08˧4f<  ˧4fRNt t˧4f@@<@T 08˧4f<  ˧4fRNt t˧4f@@<@TU ˧4ft`A˧4f˧4f˧4f$h ˧4f˧4f˧4fA˧4f˧4f˧4fnA.˧4f˧4f˧4fpxA˧4f˧4f˧4foA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fmD#"˧4f˧4f˧4f (08@HPX`hpx $˧4f˧4f˧4f@HPX`hpxM$)˧4f˧4f˧4fK$(˧4f˧4f˧4f M$C˧4f˧4f˧4f(08@HPX`hFA˧4f˧4f˧4fC˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4f"!˧4f˧4f˧4f"!˧4f˧4f˧4f"a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f:\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f2\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f*\!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f"\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f$!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f:\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f2\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f*\a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f"\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\ !˧4f˧4f˧4fi!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f˧4f˧4f˧4fbpf!˧4f˧4f˧4f $˧4f˧4f˧4f%$˧4f˧4f˧4f$>˧4f˧4f˧4f$˧4f˧4f˧4f$s˧4f˧4f˧4f$˧4f˧4f˧4fA˧4f˧4f˧4fm ˧4f˧4f˧4f$˧4f˧4f˧4f $˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fo).jqK BvZ"/ =Fl&ݡYw`D/9[J6nJ.4",E(TY"h"bCOTaItgf)A|)%P8(\t*[EVhcvűwM4\xk-^ 냣d]: I_d1[QWvofN^=ͣ\8NOD1Z`ܗ}L2G7O> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4 "4 (!!@E!@E&@E&DLL@E!@E&@E&NetBSDlAPaX NetBSDearmv5hf3D0D 0p@-# B  d45@44\4 +8p<@ !0IX/0b0 /b\ dp@4@4\4  Ѝ2(Mb2(h { S@-P>G- A `00P4 82#&P0P( 1/qp $ H밀娐pUЍ80$0( 3/P 0 `V`PE0S0C0@ 0  Z$ 32(t2(q&@-MTA P04 00#!8(  01/qp$ P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p p0h( 3/pLp #U0* 0P`/RP `@2(tm@-@L M 0Q   0  S ЍH3(qO-Mx M0@S. 8S+ #='0|&?0S( 0| 00~" ! !wx00# #p|0 tk&l %eݍ Ѝ4'|  0 X0 S 0E0WS06  S  S $0S0 600000S60 060 00 6RZ R0r0C0C00Q0 0S+ ,B< PH6D0СP`0Z 00$0(0, PU 0`0(0$00,0 0S $Y# 5%e(0S%0 %00   05 ,0S 50 0%xbpWd54%`X= ?X09*a 0  `0a$0 `a0 `p(0, 0 00(00 $0 @<^@0 0|@ ph&paX:)00 ?X 0: 0X㐳$0吣# ?X 0:v'00S. ,0S#$X  !40S [\ ?\0 * 8a0 ^` 0\H +a%6#  (|09$[㠒5 0 !y0 $ , p0  !j(0, 0 00(0@0 $0 <x 1,0S 4a0 Q0Z,@a0Xp00- ?X0)*` 0  _4`$0 _`0 _0000004 0 0 t`X9+40 ?X 0:` 0X㐣$0吓# ?X 0:`5!@<$ 0c 0$ P `5H3(Q Y+q&s^G;}i\3()324I3+W r/z@-pPP@`Df `P Ѝ`3MU@p@-XP8@T`@D p #P<opQ<PpH3(A-AP0$ P0 0 SQ ( $0µP eqh d`P, R3HHqU``0``000PneT 00CS000 g   0,`0CS0000 (00/U R ?e%8 4D 0$00 0$ 3(k('5(#+5(T0 S 0SP/P/S/@-+3( p@-HAHD0040S*0! PP P0P`04 PR@ V04 ^000(  0PPU 40PE`PP 0P4  P P0C SRP40 0P  p5(3(q&5(5(p@-@8P0 00@0@00000p5(5(A-p@P0 d|< 84 0 R`Hv  Q0S ( 㯴P xd^ @(o%?$00 0(0 !0V0? 0"Xd>D @L"`  0$ 0o@ 0$`k('#+3( 0s@-?0 0@aZ P  [W 0P 00S/S`,~8P4ЍppP \P(mD8<4( 5(3(3((t+7@-@(P xP8  c \0X+T Ѝ08PP(P ~808P 0"3(G('A@-P4@(P M8P f80803(HH @-uP(0 00<0   R8(x'3(@@-<P0:  R R1S7]P P 0SWA吡S@ @@  6P<bT PL00CS0410& 0`00 S]PT 0@@00S - P- P  P 0@0CS0\00@  ia45(5(6(x'4(5(k('#+5(Xorp@-Pd`d@000 PPPP0P0CS0p(00 Ip5(4(5(G-@0` V VHЍpPP 0崀 尐R`00`@0SoP 0S  0 h0 0 ?o2S @`sP5(5( 5(5(P `00CS`0p S00 P0S X0X /Xx'G-pሒB刢`0SS CpP[ U\ XLDV00 08PZ 00CS010a U0Pd 0@Z a  00CS0h10=0PUPP1 ` 00CS0O0 P0` R0V00P]aC p00CS0p00 VV0  000  @00S 0S XH8(4(5(5(k(' 5(#+O-`-M  R 0000100010S ر@q0`  0.0P0 0':T0J?o20SS SRO 孌0S  RZ@T  Z     00 10S@@  0 : 0P00CS000 Ѝ S "0P  BR l  @0S Z0 0$4( 5(5(8(5(5(('5(A-P0`!SP@`n 0KpP0!S P m`SP 0HH<00S0 $00CG('7( 5(A-Php@`T0S P<`"$ O&8(k('O-`@ ؀0SP ĐĠİp0 T T R R 0pfP Ѝ PP P   P Pp@8(5( 5(4(A-p0`!S@jPP_ 0 @'7, P0!S GP _X 0PP?D00S8$ T@G@ЍG('!97( O-@bp00CS01ipW PU>ءTpp0pp00P"{_a  00CS0Hx10 t@p@P0 5 0p0CS0100 S00   X 0000  0 0@ 3_ tvF 0 `00h0 P`0W0$0T P 00 x'8(6(5(k('#+5( 5(7(5(R]O-pLP0 SPEUP ЍE P C0 0X0b U000`P^ # 00C0S.20 & 0 0CS0T200 ]Z( 0 PPE CP 000S S  `V%0 V00P ^w| xt 00C00 0CS0D100 0t]X 0PFjP 0 0ZPF C V(崀VPP0PP00P O^5t plb 00C0m0 P0CS0<00hj00`65(4(5(k('#+5(6(XO-P@`p P`T !. 0PS忉P 0@^S00\P0S \ [ l Y3P @P@+0P00oq&t}'A @-T @0H P 0S( 0C00S 0C0 Ѝ5(ht@q&P0 R  QQP0R/@- 5( G-`PP@ X 0S@ @0S @T@@DT }pP 0S  0 0 PPЍ5(G-@P tp0SW`TPUP 0 @+PP @ 5(X0000D@-] 40aA R    0/'5(40000 0h@-> '5(O-R蒟@ 刀p00 pWp#s) 0`?VJV$ V 000 0S0 =D \ 1@s4\0"S00 @∀ FQuOTRTRTRQ(RTRRTRTRTRO(ROQQXQXQXQXQXQXQXQXQXQXQTR(RTRTRTRQ^V^V-Vk @ 0000@^V-V00@R \ p.1@s@\0"SR 0.V@0 @R R /Fo@P0 R00R  G@PR 000;V 00 X@} T0Sx5('5( @-0@00 005P 000 000 ,R;R 0S  S   0;SRp5(p@- L0PQS@@R0p`VP0C 5(p@-P@P \, (U$% p 00k('#+Q 0Q\SA@-o/`@-0S* 0@ 0S! PRpP OPP @P 0 S</R/    q0 5(f( Q 0@30/@-5(00@- R 0C30b5(A-ppA1S0PR a  R R 8S ` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  JU0圁0CS00 pP5(x'G-PA 0pR0pG0WR``0 0`01S 0100CS0H89 tP00CS0' 0S  dP 0Sp`0 0`0R0 000C00p0  $`p5(G-p0A 0RSXPB0GBpPPp`U,000P 00CS0'0  W  pP 0圑0CS00`PU*Ps`5(G- A`0P00 P 00CS0-0 o& 0FSLp I1S  0p10EP0CES05(O-`PBp0SP UC0S0001XPPPPPE 0Q0CS00LN YP[00`F`0WP/  W P) 0100CS0G'(;P; 0堑0 S-ڐ  S   LPY 00CS00  0堑0CS00  X0Py5(k('#+A-`AqW ڬQ1ECe R10  C0|00PPzY` 00CS00 t 0q0CSQ00 \R `R `5(k('#+O-0D0!105P` Ѝ0S/T SPPP  P%Y X ThP800CS00  ^0Q0CS001Ѓܣܓ! P 0 S*"Rʜ0Upppp00fP 0r0CS00 W1 Q !@o!S/ %S pW U 00 07P 0帱0CS000!000\Q00pPR# QUpp0pp00Pb 0q0CS00ik0p 1 1S 0S11a0Sڐ  S`l  P5 0a0CS00<>10P!pE S:`00  1S `gKqP ʼ10PE pBR   0 Pp|00P 0q0CS00 5(k('#+6(r( Q 0@30/@-G5(`01S @-@0!S @RP /H-P /5(7@-A00 S1 RUWʐ0\00EPBW 00CS00- 000 @P R0 R P Ѝ00!S JP q0 Sڴ 0R0CS00000  \00sP 005('k('#+?A-O0 Q .#p WU ! GYQ]YRZ{d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|d|${d|d|d|d|d|d|d|Hjd|@lmd|d|d|d|d|d|d|qlrd|d|d|d|@lxd|d|d|d|d|d|d|d|d|`hd|h|i,jk@lmnnoopqd|pqlrrs`w$x@lxyd|0zP0 nR pR lR 00 S P0PP1S (PHPFPP0 nR pR lR 00 S1S 0PP0PPPP0 nR pR lR 00 S1S  P0 S00ЍP0PP!R "RP  R4 00@ `P P0 nR* pR# lR$ 00 SvP TP PP0S!S 0S 1Skd YP0PPP^` ,+0100+0 R00@ 9PJ 0!S 5 P0 nR pR lR 00 S&0S ? `pwP0PPQUX )PG@oG`GoobPVWP 0 nR pR lR 00 S101P0PP0SOP0 nR pR lR 00 SX)0S) LL %P0PP0S/P0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sr1S P xP0PP  P  P 0 nR pR lR 00 SMXP0PPYPN 0nQ pQ lQ 00 S - PP8 0  7P,P pP'0Sh `Vk0VhVPPPVPU0 p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SP0 nR pR lR 00 S2S040S402P0PP0S 0 l0C0S30 Sx1SP 2SqWPP00@ 0S0 0c`Pt P0 nR- pR& lR' 00 ST1Se1S0!S ` e 0S1S 8c PL 0S0 1P0PPPr`0 gRG  R: 0 B RS `@p?S0"S;bpR1 rR1 Up020 R 0 S$ 0U0b0 ' `P$00CS00 P00 S2SP00PP2P02 P P 0b200CS00UN !2R00W0#220# 020 nRL pRA lRE PP0 nRE pR> lR? 00 S1S"'5(':q&q&Th 8(k(' +.7(6(5(q&ڻ 4 Pr" 0"0" " P0PPePZp PPU0S- `V0V PPp0 nR pR lR 00 S*1S;23P0PP0SP0 nR pR lR 00 S P0PP QR000P0P0@k `P 00 00 P0 nR, pR% lR& 00 S1S0!S t  0S1Sp bWW 0 P0S0P0PP1S 2SqX<0S 0 l0C0S30 SL P0010CS 0nQ( pQ! lQ" 00 S3 00SKPR` S`@pDR0"SZ`u 0  P0 nR pR lR 00 SN0xS P0PP0SPLP0 nR pR lR 00 S,P lſ2S|$P0PP -P"  t -@-0 0( ЍЍ/' 8(-0^S0]S0]S S]S[S .0A0S>30   \  R]\0G-`ᘁPp0 SS'PG(!RJppU``0``0,0@P.Qt0 ,(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A PPP0  0pS  0G5( 8(5(k('#+5(:{ 5(!p@-0 PJ@p P@01S?0A0S S n@P P0P 00Sh0``0 0XP0A l0X 040Z0aP`0P, (9$5( 8(Q7(7('k('#+O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00P@ 0A0CS0p10H0 P \RI0P 0 S 010S P/ 00P S)  R [ U   ܿ0P[PA n00CS0L00} T0`00 p<P P5(@9(5(5(6(6(x'k('#+A-@`@0@P X0@ p>P" 0 R00R000 1BQP@` @嚾@pP0"S,@gR0005(@9(O-cSp圳圣M@00 0GS T`SXsTP0PP00QPO( $ 00C0-0&SM0 L\  DQ<Y 0C0@p \  0$ 0POl hd00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW B @ \  ˾ P AQ 0 T Tp p pp  娾P p BR   @e0 P0CS0,000  r@9(5(5(k('#+O-M0@ T0P0ߍT40S  0 G0 000(0 pPPd@ p0 S pSx 00 0(00Y1 Y   $ =$PN |  B Rd30    BR  300S 00  M0 (@P#Qb 0bppG XxlY 00 0P\fNL, ($y00CS00 Y(1 Y   Ƚ1P FN, Y1  B  BR p100S 0  !M @ Q 0 00"2 00 (0P1 0 0CS000SUW#00 X00S 0 G L@ L 0S 5(@9(5(k('#+5(eO-- *0AQ0C Mp`01 00C S00`Pt :  P Ѝ5 &P!