  FX y RAx   <y0P  byM  4\100 0 S00C00  Q4P p0 <p 08pj0M x`00CS`0 X0@T:\ЍOX0 X @nф0B'&@-00; Ѝ@-0  3 ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝ @-0@ 00 Ѝ?@-& mB'@-@-aAMp@0WP M0dAqXaX!0T[L0P 00 ,Aލ Ѝ`0001!! ?t0A !R  0G@@P㈍9 s9<T0 <t<@D0 H0X0X o0 DDa +)7rB="YEV<++@-}<+0@-6S  + @-B?<x9m/l`B@P" XTzA  <4ŀ,  @? 0+\<+@-_ B'0@-h@  0@ 0\0CS @CI'p@-@Pp00Sp8PU``p840#U:G0X 00rX0X40P80 <0X0p`P -7@- 0@P0 Z0P R*00B0 Ѝ0@Ѝ/O-dM@P ΋P@DU 0 S dЍ`p |0 J0]0 0^`Y!0 Y0  0  .0`  V0BΛP ⏋PdI'iA-@`Pp尀@"!023 U 0 ⟛pp p.5 ╛P@T0S00|P   Ѝ迤v|}YE-,Mt H0 $0@0080000 0(0( $$0 B'-7@-T`P @XT@ R 0@  #j000 Ѝ0@Ѝ/&]+*p@-PP@ Q0S 0CS 3 00pBp@ TT 00 6, ,Up0SpV++3/A- `(p 08pЍ P 4@P  PP 08pЍAt01Sh0 ` 0X2TpT 0` 0S ` FP `X+&0n YEv C-q@1MS0`n1SP1SdV1 묁XV RЍCVR 1S  @1ЍC>V,p0S) S S ⛊X   j ≊X  YVЍCS   u X `F TTA ЍCVЍ+&0n B']bZl C#6,MF4 0Q 000/ +&A-|AJM1MSh_=`pMV0 `P c40`0 7p0S JލЍ;X P0ĉA7J.H0 0A1$HpL  $`0P0p0 P7py Lt0S8m!10 +/G-`Qp1 `S1S@1SHV$1$ 1SV TGV1S G 0=VS0  夠D@d0SVGq1S kQ 1S c <^ GV+&0n B']#6mpC-a0$MSP@D pTp0 cP 1!@ @0 7p!o$ЍJ   0S  0Se0S40SpT 1S!0T0  rq 00 BT !10!sr 000 10 0( )00 0 !+{O-hb0MSP@ἐ opTp> ,p,0  6p[Ѝ  0[ J0S  볉0S@ 0 l6poMpT 1S!1T p 0  T 1!0 00 0   $ ( !00d 0 ,`V0 ,   0$0(0!00d00 ,LV 0  , +<NkC-0P80圐 ,MR/ !!~`TP`,ЍC5`@ @9(0`0$0F( %P&++% L+O-\M`S|P@谟Q% 0rS P @0  0t1000 0 00P    RQ  \ЍS @0 u 0P@L+uA-|P,T 7|P 2|P0p40 *|P0p40 "|P |P0p40 |P  x p | PT   8 804T ( 0S0S { P"T   8 o8 T  k Rр R!P 0:{h{P:TZ 8@80 Ro aBQ*4ttttttDLtttttT\tttdt(lp  `080ikklgj   l p5p3p1w 8  8X  0S d0S 1P00: <00140k0!S0< 2  y 0G0vh9WX) | A 8  8X H 0S .0S R0* 0%0%00140k0!S0404@Tk0Hs4DsT*  8 8X \0S0S ` 0!  k40S0 S01W40Su  kW01Sj4@T 0G?oT20S0G?oT20S0G?oT20W0S| HMW<I 0sWp0;p00H.0P.t&9008`d `@AauP8 B-804@U08080S@00 @ c/4 4 6@ @,5p8 80 @ @0Y @  1=0 ! `0400<0@0,,pQ !105 "04qߍ 1PS 0 } 0tH0c?D`D05p`H +pH0SX Z}H-0A1 Nd! `0 D00@0`q+p !10`100CSd$p$1"h =J@P qߍOdoob4S 044(0 0,0c?0040(00000, 4pm+p;W,qV RT=00D@ q`P0=S "8 R  XcP 0=Sd "8 R `  $UP 0=S X"8 R  qߍO( T V0@40,@p[VD@70S 1SxX*  APP `V-T 4 0( 0(0 0,003Ap06/00 0HS  0,S(` T'&3~ Xqp )~0"S %~ P0 SX0T R $00Sc SW S0G&P00CsL =" +W&  (    [Wߡpn 3  8 k5V h t gc    ! ?      8 S |n   pu &=k3    ,/, >  +0P T0LP0PT0p*pW_u&000&00' T0&P0.T0hP}0Sa@@T T TY0P 000@L K@' 0@0& 000.00<0h 00؂p`@PV\PP P\0p*p WqߍOQP}0S0 0\0n0 00$g00( 0,p0s@-}@P   x l ` T H < ,3B'/J]~t0p@-@PT`w P  p@0p@| l,?R@-M @ P  E% Pۍ\#p@-IMM @`PIލЍp P0 L0 lFhP 0S 0S0 0S  P\#l,@-M @ TPDtۍ00 R   P\#l,H-p3MMT@PPXY` UwP PwP P=04?wP00S` 5 嶻P``V * 嬻Pt2  /` 墻`P_ H2P @wP ,,GPP0 0kU,00P`q$0SW J1!P HJ PP J1!@ HP\10S P 0v0u 0\vPPPUl{WP P 0 VZPoP`ZZE_oR0 ;P  y4S J P t710 `P<a \#?l,I? *JSd t B'2 O-@M M`;@j/p" P@@@ p p0Wp0Y:M0S i@Pm ލ Ѝ0WY@P @p4v0P 0Z 0 pH 0V9 H1Z XP zZ.$ pZP zZ. 20Sa000Z0 0G0V9 0Z +P zZ.p @)0T:ZZP zZ. p$|d0n edAl,Dp@-0`0 0T\PP h0@PT G\P Ѝp@0(PP 2ЍpNu O-lM@ <@40PPd儉lЍB70PD(0  (P$" U   Ta Te Ti;H07W$000 mL04 0S0R0S00 0 0 (0 @` 0 0@T\*7'07  0x7x0t7P0L0!@(0@@,@YM*40S 0tT0[S0Dd   0Xd p  ;P\ p P X(6H06V$01H06V$00SHLUh6P$00H086PV$0*m 0BnS01 0@0S 0< SG,0 P0,00 `?00@?000/S6 0S4801H ?zs L0 EH 0js8 0Dcs005d`p1d 0g 5fD {B^ p4 00pP p840$;X p EX$?4 ;$` p P0 0HL0K00c`pc 0Dg 3f` XHɏ 0s` 0r $0$00SR0勔T0[S0僤&  p4c 0p`Pp p $;Xh p  0[$;`[ p `0X PH 0r `0 r$0 00[ĠP 0r$000$ `,0S0勔T0[S?  paP 0 p` pH 0XP4$; p=  0[04`$;  p/ B%`p =% 0f <1f L0H! D)%`p $% 0|f 0e0 [Hȯ 08r0  00r 0 *rL0| |Ʀ/, --YEaQ-[-9;Y@'A6@Js@-4x {,B'G-䐟`DTp  P9TD PEE$U@X 1sP00@)sP 0-40 P @  3MDPE@D,6 \#p@-P@Q0  0 psP @0S \~#Pp H%0@ 0< 0p R$l#@&1,D,,,,@-+3800S ,0 0$p D c2,1,,@-@L0@3@00S ',0, 0S00'H(2,1,2,\,,C-pQ@AP@pM0a00 M0 'V+ 0=P @0 @0ۍ Ѝ0 000nS% ?S aS@ 0@pS qS @ l0h @<0 P@0 @@1,0B'0M,I' 2,<2,8@P$00S 00S/<2, 2,A-X`0S L00S 08P8@p0Pp000M,2,<2, 2,@-RP@tM  d P RQ ğE R@S% h4` R0Pt@D\ <8    Q(P   CR @ 0S $ Lu 3\ P000ßx^;0S@tЍ R Q$P \P! P 00^`\ 1Np$$ l \ VpH 0P P0 P p00$0[^ ! \^ $^``` 0QD p1A$\% lH` CQw A0Q  $QTO 0Q D R QH ]QK p`1A$`VR lH` CR B0 pp\^ $^'! 0QD p1A$\ lH` CQ A0Q^,^ ]^Lpp ^0?\QQ Qpp,Q ]Q I'I' ,1, , ,1,PA-@@P@T R-@ P`p0SlH d0 J@ P,0< 8@(0@A@&Nu 1,0n zhtD,,0A-@P@p0S0P0`|0 R d R 0L 0S @ !P@`T !,6,P2,@&Rl,P@-, 0 TD,nP@-, 0 HD,p P@-, 0  0S0!C:P 0S0 >PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&04 C:PD,X,L,H,G-1MMP-, 44 1ݍЍP0$Cg:P @4@/ 'PZ30S Scs y5@PQ / 3@cs0S0S PU~X30S5 0P/ L30 003 0; 3 3Q0RQ300?o27&Q20S  2 0P0002@0 0R R00 R P ,2@"000 H 22QT100?o2% Qy10Su 1@P0001@h, r 0PQ0S0P|,P U Q 0S 0S 0P 0! 0 00 00QQ000?o2%Qx00S  `0 0WP00080D, 0M,@ ,1,2,L,82,H,X,<2,2,P,PG-0JMM 00`0 0`S* @1 JލЍS2 0S! 09P 0S0t<PP V0  t1t p1 R0 0S0Q&Zp% 41 @T (1(! 9P'Z@#T0 "s0S @$00 R   R 0D E'l0P05qp %R0@D,P,H,L,H,1,3p,c0 0 0 0\p,h0 0 0 0Rp,rBhC-KM MPT* x2 Kލ ЍP0\"C8P @<2@82000(mP 2 0S@2/. 8P0 `aQq0S 0S 00 3@P -`1@0S p5PH1 \0*P 818!00,1 0H0S XP+ 00 000T   /o" &l0Q00S 0@0P0 00`0@\'D,k0M,p,xH,1,3@ ,1,2,<,H,P,L,rBh<2,c2,@-PAMM ) 0 AލЍ@PP0 ` pF xt0p 0hphp0+r7P60S 0 `XD,1,{p,rBh 0P/.P@-0@O)000 P0D,1,Pp@-@PoU p pQl0l0 4pP `@ P00 P )p1,.0@- 0$2,D,P@-) $0 00S/0D,P2,1,0@- 0)6,D,Pp@-Q !0?o20@0`Q  0S 0 ͑0S P (00p`@tP T0 HP80 5P400 0D,`,1,.Yp2,o#T2,80@- R 0P2,D,0@- H 06,D,@-(@(0 = 00S 0 T2,D,`,0@- - 0<2,D,P00P0SA-$a ](00Ѝ AP0q?oѣ2 PP%3P00\ Q 0S<000P ,7`0T0 0R0D00$\(  , D,X2,6,.1,,42,0@- 0'82,D,0@- 00L2,D,P00P0SA-@ '00PP.p`P 0 `0 S   S  0S00dPL04P < 0?o20D,1,.6,6,fLP00P0@-S ' 0 ЍP  5P 0Pd00}S`00S T0T偐0H}P 40 0, 0( 0D,P2,1,d,<,8,0p@-PP00008@PpTp dp@P p@L'2@ 0S80 0M00?D,6,<,1,P00P0@-S *' L0 ЍP 4 f5P 0 P 0D,d,@-M P ' D1 ЍP0! E5P @1@*P0P`p Z0@P*0@0 S0 0S P P l0 Q0S  L0@ 0P000$0@D,k0M,@ ,2,d,<2,@-P& 0 ЍP 0S t 4P 0S0TP0@P ,0 $ 4PD,$,4d,G-@PpHoᩒ @iP510S1ЍGaZ0a1Z& t1 Ѝp.ZP+Li@PA 0|S@= 7@P 1 T ЍGiP*Z i 0P`0`ZZpʤP0 Z pXK(PPP 0RPa5|0@0 ~P0 0080"%H,1,F<D,фs Ay rBA- MP% 2 ЍPO0S!#4P 0 1CJiP 00|S [7P P 0t6i@h1d@) PP!@4Q0p@-`@P0 p@F$L`LP0S/0S,p@; ?00pD,<,1,TP00P0@-S "$ 0 ЍP | ^2P 0hPL00}SH00S <0<00P 0D,iP2,1,xd,P00P0@-S # 0 ЍP | #2P 0hPL00}SH00S <0<ʌ00P 0D,iP2,1,d,A-MP`+ $@lpET \P+ W+ @ 0 ۍNu \#d,@-P# <0 ЍP $ 1P  D,YE@-Pm# <0 ЍP $ 1P  D, @-PR# p0 ЍP 0S L 1P 0S0,=  }1PD, Pp@-+# <0 p00@PP0 !PpD,P2," - 0@Sp@-# <0 p00@PP0 PpD,P2,; E Pp@-" <0 p00@PP0 PpD,P2,R W oQP@- " $0 00S@+D,2,_ oQP@- " D0 <@0S 0S PD,2,@-H0@-P000P0S " L0 ЍP@ 4 @P@$5^ iD,d p@- M Pz" 1 ЍpP! 0P 0#p`1`e0S@1D0 0S 1(cP)&P0 0S 0@T 0>&`R@P] d@ 50@ 0 @ 0@3/H0T 00S00%D, 1,m   , 2, 4,\,0@- 0 P,D,0@- 0 6,D,PA-PPPPU㈀ !00P@lph0hPڊ00`0 @00BT,0P A8D,L,1, 1, ,7@-PA 0P00岊00 Ѝ0P!0P%0S0P 00/50@0S 0 S  @#5@00+T0 S +< 0 /PD,H, 1, 2,1, , , Pp@-@ 0?o20 0P `!00pPAP 0 00xP0t tS00Pd \M0@&P(0 0P0 D,D2,H2,.1,!a 000 0@-S$00 00 P2,2,4!D,2,000 0@-S$00 00 P2,2,F!D,2,p@-@Pp@0@- 0X!X,D,0@- 0e!T,D,PG-rR@PpZPYTP`Q 1-`PbTJ +-@PP[$$ UL1`H1@W <10S $1$!0   S!  U1`0@W 00S 0 0  S   m$ j$PKP`pgP \bP L]P q Ѝt2,x2,P2,.1,t!|2,2,!e {% @-u0D,P@-V x0 pRP \00}ST00S H0HD@BP 00 0( 0$ 0D,!P2,1,!"d,<,8,P00P0Ss@- # 0 Ѝp0` 0S P@P 0Q R   L 0Ѝp@$Ѝp@D,H,1,3p,!"?"Z"Pp@- $0 p0@P0PpD,P2,"C-P D2m@r0S424͈P80S20S 1忈@0 唀 *0ܑS C"! !    㒃#A P0 U0CQ00CS0F PI00CS0J PA P!-PS0 p` 0~0` Ѝ0 `` V` 0哂" QP 000 UQ00h0PEP00P0 0 Sp(0L{0 0 SD,7,1,"<2,"K,K,;,0B'"#'#P@-00P0S`  )00ЍpPl  f-P 0E)qpP@ 0 $0$U000D,1,P#P@-00P0S@ 00ЍpP | 4-P 0e)qp L0P0`.0) 0,0S 0000D,1,Y#P@- 0 PD,_#d#@- (0@P0 @rB1,l#P00P0A-S쀟 00ЍP  ,P 0"0`P PPP 0RP-Z@*Z@@.p  D 00D,y Nu PG-00P0S  U 0 ЍP  ,P v @P@ 0R@Y`-|0P 00p@ppp`0000 0D0 @?0D,y p,`,P2,hcPA-p 00`@PP P P@K*p0 ` S P@@ @000 (0D,#y #1,#6,6,#A-p`P@Pd0 A\P 400r-4 0 RU A1,#P2, $ A-PP   R ЍAP   R  @0S00Ѝ@`pD,&1,YE $0A-p`P0 AvP@PLp @AuP 00 k00D,1,#)$Pp@-V H0 p@00Sp@000K0$@$P0EPpD,H,1,:$P2,g$0@Sp@-6 `0 pX00Sp@H0H+0<@PP0,#PpD,H,1,l$P2,$$ @Rp@- h0 p` Rp@P0P D@P0P ,Pp D,H,1,$P2,$$ - BR0 R  P R eO-M$M PQ  x3 ٍ$ЍP 0\#C+P HS@p@3`X ,3 ( PP@) 0`t' P0S 20P @B 0S0B(00pK\"l|<"0SP$S \S0P0$ 0""  0 P##00C   BR 0 D)b0 0W@0SPiR 0PS 0 D )b0 W@P$18. 1 R ! R0 R Ȱ &   尰2/ R 0S `0) Pl0 0000wX& 0`SM!D,"K,7,1,7&4,I'2,m  2, P2,2,$2,@-@P I00P C00P=00 -h0lM X00S dH 0d1 P000p (2,2,N&1, ,-lMkT00S cD 0d0 P,00p } 2,h&1, ,A-@)WPp `0 0C0S13  sLP0 S 0C0SL03P  0 0C0S03 Pp@-`P@:.P , 0S1PS !x,p@l,*`))P %.P00 0,S!0R&+(&p@-@P 00PU V 1bPps00p@-`Pp@0P<0 x.0Sp 0h R00 Ѝ0 0S0C B R1"  6,&P/0S/0@-@\0%\#0S P   R   0W7 0C200W70 0C0I'G-pP(Pp @ KPP0   KP 0 0010S&" dqKP0 0 U *** 0 011 k:qЍ/ -P@ )`@-P 0PS 1` P):`-P P)_P [:-PP000S`U& 50S 00S0 @Rđ-0  @P) `n 0S000) 0S S St0 PUu 0`S)H0PU ),P&&&&&6,&02,% ,2,YE - BR0 R  P R AO-0@!M M P<@8@4@@0D@@@JP4` 0p 0S 0S 40S 0S 塦@4m!ݍ Ѝ<P0S ;rW@P DVP 4QP $LP| w0040S 0S 0S崤\0s`0sd0sh0s0Sl0s l:'(>0S0 /wUP+'('=0S 00S01S  0 O( 0 -=0S ^P' 01Shd=d-d )0S No)P$->pN 0 `)00 xWQ /<>0S-@\> pR*` @,0 RXZP<0Q 00|SM `0S@<0?4 gZM \= = 媤K,$Q ;@0S  01RS  S h;+$q 0S 00S M?t 尐0P{ 0Sx n&P^R`@@P@ 0S :TPTMRV :FG@PU  p@p0S01S p0S\ ; 0 $P~$P $A%*Ph  0X!S/1T1P1L10<0p X10L1S 0S TAT# 0S YP  mSu0 0j0S 00S P @0T1%TIYIύS0000!Ra @@$Q(a0000N] 9010a/10apP W^ 0 $PlPl0S(!$e`PTp`HVv  0i_0P0/VP@90S FPPi/K` F  B 00S @ i?/80S00?o 2<$PPp0 PX70S P 0SV%P 0SN% 7 G`WYP@3) '606P 00@T Q \P 00@T Q \P 00PO 4`Mp .FdP<l')P< 60S"@p`V$,!&I\V&& 0( fx"~ l& \"`x6 H5`V M?0H0 %$1 `,!&N40S @qH P4$& p$4Q&&p0耝SPPT4VD@X 40S `5 `` L&U 40S 5 (` r&V m&&p wH40S 4}PCi040P01$ 04PG  (P 00 R 83000@ @p`P@Pr#$@Pp`@"  40bP[; ȐP U2Q00S G[ [ @0P00<P ,P 0*S 0`Q0-S $pQ P0000 /R *R0 0Q@00000S1 0<( ,T*))`2,B)h)d2,d,))фB';)) ,D,%$)%))*N*% X*2,q**** *YE@2,7,K,*4,2,2,  e%PDPZ0 0| 僾 2| PRx Z0"0C?o2? Z"0 "|0A劽}0|0|0 R ;R |UP 0|0|0 R RU 0S;0S(0?"( ,0".x0S ?$0$.U0 P.͡"͡"..R0m0"R0.͡0 T$`P$PPx0Sx0S60S#PP 1$ &@000.R08<0#. 0 x(L HpHL T PZPPT #P V  R70S 70S7P #09x0S PEU0S Lh!1Q!0!PZQ= 0 Q0 F#8 8pŸx U00R0SG PsPq  i$P  TP$ Uc e490Se09 Q `T) Q0d9 SUx9#N8 9R-sr Nc-!0xQ3/Pp9@F"  : R04:P:\I` HdGhFC#0S,: 0R.IN0S 2000S +000S $000S 00tiލЍ0S 03/0S 00Y @p`@Y@p`@s@- P@AP  |AP0P hЍpe`P  iAP 0x FBU 0S S TP 0S  (PA0PP Ѝp@&&&&?/$0@-Mh 00DP P10S 0S00 0 Ѝ? qQa @T0 S 00S 0s $0 :#P 0 S000Br@ T dgSP 0|S [00 0S00 00006,2, \ ,6,`2,ф@-P$M`@ >0000000xpiK0P/S:S T`K@'K   H`& 4p0/0M@P/:M`P 孜@P $Ѝ@</000`0 ?@PV@`00l0@@DcT@@0+0@0CcS1S@%% %'D,PP00/@-W (0@  000W@(2, ,@-W t0@ d00S X0 0Pp <0000S 0W@(2,2,1, ,@-W@`00S T0 0Lp 8 10 10S  kW@2,1, , h0@- X00S L0 0Dp 00 101000(2,2,1, ,0M, -X0lM@ d @580 0p  (2,]/1, ,@-0lM@u0 0 00 0rS sS ld d d XP0 0p {,d $(2,0M, ,d,///1, ,/@-`PP@ @0@s8#80U 0s8#8000@? P VU 0A0T00Ѝp00CS0 S0 S 0 /O-TM|0xp0?W0 h "? $p0pW 0}VP`PV0W B@o@ 0040RD H 8PZ0S= S0Dq0Y 0  @P)hV0S dV0#S `V|0pS H1 R 8aR 0# 5HVtp uTЍ 0 0/`V0 į $PP.V0S *V0#S@DT|0S "P\0Y5#R"0 0 "h2,@B1,O-@BMMU@ Ab^? 0a>0@@0`P5 p`5刵P<:00CS0y0 S(P50S5U <% 00e  50We S00G00S,+ 0S 0 S Z000S800CS0DPP00CS090h `(40 @P00CS0 00 0 s`83 ap0SS 00   00BލЍ@d3@<30S VW@@ c030!430 V S$ " R 5U Q Q$Q V RV"d 00H"0O0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U 0   0ZR[@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/ ,ܖ x D,6,7,P2,6,1,7,7,v6,/\,D,I'2,-A-` @T  0 ЍAЍ/0p0$ P 2xt3 h0h POoB0@S yP 5/7, 0D, ,ܖ (6,_ O-@sFM M`  @R R 0R0$0p30(0$ 0,@-W0P S T啸0 (存 3 @]V0 @,Q(2@@ಟ@aGT  员 2 NV 0 PD0P2d KP x"xd d0S 00S D 0@d W PP dⶶ@0S00?o2 P` R0@6V6 D01@ppp x卶H1pCD0(66S0d00 0d0M( A 0aPS P P  0 00S 0 0OP@ 0 @00@,h 0@Fލ Ѝ,2,+0D,D,P2,** 1,**,D07,rB7,x000O-$GJMMs~0`WXg700S00p  9PX 660 9Pl`60 0 0H097S\4640S# (X6&0S0 0]%Q0*P! R % BR$5Is00E0S P,97S9 59sa00\h%h050 RS0$000(0000  0 PV 4 5X 80000Y4s40܀C XSX t4000C 0h00d0$ 0`0 lT CP $4T!>\ 0h0d<` ((0# $0$c#!$c4"($ <7 $ &R 30 R0S R3""44008'.PT3Xi97S JލЍ000 000S   0pJ8'P\20 0 0D0 0 P pt 087PT̴97Y^ SЁ 0S [R0sO0010S ;7='0:7<0?70>78T0S,0 00 0<0 1, QIP!1 R  P 0 0ZP 0S 0097S0 0S} [[YX  SS000 00.J ,D2,\2,6,,06,2,2,2,6,P2,0D,1,0017,1 ,1H2,0;1b1t11,1 2,2Z2z22@-2Bp`WLM LЍ@i pPk  pe 00011 0S<0 ?!tq( ( 0R0 0SZ=9Q ='/?@#b!"/p8P0S P0#S 0(60 8pp P0S P0#S ӳ p|p 90S0 00 0 0LЍP4]l00D2,\2,6,Mb2 ,220A-Pr@L0 @2T` R ] B P2  Q  ,00EE?AA?1 R$!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 H5@540 ,,0S x t5H40,0p,0IPP0: S 4 4岸4 n0 0,0p4 P4 00S,  P 4 000S!@8\@48@0ST4@z LTP@00S 03000 4 z(c 4 R4$J4R P ů3S6<0s <3`V 30S 20S`2`30SBr, 00CS0~,7pPa U㈂S 00 0 0 0CS,0"p,000q002`001!P l40S 40,3/0,0@00@Y1 R08PTL0 SJ|1#+0 ? 0!$V $P0000@ V,00@ (000@ 0c0 0 0 , 0P$P00 L0#G8h< d,0S 40,3/0Cp2,d,h2,x,T2,P2,1,1,34,,rB ,6,  ф0B'p,)D,\2,;43h d,\#6,44+D4+,`,|2,_4l4@-EM @, 0 0@_$(0,0D@P,D0 , <@@P@;0 0;00Fo<<0S?;0SW 0004 8 + R<00S0 @0#PPKN|p,14S$XzFP $00|S $P/$@@eK0SR aK0 SN $ X): (1RS ,1S $00-S0S : ٶ:$ Ӷ<0S $ Eߍ-0S P: 40sj80sk4JP0000Se,0Si9 9 9T00$0S  T$  T/00P90S J0 S$P$J0 S$P$D 890S<,9Q0SPq@P=<0S!0S' U+80S #(P o 88(l80sSp8  d3Pw00S  <(Pl0a,,0S.P 7 7 R0YeV,1SC$|EP!7,!(0<7 <7 (0xp(0p 0: S 0&0&0\7 R,P7P'PPH$00|S 8$(((0S$ Cl6,! h6 600$ ((0S6$6R P *x6VK6PU 50S 50SP5P50S~ 0CS0<0S 5  (p(AQ$,0%p,0(0q(05P001!6PLI0 SE4R00S 00(3/0(0, ,D0St4 S<Q 0`40S 0 4R qp X%&0$Xp0pw4P@$P{3  0|.kp唬P$\厬<0SC, 00CS0,"ppe WD0Lc0D0 W(s=s 0 @ 0(@ʛP`n T00 0(0㽛Pa( 00CS0(pW P @`( 0@#(0 ? 0!$U0  S0  , 000CS0,p W@0S, (00@ U0,00@ I0 S81(00@- s, 0p (?WD!000hwwe(/, 0pf$P01 0#lӫ@D `dTYi<.00S ,/4$8 (0S 00(3/,p2,d,R@h2,x,T2,cL2,1,6, ,6,  ф3P2,1,34D,\2,% T,4,\#,p,3 B'6,%.3D4rB;+,`,)t2,54.44 /0h1,.5oQP@-X@ L0 Y mP T@ 0  7,D,;5@-@+H0 ٳЍ50 Qp@-P,@P@p᤬P @& - BR0 R  P R 1@-T@0SHP0z0 0R  ),m7g7),@-T@4SHP0]4 0R  ), %7YE-,0P  @-t PU @W p`W VN ^ Q/&O-@p`$MBT oTP $ЍO+T @@@@DT#$Ѝa$1  !Q@   QP $ЍOu 8S 0S P0 0pP  0 P X 0 \00 03/0 00 1&), $8Q77&71($Q!QQ% Q( Q Q QI @-Q Q("^*  ^    0!R/\^^ QQȃ((R ( R (@ ^@ "^  Q(/(R ( R (/),&p@-H0H@8D0 (8080$8P  Up$804,),4M,@-AaM(8S 0 03P@U0P0@ 0)P & 01kP@0 U  S  R8 |#1i 0;#;Z0S;#;0d|."?;#;0 #5;0?;#;0@#5;DE#Y2 @ЀX02|d 0R$080P$0 0 0 )P0X00J"7@0S80d`".@X2 08p Oߍ\ ?\0 C0"`81 08p t0Siv"%+0A!%U[0DEh0V0d!0X~ $y 00 0 0 0 20/1`P)0P  @(`<(80p<P(d0 { ,p,h2,6,T2,, Ch,\#x,Y@^;,QYEe;o;.A|;;1,(;6,;@~:;Lu @-B@B@p@-Bd00` pd00CS01'p ,P P00 @R0S"P8d`Qd00CS0+p "P \Pd00CS0p000S 8A0QPA p0 0 `Vp0 c`Pd00CS0׽p 0@S P,P \Pd00CS0ƽp `V0 0 =Pp@,&;,O-e0mMSmߍp᧭EPdA0S 0P.0͵1 PdP\HPpvP, PU6<pm P@P, 5`9P% . P 0P H I*P0S . P `PH X6*PP0S<p4 P 0P0<PP PPP @P$ H 0P |<P d0p P 0?  | d崼]p P 00S0d0p mP0? p P 0S|20S d僼,0 P P d00CS0pp2pa P QH2L0@>7,I'D,O-쑟Q0AS0`00ԁSp4M Q 1m^`4ЍdPF P0.0lP00X0P" H@~P$,!0O20$A$000 0F@, g<0P 0 8@ P 0$0qp`00P0}S0s00W 0S(@< ^ @6,P2,H,D,1,H>q>7,y>}>7,>>>@-,@02 P ,> ?A-`P㰡`p㬡 L@P  8@P $@㘡Q9?S?m?@-@P<, 0A- 0@0PS0p`0P㬀" 7P 0S 0"S0x R S  p`"R"^ 0 008,6,P2,D,q<,7,p@-MM P  `7PۍЍp@PhΟ4/S0 @ 
P;0@TP/P ?O-@pP`V1@@P`3:'7`E"70P԰ Y/  0/T@1PSZ 0 10S 0 ]0 R >/0S*00 010 Ѝ,1,@-c<P0@0 @p |pP0 0SP0 0P<@Ѝ1,ht@,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C|2,t2,?x2,2,@-0 000'  R Q 0S0000S b0C("( R S L L L L  L L L  L   Ѝ I'I'@-(A`0S0 0 0 0!0p 0S:S50P0S0 0 000 p/0S:S5000h `0PwpT埞00, 0 kp(哞Ѝp6,?6,?@0@G-@\〠pA`^ P \T1:00"^ ^ N W\^ \ @2O-p@t`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V% 0V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&2,фD,4,YE8,<,/A-p`P @P0  T  `00T  -0@ R   `FVx`00CS0  PpTL000`000 0 ST00M@[@0B'm@C-pP`]-@0尐TZ 孥 00@)ax0@P`0 \圥3L00D P 0 Ѝ4,?1,@@0B'@@2,2,O-MMP @ 04`0  T3@`T 1P 8#8T $ 30S- p Q pWp p@90P00E.002 k1P E"9EPt塜ލЍ Jpp0@@T ⑜@ <p@ Tℜ010PS  d 0$ 0/ 0$ %p@Om90$S*F>C0S  HX$ (0Q`$0SZ=9Q =)/?@#b!"/0 0p7G90S C90#S [<90AS  T0 0000 0p 0S #90 9 0 p@@q0T4T kP 9<00* 6,@r@A6,Mb*p@-@Pp@p@-P`L@3P@ 030P@ 0S ۛpu7€ 6A@-@ᄙP IZA@-ozPAA@-@zp 7AP@-)A(P*AA0@-PlMQ@00 00 T  40S P 00 P 0 0B 0 tPIcsPI 30S +@+@@` i X1 -P ^`(P@ 0S  @P@ + 7  P@v+ 6TN T | 2 @0 S7 x彣@P l0@P/T2 P寣 02 P 00 PU C+ 6 P 0 0PU 4+ 6P lЍ兣/m0S h@P@$+ 60S @aP@+ 6T 11@T  0P 0p`V2PP)000]p0 0 0@Q X'P@6,:$6,1,X2,6BD,B0B'@*B4,1,2,K,7,*4,2,2,<,8,7@-P 1 Ѝ0Q0S 1 1P !-0 CRtA R hS0R L1P 0S0,S 0P 0S 10S 0 0@ @%0 @0@0 @0 @0 @  0 00S 0PD,2,D,CB1,tX2,42,6,nB,2,P2,Bp ,,,B,,B,,3O ,,"l,h,@2,00S@-@0M, 5 0P0S8n{@0Ѝ0@82,-A-,,C@-PMP Tt P H00S@0\A PЍ @%PvAC,&CzC@-@804T axAE 㭛,CCD0@-|AT 0S % 0 T &,@07@-LAP/'0P00  Ѝ0&r8 @-@0S S S 0\ \ \R \ @ R0 RA-`@ ?+  嘀?+p  ?+Pt @P@T*\ЍAA01 !QTUQ s00 ۜ&C\#xCG-AMMP`P(%B  l2l h2 c\2 X| 0 0`1` 1PPTۍЍ0@p@ 5| , ۍЍ0i,+E\,3EELEXEp@-P hhA@PpTTPp@8@I=Pn0STP4ЍP,,d,,&nJ;',JR 4,,,O J,JJB'?R~ Ւ&B'7GX.IIII| J ,OJJJ@-Q,@-@M h!+ ]0P0 0D!0@10S + 10S0S@ЍP  100S0@%PW0 000S 0S 00fT0T@0 S090 0Z*8G ,,,,,\# t A-U0S7P@(@P|x!0Pp% /Q4 ~ T⬀`PHeDpM@u0S+ 05  (5@$5 5 5 R- +5 400000@T ,P 4 @Ѝ0400/S@P v v vd\moPio 0S"Q d0S Ձp=0c ́p;0c0S00: ~P|s R  0S \3Q 30S t: hv~PX30S 2Q P t%o2: @[~P 2 : S~P 2l!: K~P 2 : C~P 2 : ;~P t2!: 3~P T2h,!: +~P 42L<r> 04Ѝ0,&@-`0S@ P+(0S 0000q20\ @,TL 7@-0Pl000@h R R  l R  P4Ւ03/ Ѝ0Q P&&,\#p@-,AP1$aS 0SP ݊fA"P00pPP"0P "P0 "P "P0 t pEh0T@T  "  \ p0&,?RՒq? ~ bLB'&,00@-18C8S 0P ע㱐& ,@-(0(@ 0@ ,h,,p@-`BM P@0 S0`018C8ST01y0 0Pn00x0 ɯBߍpB/ BR 0ܯ00P y0001,& ,, 0?o2 0/&H-AMM&&r& &00000P00豟a0  ᧯Pڶ0  囯P 0SS WS BSp0 +∯@P  Rq&0S o|1P0S0Y J18C8S Ԡ0S R@     |PY 0@^ST00CS00  S00 P0S,PW ,h,&, ,p@-PH@P@p!P P !P @&10/@-钯o/A-@PP" p00CS"H\ \ \ \ \ \ \ \ `V S!PPHP0 P00TA25 0S P0000 !0S0R 00 /M>M< `00CS`0p SX0X /X20B'p@-XAP00C!S`B0000CS1] ] T^ <^ T^ T^ T^ t^ 0 "S 0S!Ő0 0P0 P000 \子0"Sp0H0p@4,墐0 0P0 $,\#pKMC 0R R,R /0 N@T 0N@T'!0N\!n x^   RC  R RR @-\R0 ^R^@N CSMG-@w P2 pqp =`P`PP2 00PF 0P : V @P 3@0S@0S5400@= PP?MP PPP P  0!SPe ^M> $,C&A-@MPP\1  娐@P `p崀  iPBu00u0ۍ0 P 0@ 0000S ᵏ  `P00 Z&uM,Mp@-`@6PP 0 &:Pp$PE@p> s@-@P`@T偏Ѝp  廮 R 崮 x尮(R( d#0PP O<P K(P ,f@hNdNxt yt (,0@-@M@#0(@,0 0 @P #Ѝ00,x0 PPP~P0S #00@SPd (,&,@-  (,N(,@-@ F  @mkP e 匬0P3P xth " XyI 姬Ѝ,xt yt NNNNf@O0@-4MP3P4Ѝ01<18C8S 導A 0 9 0 D><O4M0 6,0E R + '8P 41PP 0(0S"=Rn00ESxg g g g g g pbd``\XT HSK& O,B'OCO O(,N p &O1O@OMO@-0 ܫ@2,C-@-傈0 R   ЍЍ/T,-@-ro-@-ph0 R   ЍЍ/T,A-ARp`P@1T ᡫpPS`@DO-dMP@ P㻃0P0 0 !8,@(P@  p P @ `804 ,0S[  R>,0SUXM HG P00P,0o0,00娂0000Uj Pk k k k k l ?@d W00 S @. @ C< 0ЍC50&QQQQQB'ɺ p@-MiP! 0: S0 0 S P@` 000vЍp ˨p P @TPT0dHS 8$    GT,QRRO-0]M-SP M0S 4P ]ލ ЍOv/z]ލ Ѝ@p㤄P$ 00S0W0S 0S\` ⊀pP@  @pp0: S  SГQ [PP Yu gW ]ލ ЍO詂ǩP ZtE0v: S+$ `P@`P  P p  0000 00E 0S0S`-P`b`vD`0S 0 *P V P z{ R(yRwǧpPS >Px!1Z[ d 0ŧZUᨧp`4 0S!P0!0v0 P: v?b  0S -v⇧pPv.+P-Wጧ 0S!ᇧp<qT,&Ʀ2RARnSSRROaR RRRRRS0n RS0B'0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@ !P _HP00S D00S  40 .H"QZᚇh,--,&@-.J@-*Pp@-P@~p 000/,p@-@P0-S@@p 'IP0Tpp0p@-0@S`@MP0@  'P@ЍpPU PG _0P0&,w @-@P @b300S@,p@-@PPp00Spp@\,A- `pP@P000 PP0 0E YE@-@P P0P00S@l ,A-P`MaqX> 0S; )]P2 @@?T/   `00@ C I @ rH00 *S 0 000?0P?TZP10GoG>P ! `Ѝ躑d 0@-0S P 0S0P0x/P  0S00P3 0 -R  UR +R  8> Q>|0:S >t0@cS .S bS S@0,S@pS wS 8O 4 O 3IwP Q@PM@PI@P@0 0  @R0wBRP=RP 8RP3RP hP ]YE- --$-ʓ,!,x&P-5CT-I'  0/, @- 01SP0t  Qhhs`R @ !P0< 0OQ 0T! W,m MX-Q 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aR R S R0/0 R /!0 R0S //@- @P  P #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* @!A-!@RQp0p0!? Q0*=#=p00 !f?0Q 0*--p 0!? QP *!p `!\q?`p`ĕ @?@@,0p@-P@P QT4@pTT@DQ`V D@T0t0S :@,@-l@PXPHP <00S,PH-@-|&p.-&@-l@PXPHP <00S,PH-8-&p.-& Q 0/,P7@-uq Ѝ0P@LP @ $GP 0ll 0`T! _PP <0X!$0T(00PMx-Q,@-,@8P3P0-&00P0bA @SP//D%A-RPp `@X@@Ѝ`BP@`@P,  PP@@-A-P` @P  ppPd P@P  4@>sT  Aɘؘ٘p@-Pl@P T* PpD% Ppp@U p@PpфV O-MM`p 0@P P0: SX{rX  TP  |@P> 6ލЍ R R R00  P P@  P @P  PP 0"SU T 0S0C0 6/ bTP 0mS P &,t&%P P / * -s@-P@` )0 00 BЍpA-@Pp4` R 0S {p@2@-P`( @p0` G Ѝ-@-`@ (8R808Ѝ 8 0 CS  8 0C 8--p@-PQ@`0 0S S 0U P 0U zVpP0S l` z$0SpD8 zp@  p@zRpt&%2 $0 (((( 80( /-t& 0( (( 0( /-t&C-@㸀`p0S Ѝ @uP0S0S P 0 ( ((088 PP00,-7@-D@P@@00S Ѝ0 >P-s@-PP@X:`8 R8 R8SЍp 0 80 S088 8 0 8 00S088-(,0p@-AM0 08S.0 0S R(0 (SP8`000 0C?URX B(0 8 80C 8 0 CS Ѝp 0P-(,@-P@`8000 00C?UR 0 R00C8HgЍp j 0P 0c0S 00-(,7@-@8 R 0Q0 (P 00R0 8 80 89880S  Ѝ00CR80S .0S#808-(,p@-p@XU M8PE`V` D0( p8Soppp-t&(080S @-/-p@-D@0S PX( 8P 0( pp-t&p@-|P`@l0 R(0p0CR0R: $0( hp00-t&7@-@@P@P  AP Ѝ00P$ /-0S/0G-0PS`p@U!@0 00pP@@@ X P00pp @ P00--P R/@-@-4@$P(0,0P  $8 -t&O-878G0PS`M(X. (R008(X8" 0S0S kP0S08R00(XʠyP +PЍ08$08XU08~PXP(ЍO$8S$ &0 S PpP0@S   , t < 8  $ eP 048048rPP0480488080 S_]0488S0S S 8S0S S 048804880S} <048x048k0480P48k0488S 0S S8S`0S S]RP8SW0S SS048g04880 S_80 S CY80=08:0$48X_3X3`( DR( B( ( WH`X  xP`pR \lH80S 48PS8P n088H80 Zt2"8Q WD 0\48 D(<8RqDPp4@AP 0480 QZ`Z ` 1弁4 50 0 0 K Z@ iS0S `0 >Pl jPi PPf 00{PP BiU 0EcSh D  8 ,   x (  h t |  p @ H  p \ ` H l , H < t l  8 0 p @ 0pF.V WppVdP ePO`> 0Spc 0SP0@_V0 ,0Sm V V000#=V00S pL W P+V@  V !VQ00-VQ00  @0#0pP P 0 a0CS00 0p.P  ; 000P 0Sa0@S @MP{000S WXP 8 1i,00@0S 0p) d-]6P 0Sy.P +a0FS000 +P +0 /0S7PVV0FS񟗘  x  d z 2*V @V !Vy|70Ss07S|0W90k 70Sf07Sc {07S^ p0#P'/10@Sp @ph07SyF P 0S S60S `PP p0S860Sp#0CSP  <P 0 0eP0 S &0!R0*?0h50S  eP0 S %0!R0*?0M !R0 0!ıAP50S!R0j !R0 0!ı. + 4% 4!R0 0!ı40S!R0B!R0 0!ı !R0h*?0840S 40S !P0 S 030S x0 S 0 - |v 8f!SR0p0 !00pV0S0 !0<00 eSd0C0<0S 0d !0<0<J9P02P0'+)0S 0!ı2 y400r6l20S0S @ p2 D 1 H 1 P 1000!R0 0!ı|100p10 00!R0 0!ı6 0< P0000!R0 0!ı!m P P<0y -x,2--&04.-.---\#p.----- +&Fфf,ȚYEޙٚ0.-,y -t,9&D PA -.-(, -Nu `.-800S  \00SpRPP3 P B/  0b12 !5}?P8!R0 0!ıP& +P P !R0110[?P!R0 0!ıP !R0110!R0 0!ı?PP$ MwP>qp L2 !R0 0!ı?PP!R0 0!ıP 2PPrP 0P0,P>`(P 00,00  L@30SWDUhX# R0  `P V V ?U!0> `Pu V Vr !0 `Pe V Vb "^H40S %\`PQ V V.`!0PJ$% (`*0 !R04 0S40գ?0/0 $0 S00C0 $5 !R085 0SH50գ?0/0 `%00 x5 50iS 70 xP50S080/00S/,p@-@P/!pO-S`PpM`=`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  080 0S00P0S 1 0BS0 Q 0R RR R0S 0T@180 *0P R* 0/P0   80 eP e [0J0C,0   /G-pȀWY+p S@0bPPP @ ZPPE0S`0S P B0" 0R R@0`LG-@P `pM@U00C  RT0Ѝ ` ?>P ?0 ?=P@p@-@R `P b0P@@@@ P 0p7@-P@Pe0;SP0;S0@?@T AT `00SBC Ѝ0D00SCB0mS$00P#  0 --, -A-@P`pTF  p\@Q=QQP gP3 @P% @@@T AT T e00SBC00SCB0!@00CQ# 0 DP|dP fPdP Q gR  R R0  0S0 E0 i--, -@- @ @, - @-4P@&,, -N @-'P@,0 -nG-P2@T @ЍPP P0`@apP 0@qp(c Ὲ׈?V Y c0I0 P 0S0MS0+S0GS 0US 0US 0UES0UnS0UdS`X0F`p 0 @vT cT eT G@P 0U~ x@T@ 9@P 0Uc  +@P 0U P+t,8 -p@-p@`PP9<@,5<0IV@ ``.<D mP `+p, - 0 , - 0 , -7@-dP@ PP 0S  P Ѝ0, -Po/@- (+ Ѝ\#A-`QpP P P@P%U0P 0 P l @3bT @P 6/P"bЛ@-~|0p p0h hhP 0X X@0L L8P0@4 4 &&`   (7@JPC-<1M0SI ,10SE 10S@ P` p EPUiP@ Pe@ЍP@ 0@Sd@ 0DSd@ Td@ 0DSd@dT`P PEU@,,,G-@`M0PSS00/ @ R S"\R" :R R DZ Pp &kP 0H3/0S@00Ѝ0TP/@-׏p ' *IaЍ00S @  d*\0PT T ' 8dqp e\#--lO-@M`_PGPPPpᤠ夰0F R ЍWpV R  0j0Pp@ U  PPUP@QpP RpP&&p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`G PPp:@pUp@: 0@-M >+ srp@  7 PP  ! 000Ѝ0, -400S/@-$@P P@--,@-@P  ,P/ @- p@m''0@-M@'P00S@l)PaP DP OP AP _)dP oPi|0t00SЍ0 Ʌ0LP 00qp҅00@(,ݜ&_O-,M0S p0S 0@S R P 4W e[ @y P 00} P``P\P# LP  P`` 0S PPP40SWPT PQ ((@z(#`P3P00P0P0 tP0P0 ;P X W( _0 cЍ$P& 20SP PP   @( YP PY |2 ppd T2 lD2p@20WF0R,2P 0S 9P (,P# " 1P [G1&0S w)|/ 1X P DP Pd1 _L10S J^ 010 (0 {qp 000Sp 0 i;P % 0 R  [ R 0h 0P: l X +,,+tф8.- -\#,,/---|,,, -&--,<-&ݝP@- 0@,00@-P `'@ -фA-P`XpVePU@JTfkP0,<- 0 ,@-P@ @0 , 0 , 0 ,p@-P@-@P Pp@6pp@-@`$P)PpVU p@ Pp PpA-@Q`Pp m^ ^U|G-@@` P̠ @PUЍp pP]70OP ]4p0Sj!,@-W0@0S @z,0 R/%R%Q0 sQ0/@-(@0SP00 --G-`d3d@p00CS0 )vp PP 000 P U 0D IS   [o]p@P@- 0PIc2A-@0 0pR`@0S00 R0S@00s`P0S U  fP@00&&O-MpZG`@ P1!Q[ Z@IP[@P* 00p00 0ЍPP P I PT0T VP>P  {ZP00pWp&&X@-@LpgPPP Ѝ@P@@@Z`H0H 0P0\ 9@\ Ѝr8 A-P@Ѝ0S `pPPP[[@P D00< 0`uW %P\4% @-@@ G-p@`P@ 0S P@0S0# CV* UR@ R %S #SP z@# C V* WR   R %S #S 0P YZ@,,C-EMP$PEߍ@ 0@qp `,᥁Pڬ嬐P ` P:T0S EP @  0pSO`P  P@,<.-A-dX1@0SGf @1RpP? ,?Z 1P````PQ0p000 0`00[밀P@pW \p[W P0S[Ѝ \[@t,фh_&&qˏ0A-0S@`@P0L Q@pb`PY[@V[T[t,@-@@QP ,LP Goф+t@-M@P Pۍ@ ۍ1G-0S@Ѝ10SPp0P  @|QB -Q@ ` P AP <#`*P'PP 0 Z ` ZV X P uX%XpP TX@@P@T 000h0e@`@P@:0SZ@ .-t,фt0A-`V8@PP0 PЍA]#f`cpP@@@@P0 pgxZvZ@qZT ЍAЍt,Þ͞-M _P  @oЍ0@-@P0MSP @W?X =P @Ѝ0@T@0: S d*@W8.-&&@-M@>P͡0 00Ѝ0@-M0P@| Ph0 R\P0 R\ tu p0St00Ѝ0, - -/r8@-@P P0@/R@-@ (0@0T#0@ --@-\ 40 R\00S@5@& -.-h00S /pp@-qp #qpP@ TUpp,@-P#P03#0 R/   -O-a$M0S@Pp0S\0SP@|P@q@100CS}$ЍPp@ 0Si#P{u00 y @0 00R  0唐唀00 000 0 0000 000P0 0000Ge P ----(,,T, -O-M000 00 (@P*ЍT <ЍOm O-@P4M(0X0 ,0ut@ P4Ѝ40SW400 ?QJ)(@PP8400 0p P9   s[0. Kxp` P P@Ps3v Vy `SV@P,0S2 h3pW2 p@P5(H300X30G 0$ `P R $0 S S4 P P `[Ɵ`V:P `T@_P[ p20S  P0 (0 S .  %PL20S 0 @ 10S [A; P Pb p 4ЍO V P0n 0PA R L10 Pp``@P,1` p!pW 0 0@P_ V V@P P P P P@Put 0 0@P_p~4 0S V V0 0 0S @P `0 --\ -,,<-(.- -.-.-\.-d.-7@-P@MP ,0 R  000 Ѝ0 -O-` !0CP0@ S 0 ST# 0 Q$DpkC P< : : ; : : : ; : < eS  100C000@PT SQ  p 0  p@@p0@@t 00 0@l@p@`@p@T@pQ 0xS QSDSp P1So BS0< C^R`! 00 0K0S@@@pR C&R= X< X< = X< X< = X< X< X< X< X< X< X< X< X< = X< H= > X< X< = = X< X< = X< X< X< X< X< = X< = = X< X< = 0@@ 0000 0000 0LS 0 0 000 0000 0 0 `պ0000 R      R + - - &U C-=YEO-`PAM@MD`pԕUp!`&*(p"*0,p<00*pQp xlPduQ \BYpPL!0 0 0IZP0  BZP  ;ZP ,00 (2PhAލЍ 'ZPg ZPY0`=V+ !V( <V 0F^S0`͕ 0͕0($4 I>V =R+` =R-`5 0 S =R<V +V -V !V0 S 0=V C/o" R  R 0R  0R  0RP ` 0 S+#Sp 0R\S 000SD 0`SL =PV*0P+S_)`0P0&<Ÿ<30 R R R000#=R00S000=S 밡就'0000 S0`S $ 0 Q 0 0 0Pqd`0lP0`0\0S w0P~ }rL7(& -&ф0B',2;YEb$'$0 RP  / -0 14/ -0 Q/P/&@-H04 ,    00x,p,,l,G-P㌐剀M@MPT`ppP NT N  !  N N @`匀 -A-8p@0PS` 0P0aP -@-@$ 0 @z -P 0 R   /--p00S/p@-`@m嬶PPPpP 0S8@pPp  <.- -W@-@P00Pl0 0  ;D0'<'8'4'0'00豣 -y£ӣl -x - - - -P/0/ -p@-0P@0PP0 S 0.PPPPPPPPPQQPQ'L'H'''Pp P 0Q000 -l -x - -C-霁P0@SpM`2p`pp1 00!0Sj0@ 0 { @P a00CS8 `PU8 0 Ѝ 0P     U  R Q   R l@S `P 0R  {PwPH.-.----- -&&--,0P$0 00S000/.---H.---p@-L@P`0S0000p01S 0'P -Pp@-`0 p@X10S P@@p(1@0PSP5P/`P0@@S  1CP0 1C%@mP 0Sf000|  0p  0d  0@@Pw 1CP , -|,t,,h,O-dC0M0dwvP1S4& 1S7  0C# RpY( Q 000 00P20S P P1S  000 0ap1U 0S P 0 S1C10610S6X@ 1R.sr0nS `0 0`Sx& L`0FY$ 1R%Ѝ  ` 0hP 0 }0IP0 0Yʼ U % 0R 0Q|` @ 谄P1U PExP  0 --- -<.-l -(,--A-p00PS` HP ` P B80@0@D@ 0@0TЍ<.- -(,p@-P@r 02PpA-`p@@PGE$1S 0P $@@ -7@-T6k.sq 00P6 ^C06PU p>uPCP0PPЁ  G3P X&-,0.-@-P ,0 0R  ,pl0@-0`  ^ @^TSa04S '005S #,X&-0@- @P0QA 6R 00X&-G-npP@P P`PB`Bp6W @X&-00S/G- M`pjK@吠吐qpp6W @ Ѝ 0 4 PU4P P 0 PGK--X&-ф@-000mS Ѝ 0 Q0 >@P 0 S# } PPP0`0 S 7 Q0 R pV`PPp xBp00,17@-PU0P( P@ P0 Ѝ000S@PP CBhP000D ;0Ѝ,0P 9vф----P @P/t 0 /Ҩ,P/00Suo--0/@-@0S--0/@-,@0S0 0N00Ѝ--0/@-,@0S0 0<00Ѝ--0/400S/(00S/@-qp@--,P@- 00@ ^S00S00 Ѝ0  p&?p@-P0M % @!`P@@0,S  T0S 0 ,R 0p 0D0SX 0Ѝp40@0000$  @----Yq2P@-P A) ЍRS,DSSS C1 CR9 0Ce C Rꬊ Ċ ̊ E CS -S0S1rSdSWS ^S wS     0v0  E000 0 FK N R WR Q S-00 0  --é800S ,00S 0P//,.-----$0P/0 0 0C/4.-,--@-PU  @ Ѝp`@PppQ 00S0\Q0S 0S@V VP 00$Q00֩--@-0 S 0*( (  Ѝ * @--@-@ b>j--P/0S/P 0  //* oP /@-y 躤 0LP/@-- 0@-L   Ѝ@--֩@-`MP@0-S0p00Cp S T 00ЍU TP PTU $PT00W`O-P$M cLP 00S S03/0L0$ЍcL0 @P``s 0 R @@-PM >$P P # 0@03@  ZMRaDY@Tb0SV+P0P0<0 P 0+S%P A<;<9P/Pz@0nP0Sn@z@-P00 0+P0P0PVB aIY   0 0 @ =RP    B  dj000000 CR 0     h 0U?o 200S 3/PV U Y RR00SL@30 S 0\P%00S @----,`6@-@PM @PUp`0@ j[ЍU  _  B U R  F 00 CR ꈔ Ĕ L 4 U0S U3/U@pr 0 W`00SXSX 00S000JU= U U 0?o20 0U. U U V `Q``Q`V  `R``R`0ESU U U / 0S0 0 hiPS Ud 0  @0 ^000W UȪת^: -s@-P`@&000C S0 ` 0 B ^ ST00ЍpT00V (`S 00 000S/P/h.---@-X4P H0H@ 0S0S  0  03/$@y--& 80S/S/ 0CS/$&O-@0MHa  R S? 0S 00 ЍpW/$` 0 堸PP 0 AAQ-P $ UQ@0  U l@@Oo0 B Rp 0 0S X 0&@-PyP0誽|&/@-0M<20S0宎P 2     |_1 0S@ 10@@0Ѝ0! R0; "$01 S 10S 10Sx1 X11S'  f_2 L!2 R@ 1 10P ! R  R @000<_0 @000S T0 0S T \0!P P 1 10S 10St {0#Sp @.-.-<<-,<-P -.-|&,p&--@-&.-@- l9 Ѝ@-P^:`@@@p0 `8 Ѝ@-@:P  :躽/-G- @$p`P 0A(S%0 6 @@@0^03# @- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-< 2?A3c/ ( 0 0 ^ЍMb@B40@-0@@T b^P  0 &/- -@-@0@&0$R/ $2/-p@-uPi xC 00#  dPP P(Ѝ8s0S ,30S 0S(0S 0(0u0(0Pp* W0[Yqp0zR0@3r00 ,PtBt 00 0(0d0S 0S E020SW@ 2@@DX0 0 p0Wq!|s!@TJ0SIW1@0@T00|s D0p@qp m00S 00S rW 00000  0 0`+PP─ 0S 00SJ UHUE qp QP 0S 00SP0 ;-A"--.-|.-,0.-`@-($ 00000S@ ,<-.-@-($ 00000S@< ,<-.-㳨@-8, 000O00S@ ,<-.-@-@P x0x0SdP@ t,< 1A-@TPP1 \ӬթQO}ǩ  0@ `Pp0S0S 0d 0?00 80 ,00SA.,<-< -(,,,.-G-pl0P`  @ f3P 0S 0S S0<-A-` pP-@ù''0Up0P ᴹ'p@-HP@T 80   p 0 f)d)b)&0<-O-(RAMM1`R)V Ap  P A0S0 000AލЍ0!S  2PA>04S S S0n0S  0 [Q0\0S 0  C.  Q? 0   ^R000 Q\ S$R 0C0 O0P0000\\   0C R 0 C&0<-O-pQpPpMW M ۍ Ѝ@pcPGTp\3\C  TTDs a PY PU@ 3T *Wp5P@DT2jPǸ@ ĸ @@# 0 )X |(| V@ v(T@"0S 000➸P ;04P ST@ ]2 Pp 0Q 1T VP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S ]PY? S0p0000.0<-&0B',<-I'r0@-@ٿPҿP |ͿP lȿP \ÿP [MPmM&ф@-@P ?P P P(@^꥾˾O-1M0SY A0 ЍO5`<10H0 0p `xw+@PЍ00S  0 C00S  0P@P" ڥ0 00#0 y /' -' 0S@P0<-,<-ܾH.-<.-0@- LLPR^0S @T 0 B0<-&0@- LLPR^0S @T 0L B0<-&0/0<-0/0<-00S 3/0<-@-NP uLPpLP|b@-0<<-//@-L@ p0 P"S0PЍ<<-P \R0 5:/\S /\\0: / /0000/@-@P &000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P ܤ`Q  B;&` PЍpA-`pP@T@  A-P`"F$@p %QP ,0 0(000_PЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-P`p?P@P$ ?0P0T0S@ s@-0P00`a0C@S    @        H   P  X  `    P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 j \ [@Q`V1!0 j[0F?o[\20S7 @`^V`00]QQ! ]Q0[Qp.GQ 5 p`0W]Y0`QV0 0 j\Vp0[W` W nW \W`Rp0 V0xN-pN-#Zp@-0Pt @R RP D D <@D@ p@2 @I'xN-pN-|G-1`Q@P〡 ``0pW 0 p/PI H1@@1`0 (*j\W R T R 0 0P@ 0 p0 [R .BQ  [TS[Q@]R  00000T[@T[T@  ST  SR(0 R ЍPN-pN-xN-V-00@-00M/SP M $S, +S00, 0 0 9S$\S @P0 0 i0IS0@S0 Z00ۍ Ѝ00@00 S00@xN-pN-ؿO-@ MTЍ0tS bS rS aS @{S000`Vp F` 0S0QU 0W0 0P 0 PUP @0@ `0 0Li2pP#@<-W-xN-pN-O-`?eMM蟟_0 PXV4 ?/0 (i000 R?/0 | \ T?T/0 X R  Qp 8    R @      R @0`00`S 0S @@@#S ;S 40p0 @00 jP % P 0S @,S @0S 00@ P 0S  00@dV = -0 ,Tp` Q> @}Q ;Q <,0 ch \ @\\ dB0110@\SS838#0 %=pC P3#0 x< @P 0S 00@0( (p!ppep2p"0 0, , p W 020"0 20S$000 S(0Q 0Sy @;S= }S So 1!0 0v, 0(0, 00 0ܻ ػp p000p WH(0S  p Upe , ppXP (0, 0     囱!1 !( 00 $p,((,(p,p|  @>-I'D>-xN-pN-L&~> tXN- \#gEֲ@<-.LEF-MEsF'LxN-pN-f0 0 (\<0< 0 Ld00eݍЍG-@`@[p圀P䘐U@T00S Jl0h0CX0 0S0 0 V P@<-xN-pN-W-V-V-V-p@-P @%000P @p&@-@ 0  @0&0p@-P`PUp'@P 00CS07p ?f7p0 ]7HN-G-p`dBd 0S2 SQ S$PUVP(00S S  'P$0, \d0000 00!ƈPQk$00P0T00, zPP (00S(0 #R nR0V ,0020#00$0,0$06 P( T0R #R nR   PH \T000(0V0(00PP P 0\$T 0\$w 0(0V0(00 000TPrHN-\#Π|N-@-@X0  0S 0S00CS06p Xt0 oHN-O-(DMX0`SpM00S 0S c3#X0X0\030 `00d0XSXP 00CS06p X;X &pP0 pc0 X PލЍP2 I6p0S D0CP 0CP p4S D $0p0p4S \PP '6P 00\0CP|p0`0d0S00d0000S 00Sf DP00 2 02c00S +h+hh P0  c+0h+0JhTeDJf 0x!n P*wD\PP 5H&P\e ( p$ dC\0p !^C 0`PS(00&PX50P00.|0\`0P l000S S0P@ 0 P00 00 l9(00(04HN-0B'OC+R-N-\#N-r$rB@-@P bP@-@@1P b(p@-@PPp0 vb5@-T`@PP  0'p0 w' ЍV-@-`MQqM0S000@03 0@ҹ0S ͹T 08b 0 0S S ` 0ll\%@P *0 $ P4 0l00ڍЍV-N-N-@-@P  0Sxa `p\0 `  70P S w aЍЀV-FG-Ap0吁0`PU , R:(,=0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0   P 0 V-I'A-@P p0R`*W00 0 0P P 0O-/MO00PЍ080?PU 0PH0\\e R7 0SP?0 C0R 0i Pi PS4 0  PS>0@oP 0 R >0R*$0 0HP0S40P 0 R 0>0R >0 0S> 0RR0S0S4 0 S=0@oP 0=0C>S񟗐"           @        \                  8      , \   p  |    <  $   @ $!  8 L0 R: L `0p0080800400SX<e; 800 4\04 0j<0S H0S]P80S4PU 0`  E2P080 A E4 0T P 0  004 0 0  0 ;40{ 0 :0R᜚ <00s 偢0P 0S 0S 0L( AP2S 0 H` 0S0`V: $ 00@ 9@H0S C 0_  H0$P x0 H$0$ [49`0V:( $m j` 00C 0 m0P0 %8 0R:`8  0j `[ p |\8P0  R:Hu`HH8K @u"` (1 S:b` 0   0 8`" 0R7 800 g04 0i<0S HqP0800 $aP80STg04 0i<0S  80S0p4  H`P <000F400<0؆04 |i<0S V 0400<0(6 800 xV04 0di<0S tL0 R: L 5 `0pX00pY R  Q P5 50^4000  P 04`Z Z 0Z 000 G 00 00 V,дZ0 0RP  0 0 0 PQ@ `VpX 0  `F0P  ßH`pL(L<Hp(L<(0000S c04 0h<0S ` P/ 000Q00 0  0`Vp P\   `VXp0  `Pa 80S0s ">p0 ]04 0=40P0 =P 0S 00P80S0s"=p 4 0=40P =P P R0X3@0`pL<0p<q80Sn4Xk 0!p 0`R l0004 0V^*00000S(0!0  ( S0  0<H ! R0<P0' 0pN-V-V-@>-`N- W-B'$&͑ht@t N-`dxN-jV- \#YEF'$W-pN-1N-V-0 0Q 0$ (1 0X`PH`pL(<Hp(<x0h0<0 0R0((Q 0{Q  @>-YE W-p@-@P`Tp0wS {S sS 0p ,=P 0 D\0`@p =P `\#G-pP`PV00\01@ R P b0PW(AG5U !R <BPQ% L% 8% d% L%   \    :R 0SP0S X00 0P00 0W 0Sp: PP 000BS OƦ 0#<000p00007< <0 0B15s?0 0@_fDX-0-01S ^00oS^ P0\ S0S Q0S R P0S0S00QR T.DX-0@-  `Ğ\ @ T\    %R    DX-T.A-\A0 5S <0S 300,!<YP a q 0U&%0 ! R8  (P  D0  ,P  ;0  4PP 幑AZ00\P KP @ 00, PST.x' X-B'X-p@-@0` sT  t傑d lP`PT p O}P000ST @0B'B'DW-s@-@P P<@P-@0?SP@P` ⩩p Ѝp/ㄧP@OP 0S S @0Sޱ00RZ-  @-鳱 c'B'@-0@<TQ T00 O0001S R0Slp@7TX` T@0$ @H43T(8  @,*DX-pwB'T.~@-i _B'7@-@P}  0S 0@T o00 Ѝ0i0"S p`@-@e P  p YЍ<0p@-\PP%0ATp \ 2DR "@D|Ap08& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//L0L 0p@-P@!@R0 U0 ,BU001pL--01//00/00/00/00/00/ 0  /ؤ- 0  /ؤ-4k 00/ 00/00/00/00/00/ @-@z-00/@-@l,- 0  /- 0  /- 0  /-/00/00/00/ 00/00/00/%00/200/<00/F00/X00/e00/p00/o00/z00/?R00/, 00/?00/ 00/4k 00/rN.gb@-0  0Ѝ@-@ +@-  -q 5@-0S04c  +@-  -j @-0)-,- @-  ,-O( 5@-0S04c,-  @- @-0-- @-  -3 @-  - ( 5@-0S04cz- < @-  q- < C@-h-< @-  `- < @-  W-  @-  N-  q@-E - e@-=舳- e@-5V- e@--8- @-  %-  @-  *-  @-  - @- 0襶-- @-  -  C@-- @-  -  @-  覵- $0Qa @-訳- @-@D⨩P d 0  M YE 0@-0 |1FL- p@-P PP P VvP P1QVC P ty1S'ʰ1 GC P tyP v00P1 RE40S 3/Pe PP e P,Ѝ0R0 S\ 0SpW 0~ 3/px P 0`C P t fe `Hyae0010A^:0 b"P !00P000xPdP <P >P ]qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00PX-AB'|O.RSI'xO.I' 001/X-P0 R0//X-O-p`*@PP [ ! 0P @ Ѝ0c00 0\"<gP 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @X-FP/D0 R/0@-A1 P d@< X-O-Bp0 6pW Ig0p 000T Ѝ`(Z 0S mP V00010P@P 0S 00@ Z 00 smP V0S V00000 00` Z0S YmP V V 0 0 00U0 P0HS0SPP}0 F0HoY`pEDp.c1cX-9|O.@-,, ($ "ЍYE@-P@`$0 0  0 00`Ѝp@- ЍYE@-pP@`M,0 0r( 0 00`Ѝ@- ЍYE-@-00[  *Ѝ Ѝ/YEp@-Pi@ipX-@-7@- |@x(Bu$HiWPU r%  ~00h@PU b%T  ~00000S$$ҿ Ѝ0ܤ-(P 0-:P X-B'QP O-`CM@ PP LqL P|Cߍ@ &@  G0@00jP̐`V ? &`PX [      =R @@ ܆ `LhP B''1@-b0O-MM 0p@`P2 )PP* P &P 0S0 0N    :PtP嫙P 0 Q0 0Pr~ۍЍ0P 0 0  0  mP % ,00S/ 0P K@-4-̸-@-TsP 'P <'@>(I"P@% C-@M @0S0k<%P,  >0S#|P  @0Sl Y0] )Pe#B@PaD'D*B^(ЍP@R<L|P@(A`P'='P'`20SWAp0$A P<"| X  $P 0)AT !PP sAP pPP 0+Q !Xp 07'WpT+pAT3v@p0T3:X# #APQ  R@4Q p0Q  R@AP`{Vp003/P,00  h0S  R l 410!8@ꄳ-L-$-\#0@-M M+@(MK+(KB+(DKB+ K(&@PP B!@PP 0 ` @@@@@ @@@@"'Pލ Ѝ0B(>T v -MM+ K+L J+  K+0J ?P  >ۍЍT v 0@-@M ⭛1@@#P @  P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3!P/\P+X@P'@P# 0Pz e;z  0S 0_ Z'P @P4o0m&)p*00ꄳ-L-aT T |O.xO.@-@M +0@@?a#P* /@l  cP 00*!R00$Q &*@P  Z0S 0` 'P%()*Ѝ脳-L-O-`M 00[#*0S ` 0B00 SS@@@Qp @(0 S0 0`0@? 0 S:PP@ B 0p00Q %Sg0S iSD %S* dS $$0T !PsS$200P 0 倠ಠ@Z4!@ P %Q0@ 0S0 aR7 cR 03/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S  0! S 0 @S$SS0P @U:U 0 NII'7@-@ QPU O! z00 Ѝ0llP Xw 7!L q jz$( 0$[0-:P rBT T T T 0n p@-@Q`T0000P0S   0p@50-ܤ-7@-@ PU  1z<00 Ѝ0PP | mzd00S њXL 0H[ȚO0 ,Vܤ-(P U U ,-0n -U B's@-8Q`@v9hVxr ^ck^cg ^bG5c{^5xd 0 Aj@Pxx 5x~P ?^?]] ᯂqxЍpxO.\#\B'RU O-M`Pp v 0 0$0 p@5 ЕE  ^$0S  $W$P R "  K$0S  \$B$XP ^yHP YyrAp@T Pb""  "#R "0B? $0AM$*P  :@P  |v100hPX۔P[; P  4V; ;0S ;"P ; #00w3$"0ߍ_3 <_ 0~"!031<00  <00!0\<0(    \00"P,0 0 p~?"!!03  " PM ep WU $ |cT2P ||AS0S$P0 !T0  (SR !$!1P |x 1 S@U$2@t&PU % P~?0WC( !0P 0[0 R0SQ ᐹFx0S EP 0\v0SP @ v 00TP@@ $2@@~U 4-'ptbtU f@ܤ-0-V U ZU -U U U ̸-;U U U (00@-,M 0000P00 000 0 00\PPP@P DD%@0Q ,,Ѝ0@H 'B' V ܤ- -O-iMs?!0YeYs"P 00iߍOЍ/Lx`P81P ,!,0(`P z[p P@P)PY-U0P 00GSW030#[0S /00pJP@ P p00)ܤ-p,V CV +-O-p0MT@X   p$pԦ `V , @Q'U` cPP)P@P `@H E0ĦePU 0'SP0U*S!/ YP0 0zX/0 0P 0@ 0 0H0 P10Z w岥p`PUQ.R( !2S022SP0220C2   S`` u$00 00( 0 P@U  @0 0 (PA aar 0`R / [U 0 0C?oV20S =[_$:[`_auU @ v 0P| a@^#[xu$00CS0000QP a0P TX$0S  5RBeXu `PWUU S 9 0%S @S, B* B⻕& 0.R> 0 0P600Zp @P 0A0 0ĥ! P5dRu00F (ASz ,_ZC_tV LZto0ЍO Ѝ/VV rV mpV Nu ht@xO.0B'V 0@-CMlPP 0S .Qa@P 4DCߍ0 PD X-Y-G-p@ 堀堐PB`AT:00Z W ,/Z 000 aP EQ 0 Jc@V I'A-`Pp C p@  ,pDD d P@Z-A-Pl@iopl ,D0S DQ0Q.SP @$ $C CX- Y-@-M 00PDP  C 0PDP  C p@ ( ⡔ C  PUx@&  C```p @&PPЍ C C`!i\-%i]-Z-8i(]-o)O-MQ 2/M@Pc``0S ɈV:=80$d 0w-B$0B. x} I p}0`Q>d0 nC@400埈0 , P40,   TWUTr=@WR?, 2p0/vp x#|3 R0:P'P  $P @0a XB @P  P@; 1sS1lSD;"00`&a`P \P@;ɏ@P,B*0x*0wtⱏP\8 0\8TY0 yV *0z*0}\8t*0|p\:VT* Q0:$DR@* , Q9ʟP \ʟW艟^ 0/HU>H B0C   FPT ,R<TDY s0X649 @p A\)-a0p 0HAup H0S[, ,)A0K '@P @0 H0@H0Aup AA`LVp@hv7 Ȓ! HĒH p x3P l0 >\6S 0 R44@P ;5$ /, )&# [7S |G  P~0'A`A|\@P l@P 7P'TP\804'8\8P$G 8A8 ^P0&08P 8HA8 4^P00 60&S\880\8P 8iA8h0S X&8P 8ZA8Y u^P000S\80\8aP0S\80\8@n08E010 ~z7P 2P |-P l(P #P HP 8P0:4X:4SU 0 PM 0$AxP @6[4SP  0@?S @P @ 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   [0S1 YpP 2@T q1mxHHp#0l0S T 0S `"8q 3S3 V\ #C?00N?C0C ]`0  0@F0@`9P;A?Tp@`x080C4r@,0,'P$pX0S $z!Y0X6W5S $ ! `oXmqXF0S@0 <Y4!S< " 0 t0 Vo iV ܤ-V B'V I''W W X-Ը- V V % pY-\-^-;^-n-=rV ]-]-[ 4W xZ-0n FW iKW @_-7X dW W W W W W W W W W W X X !X X 4^-jY Y tZ W ;}PX YX ?RNu `X {X Z [ [ rB4[ E[ b[ [ [ [ Z-Da-[ [ [ =\ X\ v\ [ #\ 0X6S/X-P 0/xYEC-鿏P@,MpᙌP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@;^ߍM \ \ \ @-p`CM|@DPlP#d0RXPP @ W<0080 `0(PCߍM YE\ --\  ,-@-@- @ꨳ-@-0  0 P @0@ R280 /P $  ]Ѝ-, -0-5v 0@-0@XMP70  0@ P x x0xP t0E@&20/Q   LL ]2 0/R@, ,@]Ѝ0X-< ----5v $-@-MoXPⱋ@P  > >ލ0 00S@\0\ \}@P L0 (0< s]0, n]-p--$--*-\ -\ @-bCMX6S \P \8lP)XT20S H02\6S 8+2020">](c2PPr 10 :4S / \@aU 10 u:4!SO *00 0 Bjxg||02@P) i1l ]\ZTWDT0S 4!4M,!,I0S  A  =C 8P;\6S 63U - oCߍ 0 B#X-a ] n-4[ 7X Z-] rBZ-!] A] W \-3] Z] e] W W Y-] \-] o] ;^-] ] ] K] ] ] 0@-P@ T\ ! 0C @TR 0\  @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-p@PhM 0S'hЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/0 \ P0//!01000/ 00#0//O-ap$MPA@T : P00 ` 0S 0S0S$Ѝ@-@MP Mp! *0 `p Wd5\\ SS=S 8 d3R 0 ,0 ڍ ЍTT^ ^ O-Pp 0@0M'"pYPP q<`ĐĠ0 R PЍ 0L03/P 0 7놁0 1  @$0S P @B< @><`-^ p@-P`430@0S, 0 p@ )@-0MQ!p0`L0 3/P< 0t@T 4/@0p0  0 0@[$0S @;$0 @;T `@; @;@P0S0C@ ,$@ (Ѝ耳-^ Nu al \#P P00 S S, R ,0S R : 8 80R:P#3///@-M`p@ 応PPЍPP ψPTP0 pP@$U@@T @ @x0 @P^ 4k _ C0S/p@-P@ 0000p@ O-p@P|M YOP+`~P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 100,`00S/0 0T1 00 0<00040spP <@D<@@0S HP 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0,0$ 0 ,00  @-Y P 0P 0Pp PQ` QTPQH "P <080P/,/(//op@-8@Q 0@P@DPp {2Pp'p@-P@P  : e:00pp@-  '@- x  'G-`PzM@PN/2 s:0 0 0S1 0S@zߍX0P# a-P@l0 1h0$1d0(1`0,1% 1S$ FoP j?t%0`J?&Y70S 30SAT FP r*P @`p̠( p$? ;  $0wY 4 >P 3SS hT ᣊ ⟊0p0? p؀ܐ0gP 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@$P P P ,0! 4@F<#p~2P  @000@0"ZX@0@N?@@T@0S z?0 C,0! 4@p<#0! J  T I00I? 0011F10100 d84p1P8( s1S%4p ∠0!g 0Ab 0],0! <#@ ;0 W,0! @<#'0h pWt_ 4k m|}DDb-QNEFXü_ [YEI'%_ 3_ 'Q`?_ @-@M`p @@ 0~7pЍ bPP  p@@ 0n7pL<@Q 7/P Nu @-0 0P Ѝ @-0 0PЍ O-aM,MQ0=@PP6 l`P - |fPP- Vl"dT+"8Lb+b8`}P@``VIaV+"8+b8"-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`FP 0000!9`P 00S 3/p003/NaV $P 00S 3/p $aV P p0 PP pxb.;9/ 0 PPpxP;".5/0 #X R1  @ o7 70 0MP`lqllV b +PPY  DPQy+"J7b+?"PPiuP# pP kP fP aP \P UxT 7  7P (~` a % (x L-и-N_ )õq\#<a R_ 00C-$q[?` MPA@P00  >C0 1/P0@0 @P@00003/Ѝ003/$W_ O-PUMM.xx`@4P婇.z⥇Q`8Dg(q:SpWp$[ Z T   70.07 00P00@\#Pz⌗40,[Z4S =X7h400C2<7\4=1 W =7h400C26\4=1 0 00  000000pp  k0440}40s -14s[w0 00 00000 0zpp 0440[40s -1tPw003 E "165@ UݍЍP =2 ,XL=1຀P0Nc ⺀ h \  pw00$?00[000ӧ?&N?`/'"T4`, 4@ TP40S N?/$"@X4pWL4 0}10  A 5 "5 504 1p$ ,01(.8,40001A  B6$1 (11S)104 $q,0(84q,0$1#Spy 0 0t ^ pWn ,@p#0H$100$4;2P p>؀Cp $10%0$10H00: 0 0G80C0(1}1S 0}1$1S!> ,! 6$40`040ꄳ-xO.0B' YW\#('L-и---YEܤ-_ ^PP  (00/0@o//BO-@P MMAE0*!Rp0)Q`U0 $0 S  P  Pp ,{*(0$0 pS$(pP p4\,b ܍Ѝp D4m580Spp0 @0 4p0SW00y , Rv  000x;8,9/Pc 0  x08,;f ` ` ` !` ` ` +` ` _ _ 2` _ O-eM0M*Q8U"U&B'@|&u o X s&0 t0T =Q L埥C0T )qW e4p nP: FP' P = @P* @ pH0X 804pP4 80p<s P U d@D`@ W p PU  ( $T0S,   0S # 0P000P F9fP #p4080 P 00 ,0ST0 S00 P0 40040804 0SS0 4 0  0x; 8:/0PST0rԢr S S x l L L L L L d 0 Sb  SU 0|tr t<0PP<0PLpLL"@ @ 4,RP Ÿ ,0$ 0  ( Pd 1Pp P0 0ꜱ5S0+^2x1 pG t0 S\ rT0< i@m%< 00 014s10 5>*( [%Y%W%0S R%P% cލЍL-Ga rB@ܤ-La ea a a YEa ga V-b b b c #c y` օpu% a a a a $a +a 7a ?a b >f 4k a b _b 4b b ` 0c ]c cc ic rc yc W O-@AMT MXp P`L @P`T $P```<PP@Aލ Ѝԃr̓C̳ @r3 (4@$80rDP@<@T@X P \r430$3 00 r2 $02(408@Y wP or딢娂  bt20r8@d2@DDAT P2P"PP峀#P <2 8%PI,2 $ '20)ATp !0O P&!$%0 Zs#P@0S K0S0@4 000@0x;8 8/P6  %P !V%@P 0   @$$0 P@pW:{p@0c ` c 4k 7c c c c c m۶c Dd -Ga L-\#| YEa@0p@-`M2 RЍ!,^0P @40 PP@xp0 ;87/P  h PBDb-Dd- $0@-"@!P0(@Db-@-$@2S M 02Db-O- B PPPBpPP   5 `PP 4uP@Ft$र@`V* ЍD x P  P    R0SP  pPBNDI'@-@00 uP Q P 00Ѝظ C-PJMM pbg 8c@4PTdHP`YdP8 Yo`GFWI |P 0 000!00P < 8<1P <08 <@XNo<0S0 0< 8`PW 40,0= 01@0100 0A00000@ @@@,]@K0S7 0S'8CJݍЍATP0 8 RT<0$!QQ@0P 0 003/@<08 S0 S(0S 0S8 j(0S003/@<08 S@и-  ' 0S/p@-@P` !a(0SQ 003/@Qp@ R 0@-@`pP4M0S4Ѝ0 0L03/P 0@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> {oOd 0@o/b0 !!/Hh-10/v{p@-@4P0 `f.1111pHh-O-P@p`АРа0/ C  !0  P00S   0S 0P1SR0B `p@P X 00,0` 00000 ЍHh-  \ L 0@-P@M/.~1, 00 0d0@00 0T0@@@@1 0 000@5P,~ߍ0X Hh-O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+   Q 0S  -0 0P  P  $04@H0080pS,000TT0 0X0$0\0(0`0,0d0A- 0R 0  DQHa@1QRpB   !LAPAP>0 \A20Q     TTAU @@Hh-d O-dBMX1SP2X\1S02\X1S \QUЍ0C`18`1Sla`fr10XP \1 XX1! 0`1V# 1xC0CI0wfP 0 S 0.S - p `pZ"XP ^0X0`0 0-X"}\P \!}000: SX1 t0 0\1` 0Yn 0 X1 ` SX1 (0( 0 e,Hh- ' Gi- \ % @-M M`iPoۍ Ѝ-nP@p rPP+, P*+PU, P*+O, P*P{q0% p@-M&@(hH`P4 f<0 0Nq P (4( fpH\ <@P ލp_\d a,-Pbh @- D@01SP@ 0S 0   Hh-  O-M @c0 W 0Sp`آ W pP 0 0P0SP W%]P0P 0 a0CS0Sߍp( `}V2p0008V0S`p R S`0a  0 0 Gp 0U? s [ 0+ TP0ep000 C0S 0  @00t00 00S 0 0g0P0 0h![0R@0O l 0 O  R*? 01BVa0 ,d | d@edAi-s d Hh-p@-@PxP p@#pC-pPAK L1h90 < &R h)0 S 0<1LPDTPaH4pLP 0pU `1DP1 *pU `1TP1 $pUP1 `1pU`1L0H `I@ ЍC(0(0h9h900Hh-SyYEd Xk@-M@ P @oЍ@-| 0S lP \0 T0T 0PP0IL004 80<I( Ѝ ЍV-d --5v -g -$-@-p@Mp)t90 0 0T00.00 0>)p $0t !ЍHh-p@-L :@0P Jp@X\zd -?@-P @  R ,$0$@->Ѝ0@ Ѝ/ e +e @-0  0B P L0L L@ {0< <@It0 $@ IЍ-x -5v -$--3M M TCP0  4 wP wo3ݍ Ѝ% -3M M CP3ݍ Ѝ% 00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PDH@00( (0P,Hꈳ- -Ke ---le g --$-@-0  0 P <08 0440H000 0 HЍ-ne ---$-0$ 0!S/ /Ti-0$ 0 S/ /Ti-00 0 S$0 10 1/Vi-Hh-11<0@ Q !@-0 " !/Hh-0 10 1/Hh-@-Mm/.y, 0l0d 060 P000@ 0d@,6ߍ 'X Hh-0D D /Q/QQ Q/Hh- '@-@0@ 0 0\PЍue @- @0S00-e p@-tM_lPN @(  uP@`@00 0P0x9Y/E܍pe Hh--e e @-P@ X0P  {XЍ0--@-   Ѝ Ѝ/-@-\0X0@P D  Ѝ@Ѝ/e e W -@-\0X0@P D  Ѝ@Ѝ/e e W f e @-4P P P9f Bf Lf @-@mP@ Co @-0@GuP$0  P00) ,---@-0@4uP$0  P00) 0--$-QA-@@1@#PP1P#T|p|` ^P (B(A_S=P=55XAWxO.,-7@-@-P @yt 0y Ѝ0of B'Vf 0@-EMBP@ ' DP0000U ($$0x:@&Eߍ0-* Hh-@-hM+`A 'l@1^1i P0(!x F -+y<Y%0 00`00 0H0 0 00 00 000``PPpR027%yUx:` JUFX (a'(Z(J)ߍf Hh--0n 8 f 8 'f e @-@P !0`RxzItP hPP <t 1P` xZ F T f-01K@0PU@T 4(W ЍHh-V  '@-@<$0@- 0 Ѝ0@- 0 Ѝ@-0@M00 0000 0Ѝp@-P<@0/SpQ sPp@ '@- 0P--O-$M@Zp`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝf DYEؤ-0n 8-f -- g yO-,M@k$PCapYPi $Cp`V30S` kppGWT X1X!XXv$ 0 `   $ 0VRR  S  R gk 0BPEPB$HC0! 0$000 0  $0 VSS00P0#02S `F  w Ap6k @p$ C`,Ѝ5g  Lg A-`pP@P!v hPP 6/AG- M$BAP`pP Ѝ0 0 @`0 VSSXP$ B-@- 00Ѝ Ѝ/0r -@- 00Ѝ Ѝ/Xr A-`l3@PMMP\ `V`ep@ FT0'(3T$$c3T &  0So 0CS+PDS0)  0n 0S9 0S r0S 0S QN@P% 0 `0 P@oH2@P 000C?o270 o0`A(D40SލЍ!z7SrP1Q! @F?@Fod!H1PI0 D 0M$ '  0S 0S| q0Sx 0Su QN@rIP  0&0 @P_F? Q. QFQNmog ng g g -g g - -h 5v /h <_- '\M \ YEg k*--h n ;n -MM P  P  xۍЍIh -MM P  P  cۍЍVh s@-fP' `PaP O%`t0S  ( 0 8 y @HP 6O{@TT3Ѝpꅫ nh x0|+R/ @-d|+\0X}T0PyL0HuD0@q<08m40Hh-h p-h -h t-m' - --P@-@ 2@0T,-p@-@M L(@H@t0 #,0@@,0H 0"Dh@Pp0: S HP # #܍p,t 8tQ @Pc@Pڴa <ZT@@?8 1!ns8<DQi X1 08808@TT OoBQ-P@00S nv < R t00 00000 00l0p@@ m(st(0Q!-ɡ--$-s- h 'Lg V--s- O-0CMSP0q ` @g0!` B20`SPW!000 @@3/@P CߍW! 000Z 0SX 0 @{T W  00 0  0S h00S X  L0W0 ! ! 000--\ x-h h \#i ȸ-+i Hh-7@-PQ@0 SS 810 000^ Ѝ02S  1i % ;i O-HPUM@44Q (  Js$ğ0/S^P3s0샟C0`/V`%# 0SPXMU@c A@ SPtNP \HXELB@1 U(8$ DP>P $ 0RP P  ^ 0 10S 0S= 0 1S900 000S NP,0pG00 0&2&B/R 00 a 0! 0 0R R` 10 1000pXR `01S RB  0 P a0S  /SPR Uߍ` 1 00000000 .UQ U@P@T Tt |g 0-@i x- 'Hh-hi +i i j j % 9j >j ]j gj j |O.xO.Ti -[i nh A-Ph`hp@TUUU &P  TP`('\#O-@MMp\@ @P +PP6P > 3$@ڍЍ P P PPP uPZR`P5_  08f P0=S@  < ⠷P<:T P @P  ꤠ刐P@ @P h@ we \#2j j hrB/10p@-4 P@^q0 Pp@@-G-`P4 Kq@T$ `V! p0F&04 p0RSP pEPp Pp40Su p sqPp@V/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ PpP  p@*@-@ (@A-P@p`p0S 0pp RA05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0jpЍPP@N`墯p ~.ᔯp u% o 0Z`SVP0 t@ T  \GPLP <P @m|}DYEj üj @-@M M`p;@ p  Pp]q`Yq` ۍ ЍA-@P ppP` P  0Q[P4|d zd@@-@M Mp;@ `d p P0 @ R`Vq`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPo00/00/4\80S0 S001/\80S  00@-\\@!SR0(SS QU S!0$0S\  01p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q  0P!SR:p040080SS P Q408S Q0  040S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4  B(B(Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X 000/O-0@p 4MPPp`/14ЍO$0 L03/P! Ѐ0 \ p* D@ Z["H* 0*P T Pp n8``pp 0S0P 004Ѝ, [ 0Ը-O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R0!S,0S p0 p002#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/P$D H lp 1 1 E 1 (w O-0c(0M800PSp@p`00 $ 80s!3 0hh0@l0|S@3` 0`@ p D3pR0000ЍW0W*8q @ 0L03/P 2PR r0  0 0 002@pD 0 ( thHL( 004 < jh0(0,(, 0< ^hP23V 4n0p0P80SQP0 N T00SJ0SZ000q p0 j8 P8 000000  `8 E8 00000PX 00`808/a0 PpQXQ Q(00,00 040p \`\bp a X0S p^ 0$0p0 0(00,0  00 404p9 0{--k {-k YEl C-hF`0pSPlM^LIa0S0Aa0 S 9a0S2a0S+a0SG$a0SHa0SIa0SJa0SXa0S@a0Sa`0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 lЍCZ( \`0SWCW@? ? @ @@ 48P Qb QB0 \3003 0g0 'lЍ3003 0g0300 0$d3 0f0 0HS(0p`@ 0 SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8"9, xP0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 hH0L0  PxH0L0@ 8qH0L0E lЍCh!SH0000%0P pG d 9/ 000(0P0 {-~H $D lp (w YE7l =l (--Fl 1 1 1 @T Tl `T F Zl ]l dl kl tl {l l l l l E C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``P0 0pp07/@-M0@ 03/P 0 004000 1003/ލ@-`,MHP @0 0 0PP@00 RS THP pW fP00P00P0,Ѝ @T@0/W/0  0H P00P0I'ф0@-$M@D0X 8 0P 00 00,0PH0Dd$Ѝ0Zl O-%,M`@PV `\\q pTWpSP`88 ,pVV !R "2 V pP P`!V$U,b$U p 0 i0 00% 00 0 0000M0PP Q=,Ѝ3 l ll \2 C-40PS,M80S,ЍS S S !S S @P `p䐟` `X 0 000 00x 000 0 00 0 0M`PbT4 (G \4 O-P@0p (AMP U  ! `<#0!(p<#UP <lP 00 P bP _0Z0P0UX@!kO 0 0 p `@ABBA0  0|!]7C8 @p0  T!S7-. P0  ,!I7D$P!`]P@!@3@]T -`hT@D@`0@@< 0 0K-h0 0@`0P 7.㨠嬰h 00@` P 7DAߍ!0P0RPNYE(-{-l m \O-d5M0000T0 01P0100AS! B B " 310C\ O-P@OM H(}fq1gW@@Dp删`Oߍ WT00C0 00[0W 0C$ 0,0,m`P5 ş[@P hşT0@0C0p0NC2WH0 0$ 0 RടW 00 H03/0 T00!!  003/P#%#& 00t80x 3/0lPp 3f̍X 0 030300 07000F00, L@ 0a VK0W p 14t8p PP00P00X00 3/088q00yX 0L03/%$& l00,0t0T0x0X0h0H00TpX 007/P !` 1Rd 0  0!v!D W p0 B1D!2 B"11ᴑ0C100C0 epWpvpW T00 03/`P00D :*04`Y8 P0a 0` 0d0  p D00C1D!2 B"110C1010` 0S0100C0P !V 08 L0TX 3/P5yԸ-$D @= 6 A-Pp`@a!GP0 p00S p a1p d-`P !@ B"K1 dT0 01`0(`10q0000edV 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0f 8< b @_0`4 V  V  R U  U  RE ,1@  04_ 0(, -_Pp@ $( P , p @  `Y20p  0_ 0`@ _pLPPnP\ P p`@;20` O-0@AMꀳ-(-Km O-Pp4M0`\03/0 @T @@T@  P(S 0 $Y0 " Z0 >00120 01 " T e/  !"0 n/ 0 " 0 ]/  C" 0CCX 2"b0E0 0l2@0d2 0\2\ 0J000@0@0@P,((@4Ѝ<1 @1pp0,00ѽ0Ph 0@ S[00S2[ ZJP P400S/ 3/+嗓)08q P , (0_P(0, ZH D00F0B 0sP P@ (j0,(00T,00(0$ 0H@dV {-\  E lM 5 ^m ll 8 `J r {-% @-@P0B_P/YP0S0% O-pMCxb:TUtX4{ 00 rs ,b0  * 0 P  00@0 B )R RP 0Q R Q 0TR000US0a0Ѝ0S@0  llPT00U00@0 \%41R7 (R3 !R/ R-R I 0` ` 0R 0R`[YoFT00U00V V @P0 /S`Sp`` [YuT00U0,`0YE@|-d|-m C|-T8 T}- 8T0--% G-00Sp`ЍP X0p0`0@Q GR S 0]@0@MRS 0CRS" SRS 00X0+Q0S 00000S O-OM M<00 P$00$(008 0 @0P(0P0@D00P,0  0H03/80 0<000!6 0R 0  0,3/ 0P`` S04 T&40H&X/U\40a`00000 0&/p`0,`LpH0WX0h05R0lp0h J `pV Sh A`U T~h 9PUxh 3VU 00 08PTq4P0dP`080S<00O>0=C0H048 <00\$xj/U 0S  T0PWq0 000H0P0 F0PT0S bxd]P 0S4 `Q00Q0S 0L0 aA3/P Ȑ0 0&003/f0F0P ! E 0 [( $0Y(00$0 S(0 0R0$(@0D 000@ RD 0S8X"a` 0".0'000 x HH 0[x 0 `>0  0[ 0,1 0[Ȑ 0 '0l010h Lt0hpO+H+   [`*pV 0 TpU 00 0`Tp0 8TpT0P0%0 Q030#Q0S ,0 A, 2Fvp 0$&(?00P`3/ !0P`Q/V8P S(0 0L$0 Y(00C8^@ Ѝܤ-m 0-m B'@-@ @0m @-@P@@-M@       <܍ n 0@-MP@~   x   0TsP <ߍ0n @-@_@A-pPQ`≾@P P  \$0! 0PP Ѝ0$D n @-p@-@P4Sp@Tp$ @PpDp@-5n G-pt`DTP XPP@ 0 0~PP$0R04@-En A-TP4SA p`4C@ 4 0r  n  D@-A-@4S0tp4TU TU T`040 @Q0 4I@-En p@-@P0 p@\#p@-@Pe@ wopWn    @-o@-o@-o 0P/@-0@-PM  0PPt  宽@ 0PPL D}P08P0vP 00Ѝ0@n T-n @-d@A-A0J?`V=p$X"0 bPPЍ p> C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$aL-<$0pQ@-4寻㗵 #"T R0//s@-(@T@ЍpH90P50 0003/@Pwセj/@-tM2PP@" @a0 @p@ P  00@T@pT 0 @ptЍT|0t dl0l p) PP L s5-n % n n T-n n n -n o /@- M@J(o ] ///@-0@Q0T @o?0 \ 0P000@-@4M0  ZP0PUCV0 00U0 00  084Ѝ0T-//A-pP@`|VT0S0S VPH0P$1UV0U0 00X0`p@n T-0SR00/p@-@P*U<0P4`" 6D0# A0$!7p耳-(-A-<`P@hVPp( [  AX-@-p@-@M @Z0 h呺0S X.`P0PP0IV 88 0 $܍pbc-2o Yo wo 1G-1`PM@PN/1|!1x  pqpql`PdL@[县H0 [ߍ B⧟@P BhB?#N @P 0=SBN?A@ B?'@&T@  !P 0 h[ :P L R:<  b9e y& 0n o ܤ-o o o \#1A-1P@,PN/1Xp1T P`P`  P  <'9 ,,7eܤ-9o o o o p @-0M02000`00Pp0d@P @T 1\ 1T1H 1 KP1 1 Ѝ) p Q:; 0@- P <_-C-`CM P@ `XP pܐ܀0 `0`:0S1 1 Cߍ5S  |wp pP\ ``X0S  @S1, 1-9p -;-ap rp p p p :Ip@-P@11 1  p-1p@-P`夸@P堸0 p@p p@-P@P 1P1   pp 7Up@-P@11(1 P1 1 pp U@-ø@p G-@ZM,hKXT+R@`r夒T5 TH Tn20$0@TPp"pp(`pDBhP0Sg Sa  @#X 0` 0P@OP 2M&^PP ZߍP NDP !080 03P x!(p1X ( eL 0P( ]L $XO?(1L0om0 !(P PN?00P0@ 7 EA7 0 0 & F 0  000 h #@l)'-q -----q Yq ܤ-q 7zq 9|O.xO. J؍ A-P$pAq@P a-@T 6 N0岻P( 0 &#P  077 P X@ᙻoЍW\\y P < 0 q rBܤ-q r r & q /r Xr r h//O-04pn@T Ѝ@T@T* ^( P@ U [Y  [ XY P$UPE P P@ @$0"/-O-4Mp(tZ,Pf@ P @ %R000 000V0 0Q0 V0 Q0A$V@U0P@0 0 000 0 U000 Q0#02S4Ѝ;0 0Z   R& S  P@0     0P @V0V0 ^Q0A$V@U0P@ RN RK RH  R ࠡ࠳ $,( [Q$[4UU [ 0Z0P@V0V0 Q0A$V@U0P@ 0 U00U Q Q 0   }(0@-4MP!! 0  P PP@4Ѝ0@/@-@ @/r p@-P@/LP `@ H0P P `Ra BQQ pQQ 0@S:p @-H 0RH #@-0@-P@04MS!1P4Ѝ0 P*   P +0R0#@"*S Q 0R-0p@-@ ^T00PUPU' \$ST op 2@Q.^U@P@@ $ $ 0 00C 0p0 r }p@-,@P3U0P ;pA-@H`HPpFT00ԗ@"T01 PST- 00S@- /ሠ--C-麋XP(p,`0@( 0 XWaV V T0   # ЍАYĐY R  U:0V @ @T0  " s s d d @-@P 0  S@ qs 0@-0@S~0d T0"S  @0<00R( T40 ꈠ---G-錑P0`Sp@Q 0Q02@1;1':X 4僴pB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $P Q 0S T vx 0@1 00 00R"1-zp@-P@mP000p1O-0@Sp`P 0 PRQQT SL0UȰС0r 0 $R 0 0"60(Q $O0, 1QX#  E vQ 00   R @R `0` `R R [ R# Ѝ 0W1Q:P ꈠ-Ns s p@-P@P0Sr!U @ p(0"PE0U055403 0(2#p舠---40@-0@SXDP0@Еꈠ-A-AP0`SF!U @ p0䀟 SV Ѝ@4 U(0`P `4p00 0@0KSPp0P w!H pQ `00 Pm!0'p(0,0`ꈠ---Zl rs |1A-0`Sp@P0 PQQD R<0 S 2r 0 !Rv?000 RU  (0$0X3,000 1Q\RP 0 00  W1Q:P0舠-L@- @⶗00S T $̲@Ѝ8@sO-X0MSM2"Q\0@S2"`0Sb2"d0S2x"h0S2\"|H 0ST\8 80R\ , I0pQSPPTP  @@V`P. @ \00`0d  00h X 뜱;S/ʐ!@0mP@_ovRݍЍ RQ8 R q0:S 000a 1 00 0 0 0C0 ;0CS||ՆPps s s s s t  t )t rB;t Jt nt t t W t t I't t t p@-\P@0S Q0 >q   R@Cp-O-BM MpPT0@P 0` ;`( ,pPX0 Pݵ@Bލ ЍQ  0 0\0 TB`0 00!$0X4X00 $00 0v0; Se P|嗺P +RQ 0P \Q S0Rʨ0S R4 S / S S"0S000000 000000=P 0S  e 0 R$ ? ! 0$ S 0"`0S 0$ edAt O-$6#Sp 0 KP` ;+[0Kp0 d00\ `0h0|0 0XA00 P$`P`l0 (04H000 00 00p; t @-`X0Sg0 O\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP U &0R Ѝs s s s s t O-0TM,0 0000 (00$0 0P400! 0p @@pPX_ TЍ@`DP 0$0S S H0!$01R < 80#K80< 1#$ 0@\D0 0L R0HL0H0L`, @R0 D ,`0^  $ $0 p S `S$0q0S$ H$ pQ ʈ10Q02p1;1':X h(0ž0\CPWPSWP 0S0W0S0G?o2\0S p2 `($0 $0(Q $~K[  0S G v40p1 0$ 0 0 0S 0S 0$ O0B"1 0"G-zO-M00D@TЍpP`Ра@D0SW@ 0   0 0 `1/Y  S      Q R  0@0 00Q0 0`p1/P -A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-P@`p1S 3/P P`VUd0PT0P0S@000S4000S(0000A*--hp@-@4`4P0Sp@10S 3/@--0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 P   `‚ 0S0P000 00//00/00/00/10/Q@-@@ 0A0003/P@$G @< \#C-B`0pSPEM;00B0S(B0 S| B0SdB0S |B0S0 uB0SnB0S00$ R!000< R%0pG 8d 9/ 00`(0@߭ 0t)( ԭ?B0SW꨹ й  < Q 00000 0H0 Eߍ0000 0H000 00 0Sl0 0vH0 Q0  -~=l ф(--Fl O-Pp 0MS 1fߍ0L00 3/P @0 8 D00S4A 0ST0 0 0 0000P@T 4/@@10 "H` 0H 0`)`A0 R . 0 00T `0:/P `00S0V0S zA>V F 3 L &>0!C> f`20 010@0`YEF --t \#O-PM0@0` P8" ݬ `(b0   X00 0Gp!0@0 0G!00p@嵬 p@^yA@g㦬 0 \!X坬 @p0 4!4哬(!(p 0`P0 R  P}(Ѝ 0p!r0i ` `iOT0 0-p @ Y NT R ` @YE(--Ll u A-2u 9u -FKu \A-@0P\03/ p`W@@P@0P80BW  \W0 V  .  ! 0 n/ 0 00$ 1 t    ]/  CX  0SJCT D0D DDJ04D@qA-0 L  Pu yu s@-P,`@01Ѝp -p@-0(M0P,03/`Ǯ0@ S:000 00 0 0 0 !p` 0A0fۯ(Ѝp0 d O-@M4,P PЍ P 0   oK< iK p@W0H03/0PS`pH`pA0`0`PP 0l S"`2`"2]? 0 0 0A 0000 0 0崨冥r0S u'00 L0P 3/P X0P`Tp`\0p0 S8P 80 S ,1 0, S001z40P ≡0L0 3/00 P0O-UM< SD [/080H44@p"P `PO Uߍ0P00 P,T@>03, 040S 0R@ <0S6(1SJ 0J ,HLAP4#0A 4 8#H@; $Q٥֥ 0@P[P6 @T "2B 00P 0S 3/P,00,02, 0SU@0%0cD0pt `2R壥c6 Y8P ,噥,H! L@H@<#pPpT@入P @, 9@ 9,0p409p ppV @= 9   , 2 9, 40,0',0ጩ9P1: 1 !  00ꨰ  wPJ>0@0/S%0@!+  S JP+  P*]P 0/S`0oo`bS 8p80&000 SV+tg P*+a P*EPE@CE@]>Jލ Ѝ腫 5v 0n % @-g㥮)@-M @oP(0   @P  P  "88S 00b"!4b4#$("(RSЍ O-M` |'PPp X`p㴠崰,P%Ѝ0S @ xP0  TpPP Xp0   @5v ,v v *JG-|M~ `P`P PP<m+@P@a 0 Ѭ@ (@P.+J'J.0㴬+JJ.0T㥬TX 㞬PP~D4 ᕬPPu$+J0J.ᅬPPe +J J?` nPPN+Jxtpll40 0J>XP 0 .OP UT GލQP@Y+JIJPPPp0J.*@+5 P h lJ>PR ;v Dv Ov Uv _v kv  |> 0 008kP0h lھ(0, 040x0?o21000Ѝ0~ᦾ᣾lL-  O-p@ᨁ娑娡,M0 S0 0000 /00㤟0S,Ѝ/S   /00`pPU1(ዡ`P p嘁!PP PP%0(` 1`>  >0 400,00`T00X08`O0100+ ;:P 0 0 P))`ꄳ-V{O-pP@\M4 `儰=0 SpU  0  Q $0S  0 0$ pP(9\ЍO*.=Y P0:0pQ ",^T ^ 08  0`0000Y(0S`l ` 0 Rp`H03/0`0 [ 80s P\0!0000SPU0$U00[P 0RP  0 ,8p0 0 P  RP P 0$U$p0p[P0P0[}p P 0PQp0[x?[00S' !P0 !:p000 0RP7 0 1!ƒ \ 0 0 PpX0 0S(  0R 07 0 !0 SP0 0PU pСZ050Z0* Z%Q Qp 0S S0 0 0Q0000 00000000 \Ѝp0  ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0S 1 `R <$ u8P` $ $n8P 0 Q0``T R T  R X `( 0S0L0( 3/P <00S D0SS000(( v L0( 3/P 80<00S (0, S004 Q00 `( rT0\qAQq0[[m8qiP U ^[p8|Sʜ0 :0 F[p㜀  SS 8q 0PUp0pp R 0S  0 g6p 0    Ը-PL-x-% ;i O-`M,p@4 00PVY pYpPT Pp0Z:`PU`J?ERUA ?/2:00#h R 0  80s0`F`pHU p h;h0S 00  80spHY pPp U;h0l0 0L03/, 00Y:pPp9p00P80d>ЍO+p0H03/,0$$ (08RPP0$P(<00W]:< R3*,0pp0PP UP`p0$0$ PS(05(0$ 2"0$,0 0 Sn@DS g0S 0 `p8P0V`:40S00004000,0(X~ $0(0c1!0$8` 0@00D<00< R:pp8`Qp< p 00<<* `8q ,0,( 0L03/0 00 0`VV0$0$ S(055(0$ 2"0$,0P p0a  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0Pr0H03/p0@08P0D00[q*p 0 `<080sa00^ <0 0SX4p0 @0SD0  0 H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00  000 0W 08 4 1#'04 000P0 04 Q000 p0 C 0 1/@P0$A Q 0 > 1/P@P 0U:@1S<1@1 @0> C @7PU ,,\0#0<<8 00' 3 0@'00 (0 X &%, 婖(奖00 , (0  0嘖 (唖00  (0'X0兖0H偖H0P00T00LP X0f6X0 0008500 %  % %P,  (P 0 %<  ]? 000000 000 0f00㮓p 05P,0zXX& 0HSB(> $P A$ 00S H @3/Xv@DPH0L]!YZY03/ 0 0;P0L0 3/P 00S 0SPX003/PXt0PH03/ 0! P5/P%$%$)@0 Q.p8 ZG@-Q  01/ 0S 2"4X$Є  05PP  0 Hp0  @D@0 ᄐY70Y= pPPlϕh,0 S1PP p@H0 0H008L0P 3/P `0 0`00@80P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000L--YEp408\X t - d V % Ax x 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PWV`4Ѝ R00S 0 //O-X`P@ < b"0800 c#  p 0024  0 S R( 0S% p q' R Q0 2c4T 0 < k+800 b"p0p00S   [$0!0R!