` 00000`P00CS000  [  r0S00CS0x00` P  P5(5(5(5(@9(5(O-MRB000bsp 0s`Ѝܑ܁0S1  ,0 0 0P@ 0##੟ɐ Y Gt10S 0000000p0CS0D41<  \$ \  00#0L\ 0C000@000000 0C LN 5(q&5(T9(5(6(6(5(A- `P0 0Cs 0p 0l0 d  0C B R0@pT o@T9(5(q&5(G-p@P0 `R0  Pz(S%u0  d  <P [0 ,(żT9(k('#+@-@L0 <('O-GMeM0PS@p$Q403/P GݍЍ0: S8L00W +s P8:+L?0P0: S 0SP0: S 0S 0S 0/S&P700ppFP- ?P #0v# PvO+$0P ]@#P#]zP w/~L/PxLP F0P,I [)H Z& U9..0 0SPT:..0 0GP@D!0Q\ PT1RP  oR00S$ 0ST 0: SP~PO 3  0sJG=00 04K gJG=00J0SP/ Hq4XG< X00CS0!p Pp  pYW vX0 X p00CS0 0 0S PP l0 R;c 00`9(tJoQC c'x'('\\E0\\EX X0p@-@P@@DDT` U H H0Rp@\\EppX 0Xp@-@P@@DDT` U HH Q\p@\EppX X0p@-0P0@44T` U 8 80Rp@\\EppX 0Xp@-0P0@44T` U 88 Q\p@\EppX X0p@-PPP@TTT` U X X0Rp@\\tEppX 0Xp@-PPP@TTT` U XX Q\p@\YEppX0@-t pX0pt0\@ ^0@\\DEX @-0ptX pt \@ ^ \@\.E5S %R R S R SSh -^L^S R 0/0/00009(O-Q-MTv u@ 0 `0 0L0 @@@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$\ T0 !00`V0SE 000L0刐S{ ,0000D0400800$0S00( $0(B?OC$p p<,0S  @?C0000D00H0X$0p p< 0<$ Dp p<$0S00<00@00#p p<,0S  @?C 00 0S 000 # 0p p<|#0p p<0 \ C@QC003/040 0S 喹YT RS0 00 R0!0L0S XP$0x |S(0D 0$ 0(PHH050D5[<1p0tQ@<0 @ Q (8.Z,.X , , 0  0 4 04080080 0Sf QA 0! X X0:Q= 0! d d0: < 0S0  0< R 0  P @P0M@;0S00P0 0P00PPK\0.S}0S 0!w-0P: 0P: ߴ0 ٴ R P0дP000Ѝ9(VUUUev9 QO-@a!80S 60PP" 3bpW  ЍO1<0Sp|倡倱V1@P OH@0KH@IH0SL H50CS\ 00\ $ v00L0S \0.S0S 2@0S40S  ᢽ2 <0Q?o20S X  ፽040 Ѝ9(DG-p㠹?:EP0L0  P0S%00D0H0㈅` PP00  ᒼpZ\5T H0J0P 0 <=P Kh5X0 s0X00 00dt |  ` `R`S Y ( ?R004(0x |0R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z 4 00Ѝ1@GPꀧtDP \Tlp$hبĨا,8H`x4 0L0PP P 0H0PPLP PTPFX0s0X0 0PPLPTPHP<0 00PPLPTPHPX030P0LP0T0PPLP P0\0`P%0`0\P!0d0``0<0080 `000DPh0lP 0DPhPl00004@p嚻l0 h000  L00S   儻t.('QC ;9(9(9($0\ 0S r o9(QC t0L0S/0 000/0@-M0S 0 00!p|UpKЍd0d@ `0R@X0 0B?4 0Ѝ@49(9(9(qYi9(@M9(P `00CS`0p S00 P0S X0X /XSx': S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\@T10S H10S. 00 00,10'p Ϻ@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B?> 0៺T00S 9({9(9(qY]9(9(9(9(9(s9(9(s@- @P@P `PU00S @GT CЍp0t  Q \0 \0@-T (P@$U:(:(p@-P@Tp0 0C0 ,A @G-@0MV,3(30S`V0Ѝ0 0C0| 0XPS !,0S 20Sn 4 "; $p x *00  pL20S 88 (($20S  $ڹ0 : SL( 1"6000 0@001<"$0ƹ10S10S41 100H 10S|10S : S0: S s`w818q 0Rp(1 B?= 0 効'Q ,p{ 4 pvP^4 m00S :(9(9(9({9(qY]9(9(9(9(9(9(9(9(9(s9(9(1O-@0S,0010S 10S40 001q 1000PS ЍO\a0TQ 0P  010`S2p22QPPU& Ѝ  B 1`0 |0  ,R4   V 0S[     9(9(9(9(q&9(q&:(010G-S,0@010S 10S40 000 0000PUG`w2먠pq20PUG l0 0C0 W cp0,S4  `YpP S`9(9(9(9(9(q&0G-P@0T,@0@S 00S40 00@0`0娀S㨐@pVG ,0 0C0 W ,#p0 00 S p0,S4  Ep` 9(9(9(9(q&@- M @ ჳp ЍT P 0@  QQ 80 T P S  '0p@-P0S``5@P <PX Al@P8 %Pᰲp9(tC-CM@{5 萟P`@ @T *F0 pPPCߍw ? @P@w0S ?@˲P?oP@8'@-A O(' 000/:(@-A0 =յ('@- M'0P ! A00P00!0 1Ⴏ w px  Ѝ "$ 0P @000 l0l V pX   DH"$  (0:(;@5KB |tHTsO-@Xe-MQP  pPp A0St  )pCP 0S <P  ᱷt00CS027p1pЍ0S P PPpPX  )8$ Q440l0pI0 ! y0 X ̓00CS0 p YX 0 P 0S  t垶PP X0: S P< (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08P P X0: S;PX 5pP፮C`0S ㈲   P= ԮPr'  R $c\P \0 ¯S , ! 00p A 'l! 0  A {{zܶWp600@0 P @$p lP q@0S X0;X0XP   P Z@0-S PVPtpW  DҵLpY@:(?('x'jB qwtN s@-@ `PUP0P U=omЍpU 30\@a_0  P4@q&@-~MQM0pS  0` 0 ` P?`! p~,P ?8!o1@~܍Ѝ00 `P? ~,@Pʩ? ~,P 0` 0 `g PW ` . Q \00 00PP}? 0( '1q&m0Y00CS0 70 /O-`DLMp T0|$|t00000 0000Sh8V04`0p Q 0SI\#~P+?#00V 0030p Q  #aP0 0 ?l#00V00<30(#JP>#0030002PP>0"0>0 0LЍp(0: S !0 S%l P000`P3)0-V'V|VЩrX2PUT  ? H80M1PP S0 00 0f6qp>0S0 0V00R V 0V 0d1\!00X!00@@D!S9HH<H~<0V 10S0C ^:ˠˠ\:PV0 0~, e~\P0 P ;  0 7\U0Y 00V T0("00#Tq "  #>۱܍4ЍT 聟0S =! !!0#`#.# 0S1p1 00 5H!0>0H!041 0 00,q(10`(00C0  { ᰐ  t00(  ,0$ 4$ 0  b 0000 0# `V#T.# KT v&'@:((f(   \(A( =()  e(q& C-LRLb0HBS0000 Ѝ(( 00 0S  2 r0S |1 0R$ 0S pP (0: S)0{ p10S10S P(P d 00 0S q4hf 1 $00 0S00p0000 S(00(000 P@0S !000S x05P 0+P0p0 4 0X#q&=(@:(,((((4(\(0 `:( v&(` (g f(e(l A-MM8 PW: #,H PK:"+bR$0@S 0@̂0S2e+p.5P| )5Pw 0 t S( -xQ+tO+p2Tr0h0CS``F+C+PA+L?+H=+DK+P45P0@0@,+ 2 ލЍ#+0S  R  sS SS YS~P +yS+0q儁+x*H +P84P 0SD @4P4 ,(1P *0S +@(*CPP ))P0@0@**<(y  q&@:((\( q&q&   v& w     x 5 ((, M C b   2 S  r00@-@Rp]p`v&O-Lq l0S'P6@``TPP&PV,L0 R4T0S *@ET  A0d#0V`@P@UPn*PT0S ha*Tꓢ"D 2/L0P! 咣#, 0:v&u&;( v&;((O-@㤁0報`MFPp @fQ PPPU3PP'*-PT,010S( $*P@!0$0 3/0P% 0 R T  A@8 80 3/P{0Pp00St p) Q < 002/0P " "Ѝ(;(A( v&@;(f@-AMMP/$9@PAލЍp`pP/00P U`0` *L0_"Ἧ/0P0 0$ 00`)A(;(00CS0 0 /O-0c$M00P[ P$Ѝ%P0,03/P000 0ĥ`30S LCL<P<PPP 00 30S[  P U P!P r4 CSR pPt hS zGP78D"l)B0/ShP* A< W | 10S  P0S !S 0!202 03/pP XZ \'h1  0S HQ0S 01;00C Ph0D0 3/P7 0S 0 R 0pU0403/ タC00S ^'P0h0CP0PP((A(,((a(3A(A(h(4(;(((<(0(e(@-<@fP7( (D*;(M@-mp @@7 (j@-@0p6 0(@~p@-MPp@60S  0C06 `p 0: S 6`S NS Ѝp@C-MpPЍa0H03/P0 03/PnpA]pP@ 0AS0 @0a3/PE0 01P)3P/P dP0/S7P) A 00 006@ r6p (0(03/X 㛾\ P(A(A(A('x'<(O-MPЍhe0H03/P0 03/PP,50Sp 5ԾP .6%'40SD]7P 0(03/ N8P 0AS0@0 a3/Ph4C000DP 44 C+P40S  ⛿P 00  ␿P 0R S "`Qd 03p Qt 0pP`P H@SP3` Qd 30/S]P ( A1  00  PP0SU 0S "`Qd 02p Qt 00S "SBP 0 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100"`Qd P x1 ,` T RP (10 R I @ 9/0 S0S 0S 000Y\0C00-4S 0S 0(x(v&(a(<(A(e((A(((e(xe(A((|(,(4(d($v&((G-Q@zP@ЍT  T 0 &H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/HP 00 @0S 0# 00PP@! ᨼiAP0 l0屪\0 0S NPY P((,((A(((4(` <(\(T0@-0S^PP 00H03/P@((O-MMDp0$0j PP0@4@~z=0 C-zᦳ8 o6 ኳv PF@$<P>4S(40R(4p l$hR\00 X0S 0(4} 00H 0KލЍ0q\(!(p(t(0v&g ,v&x(/O-Mp@ W 0DP 0S8 00<000SPP0C080pG0S `0S * 0R 8 00 x x/  P8 *@0 X2@ ?@V"Q**@0 -0嘰 R P` hЍTT m  ` `@P2((B((Rs@-Ѝp@ 0@`P"Q@*< 0$ `P2* 0h0(P0@-@MPPሲ00<00S =  J" Ѝ00(G-zM@`Q M Y #P FP P 00P=! SR J(@ݍ Ѝ᭳PJ)8| = $ HL0RP J(DP 0P!QȄJ)8  G- AP ]000qPU+`00CS0wpU 0 0S U 0   UP 0 SP P0SP 00S 0 S P 4(@(u&x' 0 0 S@-0@0R00000S0@000S `XP PP40P((4(( 0(p@-PP 0Sp `/@Pd Q@P0/S00<0 fR P@@@@p4(h0 RX R  H R/< R/ $R/Q/ _4((((l0A-0S X0XPX`Xp@0T R S+ 0@0(4(k('@G-@c- 0(MS 0SzB1@(Ѝ0 0P50C S> "X" "X"!8"X"X"L"L"p20S X00 00!P 0 000! " PPP  0!$!$! 0!ꓭ  Xa'(4 : SB  S<  S)  S08 0P! 0'TΝS+<  pw,(kq +$y@-=XM"@p:(+0 XЍ307@-s@ PP Q Ѝ00  R Ѝ0@R0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq/@-0CP0%S*0 ,  ^Ό!0W0CBPBb 0%  0ΌC S*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 B^00 C@ T A C@T   \a0C R  0C@-0S0" ^":00NB\Bb 0%  \@ 02W"!N ^*040@-@T@@  (<A-P4q4`Q VA-QQ@@TQ S A:A՚i:TP h0dI?@ 0:S@ 0S00 0@+.X($'w('/ s@- ` P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* & #P00PG- 0S`P ㌓0P  p T@R 00T0\p0S ,=@PpPP ᷕ`(s@-@*PP0p C30@0Ѝp0  R R00`F@P$0  `F 5$00`(@-P ('0 Rr @-/ v&@-00P$(P P P('/O-pᄠ儰 ,> @0 P0p`$4 0Y/   `As O-@-lM/`%봯PnPP p/刯_0 p00 h?h/~pP?L?A0s 8/S XB\    CRX 0F>zP񟗳 6X40X46X4X4X4X4X4H6X4X60686@6X4X4X4X4`6X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X455X4X455X46 6X4X4X4X4X4X4X4X4X405X4X4X4X4 5(55X4X4X4X4l65X4X40(5X45X45X45X4X4X4X4X4X4X4t33X433X44X44 4(404X484t444444444X44><P p,PM>J=0 -R,Q0 000;l= =p, 4h>>>>>>>>>>>DC>> D,D>>>>>>>>>>>>>>>>>>>>>>>>>>>>>=>>>>>>>>>>>>>>>>DBXB>BB>C C>>>4CHCHCXCdC>>>tCCC>CCC>>>>>>==>(>><>>>T>h>x>>>>>>>????? @@>8B2嘃iPgꬃP2P_ x-3 P U2 P PP3P 82 JT2 P E(3" A2 @P <2 P 72 \ 22\P,-20AⰁ夑 00  R[ aR eB Q Pl???????????? !00000 00|[1~PZT1 Z D1 Y 0 Y Xx 0010L0"1Pe X\(!l((`(r&$' v&('4(e(T:((,v&p(t(0v&(,((`!nv&dv&Zv&Pv&Fv&u&'nǸ(((v&0((p,r&c: tQ (f(1(W\(;(((((|($v&X(+.X:(q( GZ('x' 0.(Pu&$'`(r& H4L0#@d–L#t徖|'L$0  0 W Ì1P0 ( 08,W7H1 V 2(1\ HVP00' @P"x12PU1 U 1 T 1 1S1_PS2PR82 R H2 Q X2 Q h2 p x222 22"2+S002p007 .Bbr0e0?o S c00CS0 㣖# R003XR0 B{Sv008300R 0 d0S3# S*SSʤS|0Vy PK000Sm30VK3`F}PLP20000S@4 P0P  /`(l0P/`0p@-0T L@LPP@0@VP' ᜕3`(( O ('\(!A-` @PA?