/S01/ሤ-!0 /ሤ-$1p@-S@ x1SP $003/p@px1mP$1 0SO-@0`PKMM0((0DpH0S >I @ 40 0<0o- %"{ 娻 KP@T8p]? 00 0 0U0000@00 @@@@0,fppK܍Ѝ(2ᩑ(0S*< o !80a&@@ O-`0@PMMhh,00p 0S ( 0R> 9 H3 00 0 <0.%"@~40kP`0V,p]? 0000000 0 0U000000 00p`ލЍ,ۍR,0S*< !,00C#X0S000C0C0000S0 0,0A$Pꈤ- @-@-a30  !<$10(10,1P001.@-@M30 0! 0O-4M`@(0T`X\d0hpP 2"\ @ @,0;/,0P R7P 0Pp2CF 3p W 2 3 0 " 00 0(0 0 0z`LÐ8(04ЍO/P4ЍZ:p@-@Q- %<%T%x%%%P 0 Pޒ40 Pؒ <0`p@PPϒ80 P<ɒ,0 P(Ò00 p&Vx '`x )*+p@-PBMH`@᱒  VL&p&&&&''P'l''''$(P嚒 0P呒 Bߍp`冒P00S0`{40P`u80PS<80  ,X0S(!@a 0PY\0 `0S q@ `Hd0Ph0S a@l0S W@xp0S@ M@T`$t0P]jx 9tx :;(=>x x ?CABC@-PAMH`@  ;V((8)`)))0D`qK0 @0S    8`V@ 0 Pߑ 0Aߍ(0S p #@,0S H @@00S ( @ ]Nu .jx /C1x 20@-AMP@0Q*D**P+t++++++坑   q0`N 0S (0S    ,`V HwAߍy   rq0`N 0S (0S  e  a,`VPY $0NPP 0 PJ0 PD0 P\>0 PH80 P42 0 al Nu \#x    60S O-@MU M2Pm 00x R# R0p]娥娅qt8`  0@0S D` P `  PC  D  pW00(0S%$B00,0S$$B0000S$$B0+ 0 p0B/ϙPp᭠ C"U0S1 `F` T댣0p⇞ 0S  `,pYV o$ 8;0`嬎 g0`0"  Ԓߍ@噎 0  0S   `pV ㄎ 0  1 PS Xu 0  0N 0S @0S@b ߍGV<0040!00v@0Fo$ 0DL03/00 Eppqr0S !0\HD` 0S / +p8`Y0a x 0QW 8 <0RFO  0 - 0@ /-@ 0  e R0Wp 0  yy фy )z Nu Zl y %\#y y wy -t @-x @-+0 @0p0:d @Oy @-D @-000(0,0000%d @:ꐯy p@-|A`0PsJM]/   01SB:::d;p;|;·Jߍp@0P 0 0PP@ӎo(PVU@@ 0 (0 0(0 00@0Ẏ(CP(C4`,P,`0PP`0+'3C560p@-aPM,0$0Ps@]/   0(➊$1 SPH<l<|<<<(=4=@=L=X=P 1P$^PЍp 0 ,T,0S$0*`@VTPP 0 00 000 00P0H0CP0CP`@!n@<`@4` @`@0+'-CO-P`0>,?L?`??(@@@<@H@T@l@@0@ 00 @͍P10,!<1(0`00?o200@ލp40?o2400@8 00 @oXPVU@@@ 0 b0 00 00@0ᎍBPB`\P``Pd0?o2d0p`hPolPp00 S0p0t0?o2t0 0 PEL-FGCIJKp@-1@M S>@AAAABBBBC0 00 P0 PP@ 0/S  !0D @@ 0/S  ލp1?o21QUx1N0",!@<1(0@`1?o21P 1?o2 1 1S 1SaIOVTPP 0 0 00 00P0)BP%B 1S 1Sp`JO 1S 1SP`KO 1S 1SoN \ L-!C"#O-,MbPp@%X  㔲PXZY CD0DDDEHEEE@Pp90 @Pe@ +,ЍPp+1`SPe 1S !N &!:@p@d 0PPp 1`SPe 01S  1S0I1P/S <(D0(0 00g0SvU `P  (m j0S `P $ 0 SX2vU Z xY $1 0V!7 N0  0X!pH1@!Q$✈1S  0Q p $ 'p ُ00!15:% p ͏P p Q 0, ($!p p $ ⹏P] 00 8a4Q101S/--и-% 5v YE#{ v z { 0S@0@-S@00 0S/-b' 0O-P̲EM 02@T PP0 2P  |1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 /pPP2@0S- $P* 0 x0D 0%h9A-P@ML d`P$D2P0S%  0┒PP 2 00 BP P< "0 4 P 0! H0QЍ10S.  jPP(`q000C R  R41$0 000x"` P088/0P0 00!`0vm V00S.  7PP(000AC, \ \ 0!̓P^ X^ ,0 SP$0X E ">SPt-b' D-@| --5_ p-DJ -M| A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T  @T7 @pW4dpW1V 82# @ R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0t-D-p- ---\0p@-T00P #DPPp0AS@  1SA-L-и-0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""-l0\ Q0/\P ^U Q0000@--0O-`GMM40X2@T]? 00 0 0V000000@@@@ 0hRp@c<  " G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  Kt",0h 0 t0@W 47 `4|54 VH0 <0G, ,"Bи- -0@-PDM@T P08 @\ 0@  Dd  x0 0DЍ00Sꈤ-0@-@DMP/ P0, P\ 0P  0T   R X  O0S0000000 0DЍ000Sꈤ-p@-@Q`P@M<@P   T0 0SP@Ѝp@0 @00 D0U@Ѝp舤-17@-@SWiijxjjjj Ѝ0! |P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0P<0 S@  0"{080#{0,0${000 %@-@PD `!x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍpF, 2@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P !0 $妯<  ! <U} -0$bP 0|! +|Ѝ0L-@-80@SP`4Mc00 0P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0 d oIk| Od 0p@-PQ0M0@$ 0x`0 6/8 ԉ`Px1x1a1S0C€10Ѝpu| p@-@P 0厎P  幉Pp0S@}p {P 妉Pp0S 4! B! fP  呉Pp0S hVP R 0L } 4xPppb' | | DJ| | | O-uM Mp0 Z-- H0cS_ C-0SSzB0S *PBؒ0SzȲB0S z2 P     P x2@    PP2 HD     P00002x @@K @P@ PHPP< ,h@ ,D@-1 01P01P010R0 0K000 0`*}p@  P垿'yk} 0S10$1S10 0Suݍ Ѝ㗂P`H㐂Pj剂Pi1S |!R |㟧P 0+'-p- ---t-D-------$-|3TL-и-_@-@P00S @Pt-| @-@PЍp$QU 0  `P PP> C  01/P (00 H$L Q>L-80S @-0  /pm | G-`@Pጐ匠X0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`@8  T P $QľM$00S U 0 |1 08ЍpP ᓭP P Q B ᭺ P  ȭ FP ꈤ-A-M|P8 U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `p`XM@0 803/PDG 0!!0#`' 0 3/P"#"#00 03/p 0` L03/)ì .Np` 0SXpH 0!|1 01! 0<0S P L3/0L00 3/P @0D t0Rv`p0L00 3/P @0D t0R 4 d00`RP  w00p 0Sw`$-p | O-pRMP`b @P Dn@4 SPpߍP(   pp0S ہ<08 (00,0 000040!04 04$0D0(0P @cVph&np 0 u DT 8CT ,?T  ;T 7T Ũp 忨p  L ⌨p 0p?pq8SPr 0  *0*0@0" q 0* *Ld@edAc{zd@A-PCMMPp`;8 ᕷp@P  P0<PU00 ## CލЍ /O-|0PXxx0L @88  P 0  Ѝфr l9} @-v0SЍ@-@M vT0  CR$00SЍvA-pP@0ST 0S` @P$P7 #P.0%# D0S(0 D ({#\  ( 2@00#@#000@6( d@!~ (~ 9~ & ~ ~ R~ ~ t~ ~ ~~ p@-@P # #0S S z00 00$00(00,00p@-`00MOQЍ S 00W@0u #0$P (0Vp  P0W D W  00W0S U0ąA-P@\^ 0  `04pX T mu0p04 4`X \^  R  0  `04pX ^S@-`lM8PpV0 00! ! 0 ( %PV$8 80R:V u@#RD$ͱ x@PV008P7y0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0z A-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* wPW000 0 0004P 08000 <0S $0R 0$ A 8< Q\00Ը- \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ ptxZ @-@ 0S PO-VMM00$ 5%50S5%P$ 8}PP VލЍ5 $08|%H|PHw@P THGv0(,0@D00<0P P ;vPL 0 ` p`04LWP 000  0S`PD00000<000<00a@08`0S XU 0 L   nx0U0Q0SpPX X `0S ` ` Ox` Ix0P40 `P000W@0<00D0t`P0(000,040S <`bPk`jvPP Hw(0S,00)wJ` D00pp<00008``#804S``V P0pp`0 0S 00PP 0 P0 0C5$0 0!(00,00@0. 0D0`$0500D0;啭p0PUP PPTPlP 0X`tPPT`-;w0S 4 R 000 0#0P 0S ޯ뼀8 0<$ 0S P 0$ 08000S`P .P`\0S0P 040 Q\8<0 Q\   P` 9} -  - ENu FE|d@-锝 0P 0P---0,M$00 0 00 00 00 00 0 00000000 ,ЍH7@-@ P000 00 000 0 0 0P S  Ѝ0C-@pM P` 0 0|0 00 0 00r0sS̀@ ZP0㓔$ Zp0lS|p@ FP0㓄$ Fp Ѝ@T r@Tp<G-pP8M(@ 0S   wP8Ѝ70 060050040030020 0100000.00 ,0Z P #00R R 0S T ` PP0c# BXPH<p@-PP@M `8@ @ `  5/V@@Ѝp<O-M@ 8` SFf* "R] R^ Bq/rP X"  1!4S 0C[ (00B,0,`"Q"`0 `P0 Q04Ѝ $ \ 00@-@P4MA@P  A 0 P4Ѝ0/000C R /@- $0 0Ѝ@-0 0 0}Ѝ@- 0 tЍX/@-0 0 0fЍt0@-0MMs@P M   @ 'Mލ Ѝ000; <p {dЀ4@G-0Pp4@ )0R@10PTP04@`2S$ ^ SR!  "0 8"0 \PW B1<<10}/ Q 0S G²`VBTW Hm㒕P0m᠕P2!,,!L-O-4@pP M` - P- V \ P\& P!U q?rπⲐ02s0ᲠPP c P0H 0Ѝ`VBTU% O-Pp `D@  40% 0Q@0{+0Y0 @@0@PX-Zl -0p@-0PS@U$ U# U p0UpT 0D S̽\\̽\̽\\\\̽̽\̽ @D  ppp謤-.X-$-<.@-@0S謤-C-DP4@0 | tl pp0(\ @0p @ 0 @Q%@@ ЍX-Zl rs -80@-0@S_D00  R@ꬤ-X-A-@p`P0 M  0  0`B 04 8 <00 00S00  SR000O-0@Poo`#0S Zp`0BT ЍZ  R  SR S0"P0S R00Y0 0 0 [YA-Pp`(@$@0" 0 $ 0( 0,2Q 2R0 002S R02S0(2M 00SM )S"S=  CR9|||||||||||||B0C0#S S0 SS S S0 S , RЍS  0S0000@P    @- 0  W p h p@-0@P@0S0Zk00S00ӵ0Ĵ00p謤-p@-@`PQ Q pP  |l0P00E0, S0Q  \Zl 07@-0PS@ OPP 00S T y k@ Ѝ0D@@$0SZ@ꬤ-X-S@- 0vЍ4  (P \P/ ‚!S Q /  ( 08 Q S 00SP00//p@-@Pp_onUp@nQ`00 Q@-@0@ @ Q€+q @  "2/> :h @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p謤-X-08S^/X-P- p@-@ 0(  P0R0PS 00Si ָppC-@NMMPp< Ѐe @ @@0 p p@;@ PPD Дp`] ࡸNލЍz} ydG-xM` @pᜠ堐%P@J!0@P 0S PU 0 R<\1\!\\200S 00" !PP0 0S0L0H 3/P HL 0RPPT $0RP 00  x@ 04/@xЍZ Z Yd   4ZY <  @ ̯ P h | x N` A-P`@+P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 0Ը-O-`p@BM MP/0;@( Pp@0 Z@*0j 0#;$  g P!14"S; [ mwo@ iU01U01Bލ Ѝ 0RjP 0 000 lg RZ0 0J$,$00l 0RZ 0oS 1 SR 1S  RS1S1S `2B@?0Q 0pSTE 0"0S@0S@@kP9 Ppn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 0 p ͤ 00pN pLURX@-04MHpL` L1L!LLPj@P* T00} 0R0 !?020 20P000204 pk@4Ѝ 0S" $0Q00 L03/P P P003/ dh >A-P2uSvw_10000“b\œ@FҁL@$H @A- P@ \T@@ 8ž\ @T8;g `Č `Ȍ `̌b` ` p PČpȌ`" " 0`q`1~``Pa Hk00`T08BJP08}?0@ T\ Qp`82S @4008 lŽ~?`?̌p0hx0R @Q2T0S X 22040TP 2SXĀ O-P`\M(@p4000PS}2 0\  \^T 0SQQX W@\Ѝvsfb(0,F 0L6!!S 0(0,0 P PQTU Q8b0 RW$4 0 P Z P\ T 0ZbV0V0Z 21 SR 00(040,`80Q!`00 $0rq? 00((2@ 2S01  $ 0jPMW30M@2S P  SR q? r?Ⰰsό(0 8 0 R    X 0P@TP@@ 0S 2 " i02#38( R,00W? e< 00 (0$0尰S4 ( 00q?0" 2o0,@4@@P# 80  02 S02@0S qSP i@JD0S 1H R0!0Sq?r0 8 S  o0⦵u (, ^\  Rt0 I"0o~ς,ఀpȌ Q 0C0Ʊ#80±W,0 R pTlwlh O-`M40P@p0V00PT8T(TT ePV@8:ЍP  0} "UࠓࠃR^PR\ "ς~Ⱀ, 4  0S 0Z000[ 00S 0PSVv? 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@2r/40q?0840800s (8  R    T R,08 S000f0D0pgPD07V50Qo_P0"Pyh0S SP hh 8 @WU 0 o?0 R S+ RQ  0^/ o_S㴒!P% 0 8  ,0 S0000IY0X0\04024 0P*h0S PS @hhB I )1! R0 2<0C00$@" ^(P0T0^X0\0Ph0S SP hh0T2S2Z 00fPR"? 01@22]UV 0>20"S0 L    0 HL H0P LY0H0PSB 0D  g$1!R0 P TP XT\ 0 S 0SX0\04"o0P|h0S A<SP gh<PR#3P8H0 ,1₳H2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0{, R0 V,0/ꙁ h Ը-UlO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 P20 4  0 P &P "#"#0 0D00 |P 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0<.O-bMM00 Q@ 00".;`PPbލЍ ōp H6 P 00@ Pr, W 2S 1S<2<"<<>0w   &      0S!?⧻t  0   d T 9  "aPTRUL&HRQ 0MI 1Z!*??  @ :60Y!)?? 0cpP  `?XT D ,   `e?X T Pd@ph Us@-RU0 @f`d0T `Š"; P0H0`04 oЍp  h s@-@P04P00 so0S  `VRUp ^0P 003/8_oeVeЍp@e+} k h @-@0MP M 003/00; pP pAd`P  oe$ۍ ЍO-p0\M0SQ `DaS@ P02 P0b0@SP0 0HL R   ?  ?/Z[` P `@10d ἐ 09/0P@\ЍCL-G-` p0@PHLR0418S ^ @Z R  0\ X0?Pࠡ࠱000^ 0 G/L->0@-@0M 410810!`0 P0 0P0P`0 H0PU ! 5/ỸЍ0L-ai @- 2IË@ ?@-u@ 0   mjYEă B'@-@@0sq,00p `0Co|+'t.-$M ?0 0 ᮊ$Ѝ0-4M 00 000>P4ЍO-pOMVF/ "(p&L6 `0`00( 00R00 0000CS00S0000"R 0ş `0$0000E0S 0s 0SOߍ0S xP \8aT50S@ @%9@45[07m 5; e 0 dXd80d$4@4Y-IP IYڙ$8$壒I x$d l$2@ 0Pğ RSPS0 10$080d0( pR00PZpW=  3h@P0 D3P@U0P0@ 0P  0H3P@0 U  S  Re8 "10i 0;#;Z0S;#;0d|."?;#;0 #5;0?;#;0@#5;DEp" <2 @ЀX02|d 0R$080P$0 0 0 XP0X0'!@0S80d!@1 08p }"%+0AC%U[0DE0S00T!0Xh $c 0 0  0 0`P0P  @`<80p<Pd0 t ..h..p.`C`.\#X.Y@^;x.QYE e;o;.A|;;t.;@~:;Lu @-@7@SRG-PP700@ RPąpP:<`X:00X 0PPܪ @-P@`pP0S -S :S S  000`  0 A0P0 ЍU0S500T   cPI'p@-P`Ňp@  ṇPчV@70@0pp@-P 4`ᭇp@  ჇPṇ@p@-M@ p$ ЍG-`p@T/  ePP* _P- @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0p AI @-3M M gp 3ݍ Ѝ% p@-P@@ᔈpPppA-@Pp p` j ;0W0 t0WpX U`0\0P P  0h0@ TЍU0 0  ͔9YE @-`0tM0F?oP2p@ }p>  p4@tЍAp h2Sp D0V#4 - Hh"$pp@-@0  Ć0 S " 0PUPUp@`0 S  0 0S ``0S   0 0S ``C-p@PM$MU `0S@PE8  J0P00ۍЍXھ700S @ Q@BPE@C0 00 p 0S 0#S @UX  ɜ ۜ 0@-MM@ T pP@0SdۍЍ0 ) p@-d1@0S`M HHD! R>P0  0  0 DžpI0 S E09S 'Ѝp0 S   000 00P0 PS @ h0 ] pHPn  Ѝp@p = Q   p@-@$`P]Pp0 @ `P0 002 0pp@-SP@`xM  Aj0 0囅p@) ㉅p$  Ⴥp }p  wp  P  H0  p(0xЍpt ef  0 0 s@->@P`Dp  t0@ p`` P01p  80@ pЍpv  p@-@PqP  01pPPPeq   0#1pPp60@-tM0 p@ u pP@tЍ0G-QM-700ۍ [  Y # @`V 唄@pP`@-`R 00GPp@0ST]@PT  Q*R@00 S   0 0S0 S *^P `^^  00000`0 @@P0  Ѝ@-@@~ ꄅ @-p0M0@M0$,p Ѝ  ꛅ 3 p@-P@ ` 08 l, @U\[) 0! 0 008 , 81pp@? ] ՐU p@-`<1P:<1x1S0p0@Tp 0S  00:00L1p@-S@T1S#d1S.RU9lRUppbV:l8^lbp1C3^L10CL1L1PS+^0P11C%^T10CT1T1XS^0X11C^d10Cd1d1hS^0h1$2,P0C2bV^bp2,P0Cp27@-@0 1PP! H1 0D1]<8@ 8@   (   )    , A Ѝ0@ Ѝ0Q@-@    bZP p 00` Ѝ@z Q  40@pЍ@ Ѝ 0  Q@-@    *P p 00 Ѝ@J 1S|70|x]$[P| 0 140@pЍ@ Ѝ  @-@p t10cSt14 Ѝ@ d 0@ Ѝt 081/@-@` (L0S K P |080H0S S@ 'ꔝ )O@-p!@RM Qt0 p< Ѝp1Sꜝ 0@-80@@@ PQ7@-@  ((J _ Bp 5 P层 Ѝ0@ P 11P+|1@ R  |~'QPEUQ |`00CS`0 Xe X0@p 0< Ѝ0@ X0 X Ѝ0 υ B'0B'0  p@-PD>p44p@ @p p@BV w @-@T 0S x@G-`P.H0$ :0 0 0100 & 00 0sD00,PQ 0a(!"4a# S 0 >Q & uPp =W  g080~P040Ѝ 0b"!4b4#0 0S %/%p0p@-8P`J04  :0 #I0 P@p@P@  @Tp@p@-8Q$0   a 0@ X000U0X0S @0 HX 0    > C-`HaM0@  ЍPPf p0 P  , ~pmP. P P/ P4 TkP= P8!885x|(!(.Q0S000 0 00  `  D!\10B0xH1Jx xL@ep` KPʌꘆ  z K T   .* 2 < W D \ j r @-@  ,=~p cP<1 ,,A~0,1ЍP0@D<1 P$5 ɟ Q/@-@  0S@C-qp`@ x @PP00 Ѝ 0S  ]0 Sx   0` 0+ Px}` @P '0`0PEX  xq PP 0S  '$0$0> > >0S ** V | 0S 6`0 S   000x1  @  0S T 0P0 S   0  $ : 0C-MM000@"0~p 00P؁+ L}P`pQv07S 0 S W h0 0\!`1 `Px1 (ލЍ Pp P  R쀟쐟PU rWxx x 0 S   x0  pP 0 Px1p  P  0S 00 Pφ N ] hHQ@-@  \\,p-07S@Y&0 S "0VS@k A-`R@p@M PP U 700 @ЍARP"R 0S 0 &r>XU$  *{P 0S <0 *] p \  <0S <V>P  *@ЍA@Ѝ   O-@PMpP  P 00A ЍOxP{ h@P000 @@T >T@P`@`   0 00V``I@ᤓnV3#`` ``Ypp#h3x 8118100x1@T+ {Px1@F 81181kQ NQ@ 6Q`4Q`UQpQ xQ nQ   ` 0S 0 @0P 0 X [  p 0 0S@T81181Ѝ 0 X [  n p0P 0`` 00M0 :0( X! 0[@x P 0S 08  * 0000ST Xxx0P 0S 0000S0 x ( / ? O X ;'( m @->@T( "44p P`0y"@"44 0pW oUL L0 b"!4b4# 0a@> *\>@D Ѝ耼p@-p1PSM"`! <&@P T 0p1!V 8U@ 50S TX~RP @wtAtЍpp>0S a0x1@T l1S W  @>0S@ J`l1S   {0 @ q,P 0  @  B.(0%p ,.l1S  \#\ ) L x 0 R/ 1/./A-@P 1 !  wXSpR0 qP 0`0S000S \ \JRP0 S   00S000@00P10 paU0赩 e Gé P@-|0| ||)q@0j00 R 0S_0@0 @ 0U@00굩 u é p@-@`TP\@@^0S\*\P0 0SZ0 5Pk9 <R0p\@-`pMP@z (0p``FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$P1P!PPWD14!@81Z`P(@$1! 0S0S0\,0 0 @T0@TwQ@P0\400 (P p`P,00@,@0S  0 S0 0@@굩 é  ʚ; @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p|,p0 000"#k ЍMb@Bp@-P(`0 PUPUR PU PTP,PP@4P`P4\pQ@ 굩 é P)@-0 0PT0/ᵩ é P@-0 0T0/ᵩ é //P@-(0( ((@008< D0赩 ʇ é A-(MP` 1U0@0$00 0p@000 0<0S exp(Ѝ8010C>S@( ( 03(00@000 0<0S80 p @L. އ Yé p@-XvQ@P }ypPR@p0P@ P00(P,000P400P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p &x00C0jRPU 0`0H`R0HPLPU0 P(P0P0V00 S   0HR0 S ,  0?R0 S 4  06R@-@@.RC-@PM pb异T0SY 00C01@0S D3/x2x"xx(PU0S Pm0S R>0 S ,  003/00400P4P,!0  P0V0U0S6 L0 S* H劣P, HLH R# 0|S0   000 00!   U 0 H}L0SP(pz0Sv `ЍT0n0S R 8#8 PEQ 03/UT YP. é @-4 0.$@ 3p t@ЍB'@-`AM4 MsPp }x0  +p@ v@Aލ Ѝ4F P ڣ# "P  RP# 0 ,$@4   R+'B'-@-   Ѝ Ѝ/@-MMP`@p0  R 0pۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-   ЍЍ/-@-  ЍЍ/-@-  i ЍЍ/-@-  ЍЍ/-@-  S ЍЍ/-@-  ЍЍ/-@-  = ЍЍ/0/+'0/+'p@-AMp )vp@ PA>0 dSV 0@0Aލp P 0 4Sd+'\#0/+'0@R+'p@-@PP; @: QT RV00pp+'B'Q@-@P;@@;P@-@p up u1S"@)PJw@-@M    0 :wp1$0Ѝip@-PM@`   0 T!wp 1@ R! 0 p`Ѝpii$0 /H0s P/0 #  //A->PXMUV0P0XЍU700p@ `R݀0 PU B0>000 <0"  ,> U"PP> *8 @-@T?@Q/I@-@T@@0Q/ R0 /RG-`P Mm0(0S @ bP P [P:v`P 0!00 0   08S0 C00 Ѝ080 700S # `pP `P0P 0iS.S  `P4P 040:SI'O-[M `F/@P09`0LpP C PAp:Np[ߍ0S00 0Y 0S 0Sa0PP0 $ P PU0SB0$P 0PSP0SPP@T1S<@\1S`1 $rP=\1 S S RP@L1SP1 $`P-L1@COoSB@$TP!P"d $ `0s0$~P<1P X1 $9P@T1SPö@@00SLATd h1$Y0P0; @T$9!P p$\0P0M@PE  ` $5 0[$0E  P, h0 S +9`001P d0@up `0 D000S0 35S S  CR0UX LPS y R 02 > 0*81 U48#88 S R 2 p (S 0 S U  R P!0?D0 p 0L0D0}>D0 P 000H0@@@ q^ i 0@-@PDM QP@T 00!p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   b=@P @-V000Q/Px1P/$0/0@-@PM   5UP 0 0pЍ00 Gti~i@- ` R@0$Mp0 PR  RU U 1 #  0PP  R@Tx!@T00$Ѝ R @s@-@Bp !p !p` s-88 Q  8A Ō8   "  0Q5ã0ã0A-`P'@P─@Ѝ ;P\LLP0 qU,P pP   O-P@0p"S0W"SpGP Y "`P vV700 ЍT VL70`0Y\ T00W YT X0#0%: `T X3#: 0\Sf0`xSmS0SD bS S\ Tn C RQ@Q@Q@QQ@QQ@Q@Q@QQT0 PT 0 0T 0T 00 0    00 `` 0S& T  L0P`0 NRU`0S  LT0 P0T0` I'P /0 S S /S/P0/S 0 S S/0/@-`RpP$M 0SU/ᦳ@P 0 00 0  G0S h$ЍU 7PP, T/00DU 7 O-p PP ЍO=f`P ll ЍO=K@@oY44KPP  ٜP? 0QA00 Ѝ K@ R`@Np 5J0P& 0 @  0p00@[ =  @X  TP0S w@P7  A-@P,p J` 0e SP,pJ$` PP(0e S$J0(0$0PPO-4M10C`p@XP~S |o}}o}o}}}}}}}}}}0cLcdccddeee,fDf\ftfzfz0g}gzzzPnn}Ho}}}}}}}Y ZZ[zz,[[\D\\\\z0]^z^^__d`(bzbb}X qpPrhrrz pr}}}rrsopDq ss8Y<~szD{D{\{{{t{{oo{P| |8|rr]} }ts8}_P}l}}}}}p`HUV ~pP`p $PL PћP L6P L&$ !rP`0@T\0S @U00 @ SpP00p:P  ,00K,X EPH0P50UV H0 |5Pp?0P I 0[@PPA t0,1PoGP 0 Gp 0S PI0P1H0P 00U  AFPUH0P70 0BpP<@P! .R$P0R77P0U  0pP HRPU H0@1S}@PoH0P00iU XOP0HP0^ ,0 00 0  K,0SV  PJU ,0!00 0 ,0 S@  vP4U <168`vd0b儒000 0 PPP00 0 P  p@0  @P  FPU] <18`vd0b儒0p00 0 PP00 0 P  0@H0P:0H P P0P<0UH$ 0S! /ǰ`P /°`P00 V /0P0 Q0P0<0000H0P60U ,0 00 0 FJ,0HS  Ph7 0 apP sPx 73P@H08SP7SPgU ,g`P 0SL PXUA 0 9p PJH0P580C x050,08$ 00 0 ,00,PY gP%`$8_PhX7008 A $;84@AK0:9PP88 0A  ;op PPH040U 0S 4S 04S0:006S 06S090PU1 ,0 00 0 I,0HS PU H0 PSPPH0P;00H0P90U ` xP`,ᠯpP (E`PP0 &] AiGPH0Q7;0UlQPv ^P0Pl1n VPPlQg OP0Pl1_ Pa p`F0PPRp1PtLH0P00FU10HP2?'P0HP25P 0HP2+P PHP [PH0P00H0P20 0hU3 4 00upP20S;7P0H0P20H0P60H0P;0H0P80U6 <18b`dr00 0 P000 0 P0P0P@ 0 @U <18b`dr000 0 qP00 0 gPP00 0 \P p@U =ᇮPP| PPXH0P00̀j0 SP P`0P<00Z OP XHP ЀM PQ L OPXHPԀ>   OP  OP  OP  OPXkH   Pꐮ + +' V ] j  W Ы 9 $ X  t ]?R  Ҭ ެ    4 = G L [ h  ]  p + ʮ H . H S  f @= X s _  $ * 2 9 A w p 0 i |  : R K PP  p($p 00 ,p 00pP $ ( H,8  K P  P~ OP,X H(   Pl $p pP (( ( H$8   PX   PK NP  NPXD ,0-00 0/ F,0HS3 iP' NPH,X蠄  P/`P 1PP V00 ,0 00 0 F,0S 5P/o" }P ($3P/P0HD H(0mPE D6$ H! (0D&P0 ($Pd/ɬP0H< @(0NP& <6$ @! (0<&P0U H0 XUPXH0P20H0P 000XPH0P00H0P00H0P 00~H0P 00x(07600P2  *6P50S00T01=5 =5\PHPXU <1Z0@0P@d6`&PM +0S8P=U HTDPT:qP/U 81 800cP!(0 00 0 E(0`S,T7`( "4`#, ,H0P800 pP P0 0P0 0P0 0.PH0P10H0P10H0P00H0P50H0P50H0P00H,';P,UH0P90AK&O\0U`0 Z7 `PPAK⚿OAK'OAK⡿O0 P  ,00@E,0 S  P}PP S PtM=tPDP PPp` PZDP`PPph HDP PsPpj| {P9DP pPaPpf iP'|DP ^POPpl WP jDP`  dDPi 4^DPl LWDPb `QDP#`Y < 00   ;  l?o2= Ww P(DPc "DP DP` $DP` 8DP` L DP ` `DP@` tCPh CPd CPe CPe l CPe CPl CPg CPg CPl| ,CPlv @CPfp T PbPP0x0CPpb pP ZP0, ړPP x'BP?  R3  R0 0,PSP00,0P%00 0$0(00XH`  p 9@  dZ`0PP ʎJZ \0PPZ Z P4ЍUU )`P00,0 00 0` C,pYa PP$ 0  Np`E 0S:Pd?P;  0=PH |V0PhAP`&|6xvaPPU PH6P06H0P"800H0P80H0P7 00H0P70U u6P0Ph2h2S\PxH0P00rH0P70lU `P 00`IP@ BP =PPSPSpVPpN /P *PDqPpP8H0P402H0P30,H, 4P,%H0P20Ux  0pHP9PDH0P00H0P00PV 0U0F p7  PUJ \0@T$(@<4'P Ư T : @ O-pУ`P@80 P 0P0| `gV<1\ ЍOR$ RZ< 80,040 ЍO Ѝ ( Ы TO-`S0$M; @ 0QpP  80:0<10  0H 0Cp00   |    P0 U  * 0t0$Ѝ;'l m ( X.A-PQH1`Sp51Sp:x1pS> P)@@'@T%@`fd6S?`@hfl6S@h@pft6SAp@|f6SB| @f6SC@X@A@@1pP??1pP?X  dP T0 STd6,`0Cd6l6,`0Cl6t6,`0Ct6?6`0C66,`0C6O-MDM` 0~>P ؍DЍH0 3&7 000000 06006]; E0v00 0:0030 00% pfp 2e +8 0 0 00 +0,g0 P#Z1E0B,%>P0`d6$(@OP4:@0t,0@04CMP0/P,`6hv2d6`2dl6u SLP,h-?pvt6u SFp&?0&h6l"&l6p6t6p"6680@ p440! ^]0P0P ^000S <0080000 0070)0@00S 0 S S0P\S @PP@000SS D3@ P4400  C 0?oP20@0000a l p@-@PQp;@  G-`PM@ P `ep, 0 *e ````9e1pW`0쀟pW% $e5 0 0 N^@ dT  '@PЍ00C>S`"P!@03@000C>S`"P!@03@0X 4 P T -3@- P 庲p @Ap@Ѝ0@ Ѝ/A-@RP0p`@0S p A-0Pp`@S:0SS 0  RT R0 t`V1S* ZP a 0@DpR: Q S ,  $ O-A 0MTP` 0 zyR?@PA@@081 0S  vp 00tPĀ nP iP dP _P ZP UP |PpPp 0S ` Bp P61@ R <8p 081#?I00 & &)p H0S% S% p D p L p $  p  pw L0S p0$0M0p L pe t0S@ 81110x1Z9m?p M NP= p@ dPG0 `dX$k¾P|$| p+ ]d p.#p_@t p 0S P Q  Z T  ?p  #?p}P_ xPZ sPU nPP iP dPI X00S 2"Q`` Np  Hp #%P 0G%P0 x1`40  3p X00S1XppW@0h1SP,rSbyp@Qfa a! p%P `V%R pr0S   pg !tp`p0S   D pS 08! pJpPD 1 R 0S  P6 Ѝ 0Sp pnT )O  U ĵ pu  յ   H % qg  \#Nu 6 ? h J Z v f p@-P@pp p@pRRA-P`@@pH0s  S  U@ p@@@dW0S  R H R U@ p@芝 )O Q/p@-P0U@ST` A00p >P@*i@T:pz A-P`1pSAT  p@thЍ \>PЍA!R 0, 0 0 p@ F@ap쀟V 0 !p@3`P fp0S lt"00#40  LL!D SP U6 0 (]  n  07y  @- @0P PT00Q  DA-PP 0S @0lp0S @@Do00 SU V \@ .S0.SW0_S-S!00  ?RC"0T0 0D0I'P `00CS`0p S00 P0S X0X /X?=0B'p@-h1@SP1>PPE @p B0.SSPP X P HP 4=P 0  .PP) p@-@P'Ua 0 |;0 l;0 \;0  L;0@/8,0)(&  #@       {;0  v;0  q;0 l;0 |g;p@ M KP 9 H. # ) 1 8 @ G R ^ / h o v {  + 0(ƒ -\ lp Q^ ,\ ,@-QMM@pPOZp000 *QލЍA. !. d0h p`0SPE@Ep 0S:0@0D(  O-4M\XP $0. `( (@P34Ѝ0S  <P@ < 0P@,p,$0,PGY P,p0[1200 P,p, R P 0 0 4, R, R0S ` R '20 P 0 0 pt4,0S0S ,P! "`B,AQ !!!~  P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-`P@MpVV:U 0U00E0S00T@D@@0V00ЍPW&"0$?S 0[ `W R``V?R 0U  P70 0 .0 IP0 0IV:D X0 0 @UR  ES`O-@`0p 2" Y*QP T W700 Ѝ%P@pG`  00T W 00  #P     @ \Eo   ' U/U$}\U0 T WPPT W\%0P00PPpG@`T W PpG`~I' C-RM MPLp`Hp= @;p5 9p V=~p : 9pTF    0 pIp P: IP 4I/    Rލ Ѝ   O20V002 0@I p  @pP0P@T*%p0S4 p`@T*T 0 O9p @ p   0#$$("( 29pn @  0d#$$(B(   04!c#!$c$" 9pN @@  y 0b"!4b$#  leH    .0I/P+ I/8p% 0S @00SP%@8pB00\#  u7Zl C A- @pTPM *{ЍR` R !00L0S 0 -0 0p0#0M0 0$ 0V 0  0ŷ ߷ O-4MX@`\00 0S`pdP (0S:0 `pp20"4ЍO/ 0  ,   p0,0 ,0SCT ,Lp 0"00,/4ЍP U0 000!0   0,`Ep000`!t p PE, 0 S(0SU $0$00 (000 $ 0S *}SP @TPjP@z@P@s`p/0p@-` (Mg00>0@SP  '0x Bnp0  0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 xTT0S (Ѝp0 8P 0T0S 0xcPT^ A-`|VPPFPP2X@p`Ex-P x倂|"x20 V0  |2P|R@-`@MpP!  ( (xX( 8pTPU@ T700@ Ѝi///0@-M @ L+PPЍ0 3"Qp 000)00YTp000@ 0|0KTphl 0 0" 0?Tp8 YTp  ϸ p@-Q@p SP-0x1p@K-p@->`FMV E0P0Fߍp@PF/ 9  02xt01 0 `/0 HF?FTP 0> *!0 F?8T ii@-@MP4@ $ P P@Ѝ0 Q@-808 80SSL`/// P  $0 /Hp/@-M @ p000p0@0M00@-P@,M(  ~  w PSp 0 00S p,Ѝ08i(p@-@MP Z ` U w  (PSPЍp:iC-PQSM M 3 #  <T0S2"`V2"@p@"(0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0yPL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@120@ 2T@@D@@0@L0 X:   @L0  XH@L0   @L0  XP UPPEPP@ D$("(VQp`Sލ Ѝ  XH@ɳ [    C-0@`p"M 0 @@ 0@$@hup@Ѝ P@ H)PP @@  0Tu@p @@"+00X :0 (P|Ph (v nY 0@T*x0X*b00^+@T@d @-`@DM pP@    Kv!> U 134  4R2$ @0 DЍ0Ui@i*0@-|@QM P Pp |2 0"x2QЍ0@-]MM`#Pp@ P@P -R 00@]ލЍ0S0S S SS wR@T Htp@V@T@S  CRPS @@ @xpnPP -$0 Bp 0S$ H N80Sr S~ S00,0S  R000@0S  R00@ H P 0Q Hu!>50H \0QpY0S 01S XX0S|0 0 000 0 0prmPg>S S[  @]PWx@PK W DPA 0> HE@kQTm50S= H>M P N0200S,i@n @-40 000 0sЍx 2S/2S00/@-@@V002@-S0@0 @@V0002S N/ယ G-PM`p (PPP(@PR PP`uOp<00 ⶓ hOpP0S p Pp PU0S p aO)@! (t( Pp | PPp 7/PP Pp 5'P Ѝ@- 6 qB@A lBpBfB@G-@p`0M00PU  O0S1P   b P崡 00S V 1!Y0P00 0JP0 PPP0PU:000000x Ѝ@-  NP ЍgBp@-0M2S`P@x (VP@0 \(&P00ލp@ ꈚ B@-P`2$MS0@p0  0*000%TPЍ 0p`HN$Ѝ@-@~N (@(@-@pp Op`~B 0`( "4`#/p@-^@P T00p``0@D^"000œ\p@Tp0,R00@- \!Q0 # R0 @0QRO-M@@0V0@0Ѝ`1Q JV00Pp0 , Q :@QpSI 9B\> \ lP lP U  Z4\[X\T p Q*S0C0 $'P 0 r0  0 @S2T0@cSc@-@ 000}P 0S00Ѝ@-@ 000jP 0S Ѝ@-@ 000UP 0S  Ѝ@-@\0S $\0\0@-@`q0`DM0`0@-@08T@@0p@-80@P$ >Q! &Tv0x1 RpR 0S TT0Q  >0S ( p@080vXTx A-p`KP&P@00<000S@ (0? <@0K0cSc0O-GMⴀĐ@pp0 m00KC%P`PS d0S  GRW ( Q  R `)Qh 0 0000200> 0BS0* WW 00 RS00T- $0K0`C8`0$0P DQW Wd\ h P FZ <($/  8 FQ @ p$Q DQW R <0S @FT60 0 < @W 0FS80 0 |@WWW 00S 0 84S 0 FS+008$A 8n840@W]0  0FS20 0 [@8 RN  FR3   H 0FS70 @00 0", Q2`6,0d&Rj I0Sp0 m?0S< L FP081#<111% 1+ WZ W(,  PW:@QT; 0,S P T(, "   PW: ART ,000D0C00s W00FS90 00 C8#<@73S Y 0 FSM007# 730@(1S 0 F0S=00(  (100@ 0S W02S 0 FS<0 0" n20@W0081 0 Z00 FR P0@ )2Sa P 0 FSQ0[0 02 0000[00  W 0  ^0 0FSst0p0p95SG 0 FSg^009%  9E@@6S _pp0FSS|00xM |6S @000DKP8:Gߍ0P0 "9 0F R-0    @  0FR000S0 $   0 000p00, ꐹ cSc25 79ǹ s@-`\@T Ѝp PP\0S t0t08  PP P 40p$/' P X, A-PR1!@ `[P0 p@ R1 0R00 0N 30 0 0|P0 0:0 00rP00;0 00hP0060 00IP00ЍP 0000t 0 001p0 00%p0 000 ] r A 0@-`0i0 MSPp$M 1 !p qIp@0S i `*i@ 0 P` 8QQ050 00pPT!P4 ⢿ ۍ$ЍL 0B'$c g y @- 0080-PP@ `V@ @T /!@P  ၿ00ЍpO-IM PpsPHLL `PR  !@P0IߍOS#0,0oM#600 0s400` 0 Xp00,0 PS2 V30a2@0 0 ,0IT%;`0 P ;뢯@PbIߍ@;0 Px VT` 0X`0T:0 4`:Pꑺ r @ N O-@pP`Q`,R尰,P2,ES#P㔀U`,@ ,*P*, Q 0S, * `,P0| ƺ κ RO-00"`p@PT:p ЍT  X ⢱00U *"0 p0R0  | @t:0 +p  ng:  *p@k Gm @-RM MW000 @`TPC Tp@ E00 0p"  8p ۍ Ѝ D3,: *p UPUn jp\#@-0(P  Q S0  00 0PЍ 0S 0#O-04MS@ h@@ 0P 0_0? 0o0  00 0q`P3; 0T0 @ 0P0 00 0^`P 0 $ ( |Xz(pP  ,ⱽ$((%,8"P`@ 00 y05`P2 0 0S0@0> Y000⣱  Q*{"00pP 0$00S0(0 $n0 i `( ,c(0st$(,8?P@ `0S 0h0 0h0  T0304Ѝ 00 !0`Pb @ ]Y\ $' ,#,0`S pP@,0$S  S StW0P !R "R hFp( $l(i,8fP@ֺ YEں O-P0M@040`0`p 0 ##p#X; X8l0S,0S,0儒0嚘 2S,08`0嚘 8d6S,0l0嚘 p"R㄂0,80,0H00`2 S,0d6S 8 0`pߍ0 0 0$p $  0lp 0 0 0(p $0]8 0Xp $Q8 0Lp$(D8 0h?p#0z0,@04l0R (40-pl#0k@0"04,0@ 40p]]dk,0 !P !,d ,hS  R,  P ,  4! 0  0, }R, R 00-0kP ,  B, 0 0 !P ! ZP ,0 0H0 0 0,  3 ! H ` @o p@-PUp@0L0pp@- P# Mp@ 0` 0 ` 0SFp6E@ Ѝp ` 0EFp )X` 0=Fp  !00; U100)FpO-`@p 0崀SP$H` K000 0 0 `00`0 0 0 `  $47 0Z0004H081y lH ЍO<0 $7 0@000$4@0S4H000s$80407 -S <000800S# 3DY840S'0匦 3:O40S,d0S) $0P%h0"6 00@S:p 33 88 S0a 2$ 4$6 00H0S0SZ h W 0R<0S 0Sd2`2H000s8040 P@24 P,28 P20 804 00@0S0i 0.0 0Op İh` 0H)  P0dh0 Ѝ0SD1D1 P0 $i08   00S  0R`V dp`h ЍOwP 0Iplp ЍOXꁻ Ļ ˻ ӻ ??  M  $l  ʝ |. A-@PT R0A }0p8` l0 R 0i0P 0S <0S $5  ; 5`0 P ` ``0Hp00` 00`8000  ' 00 0$00A8 % d0h0X O-RP`p@\M@P; 800 #3P 0 RT0} /p` h@@N 00p 0  0@P 0~L EY P 0 \ЍL0S0 0@S@0L0L}8OH@P 800 B2 R 0@Ty|ɥ  T0d$d0S  $ P $0S0 <Z- z 2 0;1C<18#<410,00000400<00@0,0D00 <$@(@ A8`L@P@T@H0`Bpx us ̸ h &hD! (",$0("(  0!  7E  N@ ` (",d `&P   0 \`vK 돹04S1SB081X0 37S1 0 6 zDS C DC  @-`@pP`0 h0X T6S @d0 0 < ` E4 0o Ѝ@$0  p 0 p@-P@ $o )0 00L0p@  p@-PUp00CSp@0@ $ 4  ( 000L0p@$$  up@-P `@p5800  B\000D 0<0L00p@8 % = a  KPA-P`@ 0h 0R0tP3 081HAp` `P08!(0 ARP D   C EPh0h hhB 0d 0 0P0 $Az A 6   C-p@ PR0  R $ RP608 `S3  i@@ R PP  P0  lH8!<1$?'((700 Ѝ@ 0ܾ 4 0@-@4M8!(040P 0S 0 0P 0! 0Q00  000 0 0 4Ѝ00 v2  4Ѝ0@{ 0p@-8 PR@  |0P   0,Hp@gPpp@z G-pMx0 P@81P 0P`00P 05iH00P0 0+`0  M(W0(10LZ.  P(_ xJ0+ 70I (PF  0㰷 4 K`PFAL` + ```0 A ЍGL   0tP(+ (1 ( 0(t!p>```P( `"(1* (> >Q  0*f  6 ЍG1l  ЍG 80   0S 0 00 ß Q  $ S@ 000s  i`Pqp 00 P R   0 00$0C40 040800 8ꨂ0S06 PU R  ` h L0&0 PD ЍGp0 F|0 $f1  0Sk 0Sh 0Si$V1  0  d0S  0R/.0/4 O-0M00PS㴐 @pT0`S 0 tЍ> R*j=P 0S D6S<ƚ Hƚ[  S[0  0 @!  Q 0 S:500 0`p00 0  T0 S 0 0Cs00S0 xS0L00 P!p 0 3 0 0 0'P0 [0S?60@ 600 0!p0 0 o P`P t !0 S\ 081@i@(6P GP0S0 0<S<0P0B!0 0 3 0 0 0P 0S6[[00S40SH0 h  PP  4 l00 0P0SS0KSK?3050$`0 [ xiX0 p4 @SS  00Cs00Cs0 (> $P 0 0 0S  0  3@0 R@ $ D 0 0S:0<08 0=0: P0 P3 000 000 {0[P00S* P )   p @ 0wZ600 0<P0 4N0S * mP ;  p已81 000H 0 000 0p0 c\0 S   0d!,0S  0 @(,1 0S S0 hS 0 80Sg0 00 P0PY0 .[ P. p  7 N j z  4  [  ( : K h RA-P@`(. 0l A|`0R. 0 D0BSpb ɱ0 Av $ O-`pRP 0䘠x1@T ЍT 0S R T0 S> R *:P  0 D@ G-(M@PpP Q0 (ЍGPE  ~UV`0@SR ZO "448#8UH:`aVD0UA: ⦱1#ĠČ Ƞ,Ƞ\5 U2:1 S/  0$    00 Pp   ℱaV Q ppQp%  !V h-  L(Ѝ "448#8 C!B0#" ) H @-` MQP\@M  0p000 p 0S TH ~ ۍЍ 0Q`V \@T . $p@- P@ P<p@`0S0p@\0Sp0p@; A-0 ;M0M`pp@P @ p0孰0<000C$00(00$0C,00@pV004p8  XX8U0`$0 0h:p ݍ0ЍH   p@-@PT  (@x1S0pSq ,Y:02p S:02022p R Rp07@-PX0C @P 0S0>8 Q'Q'+  A R "'     0 #0 Ѝ0@}^FPᵛ@F 00 a@ 0 Ѝ0zDe p@-@P0( Uph0Spp@O-@`PU Q Pd0S  0 4Et0 d0!] ЍP0.Q 0S 0P +  08p|0 !봐8 R0, 00C0 080<0  hP`00 0 0s0S $0 pW ! 03 0 0 R0H0@S 00ppW\0H0Hk   p⒯00 4 $0`( "4 `4#S /0 @Rp@-u00p0`PQPE@ `  @d@DLd@pP/<0`( "4`3Z1S P///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScO-`x1 @TMT. 0S pW$  1 PP@0Sh0S d0S4$0 d0 0S PPTЍ|0d 0|00 00d0 00090B ǝP Up8sPyP ; 0|0 ⣝PP$0 00 PP 00d8dX |PPk ⚝|0d 0|0XxrU v0S P 8pP   L U_  P < $R R0 0#  Q  ;P h % < 6  `!pP> t0<0t0#0 0 8dxQY X P &uUp pP ĠZ 0$8 0  h % <   <~H ! U *- Z p@-P dp`E01S A0S =0S 90S  0 @T 0Q0 PSP 0U d0S0h0d0p@ e  0dP/08 /   0S/p@-@T PP@08pr G-Pp`P+@Ѝ0F @P00 4v@P 0P000000 000(.0  z$00 pPP(0 广Cp0S t00@ 8P  0@R 0 0000@@ꀜ k c3 s@-@T`Ѝp`PV08,*:SR h0S NFH'?$`  P (0Q,0Q  U `P ⎿800000( ,0CP'0S  0h dd0S  $0R  0h0d`0SHH  0S/0S/   O-MPD0R8<`@H 0xP00Ѝ>pP Pެ0 U@ UP R R R0 2P!4m @PЍO p    @@0 0'0 y0S SY00 0000000Cs ^@UЍOꍜ k 0S/G-P@M T 0p `x600 0@0 0 @e@ЍP/@-@TP@P0S   0Ip@-@PPP @pq P03 00p  Pp@ :R R @\R @:R@.I'P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0//'0@-@A P:^|^00^0S R  B:PP |P0P O-CMM`\4!SP I SKEpWG X0P 0A@ M P 00o@@- ;040S0  00,0 0= zpP 0 R0 :R00H\4 00 0p0PP u 0S 4 dCލЍ P ;00 0PQPV%0 00 p0PP@0S!+ 30P R  03 0SG .@+*@P 3`P0 0 P000 SWB p@DW:SZ @\Sp S Spp00T:C P@D  0ST 3Qp00@0` Z@S 0#SS XP@@0U u:00h00?P0 0Q :Q0, C B  RpG:R:   H J B[$00 PC P[ P$0 @D pG H  0S Q30   @p P D$0u$0 u0 @E 0S 23 D0A00T* P 0P:SZv./'Ia @-0  0 Ѝ@-(@ P %0 0.0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ {0Pv Ps @ o% Q0P ލЍ {0P P 0@PT%0 PP U LP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0S@Z\R    B{:R|R  .I'FM p@-@PDp@NG-p= @P@ d? Pv 00@^S0S:S^ `00A\S`0S:SQ 0C^ 0@0LT1 0L\TS`ASBC\ PPOPPOOOOOOOPOOOPOPbC ^0 0 0 0 R@AdY P3 Pd @0:SS0AR0@A > P Pd : A-p= `P@ d PPd0`F 00@0S @Ad P Pd0 :RRAS@A  P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P QP.H G-Q0S`pБʯ CPV00b ``  sP00CS0$ Pp0 0 S  GW00S(@ kP  9 , 5P P00SW  X  R00S 047σ,P R   S@T P R  ` ЍR . ..@0@-0S uP \P. $.@-@SP08G.p@-P@PPpI#Pp.@-@=P  K(0@87ST. $.p@-@ PS P@p p@-@P  $(0@87ST. $.O-pWP`@P @ Ѝ0S K P 0坢P0T  RT1@ S //////0@-4@0P P8$.S O-`@0MS8 Pp,pr B>04@`ll`F0SnX 00$0S 8$ ğ0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 `000,LL,`4| ,,`1PPDpBލЍ <`P *-P 00P`VA C9R񟗈i(k(k(k(k(k(k j(k jHj(k(k(k(khjj(kj(kjj(k k(k k(k(k(k(k(k(ki(k(k(k(k(k(kj(kj(j(k(k(k(k\jpj(kj(kjj(kk(kk00L00&0G00%0B0L 0 R0C:080S500$0000S0C*0(L 0 BR#0 0S0C 0L 0 BR00'000(0 00)000*0000000v 0  0 S !