\. \ *\1  Q R+ ![\SPQU  !\@@]^1!Lo \P0/P0SP PS QR S0*S S 0PS 0 P0^ p-W p]WW UU @U (0p@-@0 /SN00N P`(pPQP`Q*LC T0 0300Q*pQc! 1@-M MP Aaq:P/P 0P0Sۍ Ѝ.S@T|`l @ @\(!&"V"x" " """"O-cM M33 "p@3]P`W,0 00S 000 0P{ 00 ;R SY 0 0 @;T* R  DY<5 cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 尉 0@&P\P   H >(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0Shh 0S X 8 0Q00 K( $#>#a#('w#C-`PMM RP s\SP RW P0S #  P0Sƍ\SP R1 PgQ PQ' SQ GQ ᱍ(0 0@pQ sQ00000Q0 R @@@ۍЍ00  P ႍt,@P p kP ; H,0 ii#$#(##A-`P 0StVp@PP P`P80Pp P @ @@ @7$L$(X0A-TPT`Tp@0T  S& 0@(k('y$L1p@- RE jDTA ,PU; P8 \Q Q 0T + 04#$ P  0S/  00P0S/  P00 @0/S000 0DPpR0 ((($$A-0j40@TPp 00S 00S0 00/S @Tt0o᱓PL0D0S sP040 (((x2A-@0PS' 0`.S0.S0S/S 4=fP 0 Q CR S.R  S.R0S/S S 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p \00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0'A-@QpW :P l\<0 㓍 H K06S 0S 3 CRV~~h~L~gSy K CR[ 040r;;P((4 9(4nxS!04(4:(4P`04(4P9(408400C /Q0PP($4S**00($R 44 @ P4 P&"**002S($0 *4($0)40($84 PU  KS 0 040r;;P( @KS(  0f( $ ((- .(---O-j4MS@- S p0cS:p& SR0d0C0 PR/R0R  E?o2R0S%  0CS!L 0\ ` @ 3 30QJ(t S7000-00 s++  10>L  Rp0<x P J<p0@ P J11  = 0upP Jx<#d@Y   EJ{XM  C{} 0 PpP J} 2P MP$PP P  0$p pPt s0cR `2P(..../!(  ///v 9/(=/qC/0@-MM@Ph  =X X 0Ps U+@0  $ $ ,  ݍЍ0$ |(p@-@F PP hp@+J/A-p0-S0S) ^PP% 0NЍ0` S0 BP@P,0U dP``/x's/-@-0@P   1Ѝ@Ѝ/(p@-@ATp@0 R P^P ` ` P`p(-P@-000  x0 t000 h@0S \ ^00L0L <ӄ ,q$ x^ Ѝ@ Ѝ/L((,(((('\(up@-xÖ@PlhPP \P pĖ000S  p/((/ -P7@-000  0@ 000 P0S | /^00l0l h| XTD 8p0 ^ Ѝ0@Ѝ/L((,((('\(u('@-  Z/('@-M9@P" 0/S-XP(XP ᢗp \❗p 0RP 0RP @ލ>/$x 000/ (@-  㱁/('@-`q,M@T xx pAPD*00CS0@ፓ@Da Pp= @Y@DOoB0S@,Ѝ0P: S fP 0S Zz Q \! P000 @ 0x @AT0 @00CS0B0 (/('x'0jB q:0O-PQAMp@-P@T 0Q00S0P0T`00000|||00CS000S p(($(A-ph@h`0P000SP'U`00CS0$00SA((H($(p@-@H`P0S@'T`p QPH(G-0a000P_50@ R'QS \!0 00CS000S _0 딀唠`D pYGi50qT0V00CS00 S 0p((H(=$(&=x&@-0P2 R' 0H(A-pP`V@ n@P*Pp@-XP<@P hDP0P 000@aT8@p(A-ppP000`4@40 040000CS@000SA(($(p@-P`@T PV 0@p@@-PG-P;<0@T2 =_P% P  S@0 Y  SFU00CS00 +S 0 0 0p`@(0=&=x&x&C-3Sc0@  ct30 0" 0  0080 Bk 3p 3 00`G4蒟  0p Ѝ/RAR R7 F%1 B&PH ,|4lPh0=S @ "?R 9R:BPtX`||R' ~R$ ^R  h; @ =R= >R @ <R =R @ |R@ 0&S@ 0=S@y  0+S@'p 0-S@(i )e&c#a@ ^'(B6((E=(=0 @-(=0s@-P0`0V0`0S@ P 0R@P@   ZP@ 0S00S 0ST P000 R  Ѝp((w&=M B6=@-L ^,PD\L؞̞Lp\T @@~, \ 1#P?0 C c0à?00à cΌ SQŒQQP0R0R0P0QPQP !>>,>O-`ps딀 %RP@? &R X(3! /[00  @ PP@ Ѝ(9> p@-8M@ T 0`  P@8Ѝp @P R 0 0 0SP@V P@ 0 F/P@( P@ T(p@-@P0)Sp(O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D t T! uz!P n0 0@@! b0 @PYVP'T  `@P,  @@ (p>G>U>O-M8Pp`6! @20 X@0DS '00S^^* PU@  0 S 0DS00SY Ѝ` pUU (0C-`p  0BS00@SP! @00P TQ@@ Ѝ(G-`d0SP@! p000 0PP@(@-$M@` PC1PL0P  IR NRpp 0PPEP@@0S@ (} Q1$Ѝ(>PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P11Sp0@0PH0P@ 0,O01qw&w&((k@P/- 0/SSS00(@-@PMލ0/S\ ሐp აp 0RP 0RPx p@-`\H0@P 60D0p@t0s00"SP Vpxq(>p@-T` RpH0@Q 8 PP 0pp@(xv&>O-pW,S 0S)P v C000000000CS020S @T  >R :RT|b|/rh2@000/SpGLL/pDPR0S 0/p0CS0p@0@ppW000000pA0P00 {v00/ Qx Q00CS0P10S 00CS00W0@0 pR0S/S0@D00v00W@0 P  R*0000t/S0S  P 00CS0p@S0@pK0S 00CS000@B00@0((($(>>(w&w&x A-p`0@00ڎP 00CS000S @ 00CS0PX00S 1X @06 R0S U$0$pGN%(($(w&(k 2G-p`BM6&0@T"oR@P$ 0SM .S00.S0 00/SSC10  PPB ePpZ% ``VT`OPP@ `` ]. E`(0EfqN@q`0-S0S0@T@@RP.᪎P0: SVP >PЍw&>(f>|2>(>>x >@-5$0Q @ P@(>>p@-L@Q50P000S LTPP 0S{@@L 101MM00CS00 L 0 L0ptvRl('?(;?x&\?G-PRp p@1`0V1 nPp gPp `R\TQ @0Ti \0DQS񟗀 t|@00CS00 {L 0@ 0 @T0S 00CS00 dL 0 0SX00CS00 OL 0 1L 1% 01 0@Q  0BPA0@D@@@ @ @ @ @ @\@x&g?A-@ ` PR 0R 0S SKp0S0 R oL0S  hLU  RLT]Lu xWLu Td@00CS00 K 0 AKx&(h(u x&}9 tx& @-0ST4 (40@-@Q M(@-x0@T   @@@@ @~@00S 4060S Ѝ((w&-$0@- R    p(-@-  0@-p(-@@-00 H@-@  =-@@-  3@-@--@-00 " ЍЍ/@-@ Ѝ@-@-  ЍЍ/ L 0S0< < @-K,S0 / 0s?,(0/8(p@-@PPPP p` `P p` `ps@-|P30P h0 6 N 0X0X`@T PLD0 0 @ M@Ѝp(w&8(B h(s@-P`@0S'!<0`^&k Pg{{'jfk[[}06S 00S\ ቺЍpo @0t0S0T.S N@8(@0    /8(@-@TЍ0Ѝ0CS긻ػػ  000 P 0 4@ 00 0@-M@ PU 0 PPp P+P   0HPPp 0   Ѝ0 )r0 08(|v&Sv&@-@P 0S0S 3P 000  Ѝh(0G-`S q0P00A#h@T0PQS$@&$00CS010S /Ѝ00S P Uۉv\s:  R b)P00CS00S U@0S庉@ UᰉP孉@(($(8(@C-@PsM^P`( UPG+릐) QĿtTxll,U2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU H^0S 2 R$0S20S _E@ P10S PE10S GEo^0St1 R$ R @T$@L10S 0E(10S 'E10S E00S E  @06 $0?o2$0-x0$@T $ fd00S D 4%I0H Ѝw&8(((Ax&G-MPp@*0 Z뤀夐夠`)?PP q9*Vx0$`W U ^0S W _P 0`S)Ѝ(w&w&8(P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 Po*m*S p0@h)PD0(00$\*0 $ 0$/w&w&(8(A-P@쀟0`0p0}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S S8(w&O-$M࡟A^`PV $`Q)pWS0嬱p0p堁00WY 0S, |12HlH H00CS00 G 0= H00CS00 G 0 xG  K ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 )$Ѝw&8((x&@(C-$M@쀟 p( 0 0`@T+ 0S0 PU@ 000P x0 0 SP00U$0 @ R^PU $0($ЍP0(8(w&G-@$Pp0ESoᩒ' 0S$ 1a11[GYGZ/TGUPG00CS00 F 0 FtaU000( |&PE U8q0$0! n#$  &B (CPP00CS000S d@00CS000S U0S0S<0<0o1FDF0GuFUpw&@(x&(A'A6A((8($(:A02p@-M000000 20S 00S 1Q1>1 `FF0@TF1=F⢒PP% t1 1@=0S @T D1哒 A@F4F1F0S 1 $ ލpA 0 000 0?P00CS0 0@ 0 00t0 t=00CS0 0S _Fl]FD0EX00S M@00S G(w&@(x&(AKA (RA8(((\A$(0@-`0000 00o^0SP$M4P @O'000P? pf%0P 000S Ʌ<000 p0CS0(00S S'$Ѝw&((dA$(?C-@0mM0 4@L0?_00?0,@0T@ '0l000`@@`PჀdTd04o@0p 0h@PlT 00/Pl 00(0`0S(&`0$S$ 0H0>60S >0S(0S$00H0( $01C$0`>0S(0S h@DnpT@$xT L07S 7S7 >0S800SD -000d000,0 0 0p,0P =&0S)7S&00S 0 0S`= < ,= , ۅp P 0-4J-<0, R , /0, |$P 00 0<<0S V0 0/`@Fk.P  #@I( 0 ( Q$0S(<@;{/D |hP=U`PkUH0k PUX00CS00 D 0 ;eDBT 00CS00 nD 0@@x`P E00CS00 VD 0@E @PT 00CS00 >D 0@E @P ?PP @07H:0P Gs@PPLP: RT00T0( $0P0S `-V`-V P0E0R9pPP( \ B( $ 1$0 L(0ST0077S 0C8#8S0)SS @708#8S7@P 0 Q A!Q0(0S0,0 0S 8  @  ,00,00D080080080@40P@P8 7L 00Rm0, I=(0ST0077WShG$0'000$0007 '00'0 0(07( $10103/$,74 DT7T' 7L' CP0S I6< 6  D RN 8 0 I $B&00CS0 l60S ℏP 60S&,0巄S6p6$6` h4 I50,0,  0 00 0C0, }"E0$0,0SK0$5 50S OD5,0S pt:4%0<50S =0 @ 0 H?PPEX< 00<0(0 0C0$000D0004< \N00CS0t40S P% 40SN)X0S\N\H4< 3 3 344D7)0093 4 0S '|0R\#CX#0LCh#I00S0ڨM 0 #0C0000NH3< 2 HC 2  (0024 X0S"00CS0 l2 R    0L2H0S#mߍ9H20S 08"SS2 @0< P0L@EH020D0D0S1  D0S2 1$ D0S x1 D0s1 R# 0S1   B  D0S D0S7SD@0 10S .>9@,0S0  ;,0Sh@Q C0,000$L D@T,0S p00tŁ 00 0H)eEqh((8(((w&1(((dA(($(@(x& t4x&(((+.$'x&x& x&uA (p(!( ApB ۄ 0/8(0 /8( 0/D(0/D( 0  /8(P@-@&P<80PP cR   A8( 0S0/8(00@-/0M0@0MP ᑂP 0: Sp  Sd PЍ0|P0 : S" PPh(| 0Ap@-Px@x`M$P)00S "0`n000``0H!`"$Ѝp8((@-P\@$s&0S0S 0C0BS00 0008(//A-PM)@j @(`0p8D@HPL pPP  0APЍqAx&A-@P`ᫀLpWU {K! 00;'7p$(h(O-pWC R``%` P0S:S2QEԐ @0S,W@  @0T/S/00Pd 000S00P R:R0:SPPP&@DOv!S"w&w&l(@@-PM/p =먐PJ  0 @ T7wpD 1   0pWZ0S 0 bT0S 0S 0 SNp @^! h`P T T T D0 @,@T >0DS 0~  l( @-PM@Rq4`1p000 5`%!pWZU x)@@U `?T?U<@ 04AS 00CS00 ? 0* 00CS00 }? 0 ЍU ??U P000J00CS0L00S <??0,h(AB Btx&B(($(B%B)Bp@-P@@Pp 0S%SpP @;p@-P8@Pp 0RPp@L;P0P- 0S RP P\ 0v&t(G-`@嘀0唐0P0p 0S0 S0S00fPP|U00CS0$00SG3p((t(v&$(0G-@0`0Pp Q :RQ :QR``R %Ru =$PPP0T:Sp0<@ 0 /PSu`Ph('HBv&A-`P倀000p 0Sp00Jf@T`|V00CS000SA((t($(0A-PSp R+u`a@T"W p000<w0 @0 0 Fb00CS0H00S `P `@l((($(p@-P$@Pp0@P0L;@-L@000@00 (f00CS000S@g((l($(O-PM/`@ 0P @@@ (XP00š0 0S 0S 000y#   P@ ?P @cP< R R R 0S  0  # R00 m P B0000S - Q p" R[0 RL"00Hp0  pP[ X 2@Z 0=00pЍQ 0S/Q0S[q "P  P x"P R  R ( ~P0 Q<Q 7 0@Df P Q  {P@0000S R p  BR 9D R5 W3 sh(GBv&((l(x&GHBPBw&UB$(O-@ 3M`p%2PP*0S*[ "0 00 `0p0Rz0#| 0Z8 RhB<01 P=PЍbPEUp  `@Q $pLhV  00X!W QPYXV E1 0 0 W0S& 0s1TP P*W 00SY0 [  P 0Sx@XT 0s  P a=TjB(t(x&tB(h(v&p@-P|`0000S S@IH000 00 00000CS0p00Spp@V(($(0@-Ml@ 0P0000P0>00G 00CS000S 7Ѝ0((w&$(@-aP 0SHO-`-|MpP@$P0cS    @4pP` vPP VP@ ' RsYcS" U;ܢ[P VP  R񟗆@$4 0R &PU`D;%U 4; }P& ;;[ 00S A00CS00 Q; 0 0@ T Ѝ;/MPVd!     [ZU!Z;;|PU;U~dU U UUR;0 f@000BBB(kBqB03C&C4Cx&DCh(BJC>QCgC|CCO-$MTBTR M0<@02  `pV. VV:V#  V /V# AQ`  1`F Qh M p+Q R Ta[000000S %?@PzLYP@ @ ,T㘀 ~ [ /R0/Sp$Ѝ YX 0 BR  R  BR    BR  y t w&((w&fF8A-(A0S 0PS0 0aqP0S00 P000$b00CS00S dP 0SRh`hp0P RP000b000CS00S ?((($((s@-0!S1Ѝp*S@SP``00P Q0C RP00C S@o `_@h0S00S=STT00 D0 R 0AD1U0 0S 0Sv&($(A-``pP0@S  R R00PH @(O-Ms@0S0000 0000,`آ<000000000C o<` 00@0000$00CS$0C0S00CS0(20S  P*yP(0Z00(P:y P -a(P 1X0 DC{0@0CS0t10S ]Ѝ0SJP$ 00[. [`+ V , R:@ 0 C\A/@`F 0SX  BR  R  B ~   B `FAQV  R@ @(w&(( w&$(8((F81O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00Q @ @% Y0S" SgP bP@ZP PUQ DoP @@` (|((Hx&ySA-XPX@X`P0p00,`0p0CS00S l((($(@-D@\?0 @ Ѝ(Q@-p@0` 0S*00DP`@P@0`SP Ѝ `P0@P0`S@0S0O- [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xPS@ RB0$x RP  R \$Ѝ$wPX:$P 0U0/Sl 00E pP $0S/00E0S``0` xQP  0/00S V/00D x00SR00Q: 0  R@?0P . B.Q/o" R  0P V 0 Y$(x As $(0  Q0@-0 @QC\0CC/x^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0SL P $$$n]0$000CS0L00S 0S 0P 0((($(p@-@ PTp 0@ @@(G-p @00 ST@D؀0P `V `RxP VP V V@ S`` S =RR QU  c0P @B6G- M⨀0`@GP0 (q000e U00SV-00ED`PIPE@T Ѝ00CS0@( RO-@@0M-S`P S! C RxP?So @Sy 00C ShM0 0Z`E0S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 6p즟ؖPW@A0S 0f0CS00  P6FBЍx6P6l6`0000Q00S 6 pR &V(0 0S 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 !00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 RL 0ppUppWㄣ~0m R  R9 V} WHs 83 BR  BR j ~  BR s `2 BR  BR  ~  BR   g ~ a   0S  QAQAQ   Q61  ( ~ AQUd Ra 4q BR  `VaQ~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00$((F8((22w&(\(v&|(Hx&O-0-$M00 06 0=``dVdp0  P600`G6 @ V 0@P 00@S0(00 70P@   R@@0% T A*% R *R@R Z  JRG| A@ TZ  + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S1 0@80-0  [ 0 + Z R CR 0S00[F00[ 0@S30S 0@0 00J S񟗸0!      `3 BR  BR  ~  BR  ~  K R  BR  ~00  BR ~0 0 ,Rw[B0mT@ 000ST @Z$ЍT TL aQ00CS0)0 儁00I00 : P 0C A 000 1 1 0AO0000T00 :LP 0 00@[@R p R0 Rp Rp B\T   R0SB6(((w&w&C(F8O-0M  P0 4400̴̔0@ 0~Q  d嘤0 p0@Q Q#:Q =Q Q Q     BR  娽P AA  p A P񟗁%L#&&,&L#l#$$X$X 0S@ЍQ Q@Q =R 0p(0  BR  pwp w    BR  u  r u  BR   a ( R  0BQRQ B  X  BR  v p}= v 0S Q AQ~@AQ  RX  ~    ?@@ M  7@P)  ~R&=Q0S! 00   @|(Hx&(w&((x1G-Pf0lAlS 0000X1Xq0P0L1 ` (V0 S000`0`0CS0!0 0@ p  0    0  R 0s00k 0p w&(w&w&((( @-0l@Uw&O-TAT`0$M`F:0PEPE000PCP$Ѝ0000(w&((O-aX P0@ 0p R    000XP X 20 E0P0C0 Ѝ0S LL .008  @D0000D ( w&(w& x&kC|2CO-@ r  DPR0400 ` R}먂 R    00h2TP`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C`F0T000@ D00C0CS0 000000C00000000 w&((w&C-M@Pᬐ`! 00000吀0p0p00CS00 p0@ @6Ѝ00p(w&w&(A-Pp@-A00CS00 b- 0 ` V-00CS00 K- 0 ` V`-00CS00 .- 0`x&q@-C@-C00S/ Rv&T0QH0 0Scq o/P0// (v&0    B / (A-@P堀0p000` R$ 0 `0T    0 0C@ S000SA((v& ($(0A-P` @0p0W0 P 0X S S0 000 00 0h0    0 0$PT T00CS0 00SAv&((w& ($(A-4b4B0 Qcr 0S a,_,r0S@0PP0/dlP2b000r0Sc00CS00  0S 0X0#S NlP  FlP,0  00P0 P   PER SP   BR 00E0CS0000`0L00S ^,80+`Qv& (x& x&Dw&x&@-L@00CS00  [p00CS0@R (@-8P@P 0     00000 0$00v& (A-P@`000# kV |`0Pڟ#p0PS H0  0000CS0 00SA((0v& ($(@-p0a0M0P0k@PlP(0: S$0 0 dkP  -uPuk00 00 hkh #T`kL00CS0,00S Ѝ((#D1D6DSDmD$(A-Qd@P0`00 PHpP<0`00CS000SAm(( (v&$(p@-`P@00P0"P S 0S00 S0X 0000CS0p$00Spp@>$v&(( ($(0/v&p@-@,`,P0SpSTpKv&,(Dp@-P@0Spv&,(p@-@Pp P0Ppخ"0@pv& 0 R/v& @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0l(5rOv&A-R0S20SPA`R p W"^jppbPpW*1 N jp "+"LP j 0P &&&{j qP jpS  Lp,S _j P jpS  zLpS !00p&m&j&`l((v&/Dw&h:(DD0S/p@-@PP1PDHAI8a 000P0R 0S"0D@305#0s  0C?o2^0SPapWP ;S xP0S *00CS0p\00Spp@  PAoQPl(E5rO((VE=E$(p@-@\P0P00 |Q@00CS0p00Spp@(($(O-@TM` R0 TЍO)ؐY. PPY  x 0 SPs   0S0P0S PP PQ 00SЀ0S@TЍ0S|22 F! R0+  p  !R -  ")p 0`"0 y) p0 sR0 L0 p)00CS0(0p W  )e Z 00CS0(0 00CS0(0 | 00CS0(0Ѐ YZ(000v ) #40  )  )P S#4$R  0 Y0p@ gp  (Jzp0㓉(ЀH4pڻl(v&5rOxEEEEEEE0 @- SS0C 0.^\Q0  @( CP/o" R O-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S D1@@YZT X@a1 r9 002#00S 0S 0p?Sp  )P T"@` I Pr P L `0@00SJ R Q !" R @v&EEl(EEG-$a$0S Qq0l0@S @ 'ĠА0Sʰ00CS00 m' 0 (0 R  0 S !'l(q(5rOEE FEx&A-pAP`'P00Sʄ10P 0S hjPp pPP gP`W@ P(1@@A'PV QPU, 00SJ ~'0 w'`00CS0 &0 S 0 000S0 S 0 0(p(`(F,F(TFl(5rOrFڻx&40@-@T  CP@@dl(E8 P  /Q 0SZ//l(G-pQ0SPS@00SoZaP000M:0@ C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠i @0 ZLN@Ꙃ! P00B R @l((($(w&@-@S`!1pP@! [$Tx1@WV2 h1N0SP U 0S0gfV $1yHpO!qr"o"060S% h"e"b"Vw$t$U 0S P e`eP PPCWT$0   ЍV(((l(w&v&D# #D08 N R S  0S  P w&O-pRBM0P0 p` A0S0S ЍP$$0 000P@00 !T):U 0S0 10S  160S  0UGE RE C100CS0l10S 0S 02   \ P 0Q R0 @|. \ ~  ^Lo \ Q  P 000 QWP@~  ^Lo \ 0(((l((w&x&$( G-pPJ@P DP1N0St `oG@afT @]fLGpfN C㠠`@0S0S 0S0S;`@Y 0 X 000 Ew&v&jDl(A-@P| P PT0Q 0S aslP@ pP@ ZP@Ts|06 R0S@@Q`` 0pG  0 0 SkxF(tw&x&O-@Sc$M5 PT  &P )P pnQ pQT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP pjY  \   0`P 0S00Y 0STP  t'$260Sg0`00\  \ 0?o2? TW P'\0#Q 0 !X R5  p"P0S 0S00 0 RZP S  R 040Tp/o" RP 0 S0C0 V p0SYX X YPPVF,(FF|Fl((w&p@-@cdQ000` R 0S <1Ep L!0S 0 00D1  S ~0 0P0RB o` R\ `` R00 0S00CS0000S Vp((v&CDl(5rO$(D1@-Q80@S c`#qP`0SP00CS00 " 0 $$0BEp w]L.:!P5#pP000T00CS0@00S  Ѝl(EEtEx&v&D(($(@-z 0@0q(@-@ o @qp@-`@00  p 0Qp\ PU"00pl(FO-TbTPLLLr 0@0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS\4]l\]T]l]x]]\!$0PU0 R$ \S0 \00 S0 @ P   0@ P0#P!"00 P  0  @}00 S$0 )0!"0T 0@ 1 }SP0  :0@4 "0 l(FFFv&FFHOFFA-@dcdsdMTZ 0SW0S<_a____T_d__<`d`l``aaa,apa^Lada4a@aXaaa|_t_R 0S  "%#00CS 0S2l" "\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8P dP aP ^P [P X PU @,l(\GQSGGGGG7A'"G&G.G6GRBG% ;GHGtjRGNGVG[GGG^ GGfGBp@-@D`PTpUPU 0S G@jB p@-Pt`t0PP6 R@N0S@2@@0S@D. 0    p0 pl(w&A-0P@`Tp R@ 0N@T P 0S@@aW\0HU 000000V0@ (w&v&@-@ 墉p P 0 Ѝ@I0ЍlGO-Pq 0M00S 1a Ա100ȡ 0000 S  @PЍ0SG 0 RS/Q  C]aP 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S-@5D6 @00CS00  0 ( `0SH0@ l00(((|2(l(}Gw&(Gx&w&A-M`&$E <\ (($((XHx&HhH'nHHHO-hsMf@PS`P>Ls0SC<30@TDUP3X \0  @ @ythX   X 0SB!01 `ЍSVP aV HVP@ 0S8X0S UPP= p 0/S9S| W:00C⒋+pÿS   P 0 ( :V\pzDL 0  @0(NT0 S \[PnTD0Sy#0tS xztg 0  0P]H1((I: Hx&IIH IIDI>I]I(vIk BR00/00S/@0S/ R /0@-@0000C S  RR R1\0*ЍJI000C S0S//QX0 0@-^ @P U@R000/w&p@-`@`P6N0Spv@TpZZZGZ@Z  p@P w&(FbJG-pPR@`Q7 X`r@0S 0 l `V@A00CS00  0aq唁 @ Q  R  I@TPP ,aHqH0 R R 3@TP@00CS00  0 Q KP @1@ST@Q@`Q 8PGB`V0@ w&#J}9 qJ;J"x&&qBJLJJiJSJ[J80 \#P0@-w&qJtJ0S/p@-@PPEPp@ZAYAA-@1S`@D`pPU 0@P00` P\(G-@PPaP000 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0uP 0T0cP0 oP0S TPT40@@T0SG( (qJJw&A-P R B0– 0`0Ճ0S 00S0S006X pWP P6p60S0S60N0F S60N00 BS/o" R 0 0-S0F0 1  QR00SQ 0S!0P   000S  00^0 PA. R   R0 0w&(Jh(PG- @@P0Sp` 0C  0XZO0A0C  R0 0CS0@00S n0S @J(J(($(P0 @-X@000D00S 00CS000S A((($(000C S/ @->P 0  (G-0p PR 0S6Q 0S!0 CB10@?`! ?,p`` `@h0i `` -R \ -Q0S `0@T0:SE 0R@/T/:Y  @`7@T0:S   @`(@? `0 :\00Y00 X @0 CB!08( @ ЍKJJJ x&qP@-HD0P  Q 000CH Ѝ K((!@-$0S Q,0S-\\ -\\ P0 ^:P0S0\HP^0Y@:T($(@K-Kp@-H@HP080Sp0u`0CS0` 800C80w&( 0R @-@T > 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @w& 0S/xQS  00 S/00 00 0S/00/B604 00 0=S0/S 00B60 0 0@-w&Kp@-`R`@PP t00P pd0 Pp0-S0S0 0pV ($00080@p((Lw&O-MRp00 p R pl2l"lb@h  0SXy XR00CS0` 2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B R @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { d Kiv&2w&w&(w&0-@0LM P R00)0 Pl l " UT 00T<0< A 001 0 w&"L:LcL2xLUL@-$M@ 0Q 00SPp@`T*vpPT @T/<PLP @0 P $Ѝ@w&w&0(LLl000S p@-XP@T T D0T@p8040@p 0/w&d(qL(v&T(0@-@d(p@-d@dP\Pp P 00008  P8  p@v&w&{G-DR0@T @ B 0S 0 @0r 8 0 00CS00 `)V*V V v va G ` 0F Sll@llXl V0@000 @\V. |V ;V&P0 @ ;P0 @ E@0L Pp=x&P0@ 6@0o|P0@ -@00@0@.p P  00P000K0  w&v& ($(J:G-pc00@ T T+P,0S)㰀" tPP @Ⱦ o@@`P  0RP @FDA@@T 0  w&03p@-`0$P P e 0R$, (@R   RP8Pj    Q  00000S@p 0 BRp@ U080@ pw&L@-y0 000w&@-@oPp@- @fP P @0 000p` P 0`@`w&O- 㰑`P0  P㜱@APp0 CR00S00 p0@X ',10S @%X U \@P@W W- V- L0@PpGWPV VoP 0000 V p0S 000w&2G-JM05P0@004 00 P400D0$_`P  0S : 4 0  |4 _t$0000 `SH4 ` Z,4$ ($00CS0! 