@5@% |YL@X1S*Q00,@T,S@P h0d 0B1 P 1h L0Ct(.G-QT0So:\0`S' 2@c@Oop @d(0d$00@X2 0S/ C00C0Y %Q *0S  ዞ 4 80R!:Xp p@C7B @p0D d@/o<@@@D@ ,P J 00C0FP `! @Q0  b `2!! 0 pp,Pt(./'A-p @@P`P PP0`0  P@lj%Q *0S  t(.$00S:@-@z@Rt(.@-PP` U(0SP@P )@T \0@T0T 4/5 00'0S 0 (( @'Ѝpt(./'YE ƦO-$MPf@K 00[0SPs )P@P 83@030 4/X(0S@k@XEPT[0T@6 0``X1000#03,*[ PePB RP: 0Lx@P6  KLp 0% D2 10Y0E30 1%Q _*0S \T\1)P@ PY 1@剞1 ꇑp K@D;Y202 K 0 PEP H1 L05300P[0[PK PPe`P @P0`0 K E K  E@   @\%Q 0@PP0'0S 0 P0@ '$Ѝ*0S @t(./'YE  (.Ʀ@-M@pP,aD(0SWTP )@T: 0@0 4/0#880 ᒘP0U/@P  㾜'0S 0 |( @&Ѝr@P %Q|0S0S P 00t(./'YES ƦO-PQpL$M(0SP P^ u@'0S  pP@&$ЍW 0`UP\ U*P* 0`0  `?oo 0c `S @P U 1e*᠜>40U$P00P03S X 200301S%U#2QZ F*0U00S  E,@P 00P@P0 0#  0|0S0S < @p,`0<0 0 &p@  >@P! 0   0%U#2QZ J*0U00S  E؛TLP )@T @0@<0< 4/@P 005t(.Ʀ/'(.YE @-L0@'0S 0 00 0%T Ѝ@Ѝt(.ƦG/////'//' 0/I' 0/I' 0 /I' 0/I' 0/I' 0/I' 0/I' 0 /I' 0 /I' 0@/I' 0/I' 0 /I'0Q/S  P///////0P/ R//A-`Pp@0 P @U*0Q R* /0/F'6 0 0CS0 S PB0 /p@-P@,`Pp@ Tp 0A S00// 0P/!R/P/P/0000Q/  /I'P/000 /I'P/ 0S S//@-@!њ 0/I' 0/I'7@-@PD@P 80R,PP80 = Ѝ0YEal B'PQ 0S////' 03P/YEg0 ACP 0AB0P CoSPS//00S00/!F' 00S00/᤻!<' ///@-@Hy@P R(  @zB'yt-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P ۚ@p@-0P `| @P  \*. Q  Rp R  (  p 0 B I' ).qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00z Ѝ0S/1>3 !/0S 000/ ).0S/A-0p @RP:``S * NP`A 0 PQ0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-@0SP`(0aL T  $ T $ Q0@ 1pC !)e0`0sA-0p0@P`MⰂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0T ).A-`@0PS<0R"0!31<0S 0R0PP0S! !x000S!!!,p (M0PA , (0 ,PF'I'I'A-`0 R*S\ ]\ tpPB@T Um uPPp0' R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00 ).< 08 C800/`Q'Q!//I'A-PRp 0@S` * MP 0!I PPA-@P`p0 SV1 V00W W0StLTTTЖЖЖЖЖtЖЖЖЖЖЖP 0 B  0  B  B " A A`0 F  B  B " Az  k`PpG  B0  BZ`FPpG|S`FPvA\p@-P@0`᫒P@@p Tp Q 00// ,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0P`F'I'I'O-P 0R@M  P&   P 000Ѝ 0@  KPP ЍO 0 PS@ Ǖ 0 00<00S*^Q000800R ]R00-R Ȗf0 S*]Q -QR\V0]Sj- 0 S{:0S00L6000S8`V 0000060S|p0@W Ƞ@bS ,0Sh40Se$0Sb<0S_(0x[ f 0(` pc0@`F `@ JUg 00C0b-Q [QR:Q =Q 0pS: Q 0R00`S0`000-S]S0`S0`0t4 R*000pBW R:0`S0`00 S<*R9 :R6 ]R300@  .0p pBuP 0S<0K[$ JP    qP p$0  0$ 峠0S00``0R00`S0`000-S]S0`S0`0=  R:0`S0`00 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S. W0`S 0`00S<0W00Z0S Z4 0;JP   pxbGx400!0pᲠ40 P0`S 0`0 (B(  P  P : [i 0]S~! R, V08C8 0  EB#ЍO # F' ).I'p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@I'I'I'A- @00P`\UC S:0S004000 p4\U R[U*U .Uy 0S0 pS xeP JU @0p W1@p(` ~0 S *R \R0)S ) \ W 1L  e0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  <t  3 0D #OU &)2U  0  4 000p0^00 00]0000p0S* *Q2  0  BG  B   B0;  Bu  0S> 0S 001006PX\QV {RS0050PS<* ,R9 Q 7 810000  U0 R     0 S *R\Q}Q00 0RR \P 0}S |0<0S 00,000$EoЍ[Ut` ).)>{I'A-0@pp`?Q $0A  R S```00``8^QO [Q \Q PUOO{Q |Q020W:0S00500 @0P U1@P(` "0 S*0)S  ) U 1L  0 S:0S00400P 0)SP  0  $  $ RK*0?S{S*C\Q@{SP H$ "!,Q  R  $  U   R  #  ?S l*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^00 0P0]0P0 w|o0W:0S002000 <Q >Q xp3PP jT &UO F^{S0 PSp* ,Rm  1000< U0 R  !   00 S*}Q00g 0RL}QF  ] 0  BY  B   B0M  BD   B0@  B 0  B5  B  B " A 0000S 00000 ).I'0S G- `M† PQPE1PL@P 6U: pPp P P$ @pxp唐0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D t000Q R:0S005000 S=:  ] 0A0MFP  H00Xo p0 P>3S, 9S $S S <0R pQ00< 00u04|04040 .  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:0_0P 08 BB0U0 RB@ Q U B!U 1 EU, ^ 0C\!1LX0RU!U! 0>Q% Q% QS 00 080Se 0S  0H 0@0 @0x00 0  0S GЍ0R 10C/TUUԦ ).|LEe,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0_P`F'I'I'0p@-0PSQ@ʡ@8QD@ p<0S P pP0@H0DH@P(00Ppp@F'I'I'O-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T 5P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  QP0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R I' O-P`p,@ Q+ V >\# (\ \[ \G \S `P \[ \Y P @\` \ \L \06\ \ \; "\^ \K \ 0M \ &\y.\) *\ \08#8S00 \ yN ^0s00 0@0s08#8Sy[Y00>@4N5>5. P`F`FV0@0>N>0> ^0C|0>@01>3 St 0O-4M\0@0(0000$00; , 0X ; Q 0  PX d  P^ PZ$\( P ``SP  UEF V pR p@_UP\ v H_VPpu\ @_UPN wpK vI _VP\p?Pu p$ V  upvw(ppu vX  pX X0X w u P pX 0X hu v? @_V_U^ X _X 0_V3 Q"$, ZS ( `X A 0PX v_PUPPPU0S 0P0004ЍI'O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0 X7  IS~ S F S 0>#0DϠ2@ 0o800 0 fX IP0 \P 0 p @0P  0JTP 0PP@ pP@06800p 0 -X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R I' O-pP084@#8 W Ѝ># R, .R`" Rl RR Rd pP Rs RZ  0=P0 BRz R Rb R 8R R M RG "R Rm RP n R &Rz$.R7 *R R ("(R8 R z  ȠLȠ \    r8    r ("(Rz  SZ >  E   R P RpG pGPp   >  e  ># !>c V  >  !># RHO-4M( ,  4 \0 0 0$ (0 @ /  0 X  0R  e0 Rc  R ] PZ   R    ``R  ,0:P0 00,0 UE F V pR p (B( _U RQ v     _V Rpu[ X# (B(   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  X p^X0w u ("(R X pL0!u vS  (B(   _V_U P  X +0  0_VX P R  R5 p  ,0k(0PZ& ,0 $p0 S,0  g0X  $0` 0Pv  _PU PRPU0S 000S004ЍI'O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0x800 0 oX7  IS~ S F S 0>#0DϠ2@ 0R800 0 IX IP0 ?P 0 p @0P  0-TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-4M( ,  4 \0 0 0$ (0 @   0 X  0R  G0 Rc  R ] PZ   R    ``R  ,0P0 00,0 UE F V pR p (B( _U RQ v     _V Rpu[ X# (B(   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  X p@X0w u ("(R X p.0!u vS  (B(   _V_U P  X 0  0_VX P R  R5 p  ,0M (0PZ& ,0 $R0 S,0  I0X  $0` 0Pv  _PU PRPU0S 000S004ЍI'O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0x800 0 oX7  IS~ S F S 0>#0DϠ2@ 0R800 0 IX IP0 ?P 0 p @0P  0-TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0   P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R I' O-pP=lMQ W @=QR 000N0 00`0=0`S Q00R0f  Z0,Q{ 4 Rv 8Ys <H[V01S0xs\!Q8pp 0,@004H<@ PP  0TX\  L0`ʀ Xd 00 SHZ1p0 0 0p,rP 0SD0S p0 0D0p,aP#D00D0uQ 0 0R < 0KS: P [  0SD0S> 40S,0@e440S 00O, 0@ R0R00D ;0Q0 0D0,`PpD Q*0 J0p0,P 0 0D0pp,P 0S 8 D0J0C0? 00S0@P, "@ Q.:400  R04P \HP XPCC HP 0000 0D0,H0SPHAA0 S0 Q00R0W  Z,Qk 4 Rf 8Yc <H[G01S0xs\ Q 0,@000X40H08p<@P0T0X0\0 00SHZ1p0 0 0p,P 0SD0SA p0 0D0p,P"D00D0 tQ 0R < 0KS:P [  0SD0SH 40S,0@V440S  004P HP lЍ, 0@ R0I00D ;0H0 0D0,vPpD Qy*0 J0p0,9Pp 0 0D0pp,/P 0S 8 D0J0C0? 00S0@P, "@ Q%:400  R0CC HP 0000 0D0,H0SPHAApQ00R0f  Z,Qz 4Pu 80Sr <H[V !R xr ^Q 0,@0004H8p<@ PP  0TX\L  `~ X 00 SHZ1p0 0 0p,cP 0SD0Sf p0 0D0p,RP"D00D0r Q P < KP:$P$ [  0SD0S; 40S,0@9440S , 0@ R0I00D ;0H0 0D0,UPpD Qs*0 J0p0,Pj 0 0D0pp,P 0S 8 D0J0C0? 00S0@P, "@ Q%:400  R0CC HP 0000 0D0,H0SPHfAAp00w 00D0C1S 0D 0C1S 0D B! R 0eEF'-Ѝ///@- // //0p@-8P00@S PpfP p).7@-4P@0S TP Ѝ0P ).@-@P 0S q@P/IP0 0 0/ /0 0 0 0 0/////0P P@- kK / *. P P/ /O-$MPpLWH_ `d@P1!$/@ @ T0030#`W00SP 0VqZ0* 9# 0  0  FqWp  pK $Ѝ 03qd 0+q 0&qp@P. `p0H P 0@J $Ѝ`d@Pꙙ\\(\@-PQM@(p,` U00 V Sp0`rЍpw`S0p`Ed-00Ѝ00 r0`0EW00 r0p`0O0O-M@0hwh[ PA  t+YAZKW  i+ d+X%  ]+ X+V<  Q+ L+ h E+X @+lЍVY PZ, P ++ &+Z  + +lЍ P  +[  +W PX PV P PЍOlh8XP<O-@Q00R0`P00M 04堄堤0 p 0ܿP R nR a BRrMT1   oRl wPM Ѝ  wPY U000T000 wP[Y U070T070P wPY U000T000 wPYU000T000 wPYT000U000{ wPYN U080T080j r@ owPY9  fwP  `wP  ZwP_YK U080T080@ JwPp  DwP  >wPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l vP T vP dx,p4$PllC-@PdM0H`>SHP@@@@ P$P(P,PPP PPP9p "`!@03@0 8p@& 0 {p@ ~{p@   $p@`{0  Pz{{P{0 P{PdЍ{00O-1MM @`D`  H "(0 p C.  PpV@D;@8 (y0Sp p p̱̑ 00Q$ P %0!pp@ t0!0_ DP BP 0S R){0@01ݍЍ!{0S PEPU R Pp 08D<4! @ P0 00 R 0C.0h,R @P1ݍЍhL1ݍЍFtH gt0@-P@M 0  PJp@ %"p@ P 0 0uЍ0p o Ѝ0A-@@`v0 PP0P! 0Npp ppR0`p0z0`EVp z``pp90`p0|z 00X(|pC-@PCM4 /EP6 0 p@& ` Paz000u6 0C.P F @4EP @Fn0@S VS 00 SCލpx@@0Sz@`0` 0P@0 G P@1:)z?0@0@"z0@0@p@-QMP4@SMZ TE /+EPB QP0s+ uP &QaP 0`pP @ 0@qqpG H p@ ۍЍp'0si/w1p0" +'y@0 P@0 F P@1:y?0@0Jp04@y0#S0p@ y00yPy@P(%x%H%@$DL@-pP`O-$(Y,PSp@`3U-00ï  0lX0 0 0yl 0R0*V&( 00`#`0{0q04 "x " 0xkP@r`U0@-DM@ -BP, 0P0#L` AC BP/ @EaS 0LT/1 0S2 0"#DЍ0ꫪ*O-((60 @`$M00@=+@ I\b-0@?o2S00/ 0 P 00d 0 uQS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@?o\2  y 4YP$Ѝ0 0sx 0 P$Ѝ0@Pa (P aP (P0 )P0CS 00}P P p R4000.P0S0 0S  00000S |3R3 t 0S( hRf `#S\ ykPV PM 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#4XP(0S  R $ R`d$  Q 0d 000Tn# d 0Nnd 0Kn% 0D%EnXP 0dR  ^ P Q&PT8XP #8XP20 P0:($^0<P0  0=R$ $ %0h00@D0 c 0Nm0 2  .ΌS1 $0 d 0(=m$ Q00 40XP10 P0:P0 0<R$0h00 0XP0  0C0  BQ $0 h00$%4q,ll'.%""""XP @ D0 0h$% 0S 0000000XP00$0Sx"xXPXP0(00XP(0$QeXP 0RP[ #0\ !#/1x2 d$0XP2p rp t t ZXP  0 R9 P6#R1 & E%E R)  \Q%8< &0# &d\0(0 0V$ 0$0 h00% 0C 000 00S P00  $0h0 C\0 @00D h00 0 H00 00S \0  $0h00$#& 0$$% 0%#PP # 0S !#/10s ad 0 ld 0 l$O-MPpKr0k0Gr0U`0 W 0 2c1  刀?00A;@P/ 0v> 0`0?d000P0?T0 04 80?<0 00$$%0000 000\ :0\0P? 0TP 1 dP /P~0S{ʴ Rxʠ RuʨQr003 0Sd `0?#0S/" ES}> `00d 0q@PD0 E0@ @8 H0X`P`d 0p4 `FQ@ T PQvNNh` @D P[^0`0 0tx|\dPl`p@< RW S S|\3;pTlVh0SdU`0S\0 R{z  RRzd8@0>C 0C0p0t R@ix0S Uq0pPt`( 0( \00;:PJ p'?0! P ό 01l"?! R1 R?U0v Po 0jL7v~@ pG0/ QP pp 0jRl h0 Sh q 0 :qp`P  0qpp0S Z R@Q @T p00 ߍ 0p\ l:qp0 L 'pQ !'/q S>P: RTP\0 P0,P0  PpJZP S 00@ p0\ z`p0S0W0ZS 0#\``o d`b0\P0? T0Y0\80? <0P0\@0? D0G0\H0?L0  >0X\p0h Qp0SL R<!pgQ: ß `Q.: ,PKz0)9@P  ß刀dSah0 ]ZP 3pv0psp@(@\ P`9P ?/& Rß%0Q0vt 0W0i 0" Q0P"0V#0,m`V10& Q#Ό3à\!=30S ( 8L^9 0( 0qp2 Pto#00o0SL >\|S9 РR30"c01 2c1Zÿ sR oT00o0S$ 0o0Q 1&`P 2&>`\3à\&=3ho0 0} z0ZoT00\VoT00DklP)\(\ ףvɻ @-@ LcpTat X00 R 0 R 0Q/  /  P  DQ 0@-0P S@@H  ^ 0S  Q 0#0S0 0/ H  Q j.0 0#  Q/000Ɠ\ 0@-xPo> 0@" \ 0 0 /A-@P `p@P@0% P PPA-\@`@P pjNP@0& P PPA-\@`@DP pH@P@0& P PPdO-P M ]`P9 p젟P n[P P @@ %  P P0Sp , Ѝy X p V Ua  f9p0`0pShA-pPQ `@Q rP 0@DDB(000S  _Ļ@- M`pPPp) m 0 0@0S m0"S" 0p000S0 7/ Ѝm0"S1Ds\0pT000S @ Ѝ1Ds$ Y ,|@-@ @O-p MWP  pp2S5`PL ]P@C FPp G ,P P6 0nS# p= 8@P00Q Q P R  \0 HB"A 0 0@00oSp\000S ;9` Ѝ, .,`иO-BMM@p mL0  0UP:38PP  UPn00=`P PC @@`K'0 PPp 0P0 0 PPp h@P! T 0dSPkPU0 Pp` p~ } 0gP @PP0 PpT i6Q @P l 00BލЍP/U ` P 1pAl0SR  PBލЍ z0H0PP0 4p>  6Phl00 P 0^l! 0 E90 0Tl0D0  0KHl!0 ,9a00&/l00 P 0$|#l00 P 0qPol0`0  P 0 cꔸПzd@d$ܴԴ0@-P@M 0 P@ PЍ00@-P>@M 0 P@ PЍ00@-P?@M 0 P@ PЍ00-,M 0 BMPЍ䐳--0$ S   0/ 00 p@-PU@pk?( ( 0P 5/pp@-PEU@ptk?( ( 0P 5/pDIJ@-Z@P 0003/@-@P 0003/pp@-P?oU20S@ 0 0 03/pd0p@-P`UV00P00S@p$ P05/pرp@-P0?oU20S@ 0 0 03/pp@-P`Z@Ppj(@0 p@/Hhp@-P@P p 0 0 03/pH-@-M  yp@(0(003/Ѝ@ Ѝ/@-yp@0003/LO-`$M ؄P @j^0Sp $Ѝj0,P@@  4/ $Ѝ,O-`$M ؄P @D0Sp $Ѝfj0,P@@  4/ $ЍЯ!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////T\X8دį|dP@(pخĮtdP@0$0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0%\6P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-@XPDMP@p, fg@ Ua @Y UT US i,0  S#3@  57,050,0 Q ,0S 57,05 50RS#,00 B R ,0S0 BT,@DЍD 0, R3057, 5 05 SR#,  0C 0S, R 0C 0S , S3 500C55$0P$ 0 8X@B 0S1 `@@0 SS( S R 0C3@ 50 00 P, Q0Ç0,  0, 0 P4@0S8@Tt ,0 @S>3 57,050,0iQ p`FQ")QP*0ASLJIHGFEDCBA@?>=<:9765432105bQ1?Q*0S' 031 a< A01`00@t 000P, \0Ç0,0,0P`@ZfQ?X0@SfQ p h7xp@S H2p2 C cs3<2000FQ 0, 00 P R05705, 5 0, 0 5P R=305`7, 50 ,  Iv@ 1$01$0@@@0TSQH1=0A?ofV20S00:AoFVP\ P\=Q, R057, 505 ,   R,0 Q ,0 0,0 R *@V_ 0S\ @Z`@ 0PP `@ RF p h7xp@S H2p2T00]`@%#jo%#jx%ju00@-MB0@ Ѝ0p@-P`M0@ 04 4/ЍpG-PRM^  `UpP*/a@<2P T1000< pp Ѝ80S 1 000< ppf0S ЍĠ f0S 0 < @0000< @ ppf0Sf 0 f 0 HNdT(@-$$@M Ѝ=O-EM MaX@P+p `E M\0P@*T 0 A\0P@T 0 p30EAP G CUEލ Ѝqf 0 Eލ Ѝif 0 ~ȡ@-@` pMPP, /[ 0RP  rR' rR  P   P @0C%3Ѝ0rS\ 0 @3Ѝ0 Ѝ@r f 0 ,tKA-`@ p@ 0P/S /[P @0 Sp  0 SC1 d@p@-IMM@`PP p 0: S p0 0rp IލЍpe@O00IލЍp@IލЍpe0@08p@-IMM@`PP p 0: S p0 0Ap IލЍpe@O00IލЍp@IލЍpe0@040@-P@M 0 P@ >PЍ080Q 0 080/p@-@PP` ت %CPP u DP  p@)PPp--00 M (0  ЍЍ/L7<--M  Ѝ Ѝ/ -- MMM<P 00  0 ЍЍ/6<0-@- M@YMP  Ѝ@Ѝ/O-,M `@RPP00:A!0@00Ppp0 0CSK PY P@ 0 @YP Mv!,Ѝ6Lp@-(M `@P% (Ѝp0 00 4<p@-`@PLpp p@p@-(M @P,0, 0 `% (Ѝp4<p@-M H0H 000` Lp  Ѝp@lЍp@4<p@-(M@PLp `u%8 Y(Ѝp@-@PT T  ,M` @Lp pZ% >,Ѝ3<C-,M pP`PEUP0R@@t0 0:2 0U @P0 @*T XL ,Ѝ2Lp@-(M `@P% (Ѝp0 00 2<p@-`@P3Lpp p@p@-(M @P,0, 0 `$ (Ѝp1<p@-M H0H 000`  Lp  Ѝp@zЍpd1<p@-(M@PKp `$8 g(Ѝp@-@PT T  ,M` @Kp p$ L,Ѝ0< Q 80 @-l880@08 880/880 00<(P 80880T0p/p@-@0@00S 000 Xg t0PP `00RA.L00p@GNP,}e/$  <ԔO-t3M0@ 0P p{0 `0D4p@ P P00U pp0 0CY 2ATT00  RG LD@D T]:[ 2 00p0`K 0K0 V0 W8 P2ATT 0`Fs 0RB K 0 y 0 Bs0SH K@0Ѝ V0& 0 ] J 0 S0pHXB0SG 0F Jv 0 B< 0 B5@ 0 B.  BJ`FtZ  0 B  BJ 0 v 0 m 0 0S J00. 00 L+<p@-@PJppp@ 0RS00 /p@-@<0<00P  @cJppp@ *<808 00 Q0R00 /|*<p@-@`PCJpT T   p@pp@-@P\ \  ` @&JpTT  p@p)<O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KD Œ Č Ȍ A`| @p4  W R ? \ QQ Wt ,0 000IC1100Q00, Ũ Ѝ0d)0 00{p'<@-000 000 @?P80@080L'@-@?P80@0800-M  Ѝ0-M  ЍO-ϟiM QP@ȡ̑qa  P? `K͌U Pul? K͌T Pi(? F͌(Z P\> F͌(Y PO> C͌ 1S PAL> JB͌8W P4> ̌V P'= ^B͌`=@ 0S078p H0PH `P$ P P P P P(| PX P@8 (P PD (PP PH PxP'( Q780L0x100C40S0 00C,0000h0000a0P06 ,0P0@`U 0e1P U.0q10 `00V0q0 `V, 0U @ `dp少Wl` 0 Z WPiߍ`0 1 S  ,00 0! 1S 0D 0| 0>p00 P ,,0$ 0 @< 8P!P H, $  B @ 0S% 00P00C1 0@S3 00 Q!1 p WQ  pGW,000 p0S,000P$0U1p㔠 0 W ׿Pp~80Sz004 0R003180/0S@@X!0@< &0S00!$0P 0S@@@@T0S0 0 ,00C00P0X00Y,0 0CR0@,00`0QQT d!@YP0 p00 W0 pW0T,00` pp少W䰍 0 X \P0080SG^p!f p!:|rQ R 81 R 0S ЍQ  <00 &Dh0 T  Ѝ X4@0h 0̃ S/᠗G-TP@pxMk +1(@($T 0CS0S(3P 40/# ଐ쓟薃蓟0尐:ؓ局㴐Г%LȘȓ㸐͠x帓尓H p|xtplhd`\X8TAD`<@Ã4,(($ Px h2101:|@ R 0S 1810S \ЍQ  H20 AC8?Hhp( U(P U (0Ѝ>\A@<W^TvQ8#N:K0'H#EJ #AH#>p-;-8`_5|2o/p,r)y&z#{ @|h}tIfؘ!Ė+!%,!-!.%0%`&i%j%k %l%m<%n#o#s%t$%u4%v,%w%x#p#rd"ye"z`"|@<p@-,@_@k( @CUT(PpO-pTT7 L7L00MJ]070 P0\0SZ  p p P` 1 pS`H\$ 0` s 00bRS 4S 600/N 0 ;0q $Q`B`q 0 ;0bp n 0S,0 04 0 s 00bR44 $S `%5 0Ѝ p P`1  4` 4 0 s 00bR 444P500/1QP p lR Ĕ P $ $ 0d0\0S0 S 4$00`j pg |0`@ `00 4Q0`Q40NQ  000r0  cR$0S0I SzB p? T0`@h p6 0 $ A` 0 s 00bR 40 ; 0ⴸp P p 40 s 00bR44 $RT0`$#0 0Ѝ0 ;0⑸p4SL 0`@  $ `004S: 0040 s 00bR $4S4!SY 0`@s  $ `004Sc  20 2"00`}` 4!4 0 s 00bR L/o 4"10100 ?ca p 02 0s440040 s 00bR44n40 s 00bR40o000 ?c0`0040040 s 00bR44T00S \ \ t0t0! 0i㏽ |Ȧ$AQLH ء Yp@-P@,0 0 PR T TTpO-T4P8 `0$Q@DMh v :Q{#R3Z 300S 8 TDЍ!  Apq@ pzo0@ qS0S0:3S*0`00<00 P @ 00{Z }x8F 4!  p9H1D00<00  0*  4A(0 00<p@-@Pa;ppp@p@-@80800P  @M;ppp@p<@- MP1F⧳pP 0@T $T` @@TP  Ѝ<V>0P0 @P`@-@MP% HMP FPFP0S)[P& mR R@0R0 1BQ;RS S0 CmS  ;S R R0 S0S PS0 C;S  QR0RRxS`SO-0uSp@` Md`Z|P paP` 0p >PD3n`3τ  "   `i h  pb F?ⴲ_ 00ͭsYn` b P` Ѝ0 0 0 Ѝxp@-D@D0@Ppp (0h0i 00 p<xp@-@0@P:#Rx x# R- # 0p ]P`p:p4lp@-@0@P :Qph^p- p #0P`pX :(4lp@-@0@P:#Rx Ó \ "R-- ( p #P`p-:p|4p@-0@DPSP @p (0008 <@%8 pp<@-H0H 0@0:#R#R"#0:p@-\0\ 0@0:#R #R#""|}#0:@-0 0@ :QQ σ #p P :@-0 0@ :QQ σ #p iP :p@-0 0P@ :QQ |}à Ãp #:Ppb :fp\@-0 0@ :QQ σ #p P`9 :Qp@-@0@P:#R   #Rp @8 “%\8 --  p #P`p:pp8 :4<@-<@<0@00:3S 00   @-8@80@00:3S00 @-0 0@ :Q$Q' " "" "`# \p`#"\" #ƒtP` :Qhp@-@0@P :Q&Q) ,"x \\`p`  #9P`pa :Qplp@-@0@P :QQp!""p!"h#!h#0  p@#3 :lp@-@0@P :QQp!""p!"h#!h#0  p@#  :lp@-@0@`P :P Q# hUh“\ ƒƒ p #P`p :QpDl@-@ MZ'qQp* c0 |0 `00004| 0000408003 Ѝ| 0< 403 ЍT T0 0`0` V:`c3P`P@( 0 000:P/,@-0 000倴X0X 00:3S 0@-p :P`/\0\ 00 :3S 0-p @- P`/d$0$ 000:#Ro/$0$ 000:#Rq/000 000:#R o30/(0( 000:#Rq30/P0 000:/p@-P0P`@0M0 0s p 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝpht@l(A-RBP0@SMx RP 0S `b 1 P00p ?p!1N  0Q`31p0S0S  d|100S0S  X030p : 03, p 4.E$ЍP Q ` *P  0:# 0` `x 000 00F0 0@EF00~ lkht@(<<@-,@@0S,F00i@-$@@0SF00|i@-X@M@ 0S Ѝ< 000 00WF0 0ЍDi@-\@M@ 0SЍ DF0 R0 0 :F0 0h@-HBH2@P$MQ :3SW0b3p `V90Sga` 0SQ1p0SB q0  B0)1`00|PR 1@ 200 R 8 H 20 0X20B%0 ^ :3,p 0 9P`$Ѝ0`00|P @ E0 R0 0 E0 0]E00@ @8 w200\$hhp@-$M `@0P 0@@@+T8 0Xp@@@ ><0p00:3S V $Ѝ  0 000:3S/C8X0X 00:3S 03@-p 8P`/@-@0@ 00 03, p P`蜷@-<0< 00030p [8P`Hp@-P0P0@Q00 |P t0 1d000*`$pxP 00 1(000*CQ$ppp@-00 P *C T |Ppd  10p@*/$xPp,  10*Cp@"$@pp@- 0 @P0:R P% P PpP 0 u10#p`tP D0 e10#p Pꌵp0 000:ꔴ0S,01/Q'0QϜ!0CS Q0@-,APN Q (@0 \0C 0S0U0//Q'0QϜ!0CS Q0@-,APN Q (@0 \0C 0S0U0//\ 0,  B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q>@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@Q!80-^\ , 0 B\ 0 ^O-J3dS0 dMbUSU^ 3,p0CQ?8 <3 Q7S@0pP 08 ,0p3S/S0P0p3@ 0 00 p) , 3, X 0 ` 60 =dЍ|B0 9dЍOM/O-*,M0pP2U 0! 5@Tg ` @p$ $岦TK*:0`SQ p 0 PP,Ѝ@`00S S@ S0PV%0S/00 04S,ЍO@0@0S A0Q  B20RP 00C 0PAV 0 0 0C0PA0PS  P@@0 C`PQO-DM 4P3 S-0S*U= 000  0@ 000@L5Q k@` p ePJ @0S 0ၥPЍD΅ P 4A " 2  -ЍP0P4P0  0 /L D0D M000S :P ЍЍ/pH0H M00 0S :P ЍЍ/404 000S :P /ȨH0H M00 0S :P ЍЍ/|404 000S :P /,MDD0P  P 0 ЍЍ/@-|0| 00@T 0J#4R |B0pQ 8@-P @B舧808 000S :P _/D0D 000SP:P4@//ᴦ000 000S :P /`L0L 000S :P @-p @/ A-0 00pW* Z3$SP! #R`@4Sp`3@Tv A|B0tQ 7AB--0    hؤ000 000S :P s/ᬤG-00 0Mp W$  ` 0 2p @%PP  0  &p@  0-@eЍ@hP  P j/p@-JP }3S P`4`F30PV@  0s3$ S"0P |2 $R 0X0S 0L3 |20X #$03p03pppF(p@-jP 73S @P4P30@Sp@A-`P\ J3S%sW" P &@P033SĔ S*/W 0B@ ^0,  W0p,030!C  ! L! \0|! c0000WP3PSSpP4Supp3PUpp@-@P PX0:|"C0T0XppG- Ѐ\-P@p  `ᖣP LTL!VW R T VW  H000S3;0 ၣ0 0(|O- M0@DT  =p4PP5P( =U9 ЍBP&` U$ @8P  0 =0 gh `  @RYd ` ` > Ѝ Ѝ0 =@0@0<|h @-?C 0@   @ ,( = @@ܝLA- Q@PP% pW# 0 0S0忡,彡000 R   R   R  P 娡ᦡ4墡`T `TX *P Q Sp  QW02hp@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S GT00SpX@ |'(@ 8Q 0@0ppp@-Xa@P`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0p?pT0T 000S P@ ?# Q @ $080///ᘘ<(0( 00Q0/0<(0( 00Q0q/<A-T0T0 0PRp @`?`,GH輗<T0T 00 R X@0|78@08Q0@0/T<0 00<0 00(Ȗ<p@-`0`0P@T X0:|20T1S@0?;@0]<000080S@078@0wp蠖<P Q@0?30R @080///R\/R/p@-PS `0@H@?GppP X @0*|"7 8@08 R 0@0/P@/*p@-|`@P`P X0:|20T1S@0?;@0:8000080S@078@0 pܔ0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/P0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/ጓp@-@I/P0P0 p@$t<p@-P@9/ p@p@-l0l 00 Q@P00R ^ p@/ p@<p@-D0@@ 00P $pp/ p@ꐑ<p@-P@$pp. p@p@-P   ` @#ppT0 T ^ @ p@.@<p@-@`P#ppT T  R @ p@.@Rp@-P@00S ^ p@z. p@sO-`0 0p@%0Ppp@-APQ@`R }10  R+ 0  0O pp!R!  B(B((00(!C R$C1Sڸ0@ @Tp!Rڸ  *d2 00000S % @T @TUpx00 QPڸ0 Pڸ  4040 B @TO| -M 0ЍC- `?PpPEIP$Y/ P@  N @DT`F࠱V HX $ P 0CA-A1@`P0@00 !p Q% , :! p!t1pP0 0TMT1 0@00@0P8010 R00SAP-  0p 0P (0 0@00 @0 0pP0 00 0@00@0P  P800 00L  @08@0L~p|`A-@`Pp{TV,1 @ 0 @A O-/? dM$ 0*#R$/@ T<  ( ` (`RR(080@80@K @ ?0Ss$?@P? 0D000D0 RW (@9D000h0S80@080, 0S0$ >0(0 RJ, 008C8S^? 0"  @HDHT,0Q0 (00S<0S (  R( ,  HL ,T ,S(0 0 40,100 180<00,0 10 l=$ 0p0H |0D00H00^p  0H SL0HP1<08 0,0000],08 0Y 0Y 00S0S0A0P<08 0,00 1 1 01IY0Cڸ P0D00 L  /o^" R 0YP@o00PP P 00P P, 0 R S R  0\ ɟ`V 0HX 0X pp 0 0 AR SsP  P ` P  V  0R  `:$00SYD QS 0C00 S40( 0S(00040 0 S(00 R4 000:3s L  RL   000Q00 0\,0(08C0,Q 0,7P 1 11RY@ڵ0  R1 8 r ir$0`V 0\U 0HX @ n@ NN Œ Č Ȍ N LL\oɟ`VD@ 80`U 0P TD0D0 R 0 R PP! YR  Y; $R  0E0 p0   0E t D000$R $ <7  eD0@00!R Bt <000V  0 B0C 0$0P<0X *1d"0@|6$  Z 0@P`< 0P8, Tp P$T000 @0pG 1`11QUr 00S400 <0pD0 P 0X *1d"0<0V @ @50S  V0A0 0C0 R d1SEdЍ꤄ 1P VUQs 0    k<$$ R 00S0 d?3Q@A`pPLp@` 0?3V 1pGW1QEP @?0D0p00L00@ 0@0@00 XX0}P90L0S S ?(080 ~ <00  $20 p`dЍ80 00@ 0Cq00S02$ 0D000h0S(00S5<0 (0 S<00v<080 @0 80^R00C\0Rʕ@t& +,1$ 0, QRp! <,\`@VP  V@P  P0,p, PQP.J q <@,T`V@ J(|p0|hpܕeV@ P0 , PA,\,PY AIa,@IpE ! W   P  X,00,0Q00 , BCR4 R0<084 00C, 00S<,04 00@0@0 0,00400 00 S` @f` P 0, !Yp, 1@S  Y@pL ^P0000 00S000 00 0S 040C04 R00CQ8(0 00, PEu1 PAj0, \ p(@0<00  w 0PU@`0V0S 8Q004CQ0儃V0F0<00DPA `P | <0`0PL W H2 D| p3$  D0@0 0Q. R+ dP(  %P d1S $ 4  tPp:U U6` p 3`FV EPEE(0,,P 0E0JLp0s  0E = D000P  UP00 : ,0R<00,P 0 0C 00Y 0C040~ p(& 04&80 0H0D6,0@0L 0 G40  pRW0P R  Y RH RLR)0 S+ 0PU0a0P@@ a lF ,@DPC#TP lF@ P0E0PE0PEQ8!3#00 00C,0W<0p0,p,00 0R0<0 0,P0,0 000 0 0WڭL 0S 0 PCD0U0 <000p]P4/ pQ, S4S Yô4SQV H5S4X  8$`@ 0 `]D 00p~0 `P00P9  n0D` 00 B0 b0P P30 0pU0 P'%PO p0SL 4S 4S Y00ôQ0S8 L5S;  \0:$ @` .0 `D0 00p!0 `D000P : 0D` 00 B0.  00Q0@0`` 0D000P  T P"  $ |;@ 0   D000P ;$  0 q R! U <$ @D0 001S U \<$ D`@0 0PL5S 0 0RU <$ @D0 00LUD`q 0 0L|PhoSPk4SP 0 00@D000$ =@ \0 `C0`   *D000ȔY  p F0 {\o`D0 0H`0UPy D00 ! UP    `>$ D@0 0` U000 D000H%RQC    `P?$ D@0 0H`U0P0PU# 0``U @P @0:0x?/0 , @0HPRp@-P0P`@0M R    80x t00 0 000P80  H000 0 B/ 0C?0 0 Ѝp)0 00()<C-M048lp\` d0h@`Pp\P  Ѝ80 800 0 pCB`Po_`PЍ(@-@P @TG-1!00`0DSHp0?sppS-, P !Q@QT:!80|0Zp@U0 S00? P R!R0 S  ((0 00'< 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP0 @ @T $U0` V P`Vp`ᕁ0P 0@PUpT` @փT @pp  ! !@-@P@心T R/A-p0,SP` @T @婃T0`SP R0Q/ C0A "" Q/@-pQ*P`@ 0N "" T0 "" ^\ 0L "" Q\PW`@@-@@@0S P$0C$`O-:z0*Mp$P( , pPx x00^b Ss @@lRXapH\ 00 4@Y @A@0 @TI Q@@[@TAP i``FF\W0^0  | aR\ |`Q'lQ"  @CP(L ,4QT S$I@0S -0P0$ 0B$0xX0C,4Q~ @CP ^a S_ʠ80,40SoʌHh@` 0 0,` $P,04CS (` R 0 KR  8  80  ppP< `' 0(@Z q @@lR@A'@T 00P0S[ 0P0$ 0B$0@'  00Q5 70,0' 4(0P0K0 F @& $P)0Sx600S00l0S$ 0 S! & ,40Q$0 lP,0S  lP$0CP$(60 R(,Ѝ 60( $0(0\CEe@` % (00 S5$%P0C (00xP0S  0P$0C$@D% 04 0,@0(@Q 4000XV 0Q[Q $ Z 0$0C ,0(@ 0 K[ZP pP40,0H$ , 1 10z D 4@000 P ^$ $@$#` P(`h0 Rv ,,Uq  P+ #  t# (`$@ ?#R WG( , #\ $6 (`  P 0(`$ R  z P $`@ lP " 20,,40 SN   P20$ 4B@0S K0P0$ 0B$0 $ 00P0 ! ı 00(@S7a` 10(@0 T0!0@Dx P(@0S  0P0$ 0B$0}`,0% a`0S 0P0$ 0B$0 i`,0 @#pxl\ @(840,l h(<\@,O-PsP3pLC@00 S o400040c`(,P Zg34@2`0T5"0C S402P00S00h0S000S200ʐ  0@DS(00S 00lP 0S D2 4204@,P0T0hPr RP0 @P 0( 0CS /P1 P1040 ,( @P,P  @1(`0 R&T !P @T 0 R 0 P'  u 00 lP ~@T00,P 00( 0  04@S]CPE@DSP4@,L04Pl _00SL004P(h0lp00@- ,(4 00 @-  ,(4 00O-\1\!0 T *⤒Y|20`1 50!Q:|20t0`1=Q,00S|20lA0 0!Q:|20h3h0 s0!Q j0!Q p/p@-x0x 000@00CS0 S 0 S P00`p3P00p@-0CS@0 S 0 S P00BpP0p@-,0, 000P{@.pp@-P{@$p@-|0| 00@0J0Q P R, !Q0000<0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0PQ`@| z{pP 0 0C Stlp ,0A100A!R   A BQ(\ !1C K" Rw   IK' T0 00Y?3 0Pq wPP| 0Y0 00 W0(@p ڼ T D H0W D@ 0 ( 0C P8g$Ѝ00$Ѝ>T0 S80 E 10@ @D  BT cp`$ЍHȏ$Ѝ 00C! [ @ D0 |0p H0K002 [ @T @yT @ @jk0 00P<p@-@Pppp@p@-@80800P  @ppp@<O-5\M0@p0nz`Plr Pv0P 0l X0P,00Y0(0Pp0@STI5*PO`(PZ0pP00PEPUA0 (00SR , *  ` P CpER2C.-,0T R8 ! 0,0 z x4(p0[H0`(0(00S(0U(EzP`FyPJ`yP0p0C0   S `   PR,,(0 !R0!!ر$(PQ,0 0R!1P10CP E" R|  KPE X,0V(0 ,00P` `($,,0@D$8 0 40PU` 0,a00C 0 Sd $ 0 (0C0S00 SRj (  = my0!( Z e 0pH000(0`0Sq P#`p (``(00S0C(0FyP 0`F S0p0Co0I! U 0H 0000 1PE UwD0|0 p x \Ѝ"P 0],0T R0P,0 p `~ `w \Ѝ` w P /0 0r<M,P   00ЍdЍ/h<0@-\0@X 00 MP p T  Ѝ0@G Ѝ0 <p@-@\ \  M` Pp T  Ѝp@(Ѝp<p@-P@ppT p@ pp@-`P@ppT  p@p0Q /0Q /p@-00 0`@P0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00O-$MS LPP`0X p H0@TI !  5/ 00@T; $T <RX! "! ".Q  R > 0P 0 0 H 0y00 P  0H8#8 S R0?@P5/@TY$Ѝ0H\  8#8 S R@0刀0@P5/@T]|\Q" @-@ RM !R "R pPĜ\  00@[Ѝ/0Q " @-  MS S PpP$R (@2Ѝ/-4M0 Ѝ<@-@000M, @Ѝ0@- 0\SY ^S9 %@@ ,S'Sv{cScX0@4Ÿ\C110N00000}00%@000@0>{C0)@@PA 00@S801P00A 0@@100CT00C0 S\S:S '000L0d%{tQO-M  s\PP 0p p00047 000R0pp  0`P p@ ,R&Ti \ @ @   R_  QS%R +NG\ TRQONMqpJIHGFEDCBA3?>=;9876543210/.-,+*)('&%$#"! ?   R Pt 0P0Ѝ% i^@@ @ `f`00 0 "!.Q *Q0 0 0RS@  RP%p0 @ % d^ @d  @  R l @    A6  RT V @    A   RyP%p0  %@@c   n  RTP%p0  %+c @@ @   < 0     B0  <0   0 @@ @D   Tp P0 S\R$ W 0`C0@ T$<0  0 p/> 0000   0 0S0\S 0 S0 LWHWSp@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0A-@0MS0H0D!0@p0S? `g 0$1QÃ!1!1"b2cP0A @ 0L0L  00210B P 0 pW$P@WP 0fS PЍЍ 0 0ЍNNgA-@0MS0H0D!0@p0S> ` 08$1à ‚0  @P0P0A 01! 0120B P 0 pW$P@TP 0nS PЍЍ0"0ЍkLDM>C-@0MS00! 0p0S2 P 0#`1H $@0!b4!b H1c$a1c0@` 00  0#3c`10BI P pЍ 0<0qW X $`0sS1 P p`VWT 0S oPpPPPЍ -?LK*S0 O-LM =뀐l oPH $0$ 0 0 : 0 @PP: @P 0S  R 0[ M #[ =[ =`P` s000`0||tp P-  [Vp p  RR pP X,     P-?LE*S1O-@Pp`0\ %\0pS sS lS@ 0\TT1DW { 01 CR0@CUPo O-pQ qM P`@? 00S040H P$   l0H  Z0   RT0P G @T %<%T 400 R,A*Pg p 4 @@TP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+p oP" 400p,1S$ 0C-11@ X 34 00Q,*P 0 p 40P4qߍ00g0\ !0D]SCBuw~}~z00D Pb@0A?S@:T;X0D  R S񏐀E~}|{zyxwvuE9rqponmlkji.gfe5cba`%YP`VlP`Q 00040lP,I 000XK -00.0\0 l 0\ @:  P160@00-00.OW 01 1ऀ01p@!R1 0BS11ऀ. pB=1&@DqVTwzq^L6$qW pG=1!T0q| ~T0OWq  !!pq0p@,@10D RHp%!R =1X@ BT!g xX14 00Sb*,Pq 0 0p4 040O R   ?R ;R   PR %R0 0p!OR#0S'S ! 0S'S'S@@pAT8 @D=AA0@a DQ! 1pP1S 0C-110S R   ?R ;R eRQ  PR %R0 0 0000 0 B10 OQ R}R0  R}R}R@py@a0D RA0DSI13 DOS ͍!!010pSl0@0l0 0St00t0U1S= 0C-11@ST@400 Q,>:plPAT @Dp=1AP OT=q00=1@Ap@%c`X] ]Y(V0QXPKPF@oᨂAP<X9 @5@2/QJ AQF A,ssO-M M:S%0:SSP 0`S:Spp@F T R*  @ 0  tDiP 0P:S ۍ ЍPۍ ЍC-pP0Ÿ0M M@`tPE 0/SU [P 0hX |PK `]P 0 ۍЍCx0P pd! P0 @ۍЍCu0 PۍЍ0P 0S/S pP u~hX0 ۍЍC p 0\ghYW L0L 0 $ۍЍ404 0 $q8<;;;; ;o`:o4:G-pP@P  W0@7hT  MP l/``P@` @T  $P00@0A0G 9,-@-@ M 00 Ѝ@ Ѝ/1J Ѝ@ Ѝ/@-@ggg@gg g0g@gp@- 0@SM 0000ЍpP0`0 0 0 0` 000Ѝpp@-(PS@:pS fP!pVeC- `@V M pPᤐ0fU@@`V   0W nU sU  @ `V0@00 Ѝ R@@@G- @MT% pP`fS@T  d a0P8C80 0nS sS Q00@TE00 Ѝ 0S00PA-P# P 100`|pp ,RR    0S,S@BdP   p`p@pVC- M@`PP(@/pW[*nUR sUI fUH0D Y)RD @fP% H0D@ pH0@0 H0H0nUp@0 H P6 sUI fUA L00L0 Ѝ@P Ѝ @CP80pY D80 400 Od 0S0008  @H0R# ,0 0H00H0H0@ HH0@ 40 0{H0@04 H00sH04 0H040, R0 0fH00H0 xT@TO-@M PZ  Y p zp(080H0c0PA `0  P0/0  P 0' ẀP!Z P   P P  p Y     p p 0@0 0@Ѝp@-1!000 @S/ 0SpQ @\T 0Sp Q00pPUp:`AoobEU@@\S@@ T 0SpPx0UppA-`p PPU@M"R& dP !0P ᴀ0V00  p000 00 0ЍPЍ!c pq000O-@0P 4M 0%P `Xe`Y6 p| nPP  p }cd0P  0? 8e` gPPNdP (e0 0 4Ѝ # ee0,` pV 0(0$0,0% PH, , P AR   0S00SPq `V  [㼢 P"0 0d0L@ Z$ H0@0D0L0E p,f[8  ` 0 `P+ Z+  RXEEhn[EXp s[ "`p0S   p`,P p`0 0$d 4Ѝ  p`R0d0 0}d0P 0U4LLA-Pp ``V@M(R, cP$ A0` ඀d000 P[00 0S0 P P ЍPЍa@-0P pW@` MR OcP 0 `) 00P 00 0 ЍP Ѝa0O-*LM< <, , 0`P |PP0|0@P00* zPZU #PgT 9PXPbP  P T 0U 0, PPP! 0p)$0 0 d)0 4 00HxZ 0s 0PS , PP R 010#.R00SOR9 =@P#`P @yHDHt 0n P DadD0 0SP P*0 & 0S t0 '000 00 n0P0TS0 P0(0$0`V (0$(0Q$ jb(0$ P7 $`Q^ @Q ` Q0Pp )\QPyY?%`V`^Q`V `@VzP 0 &0GS(x  0P] c  LЍ8@0@S hFhvP @0f  IP@ P:0A PEA/PVrTSRQPONMLKJIHGFEDCBA@?>=<;:\a76RZ3210/B-@+*)HVRQ@ Qw, @  @, `  `p`p-`$ (05 4(0h(0` p`` `` `` `  (0B(0``#t 0 S00P3 ( L0AP ,  0 80T80( 剑T0IY【pn 00 0000000s0 P]`hFhvHDHt8 P0n  PPG 0S00 DP=0 5mP00000 0f0 P PHDHt0 0Ps 0  P0P0 a LЍ?V` L0  0po0 v{0 nsl< gl( p( !`PsXIICtBAXA@@H@@P/`$P00//@@-M@0 0!1l!1"b2c N0L 0 0@@0$@B!A@C0-PЍ赁N@g P0`0K?//?@-M@G0 w0C B0  N\00L 0"2<@0$AB@C1dKPЍkL$?>$0P00?//>@-M@ 0 ;0C@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$$C!d!b8A@C1PЍ-?L^*S=p@-0P0M`2@P 0Ѝpu]00  R 0S"0ЍpSG- 1 !0 qP P@3 04 S0`0`2,0_PP00|Q``  MVPeȄ`EQ  BV|0`0ȇ`H004TS@-@P -`+`)` '`$%`,#`!`,00!R  !R 001/R001P//|R@- M`p P0P0@0Ps ҆P 0%P Ѝ 0@P ЍhC-@P,MA!DDH PNp`@\ }Nhrq]HL8/#~\H3  ize6t~-s 0R>*_ri*'?*SRQPOLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  $T "=4<"!00 0$ ,Ѝ0^0 ^( <;0 0T 0"F P 0$ 0^0s ~^ :0 0T 0"1 P 0$ 0c^0ڤ:0 00}TW  Pf 0$ 0c^0P:0T 0 0"P::" P 0$ 0c^090T 0 0"P 0$ 0c^0ڤ 0T"  P 0$ {c^\  :T"9" 0tPP 0$ Z0c^0 0T"  0(K0c^0ڨ80T 0 " 9"P 0$ 80c^0`80T 0 "8"P< 0$ %0c^0Z80T 0G"8"rPA 0$ c^T  0"_P 0$ 0c^0Aڈ70 00 P88T" EP7 0$ 0c^0*$70 00T /Pq 0$ 0c^0^60 00{T P' 0$ 0c^0|60T 0"6"P 0$ 0c^0460T 0"t6"P 0$ 0c^0050T 0 "@6"P 0$ 0c^0ڤ50T 0"5"P 0$ m0c^0\50 00T" P  0$ Z0c^050 00T"3 P 0$ G0c^0r40T 0_"5"P' 0$ 40c^0bڄ 0tT"  P 0$ 0c^0840T 0"\4"mPE 0$ 0c^030T 0"(4"ZPq 0$ 0c^0ڨ30T 0"3"GPW 0$ 0c^0`30T 0"x3"4P8 0$ 0c^0>30 00T" !PZ 0$ 0c^020 00T"| P 0$ 0c^0mڈV 0 1T" r P 0$ 0c^0420T 0"T2"Pf 0$ 0c^010T 0"2"P 0$ r0c^0Qڤ10T 0A"1"P 0$ _0c^0\10T 0"X1"P 0$ L0c^010 00T" P 0$ 90c^0q00 00T" P4 0$ &dhO8O,MLHLKK,K?JJx>=>=t=p=<==<=<D<;<;<;D<<;;;:;l:;:`:(:H:99,98809@888777! @-DT`9L9?0c^010 0 0pT0 P 0$ 0c^0X10T 0"l1"P 0$ c^!