0S$@PU3 0RPPS p00PS Pv &30S l3p@p3ppL000 0S 0 r`PPA P5 \P p'200pc PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 P_@0000 U@ "00CS0K001@@PsE n@m1000S 1 0 A0 SGl!|V@0  0 @00C0,00090 000CS010S *0 0 0 0 02 P B1 0R @z0PEu`0PUZJߍ5z00CS0`R {00w&(w&((v&$(w&(LO-؟د0ϟM0 Q002202280?_@? 00`0"00/20S@0Sʳ@ 2P0PHlL$8(0/Q00S .00CS0.0.Q00S 00C00000P`210S/xPVTP"P_ SPMpMxU0@#SGPDLX`hpx p00@ Sr0pG A0@Sr7pGa0@SQrWpG[Lp0 S00C0t00" P *'P 0p@W00@S p p p p p pq0pG00@Sq0pG`0@? @?o2;R0Sp ( [\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp000 S0 0C0~00ĕ0 0C@0pW'*00C00'60'3?00  R ~ B   ĕ?pAp000 S00C0~00•00C@0W$*00C00'90'6?00  R  B ~  ĕ  B 0'3?00  R ~ B   w$00C00'<0'9?00  R ~ B   ĕA0'6?00 Q~A•W?p00C00'?0'X,UP.>P0 |P000P$@80 ЍP0 ,  0P#0 &P00 0_<P >P &P000p0p0 ((0 @0(0-P   p 00 Hw&v&H9(w& ($(MM7MNMfMMMM((w&'0(B6M3w&MJ:F8D7 {P B@ < }  h p {S D  B p/#P0p*0}P$  @@   ? 0 }PI0 p 0B$  @ Cp0H! , @ BR #@ix! 0 = BR@ Ĥ0N0@Wj%S` :S/ #S0[ 0 p:0C Q @ BR @9W0 0 @ R%  B 0'09E p0ᜲ P H02!R1S p0HS2@p0 pXp{ X0`2  !o,!!j00S }S Go᫲[| p'P023Q w0 00`"0 !`$0 0 @ B "  $0`2  !G-`ԀԠ0@T@@0PU 0@S 0 0   B/o"J`0 0pS 0 Q 0 0 0%w&H9@--P20@-aM0$ 0 D1< 001@001|0000eXPI1| 1@Q  @@00 dn 0S $Q. 4QG Q 80 1,4  0<  ,T0000 0 0 0 0 S00aߍ0 t0 `0 H0 D0 H00SXS,0 0(w&(w&H9w& (qNG- Vp0 00 P" 000P6ꄼԻԻ|ԻԻԻԻ@@ԻԻPԻ0$00p@ YP 0 R 0`     s00S 0 00@# P0, RPS 000@ 00 00 R, R嶽P4 <00300 0000    BR   00l` P 0000 CR Sl0  P P` | ``vs 00008 @0C 0 D007`0 Sp_P \0 R   L000`0S0 R Ӻ00P 0 R000"0  mP 0@S P 000` `@`00P0`K P0 000000S$ T 0S w0@00000S0P0S@0S 000@Ѝ0$00pTw&Nw&w&A-QQ@`` p @00 P 0~X@p 0P R$@@`*R ( W% R"pi0` 4 iP #/`P 08 000C0%04`Ѝ Q  0Sc0 00 00 @ 0w&v&2NQNA- @0P P/ 000`P 000p0@``@@vP 0`0 U000 PPe``0SU &Pw&w&cNp@-PP @0 @JP P 00000Sp 幽ppw&vN P/0S/80 P/0S Q/0x(p@-@ `P600`Pp@-`IP儽 PP  IЍp @PI2/,) &  kJdA 0P/x(RQ%1IIPp@-@ PH P s`HV2 3HpJOA-P@\p`T@Q00C0V PH0@x(p@-T@T`0P0000000CS0p00Spp@Լ((x($(P0p@-P@TpU@`V P|H`x(p @-@0 S000C T DaHP gH,0O@dA0 T @@@x&gfffx(p@-@`0 Sڌ S @HPPT CHpܿ0S 0 S ,HPο0S x((p@-P @00Pp 0  0px(@0@-@ P  Q 0@H0x( 0 P/ R/x(C-@S0SS|h R 00CS0N0 - 3 Qp@-@0T PR R R& 1S#0 ػPpR!Q QT " "D0600S0T0S 00S0\((($(w&0P@-00 R0P  Ԓ ЍPQ(QA-@ 00CS00 xpxP ` F?U U P@U00CS00 `tA-@`xPx@0p000S 00S +p`V@40`00CS000SA(((($(L0P  A?Q Q R:///(@-@bM0pS10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 Ժp0 0S" UEorp$ W`RUQ@D0>T000 0ͺ00 B Pt0N R  DTR 60SЍQ Q2 1 @D@((w&(<PO-P@p 啵P `ᏵP ኵP 0PEpSUpUX@@)` PPq`Ppl44cPPEpU]X (d(t(P 0E0 10ST@ T@P@UT @csP1 R 00ST|y@ TL@P@UT ,0s0@Q0S 00S lX@@T`X ̢嬲pG`Y P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP  +PP PPP1 ` d0S_ 0E T0 S R0T00 @1 R ) U@ ^00CS010S ,P{`PPP@q0S 000)T 700CS0t00S @@T00KB UQRPQx&(c: QQQ ((ks x&QQ$(G-PP@0`嘐 ?pD 0S 00S 0DE0@o000CS00S ǵpW@UG(((($(p@-PD@`02S@20CSpᘸV02p(,0T0SP/0S//(C-p@`1010r!Q0@S10C1 ЍqXPU X2婿LPၸ')뜿P 0S ៿(\($0@P/!!R /(p@-8P\2Sp@xur\Bp(0-OM 01`"R !R X"R   1 1d"1!d2S 4#MPp14 4MP P!0400MP(14  D @T0d?B`0P4 U @T 0S %P00CS0 !!/Aӷ0$0(0,0000D>S 800$ f@B@"N!031(\((((0@- `"dx(p@-@HA'Ps PPp0B/U00pH4p@-T@TP0 0P0 T(0 0000CS0p00Spp@萴((x&$(A-p`@PU @0PPEU` XD̷0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP00000 00CS0h00S /sDP`00000C0 ((($(p@-@P@0SH00Spp@00CS00  x&0x&0x&@-@AP'ЍR-@-  Ѝ Ѝ/-$0@-  ЍЍ/x& -p@-Ml0, @P(0 0`0CS0a0`1@00DЍp@Ѝ/G-@'`cP$ 0S! l0S00CS0>0 " u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 DRH4x&0Rx&@-@@x&@-0rSIRiR0G-@0 p0R(0帀P0=00嗋=`ᓋ`F@V@p@DR000 S=S B`` R`ť` @G踡Pw&(w&0@- 4@ 00C000 0*Ѝ(R0P P PR /0@-@LP^ ^ R0L00/B6A-' 㴀0S RK'p`@PU pWp0 \ 0S 0S   3/P@P00(0SeA-@嵨PĨU p`pp0S'SSP@HAL'PP,  EAQRRRtB A-P0@S`p    3/@P@PX "W p0@=SPU0P0 00CS00  0 00CS00 w 0 T <x&vwO-@0Sp 00ЀP0 `V S0 Jn@PU* ЍY   R Q ʁ a @0aP`0 l(((@ 0R S=R/=R/A-Pp0S=SRpGp'㾯h0h`U!0@a`T 0S  FPU``@((1@-`0@S @ PPV 0 `$ K dJ  `C Ѝ@$@q   R <0 2/0`$ 0R , R  c0a0 00000@!L @UP U0 X00CS0\00S ް ЍY0#L 00P P w&R((($(@-@P= `&P pTpP @pzp0  BR = T  C `\ Ѝ00@0R\0-GM00HP00$0 0  Gߍ(p@-=X@0`P+$@0U<W0 `00$0U p@(RRbFJ-!0$MP00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ^$Ѝ(R(h(w&(p@-@XP`000T 00CS0p,00Spp@ @(($(7@-P@T@ PP0 P00p Ѝ0 yP 0 @Ȣ00000 00P4(SA-Pp` 0  }#0x#@TPUA@ 0@00`( @-;@P 0S   3/P 000A-P@`T PP 0    R   2/P @@@ pP =*@@<(O-p@Q0`rSP W 100S V'>nP pPW`0I?o2V0S Ep`VD10@T0  ЍOf 0P=S@7 P( PW0 00 0  ፯`U 0 X  ЍU0 00 U 00S -W =P0PPPPð(S$S@-` pk@P@ Ѝ0  R@ PR000 00S |0000   f"0  a"@@DT@00S ((|2$(A-`pĀ@TP0U0   A" >"0 R R   0 02/0 &"00 0000(w&w&A-pP`@P 00`PPEPvT` eTp` fTxTp`X @V Y@:S(PP@- S b?SC-pԑ0P000币-S`@TQ o@ 000@0CS`0d10S  Ѝ @P=᳆P 0 @0 0 0  0 00 000000  RP 00 00=S l0T 10=S100C0 PPP(((w&w&$(  (p@-@PTpv@p@-ķPdP@ \庭NP@ xP@ IP@P(P0 P pWqS_S(00@/0 S0@/s@-@ǰ0 0P`ᾰ0S 0"S U1r0p%!*0S`0Xq000 @0C?o2R0SЍpS'S@-M@ 7:P ލ/:P@D0 SQH0PP0@-M@ :P ލ:P@D 0RPH0PP0@-M@ 9P ލ9P0RP 0RPA-@`:P13@ 0SC P9UA 9PPPp9PJ! 0RAf @- 0-RS# 0S00 0($ Ѝ0SX00T0 S00080 ,ݪP$855(6 T050@-P0M!S@0SPЍ0P{ 0SxPUo U U  Po U [9P? J9PPEUR 0@P` O  P  P  P  P  P  P P p0St00@$9T @80(S0)S 00qop@-@`P(P} 0Sz00CSt  $ 4 4 4 4  8doopPP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(Eb0S0!SPpp(S0)S0S pp@-@P厩PPE爩P.U)     4 0op=Pp0\0!S0P p(S0)S0S "pGRTT@-p0%NTx&(0@-0 00 h(x&pT@- @ R1P\0* ЍTO-PM@(U0pE `-R lRF 8R -R| P]D@P 2 000J @P Dpe pGW` PpW `dd`F %RX \PPx8pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\qDp DPp 㞪dl|X1Hᔨ@P C@P0S0Sp@ꇭ  . Y0Q  RP!|0*QPh R5pu`  cTT{5wq'KB 2s EU$U Ukx&M pTUU0@-DMY0   0@@DPU#Z5 @0 ^    6 P xtt, Ph DЍ0=oP "k,(l(D.UHx&KFbJUUFp@-Ȫ00S | 00t 0ol l0l@0   PU L@L0L D0D P p2 Pp ( (((w&<(x(4x&x&x&x& x&p@-㪠0@@qB0 0@0PU@000hd @0PB0S00CS0400S Ap@i@C\(v&t(w&((($(P/p@-@PTp000@p@-@@aPTp0   SC88888,,88$$ @p@ {00  j00@ p<0@ P  /7@-@P4 0 P  S'`l$$$$$$$0 0 000@0 Ѝ0O0 0  0 000  00 2  0 000  <0@-@PM  0  %  0 00P0 0v@Ѝ0@-@`PT@ Ѝ0000p`@PP000/0P/  R /P/ 000/( 0P00/(A-@pP 0` V  V @00CS00  0@ 000CS00  0`(x&A-p@`xT [TP 'T` *TT "T[ RL;H\0DSX(d08@HPl7T /T@Pp+ 000C R&AET@ 0@P 0 \ pR 0  R0 p \@@aC\BW0CAC\70C00C@@ @ @ @ @ @@QV'&V( V@-@qP`P \P@0 cS 0<0 Ѝ0S@00 #10#7Q00A\ @5/MS0-S@5/^S   4@^S@0?S0'(0 0h(oVx&A-pxX@P@ULbP00`E ,`j00@00(V(@-@ R Q@@D80  "P 7VV(l s@-0@T 00` `TPUЍp(V@-p0PU@` Ѝ 0'R"R@@0 @`0 0S D00Щ @x@`(VO-0xd-0d4P ,M1P0@1%P#up3PEAULPE@ꋟ0s  00P@`V0 S 0S\V $SxS@00CS00  0$ P%V0%S@S00CS00  0`0*S>`0.S0@*S4@YL_<e`(_@0xY0WY BYR +%Yw AY* X0I Sx$tttttttt "#x$   tx$tttttx$tttT$tx$ttx$E0IS0Q[  $0'S"S"Z 0S 00吪{[v' t  iTP ) P T" l^\s00v t 0 }q$'VVWV'@|t(x&g?(-W\\0LS""""""" " " " " " " " " " " " " "x"'\ \\ "\ 0 \ M0\? \@-ÕÅe0\fnrtvabXP \ PX  \  ?P\  x 0vs  t 00 -p{ X0,  0u @ Pt  p0 R0 0C0@00  B+ 1H 01ͤ *t v0 t  tǧ0$0$  [ 0t 0wNVBT,Ѝ3 媤嘢0C-M`q 0P` Pp @P 04 p@PC 0p W  ) PuY <YnPP0( 0ES P Hژ 00S00H p^YPH0?S0 -S00H0,Ѝ%T`P($F$V0S:ЍgJS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 0 d @ypԁP0SU ⤼t⢼T   Q  y0녑 P0t y Uⅼt⃼P p"`B`X`e`q`x``_`^_` ȑȡȱ`p8W0aS R  <0R P 00< S P0pS:`(咙Q (務Q @P0S0 BS `a 0h R R* \*a  `0(SD0mm m3mEmdmm(mnannwmmnnO-;$M `*R 0P$S  ߍS r밲@pĠ$ˌp@0 0뉔ᨛሄW YX( 8$ f Pf/j,"R 0Q RR !,"!R !` !`!Q Q @p 0ꨑ!P#.   P," Rx `,a! $a$"#. !$$("(Q* R `j 0S 0P R ` 0 0! 0Ro j+ 00 @'1S jF f/jኜ01T T%Hb (( o2oVEW}}oWEVqZoooo('A-P@`!pP5S$ Pv $0f0Qp P%R 0R00000( ((p8(p@-@, P  P$p@lO 0@- 0S, P(@-P  8(O-@- CMk M:P p00*8TP 8UPP008800S : JrP  .@00t l0S ΗP,X@ (U(0 0 ( P :PHHἂY90 $0  P$0S $02 ᜗P,唙唩$ [ 0S$00  YP$00  RP$00  KP$00$0 @ jP丟$& $ ^\P($0S  S;ƑZ0;s 00 0P$ 1\  h@  Y= 0SX8 0(S(0 (0 0/P  ) %P    P00 $0YP$0S ++RP0 0 T$x  P 00 $0>P$0T0 <  P 00 $0.P$0`0   P 00 $0P$0X0  і P 00 $0P$0\0  P x ἖P 0 0 $0P$0d0 8 ᫖P 5 0 $0P$07  ᚖ P 50 $0P$07  ኖ P @50 $0P$07 r z P 50 $0P$07o bD j P 00 $0P$0x0_ R Z P 00 $0P$0|0O B80 aH0 S0S  _0Y: Yx0 *$ 0TPSH H 2 00S> J0 0S `@pCލ Ѝ30"0 000 0 SD 0-  RQ<0  -0P4\  BB!  0S 0 0SO 0C RSZOZOOZOZOOZOOOOZ  0 0 R0 00S 0 <0  d2000"0$0 00$0 P @$0!S 0$0$ 2 B 0S P 9 0S$ v. 0 S Pl $ 0S$ ޔ 0S[y 0 Sq PP  0S$h ”E (?pkis78eCp0kpp8(ppp@(P(ppppqq-q:q>qIqSq`qkqqqq,(ie'q r0s@-`PU V  P尉@P hMЍp`PD!<0 :S0@ VF e9r<$00S #@-ߙ00lx&p@-@5S4 0PSP p@WPp 0S 5S 1S IMPp5S X `Pp@ LPp (( Pp0M(8(OcredArdArs@-PA1( (000;ge( V 4 5S Px0S t0S 005S  P 0P(5S `ЍpX XkPH`4bP(WEVfdrmdrlx&<_8(gdr@-@P f/6@8( 0 Dlx&(md0P:/ 0#-3@-PX fP 0S S@@ ẙP@Ѝ0@ Ѝ/x'p@-4@4PQ9:p@` ~ @tx&y&y@-Mp@p0l Q d P0cS CS SS 4sS00ۍ0)EyUy@-MX@X0T Q L P 0nS yS0 $̲00ۍ)އo~yy0@-MMd@ PP 00YSP ,宲ۍЍ0NPyyy 0 c('@-@M,0 XP (ۍyV@-$ $0 ЍB('(% @-YMMt@ hp\YލЍ<0< S <f%Pژ10YS<0<0 rdAyz=z*@-0gj z gz z4 'z'&z'z{zgzzz{KoЍ5Tz7@-P0@ 0$S0S +0S7 TQ,BQQ, QO10S 8@0 ᗑ0000 ! Ѝ0C0ASddddedddddeddddddec0A Rt` p^ zg{{' Q{ zg{k Q{ { { @)hzwzP `00CS`0p S00 P0S X0X /Xjx'G-` 0pP09@P "K pG届T@Y @0 @PHՆ뜠pPF 0  Q V ᎊPUP P pXЍzb'O-M M@P`_%u倅倕0S0#!pO P (P88 P(p 0 p3 P  dtT(p  P 0 VP  Z⃷Pd608Hd8tDT( p P 0 VP b 0(0csS, p P 0 VP J 0,0cxsS0 p P 0 VP 2 000@csVP  04aqQ$pS P 0 &VP  04Q`$p< P  VP @ 040ap,QP p% P 0 UP  0P0`pPT P 0 UP u 0T0ۍ Ѝz('tgzz{'{v9 C{zf{{{{{|"|D|l|||||}/}R}p}}}}O-@-M, Mԯ p P T Q30S0`S6P`P8apEbWWnF`0E `F 8ġ렳0A"S0#1` kp P* Ad{PX#0LL" 壈  P0S *3/ PA0 + P-0ȢȂRx%.A .p P" 4SP4`SM64`PH2a0C" 20< S :A0 0"SA x5|%.A p] P1 <x%0 AA0qpA  R x%< \0A A 0Q<0PAx| &P 0 00S pP0`(V R s S 0 00 0`P\C ލ Ѝ}(}tx&tg~g~]~~~:~~~~') - BR0 R X A-P@  R1! 0  0  #X0 X0 tX0 ` N( H , < 0 0 8 $ 4  <  $ $ $~ $z P v T r ۿl 0SQ*\`p`PQ _ UlƿA{}S`h;Zdp}€׀(7Ii- tO-销-YMR S@`paW 8QT ,[Q  ݎ  M0"@Xj 8 ̎,  Ŏ  60H"@ j80   !R2!`  0S 0C RlSiv(wv(w(ww(wv(w(wv(w(w(w(wv00 0 1 0 0| 8QJ `  <0P+8rQ* 80A0ۍ @ 2<0P+8XQ *ЍO0 0 0 0|  l @ \ ЍO!Ѝ蝁`hʁqρ -A-@Pp(D\ @ž`8SAv| 0`3C 0`( "4`#/A-P @"440 "440 \`pp (\(,,004488<$"444$"444<D$"444$"444$"444$"444DPPTTXXQp`pQ(P"440E("440E@`0`V@P ~ {0T0E0T0E T"440E((@-@l40Pm08Ef/aWEVP@-@P TP8#!00@QWEV((80@-@0S C08f/8(0 \ P0//@-LL@LPL`0 @e88ν R 0Yꌂy&('ÂP7@-@ P 0PPP 0p 0 0E(P0 Ѝ0)vdvn0@?o2P0Ss@- `P@ՌP όP0 ɌP0 ÌP00U`庌P080DPD p0 (EEЍpWۂ?)udP0@-M wdPd@ hp H*E 0 400+ +Ѝ0)zd@ނs@- @Hp  E0  0 0`P   0   0  h0  P0  8Ѝp)td@%2Iaq ΃!p@-( PM@`Pݏ p  ( яV V h PЍp (PIH( p 0D0 )}d(@OG~d(asP0@-M @  /IP@ uD4P4 p0 pDЍ0聄){dЀC-P!a威0,M@p00 p0Shh@@@ p  @FDeP qP pP $0Q `0S*@P $D@`QUW hU0 I R00t` 0S,Ѝ00* *  P@+.$')|d,{qCU O-P-MM )@HP40Ss40}=$0(,0$  p P/4@,`D8V (0, 0(000SڍЍ!# С!@N!(@`F P Bp C@PdR8ppV @0: S \"\\;040}=$0$0(@,@0@0 p ,4p`V1(000(S0P:*  0P3@@Vp  M눁刑刡T !  Bh`!R0$@((pP9C(G `F@ @p  0Q` 4; $O 0qp#`p , P`  x )wdEYxd }_('˅D'/SPA-M & @GPH  GP( B9  j00S `P+0"S U1r0%*V  00S p0 "RspBPdPd `尀pp0 <B0ЍV~Ȇ)yd.C-p PM` QlB ԉP 03/ЍC.@@ R;  =5p RBy&H)t 0 @-GB)P7@- P@T堉P HᛉP804 gp Ѝ0oއ)wdP7@- `4P@, Qp  Ѝ0)d@\@-S(0   J('O-,M0@Q0P`p0000 0$0X,Ѝ FP pA$ KP   p $0 S T㸐帠P@$0S"  0 00SW   40 S 0 @0D> iB <p@-@PP1P' 0P, 8>0P   yA0P 0P 0Pp@Cp@ 0x`:@dZp@!U@@ݧTPptcidyararbmngnts UktP0 P-  #B%B$14!8<!)p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @!) 0"!#/P/@!)A-PT0p(,`2@.,0T@@DA?@?@@!)@-?0<@< (20,20㷆P0  P*0 002!)> 0R//G-0`p(,BP ᗆ E@PP{W ,20CS(20CS Gl0!)% p@-M@`42S%^ [ E@ 82<"T 0 (2,"MЍp@HFѦ<"82El@9`Ħ,"(2H0.X"\4Ѝp@(!)y&)2[%9s@-P`ᇌ  0SЍp00S@v0"S1Ds@-,MJ$0$ 0 0 0=q('ɑA-`0~ @Tʴ?Ϡ<,pP 0d  ? qp  RЍA{L`x0S`@D@,' Ѝy&\r!)@-`  ppP0p@l Ѝ!$LR@ @dQRQ$ A@z>U!)p@-P0@0SA( ᙊB01p!)O--B`-s@-@zS00CS0 P` Pp ptA>0 P00CS0{0 Y@oЍp@Ѝ/x'jG-Q p>@`/|2# d0? 0K 0qpЍ  RЍGx 0` 0R 0qp `D,X }0S y&!)p@-P@2S t`0n/(2@1!41#41U @0&"UU  p@@PC @@Tp!)*)>#)G-@r,y`P =` VP`Y0TLE J$_,ൈ0U !VU ! [EPsO@s X2I $! (! "4! 1"8",1!#$sO(@, "!"",!00 0     y 0  0 0 04 8 < 0@e000!)zA-@PXPAds 2F⌈ t B B$_00C0!)O-P0p0Q`@06 0 4 Q %C?C0V$ 021S 02/ .0 1  Q  32 $4 (5 , T02SlN Y) Q'PL 20 0SR00P[# S 0 2S Y 3DP<Y 2@@P00`A0S Y0S S01S 2SL+PD Ѝ`b/. $0(1,SR[#ZY  0S^   BN R@1SO148<$T^00C0@@PA`d!R 00P !$(,     Q "R. Y 00a14a8a<0#d1a#h#O-Q0P4p ЍQP@ ] "R 0S /!)O-M@D Hb\ QʤߍOqtADxH| \P}0@0P<5< 00 2! P 0 0%p@0) 4v0 ? 4"RNX2 PDTS-P K) 2Q Q54 32S !1?  <!0 #!1? < !0 # 1tS"0@R>ʇߍ@ hQS/2SrW#, `p 0 ಟ00 w 0p`#W0 002Rp`"_ p qp <T"QP20H"L뺆 0(D1 RS Q0S!Q10!/ ,p12S  ?01DP& |!Qp10l4!?h02S02S 0 0S>0)S $Z0)S  "Q  R Q !^P900 0Vi0@   0S<(!)x7qy&Ηݗ&TvZxt|U1٘hHO@-M4rW@Pp@YЍP(0P@`  B1 @PP$SDЍ@8 1 48< ČȌ P!r1 m11< 0d1 _1 ?0Y11< 0`P1 PK1 ?0<Ѝ@C!)تq~™ՙ ,O-p-蒓Y`:X& "!R &/ .0 1  Y 32 $4(5, Y \   Q R ` H2,0L2000&0S- 1S* &, W000P0  00SW0!14!8!<!14!8!<W0,p0,0`\T (`0 S( 21S$ / .0040 81 <W , S  PW 32 $4(5, W0\,0000P`$p 00$00 0P~S 0S00$00 0P P HWT $0P0  0S pD 0S 0s X2 0 RS $0 @DkoO@((0 F 4 0 8 0%4 0%80 %< 00p P0 @2S` RU 0`%PX 0 1<Ap 0PP,2 0C0P0PO`x(2? 00PPpTpp0`Fa ?`1<A 0?``PP,2 0C0P0P`(20? 0PP`Fa?`?`` 0S\ 2S@X @TVJ041S!)ت=^qh#)67 t}@!)Ԛ#C-pHBM42gS4僜0r0bP42S 0P7U42S 0S j؁ؑP 42RSgP:[42S^1!$1(1,ЍC0S dStpdt 04rW2S 0``p 0LP"R S0SЍC@D> 0ЍCSPq 0Ѝ!)1m@!)Bf@-0@M0@ pp`Phpgߍ\ ᷀0  0P \ `t02S 0S " ` PD+!SR X0P$z>+!)4@-0Xa0 0LAP d2S8 I P(!$!p! 2SP0U  $tp" Rp\EU$p0 00P d2SP  P@ Ѝ0P0!!1 y&!)mdr@!)o*)A-@T2 @P|P |P |P@ `p@T 00S p`V@{PD00S @@{@P)>ۂJ)y&A-Pp`"@""000 0@@@@-`@PT sps ", 0@W@ Ѝ"@LO-MM0t4 P@ T\D {P @ <{P44 00(04QT(0 ,0"4@# 0W0@,0S @@((,0@`00P0s唃0C@0P@P0 !0P1P83l0 (3Q,# (  s4T0>  p@: PE ,0S ,<(00S<(00@1 $^P'0FSʆ`J"P0S -S@= sUP00@ @P,0S ,][܍ЍA0 RP z8800  x0 R00S' ,10PAPQPa40C 00VC20S0S0S0S C d0S C ZCUCP$0# t PS<(0  PJ)qP8 , އ c: L!y&QC \Q 0/K)0/K)0/K),@-@-  Tg [G('G-P`p^@0S  0S X U +`Y 0S 0S  ЍK)u-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @Pݍ Ѝp!r,ddPp=0D@@rOP,0: S0RP00 0&PPfP81: S`P% S  R  r"&PPt-PPPU rPP @PK)As ϳK)t޳&@-<P 004 0,U$Ѝ  UCO)R0@-4S 3/ ?K)@-_~00 @ 0 $}S~@ԱK)@-M~@Yb}}C~@@-p PL`@@0 7/0P S Ѝ !0_S0S# 0S,aQe00CS0"@ T 00CS0! P @YT Y@DOoB 0Q   @OoB` 0 @0  0 0 SNT8P)'x''oއ@-0M 03sc000@Sdq0 S(PP R PP u 00Uy `Ѝ0S 0S @  0S\0S\ 0/2@ \0Sp0 "@u 0@kp 0S0S啕 @\0S劕 # @"  @0Shx @D @P@ @0 @ `0x P|"%   T    P  @@``L 0@` lsG H D8P)DP) /&P2 (1 0(11  J   0 0B0 @0 Paߍ0@ S100S  S:I@(1  0I@0;+ q P(10(10@0 00 0Sb 0@ K <0(0/os" R$ 00 ,` 0q0(0 0$00 0<0P `S<0! 0C<0< 0㓲" P 0P  P P :P R: U 0`$00`P0 4g | U?0$00`P](<\Q U`V  $   P`$ PK/Tq `0p!Pg0hQ P P0S*0`Q`  01 U$0 0 `H0h H0 P  0 0 P @`  Q .0 A  L L G?L @0CLS \Q*V 0 $L0t!s0<80t1 0V4 8  b5S5夢05ET0  gjP05 ET dT 5d 05 !daP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0f JQP d nd0P Eh0K/0h0 m0D! CF,qr0d 01(  n j  m  m,10,1#40L0sK?000/1001001#40>000310 00 000T0 Cf(%,5QP Hd d0P{ uHP)xU)v9 @-@ P 0 5HP)0/xU)0/xU)0/xU),@-@-  V 㗾('G-P`pn@0S ! 0S X 9U g` Y 0S 0S On LЍxU)u-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @Pݍ Ѝp!rhddPp=0D@@rOP,0: S0RP00 0JPPP81: S`P% S  R  r^PPtPPPU r PP @PxU)As ϳU)t޳&@-+P 004 0,D$Ѝ  DCY)R0@-4S 3/ {xU)@-m00 @ 0 $"mm@xxU)@-m@Qmmm@O-MMP@`pP(P0 P: S3/nP 0rS bm00P 0#0@0@D@ U  GhP  P PU ?m00@23MP@ S @X帰张P60: S)^0 "MDPP@TP X+ S R"nP-P _U T`@\ SDP@`-<P @U?PXp!t0#PU000 0C @P Pl0S"W D\PPxl0 |PPwPP V80% ܍Ѝ FF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440+( $0 $(ak XX]kddhhllppttp p@-"440 P"440@ DD@@HHL`LPPTTX~X\{ \` kp` pk p@kp@-`"Q@Upf@p@-@PpA-P@M4Q->C->?n}C@X=X\:\79>z9>:>Cu:>CFq 0? AC>hC>mGcF`E~EnF[GX 0X J~ pXW}m  $$((,S>,3S>G/F,HHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W @wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P 1 RP1H X0  P=!