ڤ T P 0$ 0c^010T 0"1"P 0$ s0c^04 0T"  P 0$ `0c^0|20 00T" P 0$ M0c^020T 0"2"P 0$ :0c^030 00T" P 0$ ' 2T"!00 0$ l30t30 2T"!00 0$ 30 3T""00 0$ 30 83T"G"00 0$ 408 x3T"r"00 0$ D40c 0T!00 0$ 40 P4 4T""00 0$ 404040 \4T""00 0$ 5050: 50 4T" o!00 0$ T50\50 4T"^!00 0$ 50506 45T"$M"00 0$ r50_50 |5T"9!00 0$ ^6060 5T">(!00 0$ ML60/ 6T"i"00 0$ ?60Z 0T!00 0$ (60 6T""00 0$ 70 70HTx!00 0$ D70iLy 0T !00 0$ T!00 0$ 7" 0PXT{"00 0$ ^ 0T!00 0$ @80H80 8T"@"00 0$ |801 `8T" !00 0$ 8080F80- 8T"Qh!00 0$ 90B_"00 0$ Y!00 0$ ~S"00 0$ x*0P h)al9 nt90 0?!00 0$ d9"00 0$ ^90 0g/"00 0$ T)!00 0$ N!00 0$ D"00 0$ >"00 0$ 8 "00 0$ 2"00 0$ ,"00 0$ &"00 0$ !00 0$ !00 0$ `z bP  ;-`p 0'P 8;"0S!00 0$ 0S !00 0$ 0S !00 0$ 0S !00 0$ 0S !00 0$ 0S !00 0$ 0Sl !00 0$ 0SD !00 0$ 0Sc "00 0$ 0S x!00 0$ 0S o"00 0$ 0S6 f!00 0$ 0Sp ]!00 0$ 0S T!00 0$ yPs 0$ r0S D!00 0$ i0S ;"00 0$ `0S 2!00 0$ W0S )!00 0$ N0S !00 0$ E0S "00 0$ <0S !00 0$ 30S< !00 0$ *0S !00 0$ !0S !00 0$ 0Sm !00 0$ 0S. !00 0$ 0S !00 0$ 0S "00 0$ 0Sj "00 0$ 0S !00 0$ 0S !00 0$ 0S{ !00 0$ 60 0x60 0"00 0$ "00 0$ "00 0$ "00 0$ "00 0$ "00 0$ y"00 0$ s"00 0$ m"00 0$ g"00 0$ a"00 0$  z 0P D5" o 0P"5"50 0C4 @@0 640 0-40 0$t4 @@p0 @4T0 0O440 0O30 0O30 0O30 03 @@j0 ݦX30 0Ԧ!00 0$ 3P0 0Ʀ2 @@F0 ๦B20 0ద20 0০v20 0\20 0m820 0 2`0 0I1@0 0zs!00 0$ 10 0k10 0bLl1 @@0 U81 @@0 H1h0 0?D0H0 06n0(0 0-z00 0$t00 0;P00 0,00 0 M2 3 01t11`1080/0.x0@/.//@/<.`--.--,X.$.p,d-,+\-+X+A-t ANL\0@Po>\DQ; 00P \QHTL a`0  046P0e0(#67(0a`  0 A03\ \ ANN1 0QU^\,+/ŸA-P@| Q 0AA M `4660@ pG0?p P0C`Ѓ0\?  P @PX P0. BP@T0 ) S PP0C0C0 QKQ0@* M0  0, l@3<\0 0O 0kP@056AP@ 0H 0+P@u` p p0l  `0P u@`@" 0P@@@0 Yn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BV@1 V @D 8,0400G0, 0 40@( (8/P840, 0S004R000@-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0$ R(400  0@=0U 0PE@T$0S0  0@4=0U 0PE@T$0S  ($  0  88 (90,K  @Uv 0PE@T$0DS, 0 E0@+@<0U] 0PE@T<($(<,00@000;00SD @x<00 00CS:0S ;008@ Q;0(0 S0(0@080t0 890w4;0U 0PE@T0S  :00;0,@:0000 pC0 0,0S P<@@B0S 0*S3 W 0PC000000 00 0 0#1<0 S@0@0R0 RR<,0 0PUS0S00)9 0 <0 30DЍ  R S R  DP?0 P 0pBS 00 0 C0 S 040U 0PE@T00  BR00S  \ 0S0($<,(<0$(0 R x800 90 00 80B4 R,5@0 000DQ1  P !ADL B \000D0S707 UR00u0 0P <@@I0 (S0 ʆ  P<@@ ;TU 0PE@00 S  SP S= 7威@D00@T80PE@TULQ60 Q H0 @S0 0CR*ʆ+R h6006000LQ`D0ʆ;460\0T 00T :0PE00@SUld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@Tz 0Sw 400h50Uu 0PE@T:0ʆD+1 0D0@D8+Ua 0PE@T:ʆH ;0 H @D;8^Dp840WS Up1 0Wp!WC 0 0C 00 00D0PE0CD00*Dpl `R*$0ATU% 0PE@0 0Rl @Dᨁ:R (0,00C 8 P0l00X0S>0p0P0?0X00 p0tP 200P30 R=0 U 0PE@T20H?o20$0S0G "d2$($B0#22cR<0S 420020 0L$Q   R D Up1p!W)R0 D ! $ R D ! $ R$!  $ R40,0000 100HU  PE@T  ( !X% 100X100+000;8D@Dt00 R  B0 D  0P00(d$$d"6?7?8?=?>?N?O?5?P?`^M?H?A?L?J?`C?HB9?:?;?0@\4 @Dʆ+8_04威@D0E D0BT4p(8#W" d400(40:Q  ;8D@D _ 0;=04HL0  : 40040 0@S4Dp0K Z0PE@ZU8tgx|p@p ⨃ ^):l0 0:00pZl0 0S 0X00\050P0;T0500 @D{5威005@D0 ;@{ 60050@ 00l(4890 (8(8:0;p600P606l 0XZl0PE@ZfUx 0C00Se 0 000 7 0pd41q岠pT*UR 0`4`UV PE1q岠@pW0`8@DQ{8D@D+8tgx|p@p㨁T7L0Q0 PpC$ 8(89v0@+Y\8@D 0w@D(208l0P0 0 0P00<0@@30 0`pC( (0R@D0+S(0,80080 0X0S>0p0P0?000pX0t0 04P4. `900p8 (89VSR: @3 0@0J9@0j900900 pC \ p 0T d \ 0h gP P:00p0 00威@DpC:00:0 0S:0:0 pCtp@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000Ph@Pp`W2@ R2Q <00 0 0S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S3# R0S  l0pS0pCp)x0 00 0P,04C0p0 p0 0 0 30 Ѝl0Sl0@@@6UGS???DP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPYP 0!(`3/@PR 8X8  ( 0(3/PI 8 E(!AP S>0Rp:oRS B P T  B T p X0Bp  (08##8@p 0BS.  p 8 d P S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?00@C/O-PM@ @㬰(0!U 0C0 0$SP $Cp`0 sRpW-(0p p0Ѝ0` Q`V00p=J\S 0W0T0S30b608#8P0U 0 CP0S 0SCU\! V ! 10T2 0 T 0SЍЍ0D?o 240%R00S020,0@0000,004@0D?o280(00<000 0 0 0C$0 0S03@05 :^`033N , %0! '05 %0 %!0(P<90C1P RP@00F3 0S C 0 $Q B("(R$AVG  ` V$  \ F Y( V F(*Q BR  BR^ : 8 Q  Rb4 %Q  R\<  BB!   S @1@ <01( 00 040$0$ 0 08@, 00SO-DMX03 0\0300 C  2 00!8ӗ1х1&=  tx l0J B0x t HH^Hl0:8HpXT`!Dp4`ᶐH@ᰐ00Rx0 Pl h`0 \0S8 B0l0\000S[ tCP`tx0l h Rl R010#P60 6SB \0P8 Brl0\00PЍl8  Ƒ R0Ƒ0Ƒ !  h0\0P8 BEl0\0{00SЍ. O-d $M tD4Yl 8H0XT0#D04@@QH0  ,0BA?C0CP`PƘ_p00B8#( Ƙ#<0Ƙ@t30 B0(1I>RD30+"8ӗ1҅1&=  `tQI Y 6R06XP0l0t080T@V` l H 0U#@H@0 Sl \P8 B0 l0\000S}$Ѝ806&6 &!9096tl I Qtl 1Y^ (t0!SX R S. Sl kP )l `f@A p400D`H0` l @5!0 PH0 ` 0 ll R1#\ Q \P80 B0 8l0\0n0P$Ѝ\P80 B0 %l0\0[00S$ЍX( O- ,0 IY!0 M@p䴟0UYZ0e&P* U! Er:\l`T`F Z PUP!Y /ooW"Z  ]ZW  00 #4 B %B B  0BV V`!0\ 8  \ 0  PE0CU`0`\  Z  BP 0 P  `QP ,8\t06 A,0l06\0 `QPl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \6&S06l0R, ` 6V`!VX\, Q* 65@ 0CP!P 1RW G/o"S W  R  PR#P`1`!WH80  O\00\0XPl<N^ Al 0n&lR &&0R8  0C \6,AQ  l00l0&l8 j, l0BP0l0\P`1`!W 80 \00\0c  PR#P" 0S $0S 0S P0X*SES[SgSqSS9 C0//O-PM@`?o2P0S}@0S0x S t0Ss0,0S$ RiL0Dp 0CpB *,0lp\p v`FP0*SWtpWT 0r ,00VpG*0*  00 P  t0S"l8P pLpXTD@4H0P  ;. 0`RH0`0t0l t0Sl  l \  60 tx`h  00Ѝ* ЍA-@P 0S $0S `PcpP l0t,@0S@1VTU@80C Ppp@-@P$ 0S! $0S ?`PP`0 S0c``,0S`  *00 00(0p`p 900&p@-P@P pP,0L D0<00 B@C 0\ 0 1 0|0:l@\@t@Fh@H@x ` pp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:`k6 @cU@ĠL Â0 6PUWtPPA-@P P 0S $0S p`|P0p`P|0A-PQb!Tc@pTe?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`௟0P 0X 0@S P X 0S\\ \((PX\ L\  RH/Sv0S[Q gQ 0St0S 0Sw RH R .0 103/0@S0S>0 X0S S000 00#400 03 0  0#400  0 n0S0c0?o20 Ѝ0So |= 000=St *S/0Sq00 0 0&S+Bzl0S =  B0#2 2c0# 0l0Sl q000(0S9QH K0t0 0 0  R 0,0S0Q0Q0$ 0Q00R 0000 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00Q P p K 0S  0PESo p W *PG 0 ,0 SR0 B0Ztp 6l8&`6&6 &!909&tpl0pG0Qtpl0_ Wt0SX# :Xv| 6S \0l S8 B0 l0\0/0P0S P|X> X 0S0(0 Ѝ0S 0>0 0 0 0 0 0 S0 S00ӈ R01q 00 0SEQ1X P7 R $0SS@ ~S  z 00#  #800#"0 x0 0 ,0 QR 0 0I000S'  0 0S0   0S,0SQ9:z RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:L R+0 B0j00,0S!  Rg  S 0 Q)0S 000#40C0q000SF 0 B050#  #800#"0 IQ#V\ R8 C0 l0\000Skp\t0Z(l 8`pR B  ^L 6ƅp6ƅp6ƅ!909&6Rt0l 0C t0l St0 SX S Sl 8`p0  X 0Sq0 B000 B000,0I ^ ^  Y Y Y Y Y Y Y Io^ᩒ#Y@KP``0P0@&ƅ&p0 ƅ0 01I>  0001&=  &6`Rt0l 0C `pt0l r\0S8 B0 l0\000S500 040\(B *X6I &R \ R80l0 C0,000K  |0 0000 B08L0DC0C t0S*l0\06\0l S8 B0 l0\000S410\ R80l0 CLJHFDB@A-@`pPStPB T00V0SI0S: (0sT Q 1@0@!A00000 |0 `dp( 0S*t l00\ R$6S S L D0 BC %060@D0 0!1 0Rpp4dp@-@*PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pSz $0Sr wpViV`F0HSr0FSRnZ WkFoY㫲[dV @!( `4/@Pk * @ 22)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fx00$0h(0 ~ Ѝ@ @0  000'-M 0 0 @ЍA-P@8PUPb8 `V 0x!(3/@PX `!@K 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P- @ R* D SR$ , 8 , @@ L DD  0  B6 0 &-;> 0$+0;/, O-@QM R0  P " !#4"  Pp L` @ *@+)0 @$ %q 0 1Q`!;  Č ` 0#:  Č (9  Č p'4 6" Č$ !Q P%D R ` @!A <Ÿ0# !Q#4" Ÿ " " 01Q"$#00# " 01Q"$# 00#0# !Q#4" P% 0# R#4!@ PUTl RR, 0R., R., 0#00R,. R,.0#00R., R., 0#0PE,4. U#. 0  A  @Q   " !T#4"Ѝ\ !" R !@ -Ppp  d 8 C-PRp ` P  0!\0 0#@B .P@18R0  C @$' C-PRp ` P  0!\0 0#@B .P@18R0  C @$'4 @-@Plp`hPp@` 0!đQ0 0#B  \ @-@Plp`hPp@` 0!đQ0 0#B   0@-1@4P\0 C @$!0 G-R (h Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H#7cHN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq$R' @-7Fc20L c! ‚'b "0C0  L A R,A B<P C,0@P @@ /qR' @-7Fc20L c! ‚'b "0C0  L A R,A B<P C,0@P @@ /q/ U/ 0`0/46ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O- ş pjDMWP@TĆP4R DQ- NP0P4 \ˀB XS-ʨ&σ pPpp Q-Yp& B&^ ScB C 00 p&P4 À fXQP4 !\˒0C`K P4`ˀXT$`; BXKT$T;!P P PQ͌Q- 1^ 22 ".A `{5P4pST.0J`@T41\0 0 00P 00 p0 !Z㲰_Q=0ⵯ00 PQ !  W Y ^PA ׼V БR"S & &  R[P- Y> 0 Ό KK0RPKPG 0 QR0C Y> 00 B 0[0000C01 KR  00N 0 @ 00T00s P\ R @02^02N00 R0P\DЍWP 0 [Q / !@LY0S F0GC$FpQ@Z p J  =A-P@^1RPA@D0+}n@R- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O-鲠 MZ``00RF@P!kΎ  R: Q@1 R5 ৎ@0`0@#4``06 RcUQpPv @P0d1h Q&8pDFh R00Su P`0@ [ ЍZf0p 8ZC8 !.P eR&(B(0 @`p0p00@`#4pp06PE`0cQ38fC8N@Pa6x0UGx#800P``pp0P't``pvApgTGxGx B(Q"(`0@APP0@#4PP06cR!0C 60S 0 S  P[`0@J R+=ʲPpeW6`p8C8000`p#406PEP0cQVA Ui@DH$H0 APP 0#4PP06 cTB 0C@6qppPg6Q0#80A6`00Gp`p!0aUQ6A S4 @DH$H0 APP 0#4PP06 cTB 0C@6r `[0@P`0f ' B("(PV\PAV B("(06OO-ʀ6kn@SMN 3003P0030 0300300%10 Jb ^@N$H@@p@p. BnS.H@Nἦ6S&00H DH4P  p, ! Ḁ@b T H DH)& B @@$D @F @dXDH&DHqZ" tqN.r@jTHp DH'x&pp@@p$D@F J @d^DH&DH0CS㎀ޕޅqಠ᷀jB^@N$HI @@ @"$ &J bX.H@Nἦ p#Rs `D0C8#8JO6S@ἦj 0c QA.P`kNP!``0C0aR! 6Ѝ@ἦk. 06Ѝd T H < 0 6@-S k>@@0 #400k.06S0k. 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&A-`*k΂@P8#8 Q.;pNp!ppaS0 A0 0  8#̠  4##<V0 0    *60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k΁6 S#H$(<0  PDHP@ 0@#4PP06 c^ 0C6 S0Ҽ60k.@PP@0@#4PP 06 0C6S S00k.@@6 0C600 6 k>@PP@ @"$PP Ɓ0O-p0@S M,0S ─&]P+(+%0 N. 0r?010S#@P j600&6 0!R1Q  S030#Z0SkΆ&0!2 R8, C8000 #40&0bQ3 B8&C8(K R!"(B(k>  0 #40编0iQ3 I8἖C8 Y("(98C8k0 00#40编0iR3 I8἖C8@! Y98C8k.0 00 #40编0iQ I!἖H30M>0k. !Pn\ N ό Y.NP἖ p m 00`" P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 00G. 0R0 0xS0   0LSI>W&&&& Ѝ ЍO0 &k0! R2 ʸ006N.V e 8C800 0#406 cQ 0C6 C8&!἖8C8἖28C8἖ L ĸ H :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  p@-@P`h0P `0P E@T @婿000@pVp)(@ pyaratcid@-M @PoЍX@oЍ@-M @PЍI@G@Ѝ@-M @PoЍ8@oЍ@-M @PЍ)@'@Ѝ@-MpP` @P @Ѝ 3Vp  /Ѝ0@/T 0p@-S P@0 C`'0@UT @p 0 p0A-S Pp@0PC`'0@UT @000p@-S P@0 C`0@UT @p 0 p0A-S Pp@0PC`0@UT @00@- MP Up 0S @p0@Ct'`|UV ` Ѝu0 0 Ѝn Ѝ@- MP Up 0S @p0@Cd`WUV ` ЍP0 0 ЍI ЍA-Mp@P `P ZUp 3. 0S P0 C3@ &UT@ Ѝ`Ѝ0`0Ѝ0@.T` Ѝp@-@lPo0PPptcidp@-@`Pc$0P p!00ploobp@-P`!@P   @Vp@-@>@@-@8@@-@2@@-@,@%@-@&@C@-@ @R@-@@p@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@3@-@@G@-@@`@-@@x@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`p@P   @pp@-P`^@P   @pp@-P0`PJ@P   @pp@-P`8@P   @ppp@-P`&@P   @^pp@-P`@P   @Lpp@-P`@P   @:pp@-P0`P@P  x @&pp@-P`@P  f @pp@-P`@P  T @pp@-P`@P  B @ pp@-P`@P  0 @ pp@-P0`P@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-P`t@P   @ pp@-P`b@P   @ pp@-P0`PN@P   @n pp@-PV@Y(0P p&0P 0pgntsp@-P`@P   @K pp@-P`@P   @: pp@-`P!@$HP p6P U %00ppatadp@-P`@P  _ @ pp@-P`@P  M @ pA-P@ X0P @p)`P  @P`e+gntsp@-P@ (0P p0P 0pgntsp@-P`,@P    @ pp@-P` @P   @ p@-@R  @ p@-@"P $0P p00ploobp@-P`@P  # @} pp@-P@P @#@n p@-@"@@-@"@@-@"@@-@"@=@-@"@[@-@"@j@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@@-@{"@@-@u"@2@-@o"@K@-@i"@_@-@c"@x@-@]"@@-@W"@@-@Q"@p@-P`@P  l" @ pp@-P@P "@ pp@-P`@P  J" @ pp@-Py@P "@ pp@-P`h@P  (" @ pp@-PW@P b"@ pp@-P`F@P  " @~ pp@-P5@P @"@n pp@-P0`P"@P  ! @Z pp@-P0P@P "@H pp@-P` @P  ! @6 pp@-P @P !@& pp@-P` @P  ! @ pp@-P @P !@ pp@-P` @P  z! @ pp@-P @P !@ pp@-P` @P  X! @ pp@-P @P !@ pp@-P0`Pt @P  4! @ pp@-P0Pa @P l!@ pp@-P`h @P  ! @ p p@-PV @P I!@w pp@-P`E @P   @e p p@-P3 @P &!@T pp@-P`" @P   @B p p@-P @P !@1 pp@-P` @P   @ p p@-P @P  @ pp@-P0`P @P   @ pp@-P0P @P  @ pp@-P` @P  ^ @ p p@-P @P  @ pp@-P` @P  ; @ p p@-P @P t @ pp@-P`p @P   @ p p@-P^ @P Q @ pp@-P`M @P   @m p p@-P; @P . @\ pp@-P0`P( @P   @H pp@-P0P @P  @6 pp@-P@! (0P p0P 0pgntsp@-P`@P   @ pp@-Pu@P @ pp@-P`j@P  { @pp@-PZ@P @pp@-`P8@ HP pP U 00ppatadp@-P`p@P  ? @pp@-P`@P  - @pp@-PM@P g@pp@-P^@P W@pA-P@p X0P @1p$`P  H@P`&gntsp@-P@R (0P p0P 0pgntsp@-P`@P   @Dpp@-P@P @5pp@-P`@P   @$pp@-P@P @p@-@Q @ @-@R  @p@-@0 P {&y&p@PPg!0S b!p[!0(m@-$@@B!l$P 0R @-P Q Mo// 0S p@-P`@`PPpuP p@$  P 0 o@-0  ؙ  @-P Q @@ @0@ a0 ( (0( b0 됙 ̘ l 0  @-0< 0 h m0@-P M`0! ~#@P 0P0 `  Ѝ%ppp ⵰P`   @% Ѝ %QQP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@ ꔋ t $@-@P@X p@-{@P  wPP 0, 0p!@!p@-PQ`@   0 S S CPQ 0 S S C^Q<S0S !S0-S0F?o2-Q0S0S -S0-S>Q/S `(` 0 S S/S>S C\P `Sq 0 S S/S>S C\P0FU0 RZ;FPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0l(0S0$00>S`0``000 0pL L0L H0 ~0`uC  >R00p  p P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- ?EoO-d1KM0 `p 000X 0,A P @ Q+ U EPP 03/P 00  @04/P 00 0 PgPPKߍP@ 0@;/ 0 @PPKߍ 0G-@,PPD aq`p@@0 S S   CQ R@<S,  )P   })P   w)P0 S -S@0-S>Q@@0 >SS @S@P@ꌂ A-PRM`Pp`0 @T- 0@0W   WV 0 /R C 0CW /RW  CW0  B/Q p!@C@T@!  e;@04D.0 0ጯ 0 S* SLp@  DU B0@D6F;0@ۍ5? 0 ۍ. 0 ۍ S0Dp NEPLEDEp DDp@x C-`M`P@P5 ,Dp`H FpB pEe0R:p#0 `[00Dp*  00 0[p" 0PPЍ0 `[00qDp  ЍfD@ЍE@@-@ rE@@-hP 0 0 D~ |} | O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`ha P0 p 03/V@ 6/T hT T @T@. 0S2 03/P V 6/h0S @0 R 2/0P`h P V 6/X3 003/Iߍ 0 0C/ɸ 0 0C/ 0 0C/ⷸ 0 0 ⮸ 0 |0 ⥸l l0l B0C/✸| { z { { xz { X{ Tz { 4{ 0z E{ { z ;`{ { y p@-P@PP  P $0SP  R PpdBP P ^PP , `PPy ly P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0gP 0 $ \00 Mߍ R00 0 0K/ݷdx x v  0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-@ - GGp@-!@ (M  P l  ࿆```YP(Ѝp<  ెP o(Ѝp\x v ,x $@-@MHF@-$@@DFlop@-M`Pᗹ@0 @!0Ps0*0 00 Ѝp耹0"Sp@-M@`vP0 Pqp 0 00 Ѝpa0"S 00 S 0 P:\03#/S 0 P\0///A-P``Ҧ@P (pP Ṧ@P sW@(0( (0 ஶ@D*Lmt 0u u 00 S 0 P:\03#/S 0 P\0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00R k /P/0 00R / 0  Q0 R* R0:/- ^ : P *0 S0*/@@/ / jP $0 00R //iP $0 00R //iP $0 00R //xiP $0 00R //@iMP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/iP/l0 00R / 00 0  S *0/ ɒ\* /XhP/|0 00R / 00 0 S *0/-  ^: gP/|0 00R / 00 0 S *0/-  ^: HgP/@0 00R / 0 0 S /fP/|0 00R / 00 0 S *0/-  ^: dfP/l0 00R / 00 0 S *0/  \* /eP/l0 00R / 00 0  S *0/ ɒ\* /TeP/|0 00R / 00 0 S *0/-  ^: dP/@0 00R / 0 0 S /DdP/d0 00R / 00 0  S *0/  R* /cP/d0 00R / 00 0 S *0/ R* /xcP/h0 00R / 00 0S00/ \: /cP/h0 00R / 00 0S00/ \: /bP/T0 00R / 00 R /! /bP/h0 00R / 00 0S00/ \: /aP/d0 00R / 00 0  S *0/  R* /$aP/d0 00R / 00 0 S *0/ R* /`P/h0 00R / 00 0S00/ \: /4`P/T0 00R / 00 R /! /_- P M /o<0"00^ R Ѝ R Ѝg<_P/L\ /  JQ\/^P/L\ /  JQ\/^P/P\ / Q/S/Q\/,^P/P\ / Q/S/Q\/]p@-M0 P000 00S Ѝp$0@S `0-S 0S0xS hP T CP ЍpwPRPc Ao/A-PP@@Pp t<0,p0P4080<0P`p @u@P@\2@-@  t2@-(@@ GT2[ᡯ➯@-@ @O-4@T `,@@D¤@`T PpQㅑ PZ P PZ  0 0  c e c z @-R 0P< P 4Q ,  D D0D @0 0 000 0 |Z4e b b ce b db p@-@M4 00R<SP,0 S R( 1`V9 P` 0 06P 40, 0C40P0 `ЍpS 0 0D ⲱЍpeЍpR t t0t 0D ⚱\ \0\ X0D ⑱H H0H a0D ∱d 4b pa ac a a c b ` qtc b ` A-@`,pPP W 0 !ᶲ,P0`,P0`G-@P MpP  0`0Ѝ!0  6`P (0S1 0  *P (0S$`V00  0P 0S  `P  P X `0 yP O( (0( $0\ ] tPa ` ^ K 0  @-0 a ^ `^  0  @-0 ` _ (^ 0p@-S `  Q P@0@p 0  0 ⿰UP` ] ] {p@-0S h`@`PPp<P p@ 0  0 ⚰@ _ ^ ] 4 @-R 0, B4 P @H@ @0@ <0B/‰, ,0, (0B/wT_ l^ \ 0_ ] \ p@-@PP#0S ,  Q <0 0 p@`SO-`p@ 40Sa HP@ P 2P0UGP 1001000`SZ 0<0S 0  R 圑 # 00R&P P [H P P P 0  03/P PP 0 S O 00CS 0 0PS Px@` `0` \0J/įL L0L H0R/⻯Y SPRp hX X d\ [ Y @\ [ Y D@-@∠0,S<SS`'PG-J `P0pUIU@* 404 SS= G000,0 100,0$ 100,0, P  ?o 0 2\0S PP*    0SsPPPPD D0D }0.;, ,0, (0.2O@Z Y W Z Y pW G-PP' 0 0R"p4x`P 4 R @, 儡ᄑ! ,04 儑@ 0T:804 80`N0P 0  Q@-P80080/Mp@-@P80080p@p@-@P 80 0R@ pP4@pMp@-@P \0 0R@ pP`r00S@#:lp2@4MA-@`_T 0p0WPP \000P000>0@S 0< p 0p>LA-`P 0 0R4 p*40S @40S,0 PP@ppLA-@P 0`0VpP0S P @T @ @0@ <0R/2@@dKV `U pS A-PP /o0`0"Q@@T 00R p @P @T @ 0  0R/J0U tT R O-@PM 3` 0R PЍ4 00R80p  PP @}`P ЍSP ⫝P3 e 004Q\ ]4[_ P,10Q1 0P0ZUPE Pm 0P !${ 0 ,0傁1`4 <0 04 <0 ,XG<XIXKlPUF ء0 I  TP"  0,S<SSLPP  ,0P`<04 0<0v100 ႝU. q ,(P<$PP_! z,04 `<0 0P4 <0P 0 0^/h h0h d0^/ P P0P U0c/Ih G|Q O N Q N N XQ P N G-@S ` VP p P % 000 Go 0 0i/ì`P P M -0P M ?o@2 ^0S Ѝ00 S ЍE@-PP M @1 0R Ѝ`@P 80 K Ѝ >0P 4 Qp@ R(*, S1  A!z400C40<00<0,*h h0h d0s/aT T0T P0s/X@ @0@ <0s/ODN M ,L HN N L JN XN K I P/?o0 2 R0S/00 S/ C0P -?o82 ^0S 0 SC/BP/0 000R/BP/0 000R/XB P -/o<0"000^ R  R/ Bp@-P_@P 4P 0 03/P EP @ap@ZpA-`P @P"pP $P p0P  pASp'G p@-P@PP ! RPP p0@ۭ@p@-@P 0@)F @-@0P P 0R R@-P0S /5o/808 80 T$0$ $0 LL \M L `L ? T? > P/0 0R/10P -?o82 ^0S 0 S/1P/@-D@T ?o 2^0S1o41A-$PMU@P` !0 P 0S6Ѝ 0P ppm PP   0P8 0R4$ P- pW. Q @P7 0P 0@ꖩ0  P<p 0  0R0"S | |0| x0 5y Ѝt  @P Pm0"Sg \ \6 /< < (< /P/?o8  2\0S /0SP/.p@-4@4P@P<0 07p.0Sl4 X4 @-@<<T(@@ @@@t\@@-@P (0 0Rs-P/0 0R/-P/0 0R/`-0P -?o82 ^0S 0 S/,-0S /$0p@-S@ P0  xP 0  pP tth@@ @@pLLL@@808 80 ]2 2 $: : : A-PP@A @Pp |```0,p0P4080<0F P`p @$ @Pr @+@-@@ @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 $+X9 : 9 B9 : |9 GPG-3 Pp0`W2W@ 404 SS& 0000P,0 10,0$ 10PP* y w t rPP@ @0@ 0( ⩥( (0( 0( ⠥9 \3 H8 9 t8 $8 p@-@M400 S4RP,  R S 1CaV1 P` 0 0P400C40`ЍpR 0 e0< j   ЍpS L L0L d0< U4 404 u0< L8 7 L7 `8 `7 6 <8 1 6 A-@`,pL PP W 0 !,P0`v ,P0`p@-00P4Q8 @Q 4 <0,04Q<0pPp 0 &0P 7 6 5 @-` MV' @Pp }P00 Ѝ| 0  P (0S @P 0 @AP  Ѝ$ $0$ 0` Ȥ+ ,6 5 4 B 0  Z@-0 ⸤5 <4 4 40S 0C40/ 0  @-0 ⥤5 H5 84 0p@-S `  Q P@Oq0@Ip 0  0 ℤ,%5 l3 3 Zp@-@P t0`0VP,0S R <0 0 p@$ $0$ ]0 \$|4 2 3 A-@`PM 40SO P@Ѝ P d10XDpP @10041000@SB <0 0 00S 0/0 03/@P P; 00CS 0 @ 0@S EPhЍAL@8 808 0,P) #0( ' 2 , 01 G-S &X@ PU 0` 0R 00p wP qU r G 0  0F/⥣!1 \1 80 LKA-PP 0 0RM4>pP 40S @,0a4, 40a@T:8 408 6p !@-P80080p@-@P 80 0R@ pP0@pd p@-@P 80 0R@ pP4@p p@-@P \0 0R@ pP`00S@#:p@A-@`T 0p0W+PP \000P0000@S 0< p 0p>@Lp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/@. & , RA-@P 0P 0R@ p`f8040S !,0X L<0, 0Q<0W@O@e@D D0D @0S/⃢0 000 0S/z- , + , , + p@-@P H0 0R@ pP`7@ppA-PP0 0R@p4\ 80,0!aV! \ ,0\ <0L04<0AAD D0D @0W/!0 000 ,0W/+ `+ (* l+ <$ * 0P -?o82 ^0S 0 S"/p@-Pk@P @P 0 03/P QP @mp%@fpp@-`P pP@}P $0S p@<4 p@-P@PP 6 gPP p0@@p@-@P 0@> 011/A-\@`pP \"1S 0 €  P 1o0P !`p P 1@0@ @B0 g,0, ,A0 _\* * (* ) * * @-@^ P ^(QRS  T00QNRS"  T  00 0 Z0 ) \) ( 0@-@R00QP,M! P! 0       H0T?o20S00,Ѝ00 ) ( p@- @PM`00$0 00 0  0 @ SЍp 0@-@P M0   0    P  Ѝ0p@-@ P0Ml,`.4l4#0ۡ "44 0ӡ "44 0ˡ  0 @ TЍp0@-M@ 0P ᳡0 |b" b! ⨡ "440 㡡0!$$    SЍ0p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0W P0V00(Ѝp@ R 0S V00% @-@ T00@-@*p00T0F+0G+0H+p,+@-@T @-@T000 000S/@-*t000 000S/@-١T*t000 000S/@-ɡ*t000 000S/@-㹡)t000 000S/@-㩡)t000 000S/@-㙡T)t000 000S/@-㉡)t000 000S/@-y(t000 000S/@-i(t000 000S/@-YT(t @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^  \#t< 0 01/001/0 01/0S@-@1/00/p@-P0P0 0@0PS` )Pp p&t/)*@-ڠ-@-( 000 000S/@-ɠ&tAo//0@-p@P M 4 P* Ѝ0 0 ;0 ๞vt  @-p@M L *P pЍ(0( (;0 wt@h   0@-pP@ M T T T  0 Ѝ04 @* Ѝ0 0 :0 st X 0 p@-@ @ $* 0 80 ]^t l 0  p@-@PP (P$Pp0 70 H*   p@-@PP (Pp0 70 5|*   p@-@PP $Pp0 70 "0*   @-@P  Y.<+ < 00 ;0 )  x @-@P ( 0 70 (t)  h @-@P $ 0 70 $,)  X R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@- P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P680 0 @ 0 048# /UUUU3333  p@-PQ@ : S d S V Sb00Z r0-0w-!- R00[ >R-   @Rx  : rP-Pw-P  RG !R-   Rx  r-w-0!@ T8 T2 T8 Tx 0    p Rs   ! Rs   0 Sp00  Sc00 ?00 S1  Sw00 Sl00 S  S  t 0 T 0 - 0 h0h h09 =: SqA00ua0-00pd00ms00jxo (  G-0 ߛA 0 %   C-hh"h2hM 0 PDH L0TPm PX`p ㌐吐唐嘐圐P寝p@Z pp 㧝p@e 7$P  09&p@] X04S040p0@S400408<@N-4--0s-{<1<0 00D00 0&ቊ>-X %ꀝ0S  qp@ Z V %@Ѝ'OoBЍ@Z00 : 5 1   P  O-PMp 0GW"S00`0v@ᑖP-TPg +T@`0W ?  0+0 $ P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R  "000R00S0S R Ѝ0pS 0F00T& W p p0@0`꺜0 0R 0 Ѝ0 ?0 g00XS00 C R @0 p` 0| A BRWf p poꙙ   0 0 07 4O-PMp 0GW"S00`0v@ƕP-TPg +T@`0W ?  0`0 Y P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R  "000R00S0S R Ѝ0pS 0F00T& W p p0@0`0 0R 0 Ѝ0 ?0 g00XS00 C R @0 p` 0| A BRWf p poꙙ   0 0 074O-M8@d6 ?0@P&P6P L 0r[4&464 0 g 0S&6  0[W %5  0P[%5  0E;R~0S00BX0<ʐ5 000500S 0:S d50HW 50 0+ C :R :S?2:0  0S`0  :R 0X0! $ 00404 0$  R$ G = c0P0x C00 0Z pP@ P`ppP`U  PP 2Q z  Q Q 0PRpU`0SpP@z `S 0BZ0S" 2 00S 0:S  M0 S2 00+ Cgc0JS0S9  00 S P0S`,ЍpP Ḋ1 00S 0:S H l 1?0 k1 00S 0:S  Z 0 10S$000<1 00S 0:S  00C 00S0 0 00+ C818!0 0 00S 0:S H t00@0+ C10<8(p`XP 0 ` tN d0 Pl   _@      a h t  t H L < L tK  D PH O-0pQ ` V 30 R# P@T60좟 R01-[@P-T@PA T"RPP aP -@a0P  :R7 X20 0SD" 000PP@:T0S " 000100SI 0:SF \ 0?@0S1 0@ 0P 10P|1||0 0:S5  X , <1<0:R@ 0S  0?@?@0 D0 VT0 E0 K00000 0 @ {@yD|T(\F p`L , PE П|E lD X | L $ p`C @-@P @ 0 /0 Ǔ$ L ( @-@P @7(0( (/0 ഓ@+ 4  @-@-Q Q Q  Q 10 0 0 0 _S)r0! SϠ @ ND^ 0r0!# \ 0 T 0 $0$ $0 +  A-P @`0#03v0a 0Vp BT@! Y 0 0R ! 0 ipP   F0 p `QPA-``M! PpP@ P& 0`0p `` 00`0 @P Ѝ @00Ѝ0P@P0P@PlX0 0 Xr -0   Xr p@-@PP` U0p@  .J0 40 ੒l p @-@P 0@ J 0  A0 ⓒL   p@-@PP Up@;  J0 60 {  @-@PM 0 0$PЍ0 00 ` 0 Up@-@PP U i00QUPQjp \00QUPU00Q0 /0 1 X 4 R! /A-pRP`@ @T T !03/pWG /p@-@P"T 0p@/pA-`Qp@P R̃P0开D00p 00$`,@(P0R 0 A-P`p@P< 0U0! V WppP`P`P' 0 0 00㼀@$P,`(pD 0W xPxpPpV W XpX`p`LPPD``귓00p||Xp@-@PPM& U 0`1S ,0S ⚒$0S ⓒ pЍp@0@ @<0 e(0( (;0 \X ` , 8 <  @-@P 0S$ e0 P @0P [0 0001 1 00X404 4<0 +@ 0 t | p@-@PP% U 0`1S ,0S ,$0S %7Ipp@0@ @90 (0( (80   p@-@P 00CS00 PpP0 70 Ȑ l H --M  HЍ Ѝ/ -- M0 0G ЍЍ/0@-0P$M R P0@S&  S$0  B!  0$Ѝ00Ӆ L000 b0 PS@$  $ ) , P 4000S$/00//L 0 C-SRPQ  9`P0`0 PT`X`\`00Wp@? l6P80d@0408px E@P! i kPrj벎00S. 0=S0`S/`V`X`V `ሀgPꛎ0#S PU 0@|%d5 0 |4 30PݍЍ800C80<w@x 0 P&Pi@ aPx 0 PP 4  H< B<(0S800C80}  0`P<0,$pp80 [_  PW0U04P@@00H`0 Pھ0 40xPC 0`V(0`y0S S `*  m `"  e$`  ] wP< R&0ZD0@P΍U0 W 0F0d 7(0 0 s0_o 00p+SR0S @S# 0`PP _opR0S @S* 0LPP` _opR _op`RpP pU/ 0 0 2 301ߍ ⧅PP,(d 0 d 0u| |0| 0td k0S\ \0\ 1d 0_$dD  X l ( D O-PPß MM`PȍP@yv T W 3U0&N 0AM.0; PY 0SV ܰ + 68+ 7\ 0 ~ 0  0th PP @ "P3H0: SX $2$"0 &\ Y Z"1 0 8 30p ލЍPP 0 @JP. ;100S1!0 &l!l1l t 0༇TL!L1L Ht 0ేWv0!010 ,t 0ইl ᆃ P \0S  S 0 0 &0 0 &H0 0 0 &0 @<8h H DL \ n , 8 p D `  ` pd A-@P`p0M- V6 W? 0 0 0 0pP: @T@T 0 pPP 嫋0Ѝ @᥋P0Ѝ 0  0Vd d0d ` 0WH H0H D 0P<   ] T ^-|| $M! 0 0 0 (0 0 0 30$ЍP-xx $M! 0 0 -0 (0 0 0 30$ЍulO-p `PPM  Bo0@"02 0  0B ^ aB\WBAB\7B R Q AL\  &QIDD(00 D0S0R0S? R0*@D T T0@Ѝ T:0 0 }E0p D TD [ R [/ :` 01 0 \0\ \0 D0D D C0 n | H $ @ x $ 0G-l@P?0 @RP;T !3*.0q0000ap ?p??`0 S Q#20* 00 Z* 0U0 R*Q * 0U000?0R*00x?Rp1?p#`@0 0S ?0Q*:00T: t($ p ` hA-P`<@<0@p,00 ₑ@|@-@PM 0l   00@D  uTЍ$0$ $30 f꬇ 8 4 | @-@P(M $0 0 0000000 <P !\ 0" 0(Ѝ( (0( B0 3d Ȇt p@-`P8M@P ! T* U3 40 0000,00(00P$0 $x<P+" 0# 08Ѝp 0 0 Tt t0t 0 UT T0T 0  0 ( d \ 8 t O-8"82 0TMP0L00`w Vk  0 00 00 !8 SoPPf @p㬱 0 p@P< 0+S+0S((P,$ 0  (P 0$W,$,0S 0 0 L0 30-TЍ0 <P  rPu 0 p p0p Y0@ PT T0T X0@ F} ̽, $  l $ d O-!1 0pIM010vyWX PP[ @`| 00 `=@P; 0+S+0S(BP  0 lP  0SV 0 0 1 30"Iߍ P P; 0 D D0D 0P ăTX 8 0/᠀0@- 0 0MPP000@" T* ⽒0P ""  0S0 0t h0 0 0 30Ѝ0L0L L40 |T!=P@ :L  4 @-!1 0FM M@P0d40p/ `  PPd@" + P `0@[ @Rh \0 0 d4 30Fލ Ѝ4 404 N0 &0x @-0 0dM@P0\00p` Pᾑ ؑRX P0 0 \0 30 dЍ0 000 h0(   88@-<@<M@ 20 Ѝ`} , `8 #4`43Z!R //0@- 0 0M@P000P# U+  @0@  "" 0S0(0t h0 0 0 30Ѝ0L0L LF0 U)OPP L똵l 8 G- M砐 pP E$e4" P;0F W08p;t0' T C PP!  <T0@To0a0@ \@  z 0 0 4 30!܍+J0@ EU@ 0P P|Q Sp x@|`t 0- M Ѝ@-0 0dM@P0\00p` P ,X P0 0 \0 30 dЍ0 000 0 ߁먲P<  O-/? 0M@Q000 ~ 0S @ \ \ p `` ` !?b"`!P+d+)P b)͌h P%d P Dpgbx"n.'t*|bt'n* )PdA, TP`lp`@ iA$L@Hi!h(f& +e,)f)h+ t . 'M `k(+x`eq "$p,k$"eq'f& ! p*d (+ fd+eQ,P)P|Pe%}(nd.eT(  "d)͌$ g. dA k(+ "$,@k" @$읉@l @&`g!,,@@ fH&g!"$D ! Li,fd$@gA .aH!*$DLaD$p*+匠- `j*i +j+i(P% `&b  4``ian,ah!&d .lad&.'._%@$0P p_$bq.8PPpbq'͌pe%h. ) }eT)l.$+, *+.$+@**b!d($"$,,dD"( *.0/"+.4.`&+8o&+ ,o&`ha.`ha& `$_%_%0_% PgQ,Ph P%PO$O$m`O$g @O]g. fA @͌ eQ@$gqpfA% @?fA$f1ꯠ`*!`!(`.})la%`@`&0`),**.* 0 .gq.Ol'.P=OP`'].lc1O `#.p͌p뿠+`''@++O+8ea#$@O `&`꿠@m/+ (/"/"+++lOe, 0,O0n,= eQfan&P@) ] 뿠坌+@ ++cA&+,0@$n@. $, ,.8eQ.믈(`.c% .Mꯈ`c1ia%`&dAꯈ0ia$`&P=PmP<_%$_%_%_%n$0P_i+P 쟠_),_%_%PP*)P*))c1ៈnQ#@P%潋韈PfA# ]n @$k쟈@f+.00(.!!, .8..M4e+f!`.0`)! "0%0 ?0%0?S@@h ~0hV@Hp` 0V@@p`F A}H H0H 0 |, ,0, 0 | H p p@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( p|TH H0H D0( e|*뜝 Ȫ    ̩ | 0@- 0 0M@P000P# U+  @0@  "" 0S0(0t h0 0 0 30Ѝ0L0L LF0 |U)PP ؛ Hx 0 G-pQM    P0E4eP;0F Z08C;t0' T DPP!  T0@To0}0@}@  y 0 0 5 30"Qލ+}0@}U@ 0P PuQ|@p p@`pj먚ę 0- M Ѝ@-0 0lM@P0d00p` P" *X P0 0 d0 30 lЍ0 000 0 m{2x < 0@-@P$ $0$$$A  0#EgܺvT20O-tM@ 0g| p D00HP&0P%0P4Zg& 0. "8 bnf+%0 " <(g+eK.g;@$@@dJfKn"f;,D͠eˌb;$e[ 0#H0cpmvmzNS ꫠa0< ' c)`0a.neL *0g+e; " -l`+0.j;`0#h0c=g;ࠀg{`"n a 荠i,`ak&Dl̠jˌ #j8b  m ` n 3i`Hp,c{n p'p}8b{@P l.b+ b*c@@$gX `m$fi&ak-P3 j+k[%@P! c; j@KlK.0+NN00NlˎYi[m4 6D=30+Li;h!L`L` *k0ꭠg d@ mČƌ͌3kˌf+" d,mČƌh+͌03e;#hˌ) n T0荠 g2 Pfl{ a" a,fk`Hhekb( b,e[P@]a[h& h,aa4bf% f)b+ L뺠+I╓Ij૗Ij k` d *C-@PlMQ dQP0SH  P?R0 00//r@-M Pp @s`P`W0D>S 0!31000 sЍ>SH 0!31000s00s00lr/-p@-MsP@U@0 ` ` @Px0x 08 R;0Ѝp@Ѝ/0 a0@( ( @q<| < P<A-@P`PpZ =VC #X0FS#S !  +0F0 `0UPP`PU`0 0 +W% -W' =W000U0- 0@+` D0%2! 00 PPPP @0@ @]0 'q000000 P~ ~ T~ p@-@PPa 1 @0RuSpWSQX0CSG5 +p 0R \PSPQP\     0 T 0+S -Sp0$ $0$ b0 pI@| | d| O-x[p\M 0H@ 8P80<0@0D01 ` )0r @0Abr@ T9H800p00000P  08 0 0 80$0`(a0GS" ukbfr00cr0 @_^r@ \Ѝd700\700+W@ 0-S=W 00 00lP @X B R j b\S  "=W  R"  0 P:04 r @ 4ar R4 0" @0 0偑   K0X# 0@ T:4qp@ 4aq0S{400@" @D@0@T V00X00@0@pW ,WspPAS0P! Y04q P 4\aq RL4 0P" PEP0 0P偑   P0=W +0G?oX20S# Y4qP 42aq0S"400P"" PEP 0P傑U V00X00P0PY4nqP 4afq0S400P"" PEP 0P傑0T0 000 V   ;I?I00V  l0S0@ T:4"q @ 4`q0S004@ 0C@0@Ty H2-+ 00 P 0\Ѝ'mp``=W   0 0!]0 n] 0 $nja1Es|p00 \Ѝ00[pI p X`+P-@ +0B XR Rj  +0Bp0+R XR  -Rp  X@PPQ`p0p p]0 wn|X X0X o0 mnmd{ d{ 8z z Hu u s s s s hs ps 0@-@PPM 0  P@ %p`Ѝ00 :0 =nDo (s s P 0 @-o/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`;P+;U PU  0  $P@P PPrjeP \0001p@400o0PoPq P  p@-0P@`T q@T0rS iPp0p@a_P0+Spp@!Q4p@-@PrQ` 0  P?<0P0 `@p0  P/3@-1 M0 00P0^ 0SR _0P0 1 00SC\p@( P X\ 0<1 00SE000 Ѝ6z0 0 @5`/o@/\0 00S "o00@ Ѝp0p p0 lX0X X0 l@_tt[ [ [ [ Ln dn $n e @n n t@- M 00P0  R 0SE 0P0 \1 00S5fp P 051 00S=000 Ѝmn0 @00S b`n00@ Ѝth h0h  0~lL L0L  0tl0{]t(l `l 0 kJ0P R@|i i i O-P!PR@p0A%OQ 00000(0.h10`0d0 00000p(0"[-]P4 !$M pM L A-`QPM3 0  0 S 5{Q @ pQ {Q @0  +P  oЍ Ѝ0}S0S ЍA^8 808 0d cf 0 K K 4K O-MM@PP`p8A RJ T:  D d0S @}\ \ [\ {\^6 N\]\@ \ ލЍ @ ]RRR @ !1 p 0cVt!t1t pp 0cQP+[S0 ]SS*SP[0 P{S &,S^U ' B0S00 (0[ 00ލЍ0]SS 0]SS }S^NU  E B   Sd  pJ XJ I DJ I I A-MMp@PP` < 000000,  0  ;T \00  ލЍ ሀ \^ @B0@S0 @90BR ^JލЍ$ $0$ | 0b\@G dG F p@-`P Pp@PTQ@D PEP@DP t000p 0  0 bF F 8F 0 S. *S8 ?0C\#S 0 P/0S /Q0 S 0 0/p@-@PPD 0 SJ  #S3 S S" S 00@S "S0, \\S 0000 S@R$ 0p0"S@00 CQ@ S 00p0p,0, ,0 bpp܆ E E 0@-QM M 0P̠ 0 0@050 0p @EO0 00P0 p \0 0 5 30 Qލ Ѝ0D04 P 0xE 2xD dH |2 H G-pepM` p #S$c0 зP@$ 0S %P @ 0Sc0SЍt `p0@S 00 40   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000  P 000#3R0 \# 000H P 000#3R0 # 000 P( 000#3R05 " 000 0#S RP@0 S00&.P0@@0Ѝ0 S SD P 000#3R0 " 0@00o P  P0 000#3R0' ! 0 00RЍ 000#3R0 P! 000</ 0@S 0 '@  \P =Q- 0P0 0 JP=Q 0 @0 0 % - 0P0 0d1 C B tpA P A h@ 8@ @ @ l,? > > > xA-`P/ 00 P$ PpPpr@P H]P $P =0S 0P@dPPP 00@4 404 I0 `= `X= |= h= < P0@-0$P 800 R @0 P@(< (00 R @-bx ,00 P @-U@8< @-,@@P%00O-ȟ Mȟ@P `pP̀ VWZU D TpO02, _`T T V 0@/02h11 07@0 070070$0Z> A 4 0 0 p P2wa<00@0SZ 0 O0STP'87 0 0 30 Ѝ ps?0|0p Ⱉp@ / PTpZ/ A \#R `A \#R aA \#R fA \#R~ cA \#Rw bA \#RE YAP#R XAP#R WAP#R= \AP#RR ]AP#RN ^AP#RA _AP#R: TAP#R UAP #R VAP #R 0S:V 0 /@T0S C K P< p0/@0000@/@ c0 QT@9/ R@'`00 /0/`Z0ST 0 `00  :_V {0S @q`00/0#/Pj`P0@`0 a 04# @ @  / "0   @/@"0   @/@ / e2"_0 ^lllp@<L 0808Pi@ 0S `00/0/@ `@ Pi {i ~@/ [_r_000`O 0SCK @@ Hbx0@/ 0;@8  $U@/ 208PP@08P<0@(@@0 _Y0 @0J0S0  2/ `00C0  &/ @.