`3 H0S$00S U K!0S |0S G 1@ЍG_Xs-P L0 ЍU`Z)XZ)lZ)Z)y&ىZ) 0`( "4`#/p@-@HP08v200@ 00 b/00 @j`pdZ)00S 4 /Z) 00S/Z) 00S/QZ)P000R0S /O-@("`0 SMPf0SD S0_졟ď080T C/ S ! R 0C00 0@ἰ? 0Z\5h!Sp 0 0Ϯ00 ?@U '  ϬR 7 R  0 \5S0 00/70/0 0 Ѝ P L R  H00 0000Z)dZ)\Z)T":ZsPO-0P@:1 R0* 0딑唡0 `P3Qx 0 U0B: 0$P:0Ï|!1\%pR 0 0/.p 0P`0 C c00p0S   0 J.0x`0 Oƃ1!0x 0O000(00SZ)Z)dZ)T])\)O-tCM0 RS !R0*< 0D`X 0:3 p 0  O:0ï\!2\%PR 0 0/. Px 0O`0 C c00d0 PS CQ c$ :RO, Q,040(p0p`ßp08`,10SC 180Y@`0!X (e! R<`?0 XXK&o[H PEp1 Q R>KI/V08:‰ V/ PlYFp8 0,80<00<0S<00<0ЍFv`FFFrFo V  h R0K Q  QZ)dZ)T\)\)\)Z)\)\) 1G- 0pP `N0  0^0@ 0S 0 0 80PS `P` 8UH0ZP000PSY`4cZQ$,$ (,`(PP8)dZ)Z)\)@-@8P 080Z)G-`P0pS100 B?X P@P 0@8,@Pt1 ?lN`10pA G 0  000 Z`0 0 p0 `1 `#(p"(,V Zp`0PQ(dl0S\1@@ 0XP\   0^P0d000 A\)dZ)\)\)\)\)\)'P0p@-P @?N800P( 0!SRp\)\)Fp@-X`0SpL0LP@1D@A0S000p\)\)\) 0 0 /])O-H0MS MP` 003/ ލ Ѝ40 pP죟00 ,0H000 t /0 @ S 0V 0M0X0x3!0S' h3QgQk  0   0励0 0Z0 02+ 2R720t0S2ڤ2 Q o   Zh"$)5$+<2PD" R{!  { ! t R1W+졟W000d1 Q5 10000S1H Q B/o" RK h!B0   ,BLD>)P: ! RP, P w 10S0Q 10S 03/     0P  0p`V0+dZ)\)\)\)Ln]Z)~Z)0O-S㰄0`P0 V0RM#@M(, : SL \p(5R,<R  P  RSV !0 ,"\|0 sB?PgL0`0  0S0 00 000Z_ 85x @5D0LT 032 b< RP1QZH 0j 0q0SY "00  G1+Gf(P0S00Q )v2 <P U`P80 00S0` 0ƯPPQG 0 0H  0 !40t ?:#b 0PU p0Y0Nh0SK  [gV _08001(P Y 03/ RލЍb0 1TP+U0H 00R00S 00  G*Gq'PK0S@ PXXvT0 P\)dZ)Z)Z)~Z)@@-@u!SP80< S0 80<  D  [p@-@@PU DVP RP 0 R0:ppZ)@0@-P@80\U< S0 80< 00p@- P0@`U0p81 R0p8P@Q00S 0SpP0Sp;600S rt.0S 0T%0S(Sp@,Z)\) [)<- XZ)u@-@M`p{WP 1!  P p`V( u 00S0H0S 0 0 P0L (-00Stt, CZu)00Ѝ@L&P0S 00`Ѝى XZ)xZ)\)[)\) Z)0@-MP `"@? hK)Q Q0 $0ASЍ000d5O-,Mp0 /@PD` T00: SR) 0Ḱ0 8J倡 R09:` V `3 V `!P@P(0S @P(0`S @P0!0A00 0S:R 040  `(`!\Ő\  ? 崣 ? (0嘳 Y0S30m Sm p3 R #R XH3 R ,(03  R0\ 0㵯 I0 " 00C 0L40S$40 0C$0娂*/2)|20S S 0: S ( S,  Sg000 00r@( %2Zp N *v0M0`S 1 00|10800 0ˏ I0X0 Q0T @ 0`; C >!000O00S 0C&  ,Ѝ*!P( 0ˏ d t 0 T @ 0`; 뫴 h\)Z)dZ)Z)5T8])\)Z)U _Z)Z)\)xZ)\)O-lM2@ 0p`HP!\P  ? 堒 ? &0 tXt2t0S0 S 0X"S 3S D@X X(20p`Y2QpQ\tQ`Xd   X 1 R, 5Xe'00X0S 0 0 `0\ *L!00ST06 0 !S0\ 0㵿 \H0 " 00 04$0L4R0@ 0$*0.0G(0S WP8 P& PlЍSq tldZ)\)T8])\)Z)U \)[)\)xZ)Z)Z)O-`2|2PU@PpU00 Z0 0 Ѝb0 Ϡ˿S 4G g@ WVLQVg TU A0 ;&00100 @0 R @T` T0pIT Q 0@`L @Q 0 `  T 0E0 0@닁 0 &P 0 Q0 Q`0@S 0 000l000 %[P00U0 dZ)\)O-P0-p,MWtWhfp`0 00`?00S \A3@30000PT Jb ? @00:XR @TT00T S @@S  T 0  0 01 0PV pP 2 000`?0p20SA 뉑  0 DQ04 9QY@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0YlhA W *%p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 OP  ,Ѝ\)dZ)@-V O('s@-@P `0S 0S 0  ЍpO-M|E M`P0S 0S P pP P 0SPލ Ѝ000S  P i0S 0S 0S M0Sx 0Sx 0Sdw0SP(0S 0S0 08Sd s/2#' 00 " " 0D@!1!? 0 0P 0Pd!! 0O0 pPd0SS "04 0 R0  0"? 0 ,¯ R( 圠*,4ï0AE80/R%'<0P 8` V Y0" |0S lhbPUt ]@0S HDb@PUn R,0SP@PPDPSH0S  `Cn* ly+xlB%|0S llR0p00S00Y%P 0,0UA:,000S 0S PL1 H0S 0S,0S P  i(P   000(PP 0SP (P #PP PXZ)7Z~>t`b)/As P8 OO-@H0pS`M W0R0: 0P 0 H"p`/<"0 S0 v20SW ^oЍ 챟쑟P  BR 0S#/  !.V  R.. P x!`T  R0  D lP  @@" 8 < P`8 <P0v P0  b$ RP `  ^ V UV U 1])AXZ)[\)Z)4pZ)Z)ghZ)00S 4 /Z)00S0`( "4`#/Z) 00S/RZ)O-M,Mp `@"Z:$ 0 0S`CZ ` pP# 0`VP!0 00؍,Ѝ0 (zP  Xt0`VPh0S t  0uh P  N0SHH, DS4; ([(+Z054%00! ?0S S00:00/0S 0 S00 :0V0 0#03 R00S :0S; 0  6t: 0S R` P 0[@4< S0 4`?0: :R00a0 B?2CQP%90S 0  e  0 0` 0YP0  90S00, R3P$0  ZP00 0 S_8Q<90S8 0 V0;R02*h0S/ 8((d0 #0 (P el80S (00 0(00x 0`  ~ (@()70S 0h0!7'(5S[/V V:'<V  3 #P  RJSQ< !0E D U0$000(p i0 U87PP0X 0ZP] D'000s0@P*P6@P"h0S0P%Q_!1Q 0PQ^100 U0 EPP P00t ?@1#R 10S0@P0  l Z$0S 10000S p50S $0S 00 P0 Lt ?YLw$Q  40S $0S  1 Qa 04 0 S 00 0 0000 0=$000 0 #600S040S T4P P g@pt3QpQSLtQPXd00H00S1 0S p30S* \P00 4 0C(P2 2 0Q\00&& :000@{0S828040/<0a0#QP8` QP`U`00S 00p@3P0p<`$\5SQ%Ϡ<# TD ?=0 O(40S 40E SE 4`V0x@@0`S y0,  dK0 0030SC 30S? 0 S( 3 S? T!. 0 / s\@T` 0 Ń># 0S 0 S\00T0  @T`0VT? @`1020兑A0^ 1QS  0`a B0P0@ W N000 Y 0?* 0  000VT pW  `@ @p \WV00!03SR @1:0R@4a p0 F 00  P C0 TS YQ! 00 H 0`P Q00* B  qN`\)dZ)T\)LnZ)xZ)\)8])\)Z)\)\)h('XZ)lZ)U Z)])O-`pܐܰ 0M @ 0 0  BRЍ P PU QP X` {{@ pQ RP Q @p])Z)4 0`( "4`#/O-lMX  N0X0X10T1p LL1LP` 0,0SlЍ0S 0,@ dI0 @x00ట@ 0D R`pT0#:#P 0 ARpQ R\tQ `; R  @P|hZ)dZ)])\)('Z)\) 0000@/00S 4 /Z)00S0`( "4`#/Z) 00S/Z):O-M`@@VMP`90S 0P )S0*`00#0.吉Y IpP 0 WP X)T ,PL9p`0S 0S ) P00 8 #R0p0,S000008 00!"441#0"q    0P@ fbf}00C0U L100 0Sz 1I 0PtM0$S 0S '00`PX7}`{60,S00,000R7 00!"44'1p0pp00ppP*0S  zPe 0 1r#`]xnPY `@  _# X#80< 0 80< @00C0 şr0 00 R.*0S  2P  0" RVލЍ0S 80< 080P5 0< S <g0 00$001  #` P 0S 80< 0804 0< S g0 00`S $`!  B("(p " ᴁ"P 80< 0 80< 00C0@'80P<.\SP# .P #P*PP3P`080< =D3 Q035;:,pW P0Sp\\(?0AS񟗮hllS3 0020S04000yP |2 H#R02 00eP026 0 03#R0mQ" 0S0S@0 xGPp  : S000 !0 #R0 Q  x 0 FQF?\!\  ,10 S$ Df#R0 š!ʡ0S  0R 10 0 %00lPd0`00C0WPpo ) \)\)Z)\)x Z)Z)J9jX\Z)FUevXZ)lZ)yO-MMY0AS񟗀꜓,<Г,h; dPX7 @. <P j$7 00>@0  6P 60S 60̆V6 'X  J0h06`$00嘦嘶100V3:6 Rpttt0S.`@aViPVohݍЍ( >P:P   u 0S i @ FL10:0 @00@(0S Shhu`%spE(P* 4 0  B, ! _50SW 00(000_/0y 0S mep(0GE0S(F GQp(Ac,xId4p0(S9@0W78Q,0 S1 #0 R( S000000!W"!#-W l'px3  (  _/.   ,0 S1 #0 R S)R ) *V { { x 0 S( R , I"2 pR)@ W(,`0@'a V!W#W lp Fa V @0 (0S $ 0 s00Q P0S"0`10S x10!1!00C0!% P0 00000C0!" Up0S@0 0 0C0 00@Z)9g\)\)\)8\)XZ)\)Pi('\)\)lZ)BZ)\Z) 0`( "4`#/O-Mܒ܂Pآ1EPQ@Tߍ0S `@EDAF@D dX90 |`t800@   B 0    S,"[ "[ "[S[ P0:000S1 a 1 R R@0 S 00"P X100CD<(P X HH X ! ! Rph0QbT0 e R\tQ ]` h00!P\ t00f 000\)\)\)('XZ)`Z)lZ)\)Z)8tS\)Z)_HTO-`0p(4弰 @$M? B$P\P  ? Գ ? 0 H30S30W SW 0 S 3 S x;@ 002 P00 00CSFTY! P 80R0L003030 000?B` a Q2!,S Q0B*c2+|20S P9 PHB P$ЍS U Px?00 1>!W 00S>>0Q#c ! RR 3 T0 0 S`0?000 ?(BS  R.. 0" !00S0H0S 0 04040c/0 P0L 50 8 QT $  $ $ $  L30  ^\ {0{< 0哸Pp0dZ)\)T8])\)Z)U Z)Z)\)hZ)Z)00S0`( "4`#/Z)O-lMX ℒF`|20xB0,0SlЍ`R0S 0,p dyB0 ,p$C000pP1@ 0 0D R`T07:!AXpX\tX`Xd  X  @RHD̥X %P 10S  0?@PhP 00S  0M0S  RQ {{00|  0X! 0T  L  <0PZ)dZ)\)('Z)\)\Z)$08O--oMM@P00 F0t2l?0SX0S $5SH0SY<PZX0S $XnS X Rg>`0V\2 PT20! X" \" BE1\"T000B`X$dPp0A^000h21`l2\B1d2>2d2V0C:=SLq QT20B   0S 0@$5H> *k$>3>0S B0 0pS0  B$511  !`0P00B1- 00 S $|䌟0S$ 봀 -⎀Ḁ$1BP`R!B@ L PP p bl 8PN 08S <P| *堀<t<0S 0 0/X0bA?:T<5A?T0 =80T0.H0 E; 0VHQ RX0`0@ <0D8 84<ϡP b0{ S Q,0 Sa?^< >P< ,;0S < A>+<B<  C᛻P: <@ E000:J*:L|:0S [0 0؍ߍ08008``!.Q  R  `0" i0S ,p@d6@ 0@ PpH 008y+\0#Q  0 ` ?옟 D0thS 90y Sy 80S 0)S 3S  0S 0 0 80S 8 0SD(0 08( 0Y (8H8o;\Ş&"\ ` 0 0Ϣd h  pBnj `b"36'+?D "@ D @ 08L<PLRPP07L `V=S؈<0D 2L0VpC p,00C S=Syu4{S +\0#Q  0分h ?xY d 6J0S <jP#50h k(60S 0%\Q\u5P50 S555;o\Ş&"\ ` 0 0Ϣd h  pBnj `b"36~4@? 2!ST2,0?! !2!S<pPu<XrpPXd>먐 >0  0 > >000$5S `0l63  03080D ` D @ /@ KdZ)\)[)XZ)\]\)Z)sV\)\)\) ('T\)3Z)Z)\)`])S}])8 \)\Z)Z)dZ)Z)Z)\)Z)lZ)t8])5U UR$2l $"2, S`2<,0?Q0^0/0\$5Sl2,h`0ppWS $%S0! !$rx | x h |l  h p lt p ` L3td  b` d @0 P3 !@0 R "00 0000 0 mP1  _b2*Y$2!020S 00 0X20S _H  P2t"ST<"0STT8 P P2 H !0"bST2"TST<8 0 0@30S2D#S<\<0d#S\*P TP 0#S\2#S\<<*cm0 0 p0S $S00pW`D$S\2<,0?d$0S\00000ᆡp `T 2R`㵟X 0V $S`0?0$2S`2<,0?00ᆡp`Y7 0$%S\0000S7囡!%\pWp`㵏X7 0%S\0 000S7囡! pWO-PLL`@T([p V W @G-A0 5 qP0#R%%r`!00 0SP 120a*|a%t1h10S 0 0U/03Q0S6 [A 5*< 5000S 0 0@TPkUGfPt0Up Pd0 0S L P<0 0S dZ)XZ)@z&Z)Z)Z)+Z)I0/])0/])0/]),@-@-  ) ('G-P`pA@0S 噶 0S X吶 ᱷU ߲`其Y 0S =0S @ tĴЍ])u-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  㓴C-M Mq@` @PPݍ Ѝp!rddPp=0D@@rO7P,0: S0RP00 0PPP81: S`P% S  R  rPPt=PPPU r]PP @P])As ϳ])t޳&@-WP 004 0,[$Ѝ  RCa)R0@-4S 3/ ])@-@00 @9 0 $?