@+@(L@{$\)<)T; . ; 'D5 6 5 5 @\ 5 44 4 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFpP P Ѝp0A-P`? A@0S' A@Q0+pPpPP A@P  p0 @BAQA3M@ p0 p0 ,0, ,<0 \1 1 1 p@-p`pP`P@T T0T0 R@@pQP00ڼXA-P@P`@p̼0S |@@R R"@`ྼ]@%P00^0@嫼D$@- 00 C-`\MPI@P- 0S|00V $"$ ~+ UpЍ h0P  $ R%pȁYT 0N|㠁0 |xx0R1 0QG B&Q&R-.4 p0ሀ Wtq{\ SzڙHvH0 f `0 8$e / \e / / D/ e 4d 4_ . 1 0O-,,% BMM $ %u  %p 000 0000+ 0uP 40 4~ P P@\ P 0S l400#S \ P 0S 444d0``\ P 0S 4d0``\ yP 0S 30   \ j0P 0S r30\ ]0P 0S r`30X3PE0 +r @3@c0P`0P\ B@P 0S PP0[[ YXP200xS0xS0Sd "L2 0 4 30BލЍhR@P\  Pl 0S <200#SE \ P 0S 2R0P\ PW 0S 100xS0xS0S" 10 0sS)0wS&0S#|! x1xQ0P \ 0P 0S NrD10\ 0P 0S Ar 10 ! 00P00 $j0 000 00fWP- 4. T- - `$`Y D<\+ p* < |{ L* \l) @$D) L) z p@-hPP0S P@L@@p@`@` 4 P@k ( P* w A-PP$ 0`` 4P Ρ@@\WP TP@dpdpP@D>4 404 0 Zp\' ) v t'  4' A-PP$ 0`` 4P @@"WP P@dpdpP@D4 404 0 Yt& ( v &  L& 0p@-dPP 4P \pD`D`P@ p־p% ( Tu @-@@P00DO-$V4M@PP07 0S? 0Sz 5 5( 0$0000 P  0 0U 0p`A  0 0?S SQ *S U 00  *Q .W Q8 /Q0S &P @[S8 \S 0 S 0@U pp  R?\ \ *\  @[\ \\ 0 SQ@ 0@0yW 4ЍWn /W U 00 ^\!\00 ,0 0c `  `/S \S V U0@  0SC -R S0 U@ ᱰ0]SZ,0`S * tb cU ⊠Ằ Q]Q \Q > @S QࠣW /W% .W&0S# 0Y 0S 0Y/S 4Ѝ/W0 0S7 0Y 0S1 0Y/S.0S@0SUu oVU@  ᲠQ@ (` [W@ X414!40{ iX0S1!|0 ^XQ@ "0(C0@p0U0 $ pW 0 P/W[ ~0 / `%Pt@D | @0hP@-@ P *Z 0 Q 4QIoad P p@-@`PUP L UPT00pT00pY 0 p  O-0Ÿ M [p a @T `ڼ ؼ!1 0 2 30\ ߍyPW 0  ;p L  m`P: 0S;p00Pѻ`P* @@0  &p@ 0  P 0PpW*P<  ">0 "C 0 p@0 0~Y`-0P0 00 0`!0 ` 0  O-0Ÿ M p a @T `P N!1 0 2 30\ ߍPW 0  p L  `P: 0S;p00PG`P* @@0  p@ 0 ~P 0PpW*P< R ">0 "C 0 xp@0 0X`-0P0 00 0`0 ` 0`O-0Ÿ M Ap a @T `ƻ Ļ!1 0 2 30\ ߍePW 0  !p L  Y`P: 0S;p00Pὺ`P* @@0  p@ 0 P 0PpW*P<  ">0 "C 0 p@0 0jX`-0P0 00 0` 0 ` 08p@-L@`P@ VPpPpPeP 0 p@-L@`P@ PpPpPNP  p@-L@`P@ <PpPpP7P x 0 00 l-H- M0S000 0 00  00\100M 0 R0    R +8 00 0 0 30KH Ѝ/4-H- M0S000 0 00  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/GL -- M0 0*--M  _--M  uA-pPPp` Q @Q hPD@L 0000Al$0$ $0 @U  l \ 0P R   0//O-8'87 0@T@!|P;P 00pUP0 B@T@!8@,@0@/S8TU DU L5 00@-@PDM  @000vp 800S DЍ0p@-`P}p@ P HRp V U ph p` V@|@L (4 00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc268270EG2&1H01./ "(0C0 /07 ? P!Q/o/o G-@b^?b ^) ^ @pBb&`b4')0V4( X4G1Y 1. "( B1 /0@ Ϡ P! Q/o/o G-@Pb5U?b"6U3 7U @ pb0g7i 0G1c h48:4904H01> AOA1AN1 @B4+B1+bD01/4 6:  /0S0@-#/A BR?R0463R64b0A3QBA b3B .00/A BR?RCA A2" #@A4#a01#000P-+0R J?S$S0c03! 0RJ?S 0B3 B b0,P `f@-R00p@-P@` ;Ppp@-P@ ;Ppp@-P@`D ;Pp>p@-@P?P p>P >PppC-PMP`V A@T |00tQЍp :  [p@`$  00 R KH ,@-zR00 0S@g /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`E@ k:P PXY  P @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍOPP @@ @0(@$0V)L(O-鰏DMP`00 0P0? 000 00S 4 T/ @p%S{ @0@ R0`S 00S S 00(4//#b!!"AK/ "bQ3:bQ#3P . ! P0 00 0 0 #>?3c112AK? .## .cR 3:.cR # 3 00 0010!00C0 0 0@ 0R PR0<R0@@mWjp%0KUSd,ba`_^]\[ZYXWVUTSRQPONMLKJIHqTy-;(>=<:87 -,+*)(Q4ih".{s(b 00 000; 0`0P `DЍ0@@0@000@0(p,P8 h0$ @PCpC 8P @ T$0S* $ 0(p0,P$00@PCplC 8P @T$0S $ 0 `0 00 0V$z[0@$ 000 GR +Rk -R 0400``PW:S 2a2c2SOR0c$000` 0(050 4`0tU0[04000000 @Wd0`nW`pW\ 0, 0 09 0I`0 844 40W0C`00B 00 0c0 4`0@0@0W%S0NW-|=0 `0r WD;0  0 p0p S00W0 0` 0 0 0U0 ^`0 0 0 0000 M`0 00 07c0 4@0`S0G 0X4 ?2c111400 00 0000 404c0#0`S400111v>C 0C40  /"b!!!A0400 0@@0@000000C S0`0`0W0= 0@1B @7P 'B@  ~7P` 0 0` Rv40W010 oWm 0 0` S0pYWW_ 0`0N00J50 4`0  044 400C`00> 00 0440 4440v>C 0C`00+ 00 0x40 40\$/A!b!b0C`00* W 0  0 0  RM 0s 0 0@0 0 0vP@ @ P) ` @aJaj B  B0 UR ZRU R   @K 04# @ ( 0$04`L(p,P@ `W0` (p,P@ `W0` "/#b!!"A0K/ XX"TbQ:L2bS0#03 p"10 !A 0  40DSd040ռ0 MR[ 0@^  @Q 0 "#^  z K/o "0P8 0`0000C/< 800A Q`A`0PQ0N#όF0 0  D[ 0 80< 0A Q 8`P 00`0 0@z[3 0@P 0 TR RO ` @D0 CR :P)\(\ ףP Q n l'$It  QA ALA ` \V6JQu8 @ 00 (0b$0 00\00C4PN00P0?2c 1A;S40`2ca12B @0@000@V@ A\N A R$ M a@000"b"b"$ (0(p,P$`(p,P$`40 @' R$ @  R 00@ p4`0 p 0P @0004 0C$0(0` 0p0P  @000 4 0C$00!0(0 ` 0 0P 4 @ " ( 00 b$ k 0 0 0>p@-PP1 00Mp0,00`@P4 U<    P00Q Q Q L 0 0 0 ,0 30#0Ѝp  x h`0` `:0 OJUD0D D;0 EJ Ht,t,t,4 p@-@PP U 0DPp P @pD0D D70 JU(0( (80 JL P T \ ( G-pP`' X/ Y O?V @P0PES  R  DV0PEV R  SS0@0D@ D0D DH0 IX(0( (I0 Ix X R@- 0BAs@ @Q 0CR J@O-騡PP p MV WC 7@PI 8PU  7p`P >D101S Y8 Ѝ070P7P0 0 0P h70 0 J=00 J|0| |D0 ZI97mK 0 D0D DC0 II^8@ t RQ0@- M@@ :PP TU BK0P Ѝ0] Ѝ08K 0 Ѝ0G-఑ MMp ōP`pG |1PT pG @PE@ X0^00pAtA0O*00 TAXA\An: q$@P0,  (@ @(@P +*P 0 0 5 30ݍЍh0h hD0 H@J0@0J0@0r0 | 0   ~--M  Ѝ Ѝ/ -- M0 0c ЍЍ/O-錒@P p` Mx X X00?<)00P @ P |00 P! !  61XP8   :VP" WS V[XPVppPp2*0`0 5V0M`l!l1 00R< Ѝ`pP: P81XP C0PP00 4< Ѝ0 0 H `f` 0 ?0 G}ẪpP V ᳪpP X0X X0 G `\ | P @-@ M;(0S2 (0 `0( `1/qpPp0  0 0 PUR <0PU; ЍPPTp 0S  0CP;PI0p0@-P M;(0S< (0 #p0( p1/qp@`03  0 0 @ToR <0@To;1`VP ЍP@T` 0S  0C@obIT 0 f;YI 0 ];p@-PPE 4A0S5 @Tp1 Rp00P0 : P 0S P00 c (+ 0P0 &0 S!,P 4P 8P p@T0T T0M F0Sp000 0K0 FeE , p@-@$PPXp@ܦj@- @@զX@ϦTjdp@-,PPȦ Y@p j0A-a@P`MZ P10p00S   0 XR  0@@SM `@@ X8 CR4<,0L0 S0\^**N^&^$ 0 SX   "\ ^ #R.S @a A  00C ƒ`0@ЍD0D DF0 IF "^ #RH 4  R  *4 8/ 0X\S 040:8 R РS / yxB@-@`PHLpL0ppD尀 ᫳T  % ]9  @-P`@H0 ^A-x`Pp@P3 T(   PPP P 0PExog\h\Do%,00888(80 E 8 ( 0 E   &00'    70C3 Z PZXZY=A-q@p P`Uh !2#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@d00W L!P0 $@ D0V0 P100S) 3/000PP0S 000S) 3/000(p00 0p3/P WPVSP 000SP0P 000LX| $X,WWA-PP} @67`Py qpPg  00Rc<!"#b!0CaqV- pW >PWV $00dqp0ST100S004 ,1003/P0 0$0 00``0S 000S+ 3/000(UP`0003/P 003/0000S PUP0000/>3x0VVUhU=A-PP| @6`Px qp Pf  00Rc<!#b!b0CaqV- pW V>PWV $00dqp0ST100S004 9,1003/P0 0$0 00``0S 000S+ 3/000(ǣP`0003/P 003/000$0S ǤP 0$000ԑ@SSxS0SSR: G-P0`00Sp 3/0Y @IOP ѥ T 00 00 Y @IOP T P00 D0D 0 p`P/pRP@QSR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP v T P00 D0D 0 p` P$/TQh0 ЍPA-@P QP P@`p\Pj0`P PpW >B0"S 96B@00@`O-PM M Q0` 0 Q /Q P.00H J5PPەۅPp/Q/ Qq @P /RR.Q7  I  B R"/  D@ P E  p P  * R,  R/0A?o20Sa/QA?0 V0 P/0000 ˤލ Ѝ DQ .PQ V 0y/S0W04ʨp !GPU6 4 \*  @(/QpP V P/0P000ލ Ѝ 6`P ``A00~A>00zA00vA?00rA00nA A-Ha@P`; 404QP0P= 0p0W& 10p p:W@\ 0 \S 0@ S @ 0:Sp@:W W0 0T0P  <00A 0 0꼧Ԉp@-@PP`2 U' 0Pp:P@0P S P:V P0@Sp0P P@Sp:VS:SpH0H H0 >000 00 > x T 00/Jp@-@PP" U+ 0PE Q  Q:\|\00\0S!R B|S0 0:SSpT T0T P0 w>U8 808 0 l>p ĵ \  0 O-ddȟ M MDčpĝP(, N 0SW 0S` t4!S S wpP 0P 0   @P 0{0S D Z' , 0 00 ፼ P]0P|0 0 ` PY  R( Xw :R \R R R  U:pG{/PPE Y@pP+  P ` RX[P #QQ .P@6 00S0 0$040$@ 0= `P| 0:R@[ @R0t4 00 0`<JP pP p:00d00[   0S gᬢ00\:R[ P<0:R 0 0 R 0`FC40DC 000S:S:0 0 H0GY0 E0    0< P@Cw00DZPEDv$pG p{PE`F@DP pP`@$$@ 0S , E0AU0:(0@#3 0 D4 30ݍ Ѝ0 0 07 XP@P ܟ@P ŸH3P00PS0{< 0`S9$`#3 0 <0S"2 0 <0S"2  0< 0 S R6 >0@>@00   #Pա0S> 0 0 @傡>@2$} 0S<xw> 0  0%03/ k 0Sg> 00|   d F XC `  h 0  ̩   L p@-PP`@M V T 0 @ Ѝpx x0x 0( <VX X0X 0( <T8 808 0( ;P , ľ $ ̾ < l @-4@@ P R0 000\|8|0O-8ğ8$  0M MpP ( ` 0 V 4D0 @R` 0S S P@T 0S  @P 00 C R 30000#30:Q0#Q0S(  0R\Sz D3@0T  P P 0 0P0 @P  20   >0S00S\S00 RAPጒ 0S7\S5 00S1 :S000 0 Sx4Sq A 00S :S|S@0@ A@0S'!1 0 8 30] ލ Ѝ  @P 00 C l10 Y P -@P/ y @@4QP P p @ 10   !1 04 :V( 0 04 :0২P 0 0oPX < @Uꔩԙ{{{|{z̮ z4zXyxx \  d 0 h p@-PP@ T `` P 0 0 t00p@   T T0T P0@ :T8 808 0@ :Tw,wX 4 ̸ , Ը G-PP@` T V = {PP d2@P 0:SS   d: p \SP0* Q@ 0:SS ^S0S:S 0Q0P@ @@d |P 0:SSd@0Q @PA0n0S:S 0 C\6B C2RBYU?PK<;:9876?432802.-,+*)('&%$#"950+000C^/!000C\!P& P0 0 P0} Ppz 0 P0v 0 P0r Po Pl0 P0h @PԞP P 0 0L 9V8 0 0L 9.x x0x t0L 9 P Pa ᩞP]; 0P0X̵ h @   x T A-PP@`J TS V\ = }PPg d4pPe 0S:S@@c0R0:SS   \0@Ad፝P pdA\ @ATp {PpT@ 0 F0X 29 0 0X '9T 0 0X 9V 0 0X 9@FP@; 0@0Գ L  "|  #P L IJ $p@-`PP@4 U= T& # P? 0Q 0XS  <,00A ^aPAUA0AW0AS70ARp| |0| x0d 8d d0d `0d 8UH H0H D0d 8p h s̱ @ q <  rO- AM Mß3 0@P0(0 0`p 0SI -0/04 PPO P88T   ::00CS4%210/.x,+*)'&%$#"   4$ 0:S 84StT:0SP:00<"(2 0 (0 30| KF%P( BKI8T 0:SSj0࡟44 440$0<4 0 S BKJ;4$ q/ 44$0C 0$C0$9 <4$0C 0$CPu0XBK I8  S:S: R> 0B44 R0  0R!0100M P@@8 0:S084  9 00ULPHp0p pE0 7.00w0<44 ̌ `X H ̆ , t 8 0 00 -H-M0S000 0 0 0@  00^100M 0 @R0    R L00 /@ 00 0 0 30KH Ѝ/  4@-L0 @ @0R( i O-@`,M$Pl20 R^ 00@`pR 0 QBMP Z p !P p J ( J PP0 S"3#: 8 U(10 r# 1$4S!1$&@@x!00P @P0S?"@!1 0 $0 30= ,Ѝ100S  U r pP Р P 5SX0(, VT00#    {PP P0S;7^뀇|8,tih hq ˠ@-(@M@@0=PЍf@-Q@0M 0    ",  0$0(0T d8P0 0# 00Ѝ W80Ѝ0-$M  00 0P$Ѝ0-$M  00 0P$Ѝ0 -M 00 0 Ѝ  0/C-<< sMPPp/ W7 @X0^00pAtA0OA0PP P0`0TAXA\AH+ 0 $@2 t0 0 1 30sߍX0X XG0 5W<0< <H0 5ꗤH@x ħ h 0   ꔁO-ϟ MPÍP$0 U 00`!R !Y @? 00,00? 0(0  1pP0'%Ypp, 0S0 R .> 0 3 30 ߍ fP0 0P 0 0C 0 S 0 B `0 zRPc_^]~}|zy`wvutsCq?>=hf-a]\Z``YCS000`0C0 ᾲPC 0S 00 0A;+ 0 4U;+ 0 4@00S0  @DT+ = ᑲP0 0P 00CS0000@ 0D S*v0H0 S00@00 `I @D84H 0  BPR '.g 0vpC0tj Mp:pZWp! 0`P` ` PPp+@MQ^T\RZYLLKNMLKJIH654321A@?>=<;:9876543212/.-,+*)(!  UMP00CS0+000pWP0  P@S XR    0 .$ 0$        00 0P0 0C0000 S000@bT @0 */P0@ S0 B0 0 R ፱P00S000000S0R >. #RR 0@00T0C0 0 >. #RR 0000C T0 S YP Y 0 00+ E ` P BR  V *@PNU 0U`0P0CS0V O*@P XR P@P=R*`P .P0@<00 G.PE@0U0 S BI RP  Y*<@ @P`0ESF00SF .P 0@0CSPF00 000Tw: `48@DV*T #T0`0 @VV 0$0P0  P  Qt$00 400S P0S` 0$P0 00000S @ P BR T *<P+ E` P BR  V >* @P -P @0P0CS0 IU` P BR V *@P`W(00S D00SWW00CSp0P o @>0@8>04`#C0 0@ 0 + 00@00   00 0 ,P 0 0C 0 S 3P `   +   +    )     00000@ 00l * 00@90 0 0` * 000@ 0U0 0@0O @00Sw<@@ULP  M P? PS00cS.  ,P 0@0CSPF00 0 0P0CS00R*P00 ᵮP P0 P +P  P BR  Y*P0`V D,P 00<0|0`V 8,P  P00CS0R00*``PZS꺕?H00v0@0. #RR  PR  B   P 00F P0>>03SS 0PU0C0000P0003 0S P PY9 Q 0$@0 0000C P0:P00<0 0 P0 R*`P խPV* @PE U  ǭP R*0P00YeERP  Y* @P$@`PPP0 3+P 0C0P0P `V  0S ᓭP 0$@0 0P0 P0PC ᄭPT*<PS$0xPp$0TP0pX` \ P 0  B0>>@I  v00  p P p0S KP0SY0Y 0S0 00 0 p >>03SS 0S0P0C0000000S PbV`*0P0<`0 0 ? PD 0 0>>` BF,  vo&00 委p 0, P p R`408$00 P?p$00 ᥬPV*P@p ᚬPY* P 400C0400]S0 H0 P  LPMP40p0D`40v`Yp  P8P0 0 /P000P [PT*0P0`04 NPV@: `48n I0P T B0  pN 7PV*pP)U@0P0CS0W0T*pP )_0U0P0S@0p0CSP02 * PNVL*0P000  P R*000 PY*<@0 @P PY:48<``48 ثPT:@4 `8 48˫PPH0T: `4@F8<` `0F4`8@ `48 `4@8<``4@84 `@8TY @t YR S  CP S `48@D 0SV Pu YO48$48O-P`U04 `@C80 S@!@30PUG$P 0䅚P $P 00 0` Z`U$0``!$00   X 0/0P| p>>0AC  _. 0 vpf P4U@DP5 0S07TU kP0T P@D0 0P UL @P0SPJ00@@t|0| |0x -00Cp U@D`0S0 0P0 S ( Ȅ x A-@P`p 0 !0@ A-@`P=<;:9876543210/.-,+*)4'&%$#"! #       0 D R R Q  R \000!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0Ď$ P 0` S^?0@00 0  ÎP 0J ZS 0  0J ZS 0-00h10000 ,Ѝ0\r  `0\s  `0\a  `0S\000000 0``0\b  `0\t  `0\n  `0\v  `0\f  `| @`P 0_ Z0\  @`oSA- Q@Pp`! jP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0E P0 Aex w A-@P`Pp$T0 pAP_T !T '0DS%(0$"0@ !1 0dw O-ǟ WMTǟPP 4pခ儡@  ?oY20S_Zg Y y @T0P(0 b`L0P,0 0S00<0{ 9P80 P  *)T. (`000P@Tp` U T 1 # 0܍0P?0S0v P|P PD6D&D0 '(0@FDA T @! Lr`0P$0  0 00(80S  V L0$ 0C BP$0a  ? *500R  ` 'h50$0R  00 00 00 "00@\0000 upT, (`,$@T' 0 7/P)0@0$ߌ,݌(ی<ٌ$l4 0 T1 30Wߍ@0SP@PR@8,00,幍 0S 0S0  n(0S ,0` 00D0UN pP00 0 0 @ `Ƞ06ɌPp@Q^O  ^* 0 309<80 Q*@P0000 S*00S0 00 0@80@ SR0 0@0P$^,\(Z4 2p00 GR 0D 0 ׌ [P@ 0S0\* 0 C( ȌP0@002"0 'Z1!0 ' 00$L⿌p $`0a 0S 00S' @0@'tqplqp  Ċ0P0* 0<0z(1(!((0 &P0~s0200*@w( 0@00 0 &0 z0 &0@<0$0v@0 0 v&LLHv v u u u IPq ,r q q r `q p ,q p |p p (p p p p Xp lp o @-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ"pD,D@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 ЍCxCp@-@QM`P0 n0 `Ѝp0@-@RMP0 [0( PkЍ0@-@M 0 00 ZЍ-M $KЍ-M $(=Ѝ@-@ M00000h0 @ #D 80P @0 0 30 ЍsA pA@-@ M(0  0 0   @D <0P @0 0 30 ЍDx @@0@-@QMP0 0 Ѝ0訉 0@-@R$MP0 0$ P$Ѝ0L 0p@-@Q0P`0M 0  `Ѝp -M00  Ѝ䘈 -M( zЍd -M $$jЍ 0-$M  0峯$Ѝ&0S  $g g Xg g g g @-PP@`Mt Th ,0PXPK00 Po0: S Ss  SЍP P P &0p`P$pV%0 `\0`.S0@D`H08< 0L R90L R58< \P@D V^0 0U $:0Ѝ]0S \040. S 0 0 #l l0l :0 #Ѝ%0$0 X$ Ѝ ,e d e d d A-pP`P' V0 ,04@P \0 00X0 $ 0 0P$05%0`@P0\X0@L L0L H0$ E#V0 000 ,0$ :#c lc pc c 8C Dc @-`Q@M `pp.  8<0RP@D0RP /%0P0V Ѝƭpp ?pP%0@έ%@ЍîPPЍO-PP4M(; ,0  Pq ( R pBo,0r R 0@`0,0 , )0P 00,00, 0A /R ,0   0 0 0 $00`K0pL0 00 0S 0 050$ 000V`00p@@  P ,0  0.Sf  @P [@0 0, L000 0S% % R R,  B $000S<R\ 00 0 I R0@PS0B0 0H00C`S`00@u@0,0 0|0 PZ0 S , 0 000 0KR 0\00 050S 0.S0 00,00 0/ 0 00 0X 0Ss,0 0 WS 00C 00 0,0S (0WS 0L0S,00S W7 (0SWt4Ѝ0@0,0 0#0@`V `#0@ 5,0<,04Ѝ 0 ,0#@u 505#0 0(0S` `4Ѝ!1 )00 ! ,  @/Q|  , 0S  \R   B  0SL0S0x \R   B   R00L Rh 4ЍO(0S0@ `5#0$0ySq0|  -Pi  ,0<%`,0g0 `5bPWa# 0$0`] \ ] O-`PPp M 00@Pj PV(p,P X PtUP1QP Uf~P[R PPQ 0L0[ PP P[" N PQ P5 , \00 L P05WU P0pP[WX M[P 0, P 5N X  ЍPۅU ׅՅ@҅ ЍPUP1X"00 0 0< 0c "@00 Ѝ 0 K0H ]  P Pl4p,00,0 P P Xx \w LGp @,0 G5 SF S@T @pT V,0`<,0L0`S00/S , @ P pp! C00Ph h0h d0| $L 8  0 @者 LO N N 1p@-P@PP 0P0S 0`00Sp@Ĩ(}(}(}($0$ $B0 "tN O N A- 1 0 0PS`@(M @Ppp 00 @0U P& 00CS(  p0 0 0 4 5;1(Ѝ 0<080" 0 (Ѝ0!N LN  0 0 @-@P Q PP 0 *0 p0@t M XM p@-@PP U p@}P0P PB0 YU404 4C0 Op@g48 PM (M 88 $M M p@-@PP U p@WP0P PB0 3U404 4C0 )p@A7 L L 7 L pL O-PMp 0GW"S00`0v@P-TPg +T@`0W ?  0 0  P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R  "000R00S0S R Ѝ0pS 0F00T& W p p0@0`0 0R 0 Ѝ0 ?0 g00XS00 C R @0 p` 0| A BRWf p poꙙ I  0 0 074@-@0LM`Pp@0 P LЍ`0 LЍC-1 0MM`00<0pP~l@P S \1 0S ~P(/ |  P& 1R P$P PP 0 0 < 30&ލЍ 0娀R 0 P PP0PS @P({(0nSꚊPh0tnfsuniop@-`T@}p@  P@P p0P傦Pp`@-@P @(0( (F0 @$ F F @-M @˧p 0: S  Op  IЍ 0 ЍЍO-3$M0@`P0 ;$#;S0 000U00S}00| e00@Pp U *  @P 0G P p@ 0/0 p P PE U@*C0S; 0S00 !  Y* 0 P  X 1T0PJUPX8}P@Wm 0p@D@@0 `$ @$Ѝ0 00 000S0@0}P M 0! 1 0 0 1@T 0 0S @ T  P0 0SZ 0 W@kSp`p0  P000 00 `8 B \B p@-P  @T @T0 0pp@-@PP U   p@D0D D:0 [U(0( (;0 QA B A A A A O-`PPp M# W+ 0Y0  eV 11* @ 7/P 0 T VK:0 0S0 ЍD0D DD0 W,0, ,,0 A `A A n A 8A @ oO-PDM@4w Z [T 40 000 80|0P$0 Zy 40S $ T000800(0u@D4` 0  $P0( 00  :/PppV@*000k000 R`e,@ `0P@P U` :/PQ 0Y` ,@0PFV0p P@0PV E03/P00 S 4 0pE$ 0pZp 0  S ^ 0* $4@ 0 ,0( $@ 40, S ,l~@DЍ$4V  PH PW0P@ ZV 0p'Su0( 0S 40,000,($ 00P<0 00 0( 000,S$  C000(0 0 0$ P0C,  U00#03U0S q `:/0P@p`p @S:/PX @Y0V0 S 0H  BT 0T@30@D 000@ U  00I 0SPp 0Z: 0 J3/P* @4 0PJ$ 0PP 0p'StW 0`0@  S`^0 * T 00T0003 0RP00 R0#03Q0Sq P0 S0  BP 0PC000 P 00C0C 00000 0(0 00R00 00$ YFPP @ ꉐ 0TP::/P [@00P0P5P1p1 * @:/Pp [:P0@V05S 0  BT0T@30@D   P0@R 0 0P @IT @00 T00T0003 P 0R^:/P 0TPP@pE bᩐᛉ) :/P P pU0@P00Pd R  P0 0C0CR 0 BP0 C000H<0, 80 S( 5 $0, ,0$ bP( 00 Q 0 w 0{Z~ 0 x 0pt 0 0 f40S| 0  0Zr$@8 ,@$0,040$0@a0@06 Db 6 6 6 6 6 6 X6 "x6 \6 (6 #p@- P@U 00S  RQ QpyP ! 0P 0ppH0H 000S@-@(w0(@ wtp@-PP`M% @T@T T0 Q 0QP ``0`P 0 RЍp0 i0 h2 p4 L4 pC-`@PM0S/$0020` 0 }P" 0 00CR 0 U S R 0S$0ЍpQ$0P0P 000S@-@(v0(@|vtA-`P@p} 쀟0 00S (fvP   m(Zve0S P~P   ZT0SPp(@vK0SG0p0Atp@-@PPM  0 P!3` P 0``p@@ Ѝp!0 S@PЍp0 <0 4 h1 <1 @-\!\1 @0,MT0$00> `pVP0STA 0ST@!0 0 $0 305,Ѝ  @`:( #<@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@ bT0 d0 ,X0P @-DQ4  / h0P@-X  S H@ @}0( (@ jhtd/ LA-p`PpP@ U! T 0F0 PU 00@^ NL0L L?0 -U000 0@0 #D . `.  |. 8. p@-@PP  p@$ʟ 0 10 ` H. . 0@-@H001UP0P  0!00@-@D001UP0P  0!0l0@-@LUPQP   00!0D0@-@D001UP0P  0!0000/ /000/00 0/С0P /0-@PQ@0/0P /0P /000S 0 00 9/`-  0  ^^$  00lmNAС   A-`pAQq@#0F P0啃Ï@hC12c` P@RH00p`PPUTp`긠X_ NĠp@-HP@P t0S,000@ p@ tLA-<2@Q`pP`Fj $ s R6 200 UfU 10p    s?U#0!P 00010 ml100 C0B100L100C0A100UU-0!P 0010 0 P 00000@ 0 0 y` ~s0 P 00?0h00, Hԟ؞< ԝ`( \( ( YtXA-01@PppG> `1#P #QIs PFR'000 0 0 UPQ,P@P@ 0&&```A00A @sl000C0A100H H0H 0 l̨(l8' & ,& 8& @-(@@ @rt0@rXp@-@P PP P @p@p0 A0 ` % % A-PPp` @P& P! yP  P@3*"0@00@0< <0< V0 @0@00% $ Q:// BQ://G-<1<0000 $$!0p0Q= `AQ@P P 0 `Q Ѐ@P   0PR@ UwTp@0@S Lw000  B BG!`\șDp@-@P P8 PpU0 =Sp=SppU p@-@P PPP@Ppp@w 0 0 ꄘ" " " p@-Pt@P 0 P0@pp@-@PP LPp P3#p$ $0$ 0 ȗ4" ! " O-10  MYp @To p `P {P0=S] @PTZ^ A@PY1Y04 S@@@S*Y3 v 81 0   `;0S:a  D!?0 0 @ Ѝ0Y   RS@l ` e0S a1S  Ѝ PPt|(p@- @t,PpP 000ppLA-l`PP` p\$@P 0=S SP(00@0 $Q ,@-q@P0@T,@-{q@P0@,@-mq@P0@0!-0!0!Q00 000000 0#0, 0# 00!R0Q0  0R0000@-@1 MS 0?P"1$Q 6Q 0  R& @  @1S 1  S( P  P    Ѝ0\ w100 Ѝ0@m0000 0/A-`Up QU @ @E 7/P@G-PTp AT P PD 7/PX PPHPG-PTp AT P PD 7/PX PPHPG-P@Up`L1S P@@E  7/P/@P@@ @;X; 1Q`0000$ 001@00a0@00 0 `PT1S%  ! 0000V @ @010aP @@@@0@@` `01 @0a1 S Do @000Q0 -"P 0 PC R00 SAP 0@/ p@-`P@T0M \ [ Rv    T0"k \ ` ``R```aa0 00000 0#0 0#0000``0000T ^pp@P ``P`  T2 0V0pp@<R /o"!T0#00#00!0 0PT 00pQ  T \0 !G-p`jqP# `Q@@PppW@Q`Jd X 0Paan0OnpG00wTaXa\aX@Z_ 000 D.;@-,@@0@P0S@舏A-@P匀@_}`P(p0@aaCn0OnZO00TTaXa\aXP(0( $0 0 L`0p@-05S PnP0SZ sX@ 0CR\np@T P ZP@n|؈/p@-@P $P sP s$sP rp@r0 0    Mp@-PP@ T $0p@! 0/L L0L 0 T, ,0, 0 8      p@-@PM$ P$`0.tP  P pp(QT00S 3/Ѝp003/( (0( Z0( } | 4 (   C-$`0DMSP 0(p0 0@0$2 ^PP 0 (0W,00S 3/DЍ K ,00 (3/ @PP A-PP@M) T2 0S Ѝ $`0P :r00 @5pP gЍ00'pL L0L H0<  T0 000 ,0< <      O-hdyM(p`p0PP ~ p@Po 2 l20 RF l0!$@ !  00⶘0 4L  00 0. $(p,`x PQ 80 03/``zpP"   !0 0 1 303yߍ         PqqP ~q|qPPqqrqP``Pgq{H?0T x ` P00/@- 0UM 0H`0L10W{p! 0H1g@pP0P`p  S 0#< ,0 0 L1 30Uߍz>Xtp@-`PP`@M& T. gdPЍp 4hP cP  cP |0 0  PL0L LG0 T000 0H0 H - O-p`@(,cPP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW aoP@@p Pp00P WP G-`R p@P8/PP @VG-!1 0M@Q000`PS UI U Z .0P0!1 0 0 30]Ѝ 0p ) 0P00S00 0PP  0PP 0PS" Up$0T  P p0 Pp0ꀀp ޖpP 0 @P&0 00ÖPy~/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R ,` , `! B  // R 0  B-  ` .$`$"  /0S :p@-@P0C0 P Pp/0p@-S@ :P0C0  P Ppp0S Pb"! b, @-@M0C0 p  00 0Ѝ/0S/ p@- PM0C@`0W  0b"!4Pb4#0 PЍp0$00$00  /00оp@-PP@ T" dP 0S S pp@dbP p@bD0D D0 T(0( (0  <     p@-PP@ T dPp >p@ eH H0H X0 , ,0, W0  <  t   p@-PP@' T Pp dP 0S SbP p@bp\ \0\ x0( @ @0@ w0( 0p@/ +     p@-@PP U p@ dL L0L g0< g U, ,0, h0< \  t l   @ 0@-PP@ M T# 7bP Ѝ0dP 0Sl00 eP P0P 0L , T0 000 0L ! X    T p@-PP@! T* 0 Q paP cP aP  aP p@aL L0L 0\ T, ,0, 0\  x L G-PP@; TD  R R `V V  0L0 00 0 `V000 0`V 0 | 0FS84/+' 0 0 0 I0l Tp堀堐p l 0  R R0 h `w 00 00 0000 0L h t %  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`' V/ T ^ 0S^  S 0RR00Ap@@TppD0D D:0 V(0( (;0 H $ C- MPÍ`@PA TI A< [PJ "Y` P t!l1 0 3 30Rߍ(3@/0SA S3 p !0  0S 0%  00 0 T0 0  p0  00Sp2P 00S4v<`  l  O-DIM@,MI͍$$J͍@Pp P0`S S  p80$I= $0 2 Iݍ,Ѝ RJ- RW# " "  J=00岰h +4# 4J8#8   _J- 0SnJ=  00SO S UVZ J=00p,:0 3 00嚯000J0 ,0HVP @'0Sj0S  0S0s S0S UVJ= 0 ( J=00peYX O < ZP] 0S ʶm 1b"!4b4#"R8VUJ= 0 p[pYpU<0J8 0gJ=00!| 0 +Pj J- 0SJ=  0␶pS Sq#< mJ͍0 spp p 00SWL2Sp S SJ=00Y0  YP pJ͍KPptL p  O-ğ MQdH4@0P0CS,v6)('&%$#"! 9 QVW00 R04 0S SQp#3 0 0 30Ѝ#3 0 0 300 HDp@`ЍOmVW= "44 8 T# #8`P'T%0SR0S # $$("(4 "8#8 DPT QVW00RTD`XT 00" 0 W* ᒵP00Sz "0 sT@@? 00z!D ePT`!0 XiT 1i #cQ]0|||Pp`P 0X! 0 ;P030#?Vp@D `0V0 0 (P030#?p@D0Q0 p0ĠĐp `pP0 U 0`@Dm    P030#? \  s80 8 \  h 4 $ T O-` 0 IM? P@pp6 P PV  P&VO 0@S00008#<tx'' 0   0 P'x 0 0 1 30%Iߍ [: J Z"448#8WX 0S }P 0 0)s̼A-@P`p W0 p 0P  p@-MP`P@@P@T 0S  R0S @P=@PЍpP5PЍpp@-@P -PuX%X0p0 @0 Ի  0. AAS0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0R00@-d!$M""00(  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S-  R  R R R/S /0S S S S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP0 PH@0S0S 0S  Ѝ0$0$ $n0 @ T p@-PP`@ V T! 0p<Ppx x0x t0 V\ \0\ X0 T@ @0@ <0 v p D  P  x O-ŸM0S 0Ѝ0 0p8 4000p4080pP h8 H  410T0 00 !   R" 0  P 0 p P !0, < @ D  80  ,400P`Y0 d1 d0SVT N 0 0S , P00\//ᨄ p@-@P P@P ``Tp 0  0n/iD rO-P@,",2$M 0L000 0 p@ `HaP0S@ ر@ @T SP- @ *MP p@p!|1 0 0 30V$Ѝ0 SRC pP? 0  +@P40+00S @{ P 0S00SQ ipP 0  @P 000S 9@P _@@ ,@P iT O-ϟ MS0 ࠍ8  ``  0 0p Y 0S0S p |P 0 0/? 0 2 30ߍ0P00 RS0$0S0$00 0 0pP$$H>(00@,04> 0y?40$>p000>080pW g972 G520W0 0S   S  R  RQ P  \P/oSpQ" RP\0S_   0Pp~Q{ ,0 0St Q0S %,0P@0 PDm @ 0 B  |0P<0OpWL @0H@ @@LPpW> 0SX 0S  0S} S 00S PP0  u?P R R RP0S0Sp;0S}PU ;5xp@H@LPD^<0SXpW3|0(S 0SH p=p@:匊0(0:000x: 0$80$Y?,40 T 0 d342 D52Z 0SW 0R P RSMQ Q D \Q^=SR^0Q@P 0 @5pPp&00 0040$0`e?0(0b0@S񏐘(8 r/0=0S [@T|`WpV K Y 01P@0P0@pTPU \0P0 j <P1x00x0[he

P 0@S S S  /T @P  v`P 0S00l`P $I(0I$ I$ }P 0(PU PU) 00  P 0(00b P0P : 40 2 ڍ<Ѝ 0(Pt t0t 0l!. 0SkT T0T P0!.ac4 Ȕ < ̶ @  <   0A-(M `P@ppbp &P @PP 2r$0S0(ЍD @-@ XP 0  @0O-Ÿ 0 M* `@p1p! P PX  PPQ P Q]p!1 0 2 30`ߍ0@SPX 0@SZ00 01P巇 j00 0 l P ZY0 S 0 D~P 00 Y:   X 0S  XS )~P  0 bT}t|A-PPp`@ 0 H 0P 0 0 -0AL. R@O-0LMp  D@00`P840 <0T8 0 0'00# 0(<  .  " b*.!@ dȟ @# ,PDHlŁ@@0" 00#P0$H<@@ !  " P Hb*@@,@ @$$P@G #!(P lń0" 00#,P0< $ 0P " b*,)[EOPE@ !4P`G@ @# ,8@GlŁ@@0" 00#  ! "4P ğ* $! ğa @#, P@dğD 0"0#P 0Hğc>  !,$P,$ʃ  $ "0P$a @ # " `!`&@ `ßj "! @ ßa  # ",@ ß$ 0&0# 0pßc> `!,`jD@LSPP"P%P8CeX@ @#@$@#D 0 ,l̈́ 0 !蒟$ `ab``P P%P"`X @ 00#@E0`ጒ`& `xŸfm   "0X"a 0P 0#PX0 ,, @(BŅ@` @@$@!D`dM 0 0#0a `̑`& P`V0: 3=0hV@Hp` 30V@@p`F AH H0H 0 , ,0, 0 4 { p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 `_nx |m z ̧ z | G-d"d2 0M000L2L"00 P00;  `p0R @  0XS@@ 1B- 0CIR0  R0000#809L>01  00LЍ0 0 0@-S@ 3/@NO-P@ MX Qs 0`  @`f&AA! B B&"`F`F"f&AA! B B""`F`Fa&AAu! B L B \ᧇ" 0\P3 L0 1 0T0p0`0`Ff&pGpGt'PEE!0F0C!6# G B("AA!0C0C1# B B%"AA!0  Ѝ QLr`0  . *0p # J K`f&pGpGt' B B&"`F`F"f&GA! B B""`F`Fa&AAu! B B Z0ᧇ" ZP Z Z 0\ 0X 0T00  p0`Z$Z4 Z0 Z2  0 p0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[`'&%$9"! 8* 000 @ @  @0{0000BdABdAndA@BdABdA`p`P00 N 0EP00 D 0PEQP0兀ಀ00PE0 0 4JA-`MPpM&laa`GQQNHH0   @ N 0!Ѝ̌ QL O-@`!0PPRPPƟ MM|čƟU tL<006~I0P40 0 060D06h0H0t60P0l60T0p0,0D6P0< 0@0 0  \P?o0 2R0S <0`1  @0` 0` 0V T D TT0h0S85080,0e?Ⲁe|5 0x0``VJ X,0L?ⰐT@5 0?X& Y08 SPT,0? )R 04d`   DP,4 -4 0_ pp4 0U L4 08K 04  0 `B 0SKP H0P40Z0 #`3 0 |4 30ݍЍo` H0@ ]0S 00SU<0`1   5dL  jS#2 0 |4 304ݍЍOJp$开,0!?0"( NSX\2T080XP\`@d?SHHX:xT `0!$4$(#d"(dhR&h. V PP$S S Z0 8刚1L 000 .,ZH0 HsXXP\`@d l0   eVL0 ] P0 V@  RZ0 F0L 000 ., U2K RSSEEЁ ԁ L ( 2@  1 1D  I \ PI0 ~ 4B~ A} ~ }  | | h| D| | O-tM@@ `eVPPk0 P p 0  0  04$`18 $S, %ἴ0 岕   46< 04 (V 60A>< 0PPU R800 0IR`1S   ;`1S0 ਖ਼0  0PL0  0P9P  PP&0  0P0  0P0  0|P0  0pP0 0eP`1Sy40S{ < P 0ppW  0R 0QpW 0pW  0R| ,0QpWg 0pWb  0R4 00QpWHpWE 0 PS 0 Q`1S   @0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P  0001p 0001p 0001p 0wt1p 0ZJL QtЍ tЍ 0 {/0 t0 m 0 f0 _ 0X0 Qx0 J>H|z *dz Pz (x Xx x w &u |u Pu $u u u u u u `u @u u u t @-@`0 0AMM0 400p00 3APP0S D 80 0 4 30AލЍ.TQ6X60,@-@ M pp PA`PP 0S@  Ѝ00S.S 0S Ѝ褗 p@-|0|AMPt 0  ` $ 0 @P F8 00 0 4 30Aލp]QP55p@-P@Q`  @Q MPV 00pV00p@-@ M`pnPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝp p@-@MP`E0S 0 @S 0S@V00ЍpO00@0 PmV00Ѝpo 0@- MP0@0 @x0@T U Ѝ0p0 0PJU:L@@ Ѝ0<00@,0 0P9 Ѝ0 y Xo tp ,9 o p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@pn d0@- MP0@0 @?@T U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P Ѝ08m m o 7m 0@-@ M T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPn \n Xn $n m |m m lm 4m m m tm (m l $m l l l l l l 0@- MP@O@ P Ѝ0 0( 0P Ѝ0a 0@- MPl0l@0A> @0@T U Ѝ0O,0@ 0P Ѝ0Hj i Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D B000T H0 0 <0 30 @Ѝp@Ѝ/.0 T39O-k ,O-PM`@P P @ p <0 Q  ЍSv RSPP -\00 +\00 3P0 0  R0N1011.\ 0 @T@  R㞀( 00 S #3@  R\ Z 0S#30 "#T$P+<0+80+40'<0'4 0(< 0(400'( ((P p 0R0p b 0T00@0 P   0R00#3@0 PS \  R#3 000#3TP 20 T @ P P 00 S #3@  PR \ 0S#30 "#T~ {00H 000J00  0L   3+O-Q0 dM R   $    (   0 ,`@P`}0pv> 00pp< pp_p  (Pc$Ѝb C-@P@ `p MPOP @U IP@W  Ѝ @Pt0 0000 0 P#@0S0Toᨂ#(_ "b C-@P@ `p MPx@P @U HP@W  Ѝ @^Pt0 0000 0 Pf#@0S0Toᨂ#g !` p@-@P00CS0 S  P `0 PpK`0 0CS0S P 0 /K@-M@0  00g00 !R !I0@dЍ@-+0 S 0@Q0 R  004S 0@l@Q0R Q  R %Q pLp@-DPD0P`@0pp 00p@,X0|L p@-@ @ `@0Ppp0p@, LA-DD p@0P`p0 ALC-P0 `0pMpp@ H 0D @ <8 @Ѝ;pLC-tPp0 `0p MFp@ ( 0  O@ Ѝ_;L0 00/HL0 00/(L0 0LA-TT p@P`M p 0 ЍL 0 0L@-tt pM`P p@ (  0 -@Ѝ;`LC-|Px0 `0pMp@ 4 00  @Ѝ:L0@-P@(0( M0 0 Ѝ04Lp@-D0D 0@0pP p@:pL  0 L  R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0z 0 ` ` O-q Mp@P`P&X/*00T*:Y@L TT  T* p hP@ 0  P0 P70p00000 Ѝ0 Pp Ѝ0 wPpDWXW X0X XX0  Ѝ0 ^Pp$M X` X` K P_ a _ O-M=<;:9876543210/.-,+*)('&%$#"!       P^[ 0S .St 0Sq 0Sn00S.Sai7ZD =400S 0l'0C ( 040 B^P5D0 Sy,@ 0D;pD+0S0 `〠t0`Sp 0S @0D+@T 0Z4  0d N 0 {Pd<&= <0 2 ݍЍ话@0(08 0 _PP0 0P0*=400D S6D;d 0D;50 0 <P( 040 BPH+,B0?Q0S0%050 0$T H ,0@ 寝@08(0 0P D;0B$ 4Q;040d  0 PxD; Sr*h4 00 B$0#8 (0$00(0D+00pCW``W  D+ = VJ  0PHW 0 P=0 0P5x3 00W0#80T3 D0N 0C0 .  . 00CS W0A 0PD;`0DkV:H+,B0?R0S"2 0T H ,0@` 0 D PD;@"0F ND;0b0`d 00 0 HPD+0D  d  0 7PD D 5D+0 D+d  0 #PD+0D;`Vw HqpD;`V0D;w 0d 00 0 P(04p0P`C 0P~ 0 Pv 0 PmtZ Y Y Z T d @l S S S R %pR R 8R ,S R E ̧ Q $Q Q ,O ELO O O N L L K `K pJ *DJ I H H G G G LF G E  F E E XD XD VUUUD C TA LA hB A \@ h@ ? \> > = h= <= > 0 =400SD 5D; D+D `5 D; 0D;1Cd 0I 0 vPP:D 4D;da0D;`d 00 0 ]PD 4D;0D;0d  0 JPD 4D;d 0D;20  0 7P( 040 BPD0` Cp2 Pp( Pe 㜢 P`/U0 0 FP0PE0GW^  0 P=400SHD 4D;d DD0 H30 0 PkD0` C3 pP'W W 㬳 `/Z 0 0 FPN0J 0GW  0 P@dp`D D  PD :W{ 0 0P,+ZD  =400SD;d0`d 00b 0 PD0D d Q 0 ~PD;p0SD;D* e`D;0SD;<*0d 005 0 bP=400D SF3D;d 0D;50 0 IP(04p0P`C 0P 0 5PB0d 0060 0 %P=400DS 0|&0C  D l6B!?C0 Se 0 P=400D S0&0C 0 D (PxD;s 0H+D;PD $ 0 PdD; D+ D ` [3'D;媠0D;7Z 0 PF( 040 BfP= 0 P5D ;3D;h0D;`d 0o 0 P D &3D;0D;0d \ 0 P D  3pD D 3`D D 3p`D;d 0D;80=CD 2`D D 2D;( D0`0(`H90' 0 TP D 9B!?C0 S  0 BP=400DSz 0d 090 0 ,PDZgD=  1R_`0`p 0````=00H+&H+ =00pP  x: 0``: 06/=0H+00C0D; ZH+D 0S#  0 P_=400SD;x R.wl-4 Rk k0`d 00 0 P 0 ^P0#0C M.PD D .`D D .`D;P0D;32 0 3d 0` 0 2P0S Ts`D;p0`SD;0D; 0d 00 0 P0"0C =00H+"H{=00`P0# p02 07/=0H{0-0C0D;`0HkD;<2 0d  0 P[D; 0SD;.* `!衟   D+@p@ [ 0 P> 0d ` 0 P0K`p@ D;S:< 0 Pf=00H+`"Hki=00PP 410`0 $0 0B  n; ; D; `: <: VUUUL; h9 D9 DR : , 8 8 8 8 - D9 9 9 89 ă 7 7 6 5 4 `5 4 H3 3 4 3 $2 \1 81 2 1 1 P p/ d/ / .  . , , - , + |+ , + * t* + * ) l) 8* ) ( t( ( 4) ) 8) (( \( `' ' & , ,& & % %  % & @ @% ,%  $ l%  $ % < t$ -`D;`0D;p 0  P1d 0p 0 PP0 1Py` 0 PqD w-D;P0D; 0 Pd=H 0PP\=00U0! `02 06/=00-0C0H; 0H;0 P8X 0 P0D 6-D;P0D; 0P"=H 0\PP=00U0" `02 06/=00-0C0H; 0H;0 PP 0 jPD ,D;P|0D; 0\P=H 0PP=00U0# `03 06/=00-0C0H; 0H;0 lPH 0 (PD ,D;Pt0D; 0P=H 0PP=00U0$ `04 06/=00-0C0H;0 H; 0Pr0 "Pj\ 0 Pa=00H+ Hk=00PP9 50`5 0' 0 P> 0B& 8,D;d 0D; 60v 0 P&P 0 P` 0 D :P 0 P(0 `CD;V0D;P ~P 0 40#PD; R 0 jP6` pPD;WW+ T P`/U0 0 FPP0PE0GW # 0 CPW 0 8P7d 0 0  *PW$ 0 PD 0 P`  D;0Bx( 0`0DkV:0(0C  D;0B(  0 Pvܨ W 0 Pg  0 P_, 9 D;0BD) L  0 PMh W|  0 P>  0 P6 QWx  0 Pp': 0B) 0 10"300;D0==0;D0 20"200;D0 00300 ;D0<=0;D00;D0000;D 0ePDkpW`Dk@- R  MAL  ,@0@(@@; Ĝ0 Ѝ< MM$000 1 2Ѝ/lA-PSp0`@@V X:0@4#DDH$H@PU )P(0P0TPD0?T0S,0, ,l0 PP# # # G-0pW::P0 @4#$4T00 ` 04#4 0@T#0T4#400S0 XT0 $( ,0 P@@S( 0 A-QMp$0PS@` 0! $, (0v(`V0S}(0S0! , $P, (0V3100@)Pq,0 \, l0U4#4 00,004#40,(0T0PT(0 SF0P$00Q (0, Ѝ 0FP=, (` , Q7:048 BC, L0L L?0 g404 4>0 ^    h A-Pp@LU`, T @0 x0W``W0*.pPE\p ^0070.200 0 S037#P00 \00( (0( g 0 p H /o/#///l@-` @0 0DM0<000p2 0(0 RP)00P@0P< 00 0 <0 30DЍ5h O-<2<P0ਂ0 M )੒ r i C7'r0BpqB$ C@$Aah!d`P3@@C6*T>WFYNX @0  p@0 SP*Z R 00L0 @   00 R0P0@P0S, ЍW 0 hPD 0 ^PW H 0 TPY p@ 0 MHPX D0D De0 9@ Ѝ: %I$4D8 t L A-`pPs0S.@ :T$ 0D0 .R T  S\R C @D.R @0.  0T  S\R  @@ ( 0 p@-0M 0P@ 0 80P k`\ P0o4 (0 0 8 30ލp440-@- M0@R0  媔PP * Ѝ@Ѝ/ , Ѝ@Ѝ/q4PRp@- `@P PP0 ?p@Q00pPRp@- `@PPP0 ?p@eQ|00pp@-@Q `wPPP0 ?p@?Q\00pp@-P@/QP p@ p@ p@-@P 0P   L  S nP   p/ 0 pQP@- 0R R   0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  P * T@T @pP  0 pp@-PP @P   T 80,D0S  0 p T@pp@-@Pa T 0 4. kl\ ʠ5 6 0p0O-M`0@)~ ᷹>p0S @P0 0 0&\`-Q-+*)('&%$ q 000Q 00A S P @1T00PCT Љ0I \ @00A S0P 0 ERD0 0 \0\00+S -S  000\000 C R0S\  \ 00S 1 CR$0C\0 \ 000C ^ \ 00L0C ^  BRڼ,(  R(  b( \eD<01 0[ ( ZN T @Z k 0&(00 Z0C 04<01$C X 0 Z 0Sa 0S %0jS 0 JS 000ʙ0 \P\Ѝ00XS1 `\`0Q QH0 9 5QiS IS NS\@>P \00(S 0* nS h0l $ 0S@ZF$0S `q o m$k iH"00h0l P\Q  ЍP  ^PA\T0 0C Q0Q\J0\000C Q 0 JS 0000S 0  S00 00SZ00 ()1 0 J0000 00>0P$0 00 (S B ?00 0 0 H0SW 0STX fPk `帻Pf p  p囻 0S P  > 8@PP'7P`p50S l 70jSk&pBhY 0X 0 lPhq0 DZ`娹 ᦹ ᤹ ᢹ$@SP   ! ||0t P` &P t0VS 0 pB p0R 0C| 00CS`P6 b PEU B0P`@fU`Ff0pX@@00S0SpG@DH0Sd NP `0P(0 `O(0W`0V`ĺP` 0SP 05P TK ᴺPFP&  l= 0" 1EP) Xl@h0S46Sb (52P5 Fp14PT0%"`t>,V \( 4/Xp4 40##"l@T@4`V 00S0jV0S 4@ $3P $P3ZXp41@D0$",0k60C,0hBc 0&ڰ 0@&3 0SR 4PB 0ӰhDF P@#p3庩P `囸 ᙸ ᗸ$啸 ᓸh0l +( 0@PẩPH0S `p000\0Q `000S ` \ 00S 1 CR)\`00C00000QP18<0\ 1401"YMS0S#0! p㨀 n0XpSl剑5Al `1$ R R R 6000XI P00 R*W 4 XpR000pt00p  QX#H 8 Q*p 00.X 000X0408p040#3 0@ 0SA#3 @ 07,0 0m0<0x3}0 0P0 S  TD ,0 1Q 05S*X@@ 0P@X@ 0 CR00XdX0  @0X$0p0%< pywPD<`X0 @ BRQdX0@0X@03/P Xw 0,(@C 0D0 P 0,  P%X0 LAe 00儵04!00028!r/WXlPX0  ApPV0 $  TV40SX@0@Ꮹ0SE@X@8p @+%< TX0,D ,0 1Q * 0X@@ 0XP* " 0,(@C 0D0T0P  ,0ԅ@8 $ x H h | < A-@PPMG 0 S`07 S20p 0PPD P? 80 0PP&  0 0PU Ѝ 00S S Ѝ0p 0< <0< 80| ௳ 0 4 h G-30BMPP040@ 0 00S0. S @ᴢA~ ` p0v #0GP @T *Xh d"Tc\2P  0 D",2 0 4 30Bލ 0    ! W@PS x`PN 8 0 0@PL` 0 00 00000 0`0@ITB 0 p pIP* <00S 0  0pW2   0 0J 0 0 0 e 0  0 0 ) 00Sz Sv! y< 0xP p O-PPM` 0Z0 Z`\0 0(pPK 4 `00300qc`P @   "P0? S0S S#X `@T 0@ G T : @D0S X@Dpn P  ᗳ qPXp@D_ R  0` 0 00ߍ S S0 S S cPP 0  0C?o 02P@ 0bP0 !W o*@SU @ 0` P 0 S S S ` Sb W:*p`b`P @0S |0 0Q PZ T:@DP!0pCZE I  0@DQZP  <pW y( PpG * P 0  0ױ   h ( P pG W 0p 0  P" `S0E` T  ^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 0٦0  4P   0 0 0 D0 30LЍ4Ptpp  @ vT@ @0@ <0 R lP @Qa lP @Q㈀ lP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] tlPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRQ P0/ $ $  0]R& PR " YXuQ   Z J b" R Z A @Rg .R`P@0@,Ѝ P` 0D0C  [4:( 0 ,Ѝ 0 ,ЍQ   0  Z "    R  PXY  P0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy(  0G-`QpQPN*0S) RE `0@0S? @S2 0W:T   000А    P 0S00@NT00X0Sp p0p l0.AT0S!@@A@0W)(0@0$D0z y y RO-P3P#RP3 M0U 0p`\ @W @RH R R4 (00 ЍW@ Ġ[? A @ GRPR@\ 40S @[0V0A[0S 0 0-ⴝ  Y*@T*0Pž 0A\ R!ɑ" 40S 04 0x (x w - M| ЍO-`S,M@ [ ` 0 `S 0S0\0{ @\e ^vQp`0030Y?$00[00003 `0 0PUX P0S @S^  0 XL*@UU pP0U00S 0 Sh*`^` ^ F Y[ R0P Z PC -(00P0S 0CQ * 0G S0S 0 p  0AQ|Q0"1 0^0[ ` 00(0@0,ЍAUz0S"  ! 0S@4?<00 R^ 0 S؞000R0 ABQ AAX QS R0S0[0Y0S< Y 0R `? 0)$ @C /P R 0 0U/ℜꖞ@00,Ѝ @H0?X0S` `0` \0U/h < 0$ 4^Hw v s s s JTs s r jxr p@- M P0 `009p @ !Qp < 40 0 1 30ލp@ `A-P 0 0M `0 10@0 (qzp 0 p0 (0 0 1 30ލ Q:/R/0S/S:00/@-\@3$* 0^ @R R R ( 0 0S0QA^ R! Q 0Q" 0 ASB @- SQ A 0SB   0  @贝( 0 / @/A-@P`TP' UVT )P @TP 0p  0 耝( 0 0QSp@-`P@ PP@`V  0R p/pA-PAUQU@A`pPWڀ1AP<( 0 6 0 .? 0 Q" @-ASRB 0@S A 0  ( 0 /-- M) ЍЍ/@-M@ &p TЍR/0-S0 \S  R 00O-P M@P 0DT"S~ ` #P-Y` +Y Q0Yb T @Q ǂpʂ`Ppg㼂pῂ`P" [-SQ& K0I P0aIQW0IAIQ70IS| V[SQ;+ mh0S \0J0 Ѝ Q0YXP(0@ \ @D0 0R 0 ЍQ} 808 8?0 ^ AL\T@n \k Tb 0 0 0HEA-(( rMPPp`* V2 @X0^00pAtA0O00TAXA\A  PPZm0 @t0 0 1 30rߍX0X XF0 ྙV<0< <G0 ങy| @j j 7 j i 0    -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/O-@SMb 0YSg 0p0S000!R !03  PP E`#3?`:0P*Q30A !!!! P = 0 Z U 0C pS!P0 0@pQ 00S  Ѝ7T 0 @00Ѝ@0@ @@0 % 0 0 g g A-@`Pp0 s0@0 0<T0_p@-0 000St@@@pdPddP@P@P 0000 0t^^(p@-P@͚ p@A-@`Pᣚppp0php MT  ux<0 M4  A94  0 J @-@P0S  3/000S@诚pA-pP@`  @ e000@P p@-@PjPpp@X@-@!1BMM 0`PF040@@@ @@׉qPpS p10S d!p0@ (g P@A0@ P> 1 0+I!0 0 4 302BލЍBP @@P  4/P Q Q 0 0Ix0 00P $0 0  @T X d \( c \@O-qQpMP #Ap@f a@0` RD0 0]:l1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00Qx00p@@aЍP[Ѝ<0 0`H\b | |Z| Y@YY0@-@PP$M U" 0 P' 00 0 P $Ѝ0`0` ``0 UH0H HH0 @Xt ` ` ` ~! ` _ A-@PMU  RN h10d0SB P1PqPa0P0p` #)/0PS-00允000S 000000 000 00 l ЍASP00H H0H D0 ▖ _ _ _ ^ ^ ^ ^ |N ^ ^ ^ G-P9 0S@P$0S!0p`PP @0S PU @@P {0Uv00 c`@ 0@  P` 0 000 ,0 A`UT] \ \ O-DdMR@Pሐ 0 0S Y 0S X4000SDd`0S00 ,0$004 0  0 0P W003܃0 03U0@0 Q  Q P0S/ 3/0 0)@T&0U00 L0 0L00_PK 0SH 0 <00@00<00OP; 0 S@T@RP800S," 00C0T@dЍdB,@@@P20\} 0,0SX  R20$   @$(0e@$0S(  ( @0{0Sp0R p1S `b!1 0&( [0S-l!l1l h0( OY @dЍ@0  0厈Ѝ0000@Ѝx 0@$0P D0 P U@0X0 P@`PC0D@0 @`XPQ0C@D@P@T00V0S@DPE`F@0S$0DQ<0SU V P  @P 0S0S @ `  @T0pSpPpW 0 #S$  V`0P S0|0 @T0T` @DR (p00SppW'0 Ph0t5#$(0 0#R00@S0\0x0t ∆`P\ tQU@  !啄PK (0S  B\`0P S (P B $0Se0 \@0@COoWB@T ($(4|@P @(4 P| 1`ptP  0tP(0Sv ̃ʃ ȃ ƃ ?PD PH pg0 $#1 0 q|p W'bP$ $30X`" `\@ @"#z56 {_EPEHpXP 0"X`\@`2!:?C0Cp4656,0Vb 0\"$P {0`PSTR0 000 Rh 0 0W'bP$ 10X"\"#z56 z{_EPEHpXP 0"X\`h1!:?C0Cp4656,0V 00!$P W{0`P0S` 00S 1CQ `0C0@0 1 ヰ@]P 00C0TP08 0000000 |0PcP" 0008 * V瞯<2 & A??Nt8 s0$ H @0 0C10 {T 0"|0 0 80P0P0PcB   1@PsPP V 0 h00P#$$pfP  B\.(0SK 0 0R0 (0 tP pP vXgP UPP `0 0C B`0 YW\0$(0 2zV 0 $L"L2PPh[spP  ypw 0#^z 0T$\A \N 2 PA0$0aꝃ`P\07sPF  0P:00XS Q0/L)AoR^& 0 0S  0c1# 00Ѝ QN0O0l1 c, 0# Q:v00Q )Q  0 O-Mp<0` DH8@P00S 0@0P 0 B@0P 0SQ^  H0PP   Q0DR0^^ 0S 0S S SK pPr@00@0 0}0W@ !≇pT0 Pe 0SUP0 @0 0R R 0\Pb S 0CPPa R@ 0D0CSڣ0Sl}pP[ 0[0 0 RYd*0  TDQ @J \  T @   T 0CC10B ~PDP|0S0SCU 0S S S r}QP@"00ЍSu 0CPP @+P~ -P% 000LP 0ࠃ:L0@^ > L@YPl #@Ѝ000 PL 0\@0Q  R  r KS S80S |0p00 0p b@0"00@@P  D21 2 Qn\ 0\0C 0 ^  00@Y 0Sg Sh S @0p 0ЍI I} PePg0S`|뚇@"00Ѝ@ @QA@E#~pPJ 0H0Y@HT $ 21@4PEW@80SjU U E P 0 00b80S80S800c8080S Tp0+  RP!@L80S L80SH00@X \y0l 00f@`  BR"@^ 1P5"@!@V+P(& A-P@p`FvP  0uP  0uPA-@> RϠP`pl3 ^ʦ{P 0 W@0 p0U@@PEPU 0 B-|P @` pT  0 B|Pp0U@98C- M` p}@P}0  C 0C2S P 0jt Ѝ6cz@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ 0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/" " " `A-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0@- !P@M: R @ 0S R0 {@Ѝ@-xap`@PM> `1PHPP3 YpP-0S  Q= p 0: SRuP  8#800@ 0$  0,  0( 0 0Ѝ}O00Ѝx0x xE0 Y<0j 0 Ѝc 0 0@\  Hp@-@P Ow00CS00 PMwpP0 =0 88  @-@P 00CS00 @ 0  I0  ķ A-@PpS 0rSL wS aS_`  0 \`0S e C+S. ^R# \0SPP0[S0TS0US0`SP`0 >0 P | X p@-@P7 0S= v P00P! !& 0S 3/PP೼000P @ P 00 `00aavd0`` 0pxcP404 480 Ti 0P0 h @-@P 00!R !.P 0C 0 ;0 0ꈴ(  @-@P 0 0 S 404 40; 0 0 S@9c8  p@-Q@PPC 100S2 0 OV =000SA 0!$0 3/0P:07p00P @ P 00< R 800pzs0PYՇT 0 J0 ࿁bP00Utp  0@000 p轃  0@00pIJ 4| IJh -Ѝ/p@-@P@TS S S  0 pH0p@,0p@r0p@66@000 0 0000/ ?`4 ;`@:AB98C D`? >`E=GH JFI`<''(Op'tKLM Np匀GF`DE`E DpŠ`KF GpJ Ġ`IpHHǐ`I JpKO ƐMLNp`L NOMpp R `p QpESPFpDGp` ^p0P``pA/`p^ APpM_Ām[PQ 0pSPMQ 0pHPBQ 0p>P8 Q 0p4P.Q 0p*P$Q 0p PQ 0pPPQ 0p P UލލWOT ,!a Qp@-P P4ATp  @P 41S P0p@/@A-4!@ pP31S L @P!4Q w0P0W0S!R PMoPP !Rp Wpppp@-@P 0@@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V q0@Al @O-,M0 0 S ! (sp2/0, (Q0 P `@P@P0S$Pp LZB @PUXX 0 `P_ @\P0HŸUJ[e`pp,Ѝ 0 叭PPuA $`ϭP[ 0 $ |`P5 @\P0  0P 0Q QA Q  PರZ`K@(  -P 0 ZP @PP,Ѝp  0p妭P ,Ѝ 0 @P@00,Ѝ$`  P(@HT 1SX0$(Q $(1ն`n0 @-@ ! \ @},w00,1S@-@0@ h00,1R@-@1  @0U,O ,!O-QM ly0Sp4 Pw`@PF QP   2P 0  p&#"PQߍ Pn 0p '0 YX \U A/ pP  0'l'%%ȠpP `'.h%t.\  ( (!!ȠpP"|"X `.#l(!"$ pP ` $(,p0`#0#4)̠))T(,0((4# '+/p3`+̠+P '\'(!"0&&8 +'t&d$%&()*,P- .p0102`48<@D)̠)X)$7;?C45P6 (|((4 l !Ƞ! G+(!+\+9:0<`=>@ABE 8pDPF|H`'&&&pHIJK`L0, p  A AA` P  L0 H HH岰 S+I !!!EEEE,TGPGp'''NpNNNR.FF`&&Ƞ&TCCPC`CpR'BpB z 0AS[ RWI^Sx  a6/@ PK(P dQP p 0D A2n0 a!N^ Q_`$Va```04a$PP   ဃsc@|C 0 0 QߍOi8 }y} Rp}[ P ʠ0 "ؒ4 8P0 p qDC|@ ?|`V PuP0 \4S 1R!3Y 80rYYf@4w`P3 ZŠD H 0 $P&80KB<,0(ecrpQbPQ 8}@̠ 0P(4,04 8Pp ` aD{@ {P(P @ } P 8Z }PP|W|@P|@|@D a t,lXO-@(`10p  0A$!1P@. 0lPS0 200\5W00P500H50 0@50 085000500(5000 S S {00P p @Ѝ[ʓ 20 2 00p *0Y 2Z 00 20120ؑSI 1S 0 Gv ICvp@W*("(R w? 0 q-P0 "m  -P 1Sk0Sh1Se-{00{0S{0` -P  z-`P pW010!! 0 p/z @. <.0 29 20 29 20S 28 2 R{ X2@SWh0Cpa 20 2k 000w감 Y3Y#d2 20)-0 . P2P:0 "S  "J  "#,0 #(#4 0p W,,,Ġ$ ̠# Ƞ ( "! '$!!,0&"+ (""$* #,/0, #(#4!%)- .0 zO00P0 0 xؑl0 `0@0S K 0T 000; I00/ Z,Z* 0J/S  00P00: S o0 p0 R C R o?00D1D!D?0 l4 <0 0100U# - p$n0SY 0 `0 S00R0K [ 9Pn00}0S p psP nppGorej8` |_ _ R Q0P:Q0Q:m@-X @-@@ ! @ p@-@P  i`P! p@}nH O-@0dM\`P `T0rm \0 0km\p  lPUi X;*1 "C3(0 0 ((0 0202 00Sy a,Z )9 0 0 0 0F 1(     g2b 0Gc!1 b 0=c$!1 b 03c<0少40IY㩐@*4 )ቐ1040x!x1x b 0ci\!\1\ b 0cK<0少40IY㩐'*4 )ቐ10407P 0 q$ 0bb 0b!J 0 b 0b 0 b 0bp00;ƕXT|dx<P(ĠhТ̟O-M  @pPPn @TH 2 ll"  `"` 0@ * y봐Y) Q0> R  j `P` A`@DT@*8@#80C 0 P 0 0RY 0 0b ^b0崀10CS`/*8#8X 0Ѝ0 R@0崐Ѝ `"V$@Ѝ@0Ѝ 0@崐0 b0 b 0R @Ѝ kP 00 ġȞĜğԜO-`pQ4M 00 YY 0IS ( STQ0ISc0@04Ѝ( @  ( $0 p@ $0S ("0!0  @P Y Y Y(0QUY&  {Y9  @P 10CSPq*PEX%XYZ Y,01600 p b 0naX%XU Q 0PEPU*01!000PEP ! 9  @P QPEUP:,,v,6Xp%X b0P09a!Q PE!UP: b0)a!긥帕U,01 P +[  101 01  `@P_ K[㫰: 0 b`(@R(@P 0 00QP(0r00@(0 = P 2@ >(004Ѝ0S 0S ( $0@T(@R(0)Q1P0CXS%Xᣠi* 8#8UYl P UP @P@Y P(@R( (}Q0(0(@R( q@ k@P(@(RUp(@!*PEX%XR(|(@R, 1Q P 0TSTA T0D@ ?@2"b0 O`(@h2h"hb0 E`P2P00H2(@0R, 0 ) UXQZ0E  1 @P PUᰑPIXY%Xᩐ: 0b `1!b0 `0CX 0@%Xfpp  0PEX%X[0!1  0 PC 1 C@PB 10CSP: 0 b_1PP!0 P 1 #PP! @@ @(R(( 0L\4И``pH(LLL̓p@-@`PP 0 00(0`00Q(0pO-@`D6$M0086800,0  01 pPO pJZ㪠6* *Z; PX%XZ! @H$H @ 0J8P ⣨ 0'0!01@0 @/ U 0EH$H 0b *8_Z 0x0@0p 0$Ѝ 2 UQPk10CS@*8#8SQp0 0P$ЍD4D$Db0 _ ZP @ ἑ@ Pz 0㼑  R 0 3弣003 00H0$H@DS 뼑 0 S 0I 1#pP A0Y@DT0@:b 0 ^ "  P PP 10CS@9*0D@ 1PP* 0㼑  R 0 <@YT, o뼑 0 R\ P0I 1pPpL [_ VPM1!b0 f^ Gp2@D1 H$H @U0PE1, 60@[0:1 0p1p@01" P00Y!08#80 !pаР @D1H$H@u01 @1p  epPPE ! BR@:L 0 b]ꀕxT\hlЏ܏В̌؏P 000/ @-@P , ^@ (^ 0"܎O- p$M2P (@0`$ \0 0p0p pP@ `  ^%0Ÿf#""`( "$ `$"     Q!  %&d!"d+"!  px10`00h1p0 PP `@  0  0`.01. @Z98#(5#l  00# 0$ b!00#b! 00 0 @ 0@P0 P0 0`0` 00$Ѝ耎tiC-@Pp M' $Q`?PU($8 ]0(0 `)^P4`㼀` b8"#4b4#  0^V@h ] Ѝ 08R(@R )P@ b] 8 ])P8 b] 0A-1?`@Pp @f(XI P] 0刁$0@pG0( $0p ?W?@`G?`@`` 0$ <@P U 0$ ?pW (] 0$ qp0 p$0?W@`G?`@`(`@ ] 0$ <@P U 0$ ] 0$ q0 0$ `R @-/ C@-@P 0 ~]@ (/] 0"R @-}/z &@-@P 4@ a] P] 0$$|O-B \M T6  0  ^,  ~?  @00 ( P0 , D0 0 H0$ 4 p( 8 H4 < 8 0P`L@$@(P P`p,0 D00]$7)$970#%'ɂ%)' "ˠČ 0#ˠČ<0 "$0  (&Ϡ' .( 0  *  )'& 0 )0冼᧳ . 0<0  4 8 ,  ",0+#)0 0# 00 @ 0Y$04(8300#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,`@ 0$P0#0p`+p ?(P)1 ` =<;:9876543210/o]6P 6P 0P#0Ġ 0P8?CP 0P 0! 0H p$ Hߍ0<Z 0 0Ġ 0^P 0H rp HP> 0Ġ 0! 0! 0! 0! 0!HP  0!0000Ġ0Ġ0Ġx 0! 0!0 !{ 0!v 0!qL0Ġ t4No 0!` 0![ 0!x 0!s 0!n %0!i0R  0_H%PA e 0!T 0!O 0!( 0!# 0!@ G0!; F0!6 E0!1 D0!, C0!' B0!" 0!|2P @0H @<2pH0 <0! ,0! +0! *0! )0! (0! &0!O0H @Pp h P@0H P@>p D ?L0Ġ0Ġr 0! 0!z 0!ud} 0!o`0ĠXP0ĠS `~}@}}|}0m(^]iDyyxx@0G-` Mp@  000 0 VJ QP0S 㾹PPL W`A 0S7 㲹P= Tp8 T 0S: 㦹P8 @V (! 0S01P0PW 10 T @0@0 ɶ 㱷 Ѝ WPTU U @ U U X00YY ᳻᰻ @ᬻ 8[[Z l P , Yp@-0@T 03/@TXdPP 00@T 03/@T\up虻H00@T 03/@T$Tp , h 0@-@M@P Ѝ0P  0P p P(0( (A0 .VЍ0|X4u\u4uO-pPR M ഁУ@  `880 S" 0SJ: q# 0 Z  0080 S 0Q>0 [# 0 0 Ѝ 2  0 0 2 08 @@ @ Ѝ  P00 0 00 0 tP00 ЍP   P  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? 9P10@-@0T1!\ 0C B  S P @Np@-P`V@1@!T 0N B@n\pSVpC- MP `@(hV dV``0V"pؑI@ T`1 `! "@D  T@ p PP Ѝ ЍVpP p`O-Mq0P0 pG 0 PU  @P 0U`1`!000  0 Q"X0 PU0  ЍЍ@- M` @U U ( P 0 q@pG  P@D @PPvT Ѝ Ѝ Ѝ0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-Ÿ2 0|M@R0t00P`\ 00S80S `h"`2 0 t0 30|Ѝ4P  'P8 p0\ 14p0p'U`0$  8 0 0# `[9 P%8pW= ` 11!040 M4PU 08  R88P@PX`0 A@82 12480Q8p :'V0 S !V08PVP8 ŶP 8 ` 0`P 8pV00V08PUP8pmU0`0h`e X 4 O- ʟ M 8p<$\  0| `Vv 0@"4SlSj90Vn ,000`00k0P.  ]00\ S|  S `PI \ 0P0  0CX 0 !>01HU0(0 PNpU0S(00S0!Q0:X Z c/ \G c/C 0p0S 0 Z0 00p 0SZ0SbU00@2S708 R,00* 4P0P\ R,0(PT4`,0(倀@ 0  p  (`VL` 8D7(0-_V$704`8X00 S  0 \ V Y P% P PX V0"2 R8\((\ :P00S$8Q 4Y3 @ [`@, X`D 0SX 0 OPZ【PX 0SQc/ 0 00SP ZD 0 SR@T G000S $0S  !S0 0S 0@T `6  P0 SR@T G000ST?00Z【 c/ \H0 SRr@T G00 R 00jT"00$$4 0 2 30 ߍ p 8Qd0 SR@T G000SBT00Z【 c/\p0{@ .w,T0 S ,c`]$P((\X` `0R48 0\R408  \P0` @ =0 SRI@Td `&G00_X P2 `0 R(S VPR V`Pa `8@40ζ0 SR1@T F000SS00PN0 SRc @ c@ ``P 0PP ` R8@P@-@ Xs r@ =@ 0 SR @T F000S@ g `k@ x x $ A-`PpX@M@`@C000,0 0(000X0@4Ѝ$ O-``ßp MWA5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @S0@"2 0 0 30ЍhTŸ <AЍOT 04S:`X ~> P Pp` F   `X  QTpK`PYH  tQT  QX ( Q  ` T 04S`XA @p~ _X` `H`pQ`@ T W`@Z~~ @-@0V@p Y ! 1Q@pU VYp:q?oT20S@` Pc0gR 0 ^ 4  @- A0@ @ €1p@-P@Q 0P ! "0 2pp@^p@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R000E B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/0@-@!@1 0 MQ020* ^3 0/@!TR*/ "RR /P 1DE0^ R QQ*QQ  Rh `0 0 2 30ߍ0@ 40 0 2 30ߍ0@$ 경x l QRO-PP$MQp X 0#!  0 00 U `E0`0r"U@ (UP'  8/P 8/P 8/P Y  0`0S00 00Pc8/P`T*0 0 @T:8/PY Y~ 0 SY{ 00` @TP* 0 0C0C@J BS0!AQ RS Y B50V[0*Sx* S:PJ 0pC 0 00Pf0SUc0` r"V\*@c⃠ W*0 0[ P 8/P Y Y 0 -  U [0`0V:$Ѝ  00ShY 0 0V} Y0 00 0 `p 00S0 c0/R$ЍY w 0 S 0 @`YF PSa  BWYv  0R08/P 8/P 0Q P08/ PP 8/P0 PJ8/0P p8/P 0 D0P 8/P T 8/P 8/ PPP S*0S: IP}00S  dPI 0 @Q PI0 G 0 R0"! RS  B#10S8/PQ 8/ PPPH8/P8/P8/Pu8/Pn8/Pt8/P_ 00S0 l0 L0 k0 L 0 0C0C @JS E0!] 0 0C0C @J ES0!R$ VV\VVtVR Q0P:Q0Q:@-eC- 4PS@ M  $3/`t  0 JHQP` c4P4S  $3/000 ЍN 0 A- 4dpV:@T@T 0P R 00  0R 0 00  @P0`0dp@A 0A-`M pZ@P#0: SPP ˅P@ P 0 GtdЍNP00ЍPЍ( $$4/p@-P$0r0" @`Pp4 $ U0000C0  0R 1 00 0 p  0% 0~H R 0@-S N  0 0R 00A0 徰O-4MSx`A`ↁP@p0 T0? S*Pk $ 0  JG QP Se$R PWTDL00`000aS0@ `d 0V 0  $6/ЍS   00 S0` 0 aR` 0 0 0  0000Ѝ CM 0 =M 0 5MO 0 0Q 0A00/0@-S@  R   0 0Sp@-@PT @T 0 Tpp@TP`pRQ3@-`0#03Q00S@PMЍ0p 0> *Pp GVGp>Ѝ%S LT 0p@0 0A-!1 0xM@P0t00PX 0SD@0 SBa`\`a!p0  ?P6\! `p,`0 H y?1 0H@UU@@P@T  K 0 0 t0 30%xЍ0娀 S``  cLT 0 ]L0l 0<0 0\ t0 30 xЍAPK0 @N$NNM ) ML M LHu'@-0M@ 0P k00Ѝ@-0M@0P ^00Ѝ-4M0P Q04ЍH'C-DDŸ M,Ÿpn?2cAAA@111A@<aP00AD?8P<`@ Rd@PW6!1 0 0 30\ЍT00à?d@DR ?P00S5 U*-0,!0 QP  0S0 QPW 0@d 0@T0@dp 0@U*0SP  PR @p0  0U*0 SP  PR ,d Q Kh8O-ϟ M|ϟp 0S㨰 ` pᔟ` [ 0@00S %SP 0@zSzxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPOMEKJHGFEDCBA@?>=<;:9YCCV6/.-+)(4k^"#}{G E,T [n 4-$= 0 |0 30~Ѝ,PϠl4 @0 P $0(@:, #"0,cR:,c2S <  @@͟ 00C L``C@ @r  ^^A!/3b112A0 <  ̟ 0 cPp<5: cP` ;0!3b112A0  K0 S 0! [ K 0R Qd; Q00dP  : [ 0 S  R    BtQ1:0/A!b0dP   [ 0 S  R   0  ``: Q00dP   [ 0[  R   0  `k 9 Q00dP   [{ 0 Sv  R pd d9 / b !Q Q00dP   [\ 0[W  R Q8 Q00dP   [D 0 S?  R 9 0   ` -0 S00C  B1D8Q/0A!b0dP  g [ 0 S  R   1 '(0 dP0  M [ 0 S  R  1 p'0 dP0  4 [ 0 S  R  [ 00[006 Q0 0dP   [ 0 S  R 0 01?2c 1 R11Aãd0Sâ/d0CS0c0(6dP 0 [ 0 S  R  08  8   `U80S0 R05p0dP0|5 0 [e 0 S`  R Z 0 0  `,N0dPS004 0 [A 0 S<  R 6 [4 00[^-  0  `! 0S8  qp$   \qp $ P 0# S! -R? S30 [ K  S Q \#1P "`aa!B! #<0 dP0    0[ 0 S  R   0  `1   0  `x`0  0SG0  PJ P v [ 0 S QGPt0` 4j0 S  1h [b K 0P[ QU0S 1 [M K 0RF Q@UP 1 00 / b !Q dP  y [' 02 Q, lP)\(\ ףm@ED0DC*CBAA$A@8>==<<X:908n $IT54 S  R  1 h 0 dP0  0 [ 0 S  R  8  0L08008<00dP@0 0D00H00L0 0X0!  [ 0 S  R  0l0 S0Cڜ [ K 0R Q0S  [ 0[  R }UPUP 4B18" @ $08VS` gS 0 `[ " " N"N Ϡ$0B!l0 8 040c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0l3dP 0i [ 0[  R  o P 3Q00dP  K [ 0 S  R ,4`0?<W,<$T,d $0< F, 1 $<0 0  dA-M`@PF0p40@0000 0@pPP T pF0EЍE" 0 ЍET 0 @-$$@M Ѝ C-pP`X@X@ M K@0@0  0 @ = Ѝ蠹 4C-P`p@XX M *d@0( 0  0p@  Ѝ 4@-0N \0N@ T \ڐET 0 \E 0 0@- MP@0 P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000F̌0@-l>0F. "l@V,h @P^QhLl -R 0 P0R 0R R0g h C-$Ÿ$20#Lc\*0Sm S} 0C l l;Sàʌ͌fc\*0S[ S@a 0cϠa^l@Ҍ 1C0o 1fcf Qq P@\ pp0T0C␓H` G41@?L1c1c0P0B0P0BP`N4PQ` @PS( 0S l lVàڤ0@00002c2cPÌ l làL l là@)\P ף*Qgfff$IT00 0P /0S/ 0 S/0S/0S0@//O-M0 @  S 0P$0@8 <@D0T T0W,Wn౔ŠPnnAD0@4j\ F查^౜NΠ @n nL4jR౸柵ƟL,౜BΠϠNl !B8 < jQx柵xƟL౜AΠϠl 0 A@jPƟ 0@c@sTP0SjQ v f V F 0Sj ` `U1:`X1! R< PEe@Ϡll  pC CP Q BW^oPU< H%@0 c sD0 8j0 ;R~ `@Qq\0&Py 0$ UTY WV] V0 0P@`$0Pp?0/ 0 /?0S BͱV bͱ 0$0  a`G12BdD3&bCd`@GGd 0:0.0:0;2T;r70Ctw00p?YZ0c 0 :0+Q _P  .0:PVZ}c 0 :0+a o`  .0~:[? `C#E@CP 2T2 0 cQ R@ 0@ V@! Bqgqg[pCc 0 U:0)   .0L:r?D0Cp\1 # ?B1c1c0Z@ 0B0 015@02c2c2B!@" "b1C S/  0@ 0Jd 0:0z.0:0}4;`vc 0:0&.09 }:E.€Qk9_u"nScm$Iųyc 0 90*Q _P  .09PPD`0@ 00T @ @D0 S0@@ @$ 0Ѝv c 090)  .09 \<00P<000084P<00Py\?T 0 0@-pP M0P0@<P T0S V ZP9LPQ%  .   ! 0 0,. R0 ^ 0  ! Q0s)? 0 Ѝ0 S, 01P0% V 0? VP80R ,PPQP!V00%. R0R!:∫ RF\h 0OPC F>02YVF"F,l Rl0l0\"RP*;<Ѝ"R 0S*0Z000C R\`,⸠  `P 00R 0R0S 0V0W2 z6 @S%VCL00S R ;S,S SH0\- 0 (\M 02FS``F0F4HpP=09@Hi@V|hlp崠hpx|…崠 ራ b9|ЍHpP H00cH08P , 0 C[   1000pS0S >S0C"1 0P00bP 0,Sd000XP 0S   HLl6 ihƎp60 |ax倆0$D,8@0=$@(P`4p8@ PPUS lQ8 X1X!@0d0 T000(aM@@`F T0P0\  R@ d?@D  x@D0P0T0S 00 PhP@0 0 l0 00WPࣥT*D,xH2 h|[<1 8(@-\F=<;:9p7l3j10/.,+q)('%k#"i PmLKJxh RwtLIzS WWT 0W   0Q񏐩00@0C \$SjPg u0Sq 0Wp1!PK  u0S 0Wp1!P;  u0S} 0Wp1!P+@@@3 1u0Sp 0Wp1!P"  u0S p  0Wp1!P  Z u0ST 0Wp1!Pg up0S> 0Wp1!P `0*S0 0C P@00C P00@ S0`a`0`F0@ \$P/ u@0SWp10P 5 u10S 0Wp1!Pu$0S 0Wp1!P * u0S 0Wp1!Pu0S 0Wp1!Pv  s u0S? 0Wp1!Pe > u0S 0Wp1!PV p <Ѝ 7 u0S p 0Wp1!P8u0SJ 0Wp1!P+pn  u0SB 0Wp1!P  u0S p  0Wp1!P u0S 0Wp1!P p] p p0W M*0P~ <Ѝ ep7d ^p{] WpV PpO IpH BpA ;p:vP0p/ @0Wp10P# ! p u0Sj 0Wp1!P^ B u0S p 0Wp1!PIu0SA 0Wp1!P<$P~0`&P   pu0SO 0Wp1!P)@J u0S p  0Wp1!P p p pur0S p  0Wp1!P p zpy  uM0S lpl  0Wp1!Pu:0S YpY  0Wp1!P00@ S0@01000C0@ \$P u0S8p7 Wp1@s P  0'p0 $ Wp1@z$P@0p@-PP@ 0S0p 000p0 0 |,],O-Ο oMMPƍ@H< D0 <0S 00H!R !0s0咑 0T0 0S   R 0 00 @0=ܰ0,0\0=<00@匰h0,XLPU @%U PU `D0?Y0S VU 0pP ` r010 0FZS'%$"! X     l:$L>~34nz P%    R^0s[ <0SJ P=*X1RR坋XOًX.TQXQ\Qg,ˠ~@Q`G0D,< TDHl(80<@P@ P@@0@0@00v@0 F 0`A@0 F R$V @J`:` \ \0[+0pJ0`0S00``6p%<:  0u   S A0PS-0@tPr0W  0(00SW00n(@R@@TI pr0d`$ _P 8 4 0 }PvP| ,0S ,0@0S0000PP (8 0 6 30 oލЍVa 0Pamr0$P@P0804000!R PQ  R(  儠 AR.S 0000S0r00_1S 0010000S0G?0VZW $0@DT0 $0`000S00 0PCUC(0P0}0PU0R0Sy u000Wp0 SP !00x S |0t  0  0 6| @R1|0PN x 0R0 BR0S@ = ,0S i0P,04 t0 PS-0r0|0s40` ` W PPP PEUP0$Pr0?`00 00$0,0S ,0SD0 D0Z WW@_ P*@ 0JoHPP @0 0ᔎ0@s ⬋PP,P} ? P∠)H0 ⯎p@ $0, 00`0`\  ^dV 'HD<@4  L X 8 | ( ȽBT3lg$< T 0(0l0( 0 M Z\ Q AP  WrP S(000V00(00 (@R@@TW 0 (0p0L s(d`d0 CR$ .$0dS( S PPP @r08 4 0 < 0 0x0PUD A@11D P* 0W(  :rS(00` ``0(0H2( 0  Z Q_ AP  00 0`@_ ')VD0 0D0 H0姍p` $ @_a 0`*VC 0 F Rp`qp0 F R`倠`((@lt3 0 } Zw P  !AP    Ra,(  4 0`sPL000S|0S,0@ 0C$040ZZڐ0 0S@04@Z @DT40`L0Sq000  0T0S 0]$0@CT@T ڐ00S`@0pGWW0H,E@@`pGW? 0S@ 0PK 00CZZ0)ڴ%  `PPd@`@JZ0S0PJZ0 ` d@`P0S0d6 000j|PbT0%ڰ `Pd`P` @DT0S0YP@DT 0d``P0S0P700@01?P) W 0TR0 @ @R0` 0@@GTX R> 0  PR,l80`PdpPl@@p `@DT\ P@DT `dp `Pl@90\ 0r0SPMPEU0ڠIp@`PEU 0S@ 0P(PEU00S0:0P0P0000S0l:000000 T000000S0@|@T,0@ p0$0p0&0R`0 :QP0 1,00NS `Vr0Tk`@P  P@$P8@4@|+|;|  0, %<0S]+;  , 0%S0(0(s U 0 ` R Rd` R X00$BN%R0f03T4l``p@DT 0R`0 Pv@DT 0   0R@0 (p(@(0:j Q 0 @ 0  P}@ y PD  D w(D(@(0:> Qz 0 @ 0  PP'0 oP0 q8P RQӕ 4sLPP`pPph080`US}U80PE0C8000pG00000S0@$00CSZ ڐ Q@8Z@ @ATT0ڌ@DT 0S 0 9P@DT 00S0400@0!P P D000D0.Pxd`!0NQ00  0f0SP000F`B#P|r0T0د 0P``P` @DT0S0P 04 10R+ S0bB- C S!!/ @(ϟcS,/L!b0C000A0 A00@0A^B0. ^@0X0X W r0$ >@$ ,` $ _P@8@4@0S0h>00p0tH.H>H 0@, $x00C@0sP QX @P  jQV @P  `SD 01DS-0`r0͵W  (0 0SPD  D @P @ P P``0P0S0=00@0#P00L ,`@P 8 0 $ _s0 U0`0 W ( UH000d0$0L048p0$p0$p 0K[0 `G G 0S T  S  R0 40@P48p$0PVpG   PD  @AD _( ( Q{ A _P2+( ( Q\ A _  S SD0 @AD0_0   0 S Z$04j 0`L RP 4 A R R Q4$  P8L$ @$ ,`_0@`Vʜi`0r0 i`GP6p(0 <`0@(00sL` d`XS @p$P0 ER.0 "!.0000AX0qQ @  P  PD  D  Q @  P SD0 @@D00SD 01D 7PD  @PAD QZ A Q1 A Xg`k000c0$0 0n001 0g@P0X0p&x0  0(R< ! `S@ 4 G BPt0@dDt& $P0`P` @DT30S0iP 0D000D0e`4@,`P8_00G0S 0@P`GK0`$P0S0\500@0|@D   P@D D @P D$D @P DD  @PDD  @PD D0000@PDR LPPLp`p$0V`!D0DSD0 D000 @? P∠"H 0 Cp@| 0 @00`#3 D 0V!Q AP  Q AP  Pw g#3 , 02!x 0B@00?T0jD @P D D@PD .# 0  0 '# 0  0D @P DsiP|@ D 00< 0p 0RD D ^@n SD0 D00 0D @ D_>D @ D_6 0 D@PD, 0 D P 8 `0 F Rb@A@0 A R$Q KR] q`0@00 R0 ` @y,ᦅ(" 0 0 gfff\ Ķ|x < 0 $UH>  SD0 D00 0,$00< 0pI $0 @`>RD  pq  D 2@ ( u0< 0p) RD0pD0 RPPV (0P 0(0@0A-@`P d.d> `.`>{ `p L.L> 0o `p 0dP  0 xP0H 0@E P0DU04= 10 MP(0DSD8D<.=010|=4 00  ` 8|ЍOst@@C>0 SA@0c 0c6ю 0@DT0A0D00DS0<0  0S 0 (0 0 P00 SS00PC_o0C00P0CRS00(0P0 t@( 0R?0S @000 h0,0T0Sp@CN0@6@d00<0@T`P < RQR00 B@D0A< 0PQ 00S7 `P BPP 2PP Q+00 0R0 R00S   0`Sy<0`0<00@0TT0S`D0Sc,0S00Sr <0S( 0St0 0,@ B 0, 00  #P0;  0pRpS 0 >QppW 00SQ 0YD  @ ,0S@ rP X#  j`P  dP00|Ѝ0S000E 00D0000@0( 0h00S,0D0P0 0 RS00000,0SPPU (QAژ8  01!r@ \8`0p" W 88  @P`p 0 D0S  7P 0 7 ,0`S uA ,0H0(0l00 e@. |7H00P1`Cf 0  &0`^p $G %  0P0PX`!H0U  6 6  p 0  0pp 0`pqP 0<x 0 gPP l0XPT(0 0DR Ps9U@ PP 000@0Sh0,06000*000 0Y 5< ` uA l5 B  0@P1Pd 1(PWt@( 0R?0S00S6<@0`B 0< (0 B0cP00< 00d<00000 000QQ p`pV Y V  R R R S p CP P9W  01p 408 |ЍO 00 @008040Q @|ЍY 3 (0@c010 $B\ 0`0#p   0`@pS؄ 8^<0@0<0000 PbPW^PPT 00 0R0 R00S 001 `,0@ S00Ӣ?D2 (01Ӏ ,0S 2 v 0XP,P`(0@0(01000V , *0Tw (0 x P h,@!"`$APP P(0 0C (0TP 00Sh0S,0,p@ CP  u00S0S0DSp0S S TP P T0DP ?aCoc?`(?yPD?ě'?@8!?$@@Qw  s9R@  00C09,0S  P \Pd@0V0@(0f0 P0EHXz PX 0H@p`  0 0`p0PP@ PXHP p1| 0xP&~ 0kPB 0X@0SH l0(0`ЂH0`P)2 (01Ӏ0,0b@ ,0[  L2]`p 0 0O 0= 0`p*P  0$`pJ00P 0P3P  FP `@P   ! `P{UDZXv,0S h0SH0(0 0C l03- 0 3` uAY0S0 pS 9[p9  `P`q(  ( 0 PTg0 S 0Sm ST  0 0`pPH 0PX ?UY@0S9QPl0@PX(01X`fl0X(0A0S46S T50S0 000@R 0 0SH46S0 0 v0@ s0R c00 00S(0 0(0100V`؄uOnL |`P h0S ,000C0h0#h0,0q00C0 h0 p`19[ p\ YM)0<`-M Ѝ@-@ / ?!BCX @p@-@ P` !LN !@Ap A-P@p`P  0P  0PQ0@-@@ T3#H1THPD1$LPA2 L+@L+l0n0@- 00 M0000@  0 0 0 30"Ѝ| "00厣厣0000 000000w y@ _ X1A-0@`T@ T P4 T8#8Sp'Q0- Q"q1 q.0R0pQP T@W00@   COPW@ TPZsX@03a2!00(^d]A-@0 Qp`U$; x S V$%R JV@TXU45S 0A-ˠ Pa LRCs\ LU/ rR?0b03 P7  pp„ R ATT% U# \E20  r/>4̠ @@\ \/,Q P AW/pWp„A !  B E@T@E0A-ˠ a LRCS0\8 \TN:x10@o\0 ^# QR<0b035PPA@DT30!#11S!41 #<12 A"LA^U /B \ s၃p AT\ A Nr14L@QPUP@E 0  ]@T@?Z4O-`9:#:p \S)*P@ M"* 0\R$ 0 S6C 0:  Ѝ> *0\ S 0*p`W03"X  Ѝ4>70 G- PXl X` PD Xa`  P)3QB< Q7qW ?qD0 @)pY Q X Y00    $5;0'% /@pY X``@p@pW0VVA?@ D da2  2 N33. ϠpWVO-鄢 M! # @dtk{[@0R- P% X@R ?[e0k?0 C c4 4+3 0k# 0K>#@>@0@2 0S 0 ЍO?9 Ѝ X7 PHP0  ?{M`? + 0K# k6,+60 `2 @5205P0 P P0/Ġˌ ЍQ`b ЍO0@@0R P@P 0 ЍO 0RH0H000P0O-Ă M!j# FUu,["{Z@0MVW V0 `T $:S0{:H20Ao ЍVL Y< ?Ze0j?0 C c44*3 0j# 0J>#@>@0@S^ Q 3 #1Q11!01 2  L2!L F>!l"4< ЍOqYA ЍV P Q1 ЍO   V! `I?z'? * 0J# jb0/duP P03 !0##1RD$1",!020 C cA.c00 //tp@-K@T0TUoJP( V @DOoUB@T p~T03@d0 L  000V`p@ (  000pppM`M@-@;0SM S^ #  0$", !0 C0c. =Ѝ^ h <$;S 4#>Ѝ(R03:045S <ts?S/ e ?S/  \;p@-!0@S. ? T5 S\J J P03H:04Q P00Cà0cTR7 ;P39:@ @AA!@aà$!RU00 p@ AABAR(R 0 p\0D?oR20S p@o0pp 0rq;!0A-ˠ_S  _%F \@ \RH RQ3P:TA!@L,lS^+ CQ03A:0 !00C0c$qaV 0C}@~@0p ?0 \Q AR^\R A0 a[0hpp;0S ;0S P 0/45S 0 ;S l0l !;S /45SP/P @- P/;0S ;0S ?S/P 3# /R /45S @-45S 0/;0S ;0S /R?P 3#P/S 0//45S @-45S p@-88A!:S$&O#S,C>c0&0 PcT @C22 Q-pQ1^ Qp  000p0C?o R20S p RS00 L  000ppawTpEDE0@-0!*P M!: %+ % C!A Ѝ0@ 0O Ѝ09P :#:S % Ѝ04>70 >-Ϡ M\Ϡ L Ѝ Ѝ-Ϡ M\Ϡ Ѝ< ЍG-T!MV#zO\` PpO$ W \$0 Ѝ0` GoP \M Ѝ 0pW 0 0 p P`U&[㉕eQ`ve` #>   0p`0#0 0 0S@@ 0A PЍ 0 ЍO-s!j_,M#J_%V `$@P T T$00ό 0 st0 0,Ѝ Tx ,Ѝ 0 9`V  0  0 -` Š5(ˌ$ @刅Q㤊 E000R0 FP @$N*0/S  #0!:*S0p#!`!H:  1!)0r0Z Sl\ QY0^ 3# 0 Y`FP0 #0#* 0 0Q0! ,Ѝ0H,Ѝp?/0P00P 0 0m`ch!` #  \Zp#|`Z Q Q Yp R0`^3# p  ! #% QP)   0/ ɠ@- ʠ,ʠ\ l!P Q4>70i QP/>@-!  #  ^Q\ \0030# P 000 2 @-!  #  ^ Q\ \0030#SP 000  R0   Q/S/p@-@P `qPP  lp0 :0 F Te,e@- M@P`S0 pRUT 0S*frP  B@;p Ѝ$S 3T@p.s @@-'p Ѝ"@p@-Q@PP9 100S 0  R 0  00c0 p  p&   0R00 P @P r0 0 $0 ,0, ,<0 p 4pcHc@-0 Y0 0[ PT@T 06S 0@ЍG-q0p@9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,1g1gPU 0C  P 00Sj`P! 00000000i0S x0xgd0sgiV0S 80gg ,0R0i t`Kq\G-`0b@TP塢ڃ0T'P# Zp  !p0  n.  P2)0@R0C`0P003 `MpG P `C-0P!1^$23\ *G-0@P@DT`G !1PG*32\ =:Pp @@  Q0 0S 0SQ 0 A B`Q3 3pU  0 0S3#U0 E B S 02LS @0@P`P 0 0A-`@apPFF 0` P0T 0@*S UV@S  \ SL T 0`7S # 52#10C c2s#0FUTV 053 1?A-@Mp`@PBP @p!JW0T0  CND@D@5`@Ѝ P0 `00 !30 0ST0C@@1`Ѝ0S0/0 R /JO-PMp 0GW"S`@wP-TP +T@`0g0TW Wc Xp pc 0 0   P @p P Z Q P  S  RQ ! R 00B ^a0BSW0BA0BSL70BUI| X[ ; Q P  S  R2 !00XS00 C RP A BRLWQ ?0X  0Cj 0  ;"00"00 0S \0F0 Ѝ@`cm0 0R 0 ЍH0H H?0 ?7@0 p`0p pꀼC 0 0 0D 0 0000/$ 0<0/0 0000/ 0<0/0 0000 /᜾ 0<0 /0 0000/X 0<0/0 0000/ 0<0/0 0000/н 0<0/0 0000/ጽ 0<0/0 0000 /H 0<0 /0 0000 / 0<0 /0 0000@/ 0<0@/0 0000/| 0<0/0 0000 /8 0<0 /0 0000/ 0<0/0 0000/ḻ D0<0/ @/ /H-M 0ЍA-`pP@ 0 8#@T00@0@-@M/" R Ϡ?#0! P O, P!ЍG-Q`pP S Xb `RSW Pi 0Cr ?o/o0CS`00c<@#ÁX  qS& ?o/o0CS@@` 0f0 <#Á0Ϡ00 Q`V@ 0XP@0B X0 0Ueo`P96?oo0Cs !` V 0f0<#ÁX X go0`06@f>0!.@<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@ P  000|g / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R R  // U /Q R 0 0S00/0 0/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP Q  00S@ 00Q0 /0 U0/Q0@- S Q0CP S  @P 0@ U00Q 0000@-Q @ TS Q@DP  ST P 0 U00Q 00S @Q U //q 0/  //R  Q 0/0 U0/0 0/0/R  -/p@-@RP` 0S V 0U00S0 0p0 0p0 0 ;;s R S   0 /U/0 0/0 0/RQp@-`P@ 0S 0 0 S 00 p0 0p 0   0::x:R S Q0 S 00 /0 /U/S0 0/R S 0Q00S0 0/0 0/0 //q 0/-Q S Q R  0S 00R 0@-Q S B @Q R0C  SR  @ 0U00@-0 M0| @00000册册00倌 ႌ4 ,0 0 0 30Ѝnܫ | - BMMRč `` T @P   P㤊3  8 8L8,0@- @-Ÿr M Mp$ȍP|`@M TF "  r" @$@`p 0 H",2 0 $8 30ލ ЍB^"P0 @p r M0 B^P.!0 f100A@  0 P0  B\A AL+\ 92( PH  [n?2| \ 87tL\ 7ԩ 68Mp[ H6Z 0 50  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !02300  9P0ЍK00(0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ(00@-@T@T0 00/ᤢ (- 0 0 0 MJ Ѝ䀢 -- M0 0 ЍЍ/$ $0 00S0/$ t@-@p@-0@ ,ppP\0Ppp\//////S //1G-0pPW`(M 1 0  0(0 $5/(Ѝy@PL 0S TTT S0S4*4! 00S S) $S 1 0 0S0S "S *\pC 0RW001 00 S0000t0t t0 @0X0X X0 6}y@,(t`X.p.(.-H..//O-QPHH̟ MQ0Z [ < 0 0 0; 00$0; 000%SSppSE `0 pp 0GZSZ?XW9UTSRQP'"MJ~}|?>=<;:9876y43210/.-,+F)('&%#"/ ZUg^ gjyW  ` P0,p ,@  ` P  )  R Y 4 P  R0 [ ɄS0CQ [0Ԅ0ɄPU*^ 0`CV`FY 0 [0Ʉ`V*S 00Gp! 00G S[    000S0- pvS # 0@ 000 !0d00C0FQ0PA0TXX0 p"pP @T v  0P 0CV`P f0 PFsp xp0 '  0v) 0SV$`0P@`X 0< 5   0pp@ p*W 00G S`pa`00G S+0p00 pR0 bpp0pS 00`  P,0,@  0 000vx 0SV00q`P@00V`S00C `0 ?,  v QV~ @.10d0Q00S0) 000D0@@0# 000 0 plWp Gp倀D0 000  04 00g\a 00- 0+ 0 vS  P00%0!: 0@P%0 0 h dT0*00C@C ]\X 00^ Y 04m Yk* 0[pɅ Pd  BR B_0 [Ʉ R*Y  BR BM [Ʉ R*G00 <  00000 Y0I0"2 0 0 30Ѝ  x  000?0,& 0P0  0 P`$0 0Z00\ 0F @0(0"( 00P0@  000@. 0@00S/ SA`vPⰐ0pS >P3 p 0 M 0`P(0S1Ss(P @`TP00ST`0v_Ⲡ0Sqs`V0@  ^  0S< ` @, dX Tf0 <0080v?@0p0L08 0\ S<0#P 1S0 00S S00T01< 021t0H0ATX0D0St00p040800)SAT| P0@P{ @0PpPPwy 0;4@ fP @0P@P 8 <0 @8 @ 0 T<0@ 0X  SX  D0S+,0SV d< 0 p0 S00D0#*pLH`|P6 0  0P4/PX|x*d: 0 6 30ݍ Ѝ70`04 040\0 gj pW5 A8@P@0Ppw ! @0Pp/0 = 4`0 0呁P 0 t P8; x<0PSX0S  P@0U  00P`F $0?mE0(0 蘰 Pf10ူE0( &儰WPI [0Z  QP `1  0 80 (X0,0୫&  R ,00,0$0 0 C0 SQ@0b0!0p?A9c! P }0S y@w0P \0'0@0'0 c (,0P,03 Q#  #64 0 P0`1  0 70X0 ,00 0 0  .101m 0,0`1  0 60X0 ,0p0 M 00 T5P]0,&0<  XcR8000S<0T0=P0@[@/ + 0 @000D00,0\Q @U`D  100 V p@چ Q v?WU1u0 1 # 3^U10#03 @$A 2UY1#30C Q# E @EU  V@$000 00S0 @0U   ˆ0v`1 00t@r0P [0#0@4#4 b (0`00,00 X3 X0T@0p0(3 @Xb[0"0@" b0 AQRl `1S 0  Z |, ^`!!! QZ   X20 @| X0Q  0D R[ YE AT *`v|P 0p tPp4/P@0 1D@\X0 0,0b0+S .0CS@0PPPQ P0q@ p20@D0 ,@0 0@X0 ຩ0`!`V A ċ 8 C<H`<h   @l x| L($ ,4S0X01SP 0\0\00S S00 00ᨰf $0P16\0 IPS00 \P1014@PD  6ShP 0 (0(0p ~0P`p P 㸐D TP B("(R DD ~P0`0P0@6 @I`06S$0S A0$0 RVPK0g("(Dp D  T B("(R D0D ~P0`0@0PR ^Z0"0@# _aEW 0 0R` 0`1  0 3X 0ṨV 0   UPy  E("( 0R00  T B("(R D  R,# ,~P0 3d X0⊨ Z0$0@H$H  a0,00 84 X@0o&0 R ]4U 0|P=0$@ E U@ 0 Tˆ20V0$D0S<0`0- ;0` 5` 0/0Mk(0`00@ 0jP\8PY1011S1 = 0  0 0 60@X@0" &0 R  0 D6 X0! 0 0 0r06 @Xj`\Y0&0& ]`0`0@0P9 EY0'0@<'< F`,0+S .0CS!@0P *Y0'0@' +`Y0'0' `8aP0@ Y0(0( `/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@}P$Ѝ0 }P 0"c110$Ѝ000$Ѝ00@-$MP@}P$Ѝ0 }P 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  ?@Ac@0Ѝ/MbO-1 p0AMM0 40pP H dG_PPC @ +0,8P7 0S4 `  0S+ 00@ w+P00@S 0S0S 00@ @K @jS @nnD ,0 0 4 30AލЍ_p p o O-@00ß CMM,čß ß1 Xd$,p000S000- 0p  P?QP0\400 PM0`04 !/ S $ 0  ]\40 0P 0  0 0  PP P02 O S0 O dL10,430JCލЍ!448#8S0Q Q/ Q uO     dO  , "44 .$$X8(#8"(T]GO _ o $@ @vcwVx7vP //ᨨP //A-`p@0.V0PVSQ@ PQP  R N0 0O-P(+(; 0M M060 ;@0,0J0[T 0 M01)0`,4 05@ d!A  d!. 0`11110NP  4J0@ʏ$z0 p d10 d1~ P( `@ L`0D@SH _V S\  S S00 Q@0S S R: 0CQS0 C0SQ000009[XP 0/ H  0+ 0:1P 2#S;S 0(S# 8 R 0(S> 0(S 0x(S 0 h8R 00sS 2 S S 0<(  $8R 2 S S0S 00 S S SS@@ `0 eL_AP @@ 0Q"0A'A+S? 7R2 S S000R00S 0`0 S S00 (@@0S S 50@ @@@@@00P00H06yO 0;$ 0H'PdD@ R`P 0D@ 0R`x] `L 0d!S 0 0 2d1  At0 |31g1|upA τ0`0S [ `0`SH@DH .S0S[ P`.׶V00K[0S 0 0P % $0$004 0 6 30܍ Ѝ0, S B T T Yʔ4800404(P0$0 0 P,