@@])@-@@ $???@P/00@-@0S z @ XZ)up1Q0@?o2P  R9 -P0 P0S 00SS0 000 000x PP  P R0 T XL PQLL 0 0/TTT8 Z)Z)\)\)\)T 8t0 p000 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/\)Z)T8 T 8Z)0p@-000 0 00@P22=000=000X0X0<0<0@0@0p \0\0H3H3L3L3P3P3T3T3u/ h p@G0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p H3H3L3L3P3P3T3T3u/ EEP  4444K4K4h v 5 5d0d00000-P5BP5H5H5=Ch H5H5S>S>p@0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//\)4O-P@-TM t圴圔pqx-[?ldp:0  0@ @P @Ѝ`\VP0S/ 40S40S  ?7:0 0 P`\/P3#0S #S5| P p0S d,0CS Ds*~0S 0\%R#\\5 0C"?o20K`h0 0 S`2 0 ᑣ#0d 4:- 2  ? Y7:010S?,A!Ϡ\<# P  0b  ? 0SQ0S 0ġh 0S 0x\%R\P l10S%`yXQ5 L!0 0@! 0 * 0S p 0 0 00@@ hW`h0̰00J00V* 0R A DzZ)@\)Z)\)\)XZ)[)Z)Z)$dZ)8 T\)\);`])])\Z)UZ)Z)Z)\)9O-@*@M0M08x`P < 劲ލЍ80S =:P<Ϯ pt 0: S X gP@888X04HSP )000S U008 78    8@ 8p [WppTp\7PpWL 7P 7@T P +H8P 00 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p,gp2S )67P )17P ).T4PZM-`Y 4[ 0S0:<관X V.+0 ;  60 ,P %Q$ f Q춝C ?5yPu` 2S<404040$4jX02P#W20AT2@02 :6r0G56 /6 0 lT5H ? 0pl3& 8 S20#"20#202P` 2S d#0\P@Q=S00 5P@ ) 2RT0 S @x0S IC 5*< 53 30S q0 0@20S 0۰|3 0 S@ T 10Sd"d2Q`d 0D^3" @=؀C2,0刂0000t @DO.0 @7'p0 @S葟0S0S0=S0S p(8000J p 0L%000X30P%,9q  *h1 10S @0 0\)Z)Z)[)XZ)])(Z)Z)])A#D:\)\)fP8 =dT$B_xT\Z)#D *Z) 4][)\)iN~u\)\)\)Z)Z)Z) `])1YZ)\)qZ)\)Z)\)\)\)\)\)\)\)dZ)\)Z)gZ)=S%0S& <0p 0P%<<00X30*0 00S [0 00S5 0 >0S WPLq 5*N> 0:#: 5p1y $10S 20 000S(3Pq00*1Y 10S h0 00<cQdzP\r 0<0*qp29 $20S H0 00S0L%r0L%r0H00q" P 000cH00SPGP$s*@43 20S \#0 0 00L40q"  400cL00SPs*330S #0 0 0t4pW.4E  ^  \pWR 0SPt*4T40S f$0 0 0t0Q,%R0%45S R! lf004E0S|PP*`5}50S 6%0 0 00(0Si xQ$ =0S0x < (%0S^,P*6Q50S  `8&0 0 08%<5HSR$  H00850<S6bP*[6#|60S 2&0 0 0@%D5LSR$ t L00@50DS4Pp*-7470S '0 0 07 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000* 880S W)0 0 0T PYd P4TQڨ0QXڌ T0 0S Py* 9k\90S $z)0 0 00S3 6 R0S0QQ*P "0 0Sl xP`z*q p:9$:0S H*0 0 0 Q0S Q0S  Q0S0+ Q^ NQ L Q0SQLd Q0S{v<Q Q0S Q0S Q0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0* p<$<0S r,0 0 0<0S <0S(L* <<0S T0 ]h  < < PRL PM\= 0S@ 剩PL \  5`\堭p@PUWʸ- 0 ?001>0d.P6  5,P0>P<) 3D^ SH.;00 0 S 05t>|> > >p>PWppY>@@5008PEUPHLd  BL 0b03",P P Y) T?0S   p?8 H4L0d P B b"30 T?0S   q0`00p] P?F ̨6P k0x& 5000h60S 1S P D1PD6  <6@ %Q$ %V @ 0`P@@  04 8 <%c#!$c4"%S 50S :P 0 0  ``Z0  0 0 0 05a(!"4a#Q  0SgwPh0 $"448#8 S  0SidPj0 $"448#8S t0SjXQPk0 $"448#8V:QQ  /Q R 0Sf4Pg000 4000 Pz c0SdPe 0 40#40htO0S 00 0 0 00  $O0S 0 0 000  0vO0S 0  09000 0  0p]O0S ``&d``0000  0`pFO0S @000u0  01 1Q1Q,+ 0S 囪A 5< 0 !00!@0|!0pCS #0p R0 !0B88#80WP q`@f0P0UPQb R E/ !0!Y pG P\)lZ)Z)Z)\)])\)LBAL XZ)(]{Bu\Z)\)\)\)pZ)\)2^q|00S!4!: S  S :C / S : S 0P/@-Z)\Z)1A-`0S lhb/@ 㳩T L10S@10S4,1 10ST00S ֩p@ϩ00CS0 P U 00CS0 P PYU tYU0 P0  0 0 SNUXZ)g[)\)`Z)[)'x''@-@P J$ PԧЍXZ)gO-p,1 p$1p 100 MP1 pp?P 0P  ppPP'#P(ɡ @ )PT`00 WT  V p pXP @@ 00])])dZ)8])])])O-1P0- Ϡ,"ʼn$MP   p P 0L x /24`,@T 㿨 0`P$Ѝ?0 0 ?   ֜  P 0" 00?QR0 0# Ϡ?,0 8ƨ`0@p 0彨\)\)-O-p- M0P8؀:0PϠ,"  `ዜZ0 Ѝ 0|哨@Z ЍOJ ?   nP P" ? {0@`\)Z);A-`P@U ,19"  U0P PP0 0T3p䀟`+0 L@D0T@S    8HĒL d  B 0b<3l@"y0 S  0P00`0@TЍ\)qgrZ)dZ)Z)\) 0S/A-@p d`V F0P f02Qf0 SR P00@00 0` PЍdZ)dd)\)\)@-0P0@T@T$d pL `l0̠p `V W @00 0 0 000P@0@00 ЍdZ)])p@-XM`P@X 0 `P @XЍp0@-S  H0@S  T00S HL004#,~P00XZ)tp@-@8`8P0 0$00Sp p@mdZ)\)Z)0 /\)\@-^* 0<80@400 0!1Q0Z)Z)dZ)Hz&O-\MPpSR E00 00S` tp@ [00CSD \ЍO`T `700XYH`o`00E0 0PE00?0+0F`F B\ЍO000D0P p`  x00PpD@T  y$0F 0/ `@V @:P pAs dd)StS\%2R/C-@=MS}QPH 0SV,PV.10S 2K10S0 L5as0|pS净  00S   0 0"W0S  /0S  # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍT\Z))\)Z)\%0R/=S/ 5004 030304040 5 5L5sP%P% s,, TPC-<40S 0$0,DP$440S0 40S, T0SB 3`3 30S@=S= S*330S Y0P 0VhSXS匠Ts冠P`UU00Q AP 0S ?@?)fd`P"hR0"00S7 lr002Pb0S) x#0S) 00RE>0X4*q 2920S H0 00SIWP10S I1 TQd1*E\1 P10S 0 0P10S DI41 P0*$000S 0 000S 0d$  0 (0Է ЍCз Ѝ\)Z)\)\)Z)\)Z)XZ)cdZ)\)\)Z)Z)])8])])])])MZ)\)Z)\Z)dd) O-PPMp80S# \/ "C / Q @aV``  [ΑYP xd \P  ?88  ? }0 -2r0S0` S` 0!S 3S  0?? 0!0! !!0S`0 0 0 `U\/0ϬL3 80S30Ð0C03` 0S300CQ"À 00P*900S ` ` `Ѝ kS  *$0 0C$040S 4 $ P@ P VdZ)Z)\)T\)8])\)Z)U Z)Z)Z)t0A-P`p`ATR m@P<:0S @ -1p0A\),80 0 1S/ 0S/\)\0 5< ÒH0\ Ò3S\ Ò3S\///dZ)^FPO-0(P,0@4p8`E P P0P` 0S 0 S   000 00 00S 0 S L0 w0    p ppZ)dd)\)Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS lp Q 00p( 08pQቐሀ@`0S    P/100 P000B00   @-hH`0S`Po/0! 2/B1   P"/   @-tH`0S( 00/1000/0B10B1/101/   @-pH`0S|00/1000/0B10B1/101/   @-JHO-$5S[  l@P`hT00! t pbR$ YB,  !$  p  R !U101Q+DP 1 @PA Cό02 R&@@00Z   T   @U   @ Ѝ ^000 0S0 B0O-RMhbP  Y @PH @<  lPpߍP(  5ppa,0S  <08 (00,0 0000400!4 04$0D0(0 P r|Vph M 0 p* H8m <jm 0fm $bm ^m  p p  * ᶵp 8p?pq8SڮPr   00**0@0 4 0* *dd@edA{zd@A-CMMPPp`;8 Lp@P  0P;P'U00 ## CލЍO-MMP@`pPaP0 P: S3/X,P 0rS +00P 0#0@0@G@ U  &P  (P PU x+00@23MP@ S @X帰张 P60: S)^0 "PP@TP X+ S R"᧳P-P U Tᙳ@\ S}P@`-uP @UPXp!t0#PU000 07 S@P ϴP*0S[W }PPxẴl0 ᵴPPᰴPP 5V80% ܍Ѝ FF F@00S 4 /Z)00S0`( "4`#/Z)O-pt1l1`00Pɯ 0 X@ 03ˠ121#@ R` 0A0P s00`RQq00S" D% 0%3CC(0QXp000Q  X00 <P00\)dZ)xd)3XZ)u\)IZ) 00S/Z)O-p-M 0뜱`P@0V000Ѝ000/U0p00 0 Z000P00S I00 ?#0X000  1@400    0P@4P@ 000/U05:00 0"000P00S  Ѝ00 ?)0pp%&` ' X|yd0  a'%o0 S    \)Z)Z)dZ)\)p6O-PhhVd6d04MCTH@ Hr` pr!0_ 0 CR(L""!!L"L"@ 1  50S BT 1 19 1  @ a0l > 1\  P 1   x(00 0x00P(0 R. A00!00  Y40SF AB0a!(00 0`M00@P(0 R4 4 0 $4$4\0P 0S 0P *0S 1  ( 000juPl3 @ 4ЍjP|30S01 0? ҕD30,083@,[0 S,0(,0h Pn@P,@, R)0,0, 0R0( 000 [0A(㻖|2 Q,, (,0!P7Pm,00,01R0 00 0Cp"3P0 ,0W7! 1 1S2K T10S# uA, 0R?R0(0$0 000$00?y000P$00S  [ P0,00|$0 0 d 0 0, ( 0S     `Pp@+pdZ)ej\))XZ)LlZ)F^^F Z)\)xd)u)O-0P⼁!QPP!a`$Ma !S@r0!!1  `00 0p000P 0S @㤚D$pPU PU 000/ 0`P&P0[P    0S @    RP P@0$ЍdZ)pej\)pZ)\)DXZ)yZ)p@-P0 % .  @Q 0S p# #300# #:>00Tv0SpP8PpdZ)^FXZ)gR/G-P `$ 0pq@V` 0j@`` V`@&!D`( G-P`0 4J$ Y0000008#8#$48#8Y\dp q00! ## ?@Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- 0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@p0P2#U 1!# ` R J` U9# c! SV Q V3  P! I P` 09# c SV!Q V3  P 0 P$` U P `` Ѝ 2 0A-1àQ`P |0| ||"0@Sp࠱ P$` p@QL ࠁ PQ e p@-@P0080P 4 PR*SpL0L LS@04 <<"0C800S   0.H/ 2 ,0S/`0@-@0  L>,0,0080S 0  h"0@ |d)_HC ,0@-S ,0, ,,V"@TP @xV O-p-LMPU`@( %88S80@ @4@D2@D1@DS@D50  00 0P U0#03?[[[UWi@D `0P 045Q ,O0 0 ᦔ;D 0 XR @g"<p!8pL0$0$0 0H(0 0 `,0`4  0 4$!HP 0 PL40  $00T 0P蟙, 005RSUSP3S` 4$`UQV  `F0"00,040000 C3 : 4`C#,0PQ(0 $,80* f@P,Ph3Q 0Q+ 0CQ 0؃SP` T$P$P@ T@P P0TpW@ !" P` !T@"0`P`0?: p0T @ u8< @D0RP P=v0 `S2$0$0S@p :0 P  S Z 1!A8  B`40g40 040 00Q800800pȯ0T0 `S2$0$0S@p 0 0 P 80S0 0C800S   0v`姘O@  D e @ LЍ0 0|d)LBAWh|5y NBAW|I 2 [G-0,0S0  P@`00qW40S*0Ѝ! 0 W@P   l@Ppy$ A-0`c,0@Sl0l llc PpQ L0< H 0P@DT@y> ? C-0`c,0(PS0 7 p@Q |0l x@PEU  0P !  0 P P ЍyO Q X0sC-@0Ђ D`P 004 0ؗ 0PЍp|d)\)X0sC-@0Ђ D`P 004 0ὗ 0PЍp|d)\)0A-PQ H`p@0P R   T0! 癗@P 8%4Pݕ+[)d)|d)hHg@-,@P,0S ;00d)@-,P ,\  D Ѝd)p@-@Pp0p 0 SX0d0RX c#!$c4"5 D006.8 Q#3SRpp\)Z)dZ)27@-0S S2+, R0 ELh `Q tp"PCsaQ* Q( H<P 4,B 5*< 50d30a3210S ᆵ0 00@ 7.Bp#x3@ Ŝ & 0P xtX|PA 5*< 50d301$10S Q0 0@ d3S+ CQ+aQ# 0AS"HP M@0a3d3*|0kp00S $z0 0@S Ѝ08\Z)|d)dZ)gZ)Z)Z)d) !O-0-Mp "##@0` @ 0$0븃 ᠕pPs0S @0P- # 00"$ qp)$:lU tU bU0GpP*$j @P 80 (P/  @0S (00,00#+C `$I0P P V0d sЍV0p F  pᇲP `  \0 pw0P `P V:P0V 0S00$$0+SU Pl3 0 +SG P<  @10 00$ 0S X(0,  $ 8y,p Q @p0 00$ 0S X(0,  $ 8\p| \ @0P H  P0 Pl $'Lz&7UpG- 0pP@P` V  0  0  G `00000O-0mM` $P0@004080 0 zpp40S+ mߍbW AW LW |84cW iW0 p8J 4@0 0@4: S@ @0(0D0,0000408`0+P  P 0! RT| 'p 0Q= $ 0! $刡匱@P 0V$0 0/S <<