N6 dA-@@`V 0 CQPq GP pG PFP 0`0`l@-@00 R \\  $0!0D0 0@ ($ T괘`@-@PL  0S  T0S@GG@G P/0-` 00 0Q,000 P0($0 䐗p@-@P}0`H P 0(S  1T  0 $000f`pp@-`0P E@P PEP 00p.4 A- 0@S  P t00  ( $  T800 R> D( 0S  !R $8p0p( $ p aGa@(`P 0!P4 R B  B QP|70 pHl'  ( X'  X 0 DG @400@ p30  0H0C(01`,0FS0,0(0$@$ 00$S`SY(@CQr @T  B Q$ , R  @ p,p p$ P  EP p  B RS RA 4Ѝ50bPP @ `%0 0 0  x% 00@T:T5 B0P@500050 P ATf4000C?00 P$ ,p R*#Zp $P@d`(.]p 0 P 1 T  @ P$8$ `R " @T7 c ` 0Z$@ Z (0pp00G0#0 $0Tf # 0$ a:,lC@ 01$00P0k ,0$ FD,0$ PY  B , b, $`,P (NP 0SGP( 01 (0LPP$ 0 a$,P1 0$1,P$ z0F@ P$kb`(0$ a1h(@ P$MP0 1T(0B1!0<0 ^ςS0}00 @P +.000@P ! /1:\0   \00 Ppp<f됕2 8 \< ,ؓp\Ht 0ȑDt DD,|,,h@-@P:00Q  P   $00<0 0@ ($ Pp@-l@@`VpPPpZ0U1pPE1PSp ( 0$ 0p謉QA-pA@PT`QV0A@P 0 pPP``p`(`,`0@A-p`@APP T  0 000P   \|@-@@0/h 00(/000/܇004/ȇ00/ᴇ00/ 00(/ጇ000/x008/d008/PA-x``PU pqW@PsC404 0 ,(08P AB]C/-< <0  M00( $ E Ѝ䌆 x|@-@P @0`00@C0 50 ($@-@Q 00 2  0 G-H`P@pM[ 0ip TW 00K 0 000 00- 000 0$00|cPP: 0 2  <R 2"  "V &= " 2I 0  0 qppn W* W+ 000@gV uhP@Ѝ00@T0-002cPP 02 2 2: 2 (iP)0? 2< 2D10 04100(10 0 10 0100100100彑P 0 R00   0=T 0 2  13/p^0SW 2: 2l YP 2 @0 2@001P,00|" 8<p,,C-@`pQP M 00EPEUC\A@E=2 2 X 0 R0S 2 +13/PP"?o2R03S H}PA (0$( p 2P 500 Ѝ(0 $XP ЍP00 Ѝ(0" $X000X "X00"?o213/pP 傑 Ѝ@-@`pQP M s00U,0`V( 2S * 2 P13/PPF  `P 0 p 2P 00 Ѝ E Ѝr0P0PC-1pPS M-:b V%*AY YpY 0 P Ѝ 0  P`V: ЍV@P `W 2< 2 ЍO-rMWb8*P00A̱Xp V [KD)@@P) Á @1@DT0 @ 2< 2Ѝ0 @D  @d P 0pSЍ0 V P ЍC-"1`S M2:rWB R"*T$* RU  R00U00SR o0 ) PpX U"B Ѝ 2< 2 Ѝ?P"! ЍG-rW" RbM"*R* 0 @0\ U@D0  PpY  U 2< 2Ѝ"ЍЍG-`഑p 0@M PP IP!X%( 0!|!0 0CS @a%XàN 8#8S0C! 0 R 0 1P@10CS㣐.* 8#8 0 BR ("(R B("(  0S0081#810T!2 B0C!2pl0l l0 T T0T b 0808 80 $8t8غDp@- @XP ` qPP  嚏pPp@-P`@Q 匏00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M Q00 Vu 2+ R2 13/p) 0 D0! 2$  00 2 p`0 9/P 0 9/P  d0P 4Ѝp$  0qp 0 VP 2: 24Ѝ?p`(0 0,9/P 0 h 8 80 $0Q/ $0S/l d(<<0 0R/$ 0S/ lԅA-@T 0S>Rp`/FXP0P@Q0@ @@E:P 0A/P< =B'O-P$M`Z2t娄D 7p4D$4aSX 0! 0  0+WpLDvBP b0@S<S9DTdp| 8204404 4000$4040(404,4P9048 49$Ѝ $40$0($0,$0$0 R2p0X" P "2Q9PP10 `00SdPIPXR0 `0 00CS0z Ip  RF($R [Y $R8 [ Q R  `9&@) 0@ 0000`006@?U0`00 I 4S !H@96@ 4S $Qp [ [ ,$R ^Qp IQp$R [MQp -Qp   ^Qp [?@0QjYE"X.tJ';'C+B'"B'0B'OI'ф7\#""O-@`MpPnY13#@3p#3M RPGPP2 QH@ P  `XP! d@QQ@0!C!-\\ R0C0h20pW WT Z( Y <Uu```X` r`T! ZPP   l`Pe 0+ 0X!Yq``pVpP@ |&u% B R,DDDDDDZ U X \Y0S X  R 7/ P  R x/$ 1 $ 0 tYEPa0S @t5YE$&Z#X.;'k###D#\##O-`4IwMpP$aX0`` `` X5p8pGW( 0R[ S 00 0 tvPePRP&GP"Sf0@S$<<0<<<<<<D<L<<<TH0@ S<<<<<<aP ` ` `` ` ` `$(,S4 0S000 0S000-T0T$pG4T` 'y P C```V/V  000140SU0S0000 C C0S S/R TUp0Sf 0&vUo0: S (00/V%s00pJ`V  PpT 9PPU0S7 s0ၾP0@ /Q50CS$ `/  `0SG 00   B R\ L Q,Q p / 0  pPpG 0ph 0  P 0p K/R  S/R/    C  R:  -#   30SS/Q$ 0S% T0sX. @D!R\0PT!R\ dfX00: S  CCT0: S H1: S t : S  Sy  Sq OP9 `6 Sf S0 L0S !Q(0尵0 [ @  Ἡ['8Ÿ0 S802"Q `TP,0!SQ  +5H1: S I00[0S 80h!0CS80h1h!hNPQ X09S 00S ! Q0S !P ៧C3W(0S0S 00 Tp!zr0: S0 W N'#YE;'#.$D&r$LL&$#$$$$ %T%N't%#6%_%#?%\#G-@PU`-.L&2pD@6@f@4FQP$60`VPR0S0 "r `NRP 9R4P0805H`402RP0%.(0@ZRP8rP0d `5`%H`$RP8P H0@ 08,%43/00P08004 qDR0 P 0!'RP (1 RP 0000/0 T$0 `TP0; S @,0(D 2#!H8 01/EB?xOO@P5 Th/dIg0S\cT2S  D*10$CP@T `. p/RZ/ xP ``  R:  p00  % tPpYE8f(;' 8A-`P@MNC3 0` LP  K LP  K LP  K LP  KPH圭D3P0<3P P$P 3( 0lP+( fP3( `P7( ZP;( TP?P ( PLP( FP dP8$@Ѝ(P (8PM0"z(0S ()P(0S (P(0S (P(0S ( P|JxPh!x~p X`PPa D1R`>PU 0E /R "Pp(ӦPU  00,0/00${00CS$l8tP0$0~00S pJj뀀0s00~)B'+XP) V3X Ԣ&SX0yXg(Xg(XA-@PM&`p *p 00S V@PjLP PP ``P ~$ˠ 0@*YET ;'B'0B'C+O-`pFMP᠖M%` ` *p t6 HX.0S ЍfP WP! PP p `RP dP vP iP0p0 `rPxPpp0p0 p$p qX 1S  vVDhehhPU !KP$0 S@500S6$>@X*/Q /ᇶP.QQ .QQ[  Q00@  0P0SP$0`S0S@ npP ᡞPP0S .i50C SX<<<<<<\0$S P P'% @00$ @% 04i0S $ ?RR00R0SV4 $% 0SX  (P ḟ0 0C0 IP 0S ^0S U#0S 5S 0S 0SAJP 00~ 0 02yX  PrHSP j0S )0Sc %0?S_ !0SᣝG)S $ 000: S R  S/o" R 0: SHP 0S  ⠥P S:I 0SIP ֿ0S ҿ0?S ο0S)@cYE;'0\#zcJc#jcA-P@K$p` (p 00S PA@P(pPp ˦HP"PW` /P 0S 0S0PHPx"0YE: ;'\#p@-PM  7 $ 0GHPH@IU!ITD0 00HP00cC#MP3 HP 30S S! S  3YI d3! l3 00T30S  R 4#6 R #!SR3U3 3 w20S ({ 2 20S #0S'002@T$MP0"@\B00CS00  0 D q0S60016 R0S 10S<0PT<00 01 10SQ 10SM(x1d1POT10S P10S l1 `1 0S  160S 8 )@$1 H01!( h $0S0F0S 00q0S0S 00@`|P@Toዱ)YEzȣ&)))()))dezФ&ؤ&z!)h&)zdG-@MP WJ"2br@@0 S + ZX "@'pD 0 L1 05P8| 1HPh!dx )HPP L8 !HP8 T< 0DS 00S8 @0xL 0QaD0@0 0Q)@0SZ L *qPUPfa0@S񟗶(((hp@ꀁhFP `8f@@L  P w P P 0@0 00 @L?LO0@0 00 0 J*PL |+D0S hx GPTv &YE;';'ēBt @Γht@ٓt@I'X.\#ڐgt@-IE&O-MpwIp!3@0o0C?o`HT20@$@4@@@@ @#p$44 X XT 0S@ Z`> [``: eRPGPP qH@ P       hP dP fPvP@` ``k0T 0090 S2 : P @f A0S #S9`2  q`P\M 0pP#?. J0P0 ,xp0 xp 8 Fp e0S<0 0@0050C SSpXX| 0S Λb@P~0S? 0d$ p p  1 R qX  Pp P    3/P00S N$ p  tp[h0X00S 1f%YE#)&X.;'' #\##)##8O-M M`RP4J ^6P5 00 5[P5005 P9 00 P PPy P㰙yNP pQ |]dA@6P񟗳P`p|,l$ ,    0USxP $pQ PQH 0(<ȟS SS{ (d055050050505 ႶP |PB ^ pd0"S dc p Q0"S  pC0"S P 0cp10050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X :o&$U5SPP5`FV5S UU0U%0; TpPl%5S 0DP80: S055PEU L  V05V.弥4P$040♇ Kp4PP Cd$iBm%h5\D00000 0 CaPP#2 CCNCCCPc`0 T 0S #P\bp@d^0#S  BRMD8 ED0E?o2?  B X<%PP6f/w5X PP!D`$e00CS0 5P Pp PNU0 P00CS050 Vr0S:00S:01V51`1S(1S v 8Pdh!iB%pV|x%P 4i P,0V0< &P(/b0`FV}P@hbP  f/嫸0 [T   PV#) 0X.Nl ҥ$&;'%)5v 0\#rB#)0B' Ʀ r8ͦB'md=$)PC-ʜ 0P !@㐐`p@XP2$ P`00CS`0 e%@T ЍX0 X @I)0B'h5O-P`@dMu$P(P,P0P4P P  F"p4pK[lTT1Z03rTdT00 0Ap0-t$t{aSPPP@S(a0@S3P0 0dT5 RT ST# QT040  ;apT[ S0lT[ 0 0  $fH$ Bp8 dЍ $f$ Bpa 8f8 Bp( 8J 8fU  Hf[K /@P`p xv `[X\@T8 BpD@P,",!} ,"0PU!  {P Q !`0P 0`[`& Y@| #t #+w08箧H8 pҭP0 @,U TS l` V8 㼭q0P 0Pc@P0 P @ #;'wX.I~D)D6{DDQ|D(`m|}Düּ\#% yaratcid B'0O-LOp222422223220_aM$0 00  pr>`PpG a`PB 42"S 200002^S R2SW10 dbV% ``L0=dp L$pP  ``L00dppd2S PbAPX0: S0d2232` 3`Sd2St}0 l=PPpB0SH D /3PE/PF1@PC9P<4LX`dp|$0D4pA@9P007000`仟 ,b,000S0?# E_0d204202020202 @\[\k @!Taߍ0220202;/`ŁP000S hp= 00[ / ᳁`P000S Vp+ 0 0V /ᡁP000S Dp 0$000*2j000 0B BkP 000S ^3 S;3ť)00i 0 kP 000SX"\2RRX2Ti/ ZP P3@PX0: S00z `P )/EP 0  P^ᢥ>`P V>5&@p X:{\10 [tp*>[\ D!14<(S4>̲03&703!7^pm703|7. P ʰ0 S 0R' 2S$ 2Sp 0s `Q J>p@P/ X^P 4 f/围H7 w0L7TP'\?S@<"820,"(2 PPN0 0P UY#P`T ]d2S+ ?pX`>00SX!\1 \1X! 0 \02T7,2P70B'8P)R.b||&"NzM)V)_1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0lYHw)X.;'edA0n \#PiB'`w)SXw)..&)YEPw)8qõhw)zd@x)?O-`@pБЁQ p%W㰑 0S 0S fp1`VA LP dG0S LAD`V.Z ЍyPmPPP fP }'n0@ Sh3$33T2$3$3$3$3$3$33300000000000000p4W 0.6P g'P'P 9XX.|);' O-4$$MpP _:P!!9`80D嬄嬤00```$Xp6Y00S 0S 0S X`L4pWQ* 0S00P 婯0S 壯埯0쳟0W30S$ЍzPOPBP4 FPo 8LP@*P 85555(855h855555555666t7575555557757855555588@8X800 êP2 彪P20x00b 0 Kl0 0妪P00b `埪P00[ 0 c@KPS,0N000J00G00D0 mK1 >0S W00000,000(00%000!00000000000``!0Sa͞P` a0Y0S 0 v0P *+PpG! 0aK0X7~KX))X.);'HpX) kPwtz&O-MP8;ҮT$ PUPEǴvPlP+HP7 TP3@ ` 8p@,ծ  ~<qp@!ʮ0S Ʈ < R<0@[{ *Wm@ P <h<99x<p<<99<` 4"p(2 R Z R 1!, Q (0呩P(0,  R  $ @(0bP(0@$0:$0 -RE 80@0 0  p0e@P>Ѝ 00v1 4<? 040P ?000R0Sp b```8pV0S<0S {000@`p@ @ @P Pl 03/p T  X.??;'&? ? &@-,@,צ@ܦզ@)&O-@P8M -`,@嬬F8 0⧬v`^ =p 8p VV6 R|,0 P8 /P0T 4P0\80pHP  F U95VpEh C0IPHPU 0 p(5pO005SO -5*( 0(0,00(00 0FrPPP,%,U!PzZ `Z NZJ (AZ; CZP pia J0R0B@?@???@???@?????? A?$A,A4A??AWZ$00!0 0 ( $0DS +K0L0J0O0ܓ~05{N00Yw 3M0sH0q5$00!0 0 t ڠ$0@S. XuUI03YU0zZ0QkZ CZ BZKLZ aZGElJZ A@A>>>>>A>>>8B>>Aꨒ.ꤒ,[jmPfH0ScI0S`O005S) LP% U( p0 (0S  0C!P ᶠ@P!&@ᐩSp``p! ɠP|! ἥPd! 0S1D!|=3/ 06X@ PD`Pˡ$P1! HR #b0 ⻰pR PP 0  0K0 ⤰p^(&)Щ&Dk0&gk@)&kH&;'RPfX.k&k&&&kk`bckkdlid -eWPil.ljPgui Plm@-P Tޤ@Z)@p@-D@DͤPҤ@(ʤ ɤۤp@ꘗ)\&p@-D@DᵤPẤ@(岤 層äp@ɤ괗)د&h  A-|@|p `(Pᚤ,ᗤᝤ0`ᚤ8P@咤@@4匤,卤៤ᔤA裤̗)P& G-`M4PLP5P0 Rp) P5\5@P L5H2HP8"0 8288@q 5 Hp HQ s5P j @ p1a 0姸0 @ p坸0 @嗸 x哸080<0@0D00 0000P0 0 080$@P ѹ 83 HL@P@T@X@\@HP  H 333 0400,0@@,0( 00PWp PPUPh0PP 0/`Ѝnzp z%yzWzazzr zz-&+d+**)O-`Pd6M``F(`0  p86X0K $V0Sv`@@0V|P 0SЍuPfPFP RPh g@P\KJJJJLKJJJJ$KJJK00唺0P0 DS0#S P00 $b$00S  $V$00S 7`P R0#S (ZfP $;$0(0Sx P $/$0(0Sl 0gP EPq q   ` @fpKWwQU3@S33@0 RH0cS pS: bSAJJK[00\Z9W W, 88 0,3/8 RfV 6@!3Xi 2P0 0C?oR20S` htZ|WJ% `DRѩ000 000 0$r,0 $00S WZ 0 %긩0S0010Sg1 0S 0妤P0 0  Q00s  `1000L,0 0283PX& S R 0@0@0 #  R S u2P(00s  h2pU O3X .2 021`|X.;')\#|l| |3|#J||||I'||O-P@p'M Mfট$PP Gp6 @DT T/ TX 唶L`PK'ݍ ЍAP? a@PP񟗡xRTTQTQTTTTTTTTQTTRTRDRLR`R5P50S $ PW MQe`pP%000P00` ǣP L£P <彣P忻P  P  嬣P 嫸P(  Q- qn;Pq/ Q00 000#0 00$00 0P@i(#IPPLdDP(|P(ǺX@SW Ǹ 1f2 P aP( !ZP( (mL@P` TH0P` 0(Ȑ⨀ q;P 00 00$0 00p囸@P K@P  K@PK@PK@P `P P P !g`LP X  P( (`m` pP( !q:@PP WD VPa>|0pp+֧0S > +U /RPm`` 0V@ sr0 0R0pp` `  1PY00S` 00 000$000 e( 1pA0?0Ἒ0Pa0SJ+S'- 29S!S 1aV`};' a ()X.oqõ\# 6Ápzd@edAp@-P@x3gp@-P@p3)p@-P@h3᭼@-1p@-P@^3 p@-P@V3p@p@-P@M3p@0O-nM M@00ܞp4`PI 00 >R㰎0$0 0>^000㘮(000 &p@:p>P10x?0S8>D$RH$r R  $t ⡥|00<4A @0<4x00<$ 030p0 IOP СPp`FB@D4TFp[[[[ a[[d[[[[[[[[[[D\\[\[[[,a[[[[[[\][<]p]]]h^^[[[^_8_`_[@`[t``00@ዡP \< $w|傡Pr ll  (< j <$$r $b@4lP ;$0 00  0 ;<L0(00 0,.|;0@= N T;$50 00 0  ;(0!00 P 0  : 0(00 0*:$0!00 0 :(0!00 0 P:,0(00 0 :0:@0S P0$0H: 000 0 A$!00  0 :0!00 0 :0!00 0 $940c 00 | 0 $: 0!00 L 0 ~88갸@0S 0 7PN7~剠P0@4w 傠P@q 8(M vHPD40 nPD40D4Z | = 0P00P X@00 1 @1 /08C@@P0 097 000  ឺ , G: PNpP/ IpP M0S 0T4000(0<4 T!P\<PFU ZU V⽣  ṣ0HVp0`R 4S<4Z0 H$L40V.p`@?HL4@0S |$H?ሞH5HLX  $?z|5XHL0$4SH$L4R0 %W-p`  V.p  4S@  z7P  =M  >P`; =`Pd%dV.p `1: SD < $R-@P  <E0P,0   'P .,00S,0Z3$R  $$H0p!|$ L{ =p40P40 r04FP AP$,03}pL{ 40S0X44SP0S4ڀ2S, "20# *Pr 0T40SPp'0ST4S h38#d\P P3 `s$2S 2H$L4P*pRL0 L4H/0#! 0{p<2 C  AL(0) ;kp̞h  P L l$L4H1# 4S 0}_X0 P0$$4RT SQ  X0  ,p XS  S!0$Qh +S0$:$40 Q$ Qq*4m@)˛X.|);'m B'0 &?SqѢl0 I'ev&؅]S ' ݜ)AҝH)2AUl{a4k  9џز&2Zրe% 47lzHL$ Q,} Q+Q +*0$0$Q0$SV 4S$P 44崀S04144 0S @4S 0 0@4,4S $4R#1ѣ1,4$0 0 0000Vv +t |+0S 0+<Jp@ P! 0d!|oN];+ kjP6X+-Q.041$4+DT4S) ,d0"|}o+D+B+@+< ,\4$P1H4PT1x0<$+0@ 0+pevc|vP;=0Z +%P;=0gPN  Dup  TD > 0+- (!O-0p IMM⌙i4, X pP^d9`4pGs04WY `ߠ  ۠Xa$ 4S<44S $$4R0(*p  `&,p  4S P,0S x0$奛 $tY0 0p 0$噛 P0$ D1Sf  $$4P_*` FJZU CUʣDPEU@oXnqXnXnnXnXnXnXnooXnXnXnoXnXn,pXnXnXnq00vbPEUU\pXnXnXnpXnXnpXnXnXnp qXnXnXnXnPqXnXnq (s'8#80( R&0C RJ ("(I044s04>0 00 0 t610(00 d0,0@# @0 00 ( 00*00 +0 0*00 +0}0!00  0q0c 00 x0 e<50!00 H 0X,00 1 1 L40(40SoI;d$5:PP$fI` +p 4S )PP$t$A0P0#X  L(@ P@4(0(p00S0 Z 00p$#;$` =0r P0 r04岛P ⬛P #0I3m`$`4S80S4d 1S !10"D 0S4j⊛P $3" b}000  $Ĕ!<#pX2   H0 $ rhpԑU P p` 4 $$s(4S 0@ ?W  < $tR $4&S 4%㰚X0; 4 44 W  0(p0HpW㔚X0:S Q4S  0 ᯙ  (0Z00S (  $!iX0⫱bX0+؞)X.;'ҝ)H&b&?Sl0 2ݞ)^AUl_ Ix 9O-GM MPh bD嘤$p40PEPEUa@@5P x4w@xLx4w4w`x4w4wpx4w4wx4w4xx4w4w4wx8z4w4w4w4w4w4w4w4w4w4w4w4wxxy4w y> Y E'P >WP ;'Px<;S4'P`Ѐ J $J 0 J >T믊 PZ(  >0 2S1<+02H0WC=0S C@4PXT ~ ~ ~ ~ ~ ~, ~ ~ ~  ~p ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~~ ~` ~p| ~ ~  ~HT`Ȁ8 ~ 09 0iȌ hh0P 00R0S FU 0;8;08;N 00L<ppGG@h;h00S 0㰃P  +;kP,  0E h?h000S0? <  0< 0: 0 |E@0 0L;0@; 0@0 00 008;0 hh0P00S0? :P 00v 00s 09pꔊ hh0`0PS t\ hh00S0@S Xec 0; 0004*0 - 0 0 000* ĉhD0 ɟ Lh00S 0P :0D0W<809 , d P 0: 0 T>!.u8PP9P H92D0SUȌ0 U00̌ ňp0p{IPt   E 0@ @ 8 0PUP 0C S0400000,00(00$00 0000000000 000000<0 0Q0p Rp PP4봈Wp t08; 00 d0&p>8; 00 d0&p08; 00 Xd0%pD"8; 00 d0%p pW  |0 x;0z+y; E 0;0; ; '0cy;0z;(0x;P+@P d0%Pd;"0#10@00 0pc`QHLe  p   p 0%Plc0S PP c0%P_ 0  00 5}%PxRd 0 `UXpp 0 i%Pp,5,%a% #!2P(10[[[[,Q0Q4QD 0@PPPP` D<;SʤDB%>؀C 0 ềPG@P 3< 0ᑈ 0ᎈ 0$(cN% 0㛁PG@XP… 3 0q 0z`"2Rz 0ePt ' #t#t3@PZP30S 0 t' @P 0EP@P 0>PD2 p0崗#p00 c3z@+V@0W0 00 DP0" 00S} # P 1$PmAQf$PD 1$ 0%bq ~@P 1 0ۀPZA@ P 0܇ 0@PȀPD 0€P X*l*{Gz??!eA=c;'X.`RMb@A5Qj|*mQX***YE@*I':ȴ*d*Gh*&0(*-C6?*8~Aث*$@*@@,1B'*:*ȫ*_&*B'<*,= Ea~ &@Vm}%Jl4XbrX* 1 I뤆  p"@=T8 0S4 n\0Pl0l00P0p+tl"pP ә0S Yy#t;D000[ W1 0 A 81d"R&RZ 0 W D G1 @S8 2R`2 C8#<48#8S|2!TR?LT!LL0do0 d22X%X  :  xzxm0|0h?$h,c 0ឆ#ᲆ 0JᔆJh P# !P#!b)*3PU 03  =Ph2d0h220W`! (0#$# D0(0"(00t2 0BS1 (S9; 3 0;`U10#tt4x!'x008C8S!! 0 0G 8(#8 "( 0 (5q;    0L;X 4 0Vc0`#$$D0(000"(` 5 X  p0 IX0 PD0p\5> 0X0[RV <X0 0RpYV0#$# D0(00"(0e&0 G0D Sv̖0Z`H0  D0CSP p,Pt0 lP Q>꼔 (08@HPX`hp/ 0`P#0#! $(,048<0  PN \0 PE Q k0 P& 0#$$0(#"(!0 P(  0 PL  0 P Q Q  p n0 P  z0 P  0 P  0 P  0 P,  0 PL  0 P p 0 P  7: PP  0`#0SH S' S~ VA0#$# D0(00"(0`@  SpIW0KV pYpBpCp0K pv  0\0pG\0W0 I)p0K9+q \0x\0 YpIW0KV\0, <+W  PV\0 \ \0h< X{Ve ` 0\0pGw\0W0 \0?\0 V y 0#oO-M`Pᕖ@0L-S@᳑P0 @,4 $tp$+4QP a`F0pP[N;PQLpGK PL  >}P@ T3XC d@P LllllllllTl`DllllxllL@0S @HGG 0s 0p3 0Y  \>Z'$7`PHP`0b 2 R  0 S  U+ 0 !0!00Xkᆕフ〕}z wp4 ,}pҕ0SnX@n` kp0S붕PZ| p@@5 0> VpIn`L<+S;'Nu \#J?pu\i{YE30n O-PAM M)@`Ⴠ눧P |}Pt7tW00-S% P ᜈP= @ p H PZ P`F0S0 ` @DDA@Dv dp ,0Stb@Q 61 Ql ^P -00 `@Z-00  D0B5S񟗌꘢8,8Тܢ` 00S :=P5=0 0y긄z4P .=00k00ht400d t4 `0S \= X D4 T00Q0>P J  j300S P80$030(000,0-t0C?o#2p R0S0$0PlPP80@;@DT,3a00@`FrS= RS iS1 ltS xS:㠢Ȳ+ ?0p 0@00@00S  0s T1B0S Y?R#R0 B(0/S 刴(0S } 0@DYT0S (0S xg1 0p0-XS <TXQ(0S 0N 0@A"3Pp+r 0 pPTW Q0H+X.9Q+s&;'$B'LL&X&)B'Fas 8%O-PTM)@pP4,/p ?,#@DRQ0I @@0SR;vP cP SP- TP0(3 LP d0@S,8D0D003030800H00 30$30,3C 0C0 0B 0 B "00P00 C0 2#10C0 00C0P00C1# 0 00C0P00C1#0 00 C000C2#0Wqp4 0P 0PQT+{6<JZ2V HY`'os`F P$ 0SU030#:U 5%PX՜P H1 0sP&T6K/r0 3PvTS0 0R3# G@fRPEX!EK/r0Pf"E0<6S"46S|" 02Q|" 42t01Xf\卜6S L刜P W0`W 0 4P0 Fff,6S m/PP &bOfZ<6S46S;P1|Q0@6D&Sl1 0 00R\!  H&PRL! $&R@! 8&R4! 0&@R$!  !Q   @- . @(@!t0P0d +X.;'Qr: 0p+ф<+0+puI'0B'?LJEis9 :FG-P`pIHM p10PEU& VHP h0@ S S4444444HHII 00pa 4iP ` 1!YaCPP 5 L`$@@Ȁ`(` `C ?P P0S PxW M8P X40 0000 F&X.;'0n x+\#yt PCt Yd0G-`HMp0n C S ip 2B1 `FS 1S 0$  !RS@$ P+PTPQ|4xP`PAP MP2 a0@S$(((((((((($((((4 00 04044041! 00101@30@3101101101101ДY 000 0HЍP kPPp  240S  0 `PPV q V `FV R $Sa (08 ]V ZS +X.;'a &^+\#B'C-Mp`Y{@PV p-6TpF`F5 VE@T TcP D^P0F,V pp6PU 5 `V V 50S aP tP0S 500@V 0S qpG bP`VK \\ TLtP9@PA@3PPh|  ,DXlzP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0 B0SZ<0SU00SP剅P0$0-:FU 0SA 0S 0S;`V UU5oP tjP |eP& UH U U6PEU2Xp<U( Q vP! 2 U4 @U U0000    U Qa-PJ0000 0 |P  P  $0S A . 5p qp*TQ@T  0"600"$0$P @݄P ؄P`wRl,;'? X.~B'a \#a <UG-@PMaqM p10S `A⼑P R ލЍRP fP745aP\ 1X@0JNGP1 JsP/0: S2  S)J P0 JN@~p 0KV4S00pOU0S Lp BJ PJ @PJ(`M,;'\#jtPC-PGMM Q8z0,M:$=$ <8 =8X@8DXtP =0D80l8"=`{C0X `XdXhXpXtXXXXXXXXHhLhPhThXh\hxxx8sPP   6P:?j 0LN1 P$L 8 sP0< , <s@P ?PN ;T(X妈@ȃ0Pb+TX8 s;P  0S;+,|Kh8S <PU MhX sP@ x夃OoBl;p z+T;(8p zP `ZT`hQBPdh0Jp኎P0 pP:T P t:h(P P:T(X( `P :h(40FDSMdDxLPt(`ll8` $08 <))p`0H b=9 W B 0،10 ܜl  \⤆8T0>0P XP0P Sۇb0 xty0X8T8020S6480V0`- 000L85gNP0`8d80eJP լY 5?Q4>GލЍt5x lE\%0DX<<r0P 0S 5N 'P@P dd<S P 0S "N N,4 $D8SQrN4 M` 4 4qt |>qCht t>qPt m>q8t f>q `>q$Z> q$T>q N>q H>C JACAAAA 0S0S1  #.@d288S"@PvqN @+[4 P: B?l 081<S{v+4 P*A0:YQP 0KP ~-@P|xA lAi?P@PDA< A0@`(r1QPP0@P`p@+40(@0@000,`40U0 (P<P8}N,8U0C?o20SP ,R  \0,0S /M,8S=k ^,8S YE),M D8M <8R8X80h8%888- 80B'B'm ha p889;'98X.&9фB'-9@96)T9l9X.999% : :$$% %%,: y2:g7<: %G:(% p  ::6, \ V:G-P`8EDhY|P03[Xp2S l P-U[wPH t处9PB/PE0@ *  mpl40pEWQU P4 000`nxP (L,/3PE0S#4 4# 3RP㶄㳄㰄㭄YP -vP303 `px pYlpPd34_X ]4S HS\P  0]-\P P 4SqSq\Pl l PnRw,p`bG1/΅<01 1> 110101$1p[975<>0"02Q$}+p`h Pe Q18C8S {]Q`q܁ܑ$[l0V0C?o20S i\P  \[=`S 0 0000 l3\18C8S 3S P P=?o20 P P l\18C8S 0 P 8`?oP20S 0PZ ]x, MLLL;'I'L,LO JJB'L&?R&LM,,' }LL\#I'CYECC-@`PP 1 儑|q倁 "ph1QALH1PD c41?4~P $~P 0 nPbP9P0P00@0c0@ S VP V  0 00000T TTF -bc0S T,S&;'  vOB'SA-`@C0P@000 0 %P0 0l~P00u吢chgo xث@哌|~P0r0"2PP 딂U 0+0C0SpPmP p]pU~PPE ᤩԂ心P 0S巃҃P10尃˃P1 0Q OU 0SH뷇P㬇>PEl10S `10Pծ@HQeֻ0S,1,~P#P ddL Pdqp 000000S;뙮 h{kPP`0S PPt00S8h, --/u +,l.-B<--&фl0.-3-d.-$.-O-`pBPᨒ뤂堢` p2 0 qQ BpPpGzJ{uP`P GP( IP) EP \ 0  a@Pht,(80000-C+O-M uP]*D,P4/]w4PP 000l 0:P0X0c0LA@Tl`P(t@@@ $px40IY~[p䓟弃00 (0\  `0 !1R S` \0 | 0Zx, ,Az P ,#40S  DD 0S  ,   0S il@P t@`|"P20" -| -R R -R i^eR^~iR{ kRx eRusPPPEPz IPw -P[ SQ@"P<HhT00JF|0P^U?0S< ?SPP80`^V40S1 ?S``-0@^T)0S& ?S@@"0000S5`0S2   R-ڰ1\0 1 %\0`_ꨏJDX-O.I'%-&X.;'T.ht@pX-4B'JPU gtO-@Pp`LM@ p1 PEUV Pp (gP uP GP000`0S@0T PUP   p  !(P0P 0S U(@ p U ~ p T p V [ p|(PU cF TkPL@@H 0( X.;'\#)  0O-@<<%085M@05`@(5b 5p@5b/~UP P H@T0$5$T5$500jP]O-mPN DP> fP@ CPA dh>pPB rP p"H/,( P00: S0S00a`P pfP 00SpW__W  3U`P J 3 7|3| C4@00XXXTsII0@ HO,P  PcP c+~~~;{]< @P(@UP,PP0@'40(Vp", @P u @M300,2" 2cP1QW ]SZ. 1 Ѝ(pn,0TP (40S(40S( k4PU@P( 0P 0U0 0 0 00 pP ,<,0`ꀳ-ȸ--ؤ-и--V-,--ظ--- B'zP P Q R u7G:$-ܸ-P Q X.-xO.,-'R w { w -Ը-(-X- BR 0z O-`MM 0PUP Lu` `` p@$50 CP1YR pP  00I0oP80: S* `wpTaTb@DT (\zT |!0 < 0&000 0 0 01  000` p 0V0R0Sg Y (ߌ(`Pp  0P 0v  vhP8\(0fP U7%`PQ> 0U04 0!002QX C000sH$H( pP02 0cP- 9P( %@Pt$ $( Z Q$W C !<&VN 40E4C0!}%P %8 }*| PRu}0S |0 0/X0  $ P]}0S | @$ Pp,F0  Q   S  R#4p=}0S0{ | 1UZT@PPp` tX., X.;'\#! 7 B a B'ht@ „ ׄ u8  0O-PMP00`w@P| tw@Phhdދߍ*.({D?/X14p40H 0t> H0R`1Z8`12h7D>(0pQ H1!1lC0( Ο@Pv0` m H0R =+00-(iI`18`10SpVPMP 6PU ?PL 4PpㄭN@P񟗬0pHfP j@PP񟗘<<0X1h:<kh~f`zp㬬wd1f3d1kq0000k0dAC0e `pH]0 P(℞P 0P 0%Pek 0 HR(ⷞ0 (3@P 0 P(`끦 ڊ8d&`(00`1(fpXX #(?1S(ኞP  (q Bo(z(e:0P dA@ @0 Tp   p| ( 0 R 0 0  P819:0  0  @Z/0 *  p ƍŋP* %`11`V nPP[9 \)[90)0 0+<)(BHd1 (EnPM{PP 嘍@ z(0 40,9*:p  W! (0S` YPsWWB N(⿀P9\( `!d10d1807"/0  ~`!0 2s7"/0 ~2s "/ ~p+ `1 (~Pڴ`!d1 0d1(00 7Mp(t}lz(00 \7pz0S 0`aa0pGWz0Sz0S z0 S `1d!8 0d!'zpz0S &0ٌpz0S p&`̌(`P q( DŒj<ʌg4囌ɀ`1 H S 0⍐p !p5 P zd1$A>d1 0T1 (00 5T儈p* 啌&$0 T1(00 |5Tspd儌opT !p P d10d1F,w K70(@00 P Xe0 4 0 (f}p `!d1# #$ 34(pt (S⚩pP4(00 @4pl(!R`14`11(ǍP,~ 0cs0!0R0S"Rd1(`1!P0! R!000 Q0`p1Y< ( (`1 (Ā1PU5`1d!( = Z @> ;0xG(⧀("1\R@T? 0S 0 @Ո@ 0S   `H 0S YPP P ( RZ R   (001娈@0 S   0ҋPUQFӡ ڡ  ˥ +' l m ( ;'YE ? W X.- G ܥ - ¨  @%  ' ͔9 ]4 6 L h  p Ӧ  ' < b y   Ч š ̡ $ )  T n  Ө Wd1@00凉qhd1@ x0S h  Q/0p@-x@0Ppp@ P T0fI&p@ 0 0$010L̄ ,Kp@-hPMP@T Ѝp@ `0 @ Y 0 @Yeؚ̚0ƒ S'* 0@- P@ R P@ 0\ R^H00"@ 800 0^$00"@0/(eddd p@-`0M TAT!@ `` @!  4!0  (! 0 $ QpP 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp' */4T*/@-@u@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress U0-7l* 4, T[#Fx^|dghTh%7krq y` u${$, "p$k ,,82/k <4 9=FIS P$XDXJk dXXXjXXXX_ xl` v{?Lȧз@ G M Fx x L L L, ,-% * @3i 1   %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory +d)(2*T;)L>@@7*;*@@@A*G*,)X  N*T*@@1 t,]@@Z*unblock and -DNO_CONV?$xT(HD oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... dr pr rrrrr)rr)~crrrE sZs3sMscs#ms ms_s^sFs<s>s?ssPATH= S t3O 9fJ|d||sP9c||m||l||r  Vxp|awn||v |Hb    EOF reading here (<<) document&RŁɁ΁Ӂ[ ׁ܁  '. zuu4X yLz;>zD }-+?=S ` @`  &0@DyyyyyabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'4#)0]")1ex")1k")8u #)0h #)0")0")0")0ɆK L;> :L7C )0  h :  + [l rBb%03 !aW ^D                  F<< S\8@~ h y 0& \XpF^0~  c(FZfxlxpv0y 0dj 0ZXZ4j Ty|Gx$RT@%X;>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20240503090059Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed yG W\ !j }7h   Sst:e *+@*@*)D)<*-* *h+f p,)v p,+, K,w 4,`*)k5++bp,}#3#3233#ÒʒҒ ڒ@2@nmpx6 E@L>S_NYv`g /C$.C4C$3CG;ƑEN͑ԑTܑ@\@ d  @ !! )( @option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.ow@U@@@@@@@@@Ũ @@@ʩ@ҩ@ag٩ީ- %,39E@L@QV`fqx~NcªʪѪت8I]mͧ:'ī̫ѫ׫ݫYA J]b' Jiɡ8 !'.3 ;@ITA Y]aJkow{b' MU[`gnu|ŨɨШڨ"-29>ENS[agī̫ѫ׫ݫYA J]b' Jiɡ8 !'.3 ;@ITA Y]aJkow{b' ī̫ѫ׫ݫYA J]b' Jiɡ8 !'.3 ;@ITA Y]aJkow{b' changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] ^Usage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'%;\o  6 a } \ Gl !K#K$ &K1K23K4K5/6K8:9@9G:`;z<=@ABC;DbExFGHJLMNOPQ RS9TBUJVbW|\acdefg/h/i/p6qKsKtKuLvKwRxf @`|!3Jf~ @Ha9UxKKKK/<Nhx $9Vn1LgKK .KAqK :/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]` 4k >f _ 4k 8 !'.3 ;@ITA Y]aJkow{b' returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-^2u:::::::;;ɬ N;8?>>>>>> ?&& &8&P&h&&&&̧&&&Ĩ&&8&P&p&&('8 !'.3 ;@ITA Y]aJkow{b' %;\o  6 a } \ Gl !K#K$ &K1K23K4K5/6K8:9@9G:`;z<=@ABC;DbExFGHJLMNOPQ RS9TBUJVbW|\acdefg/h/i/p6qKsKtKuLvKwRxf @`|!3Jf~ @Ha9UxKKKK/<Nhx $9Vn1LgKK .KAqK :SFH0eC쬕ISFU0eC쬛IaHah!IdontNeedEFIII(s*K>;n I|nQn- q+II|nQn- q+II|nQn- q+II|nQn- q+ JJ|nQn- q+$J=rGy=iG}(J3J;Mt?>JIJmWC 3KOOTJ_JyD<#*=(jJtJ3Dh&~JJ\ M}-JJ@Mjy֬JJ-чHYJ-чHb' JZIчH4k KIчH>f KIчHDJ*K2IчHEKS'@ )ѸQKXK*1@ )ѸrK1x )ѸwKKbackupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsidwddsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcaps=kzi&3yiH&c&!H& `& 0&c&ld Э&d&@mH&j&ImH&Smh&Zmh&RmH&YmH&xmmmmm mmm@mmmm m0n@nnn $n /n5n ;n@ init_current_mediasetmediamodesetmediaoptsetmediasetmediainst pGp pBMpm pm  pm `&p.p@&p.ppm BMpmedia_statusmedia_constructorooF n&ooF n&F oF o&popoخ&oonF &o@&paddr_match$$xL$$settunnel0qH&6q&print_link_addressessetvlansetvlanif$r &[r)r&Zr[r YEsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanwxxxsethidessidsetapbridgesetiffragsetifrts,x&+xH&3x&2x3xdH&t0&tt)* H&A &8x&>xİ&=xH& `&t 0** H& &#s&TxD)VwVw'tt4(rr%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAf _ 4k ` $J%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsunionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]Only one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@asynchronousautomountednfs4aclsposix1eaclsextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupqõa P_S 8Ba < Gt }p 4@#,6:?F bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node getmntoptsegG:jM:m:o:rU:%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsunknown %s id: %sinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.qõa P_S 8Ba < Gt } ` @` p Ԉ^4@.a @\Yusage: %s [-o options] special node specified device does not match mounted devicemount table fullincorrect super block%s on %s: %sreloadqõa P_S 8Ba < Gt }* 3 ` @` p Ԉ\.a @^f 4@?softdepqõa P_S 8Ba < Gt }4@usage: mount_kernfs [-o options] /kern mount_point kernfs on %sqõa P_S 8Ba < Gt } ` @` p 4@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s qõa P_S 8Ba < Gt }^p 4@cY^E h n@w~  &@ #)2<F Q@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvConflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cwsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %sp qõa P_S 8Ba < Gt }4@\Yusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o TGd)Px$Kk%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @B#C2F>IWLaNnOSabcƸeڸfh3i?kKmYnjoyrsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp HO` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()[[[|[x[t[p[l[h[usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY $Mw+]%UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print  x  xxi#x0x>Px]cr xxxx3xCxUxat`xaxxxxx#*xCYxwxwxwxwxx.3xAH Yxxxxxbitmask_scan  n u z  %07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlV555sendrequestrecvrequestYE;;;;;;***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16K) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz  " $#!%Z^\`[_]aX \ : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataYE+-LESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-iTS ]R =P-fR oR -|R YE-R YE$-R R -QT R -R R -R R -S S -"S M -+S YEö-4S YE·->S YE*-GS OS -\S V-cS jS 8-tS YE-~S 4k -S TS -S S -S -S -S R -S R -S S -T T -"T M -+T YE-4T YE->T R ,-JT R +-[T YE*-fT tT ,-T M )-T YEG-T YEF-collectV ?^ V k^ M M 9^ 8 !'.3 ;@ITA Y]aJkow{b' NAME=_ >f ` mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds8 !'.3 ;@ITA Y]aJkow{b'  edit_fs_type_extH lp (w 1 1 1 E F @T `T 1L1 dL2 t<2 edit_and_check_label 8 !'.3 ;@ITA Y]aJkow{b' disklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiy L P \ , ȣ ę \ ` \ `  Ю L p ؓ Г ܭ p disklabel_change_geom@houter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default--$--pm_from_pepm_whole_diskgpt_freegpt_create_new \Ē4X(X0|` hПȂl|pȁHt4k ~J~Jn n I>f (JIYb' DJQKrKwK $J! 8U!   4k >f     _ x' Y {J` b'  rK $Jgpt_get_part_devicegpt_get_part_alignment^2:::;ɬ Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC쬕ISFU0eC쬛IaHah!IdontNeedEFIII(s*K>;n I|nQn- q+II|nQn- q+II|nQn- q+II|nQn- q+ JJ|nQn- q+$J=rGy=iG}(J3J;Mt?>JIJmWC 3KOOTJ_JyD<#*=(jJtJ3Dh&~JJ\ M}-JJ@Mjy֬JJ-чHYJ-чHb' JZIчH4k KIчH>f KIчHDJ*K2IчHEKS'@ )ѸQKXK*1@ )ѸrK1x )ѸwKK9  % = @_JL TA\ df v  mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new$ ,H8 xܸ(XD` |\PL̹Ĺ\mbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_free/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.10 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.10 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.10 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.10 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.10 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.10xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32gamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************YE;;;;;;usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2A!S!dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option bMcd(e fH ga h iAjTS kT l m^ nRoe pq+rp sw :Nt uv w~ x z?y A B C D E F Gɰ H IcJӰ Kڰ LDM N O P QSJ T U V W% X/ Zٝ 1> 4G 6:P A |3~a }l j s  ± ȱ α _S %a V ݱ   :      ( & / - 5 B  H N V [ k t J default_configread_configrt_compare_protoTTrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initkն  ܶ )c z script_buftoenv}( ܰ / Ͷ make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_ost    ! ( if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leaseread_leaselog_dhcp 2 dhcp_bind E   ˸   Ļ  dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sSTOPPED%s: removing interfacepid %d failed to exitNOCARRIERPREINITDUID %sdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.6--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.6 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.6 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished]]]]t]t]VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B $UD d  Ă B $]D d BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ I' < D < L U    B ]@ T!"P"L" U $ h  4Bx ] D /etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist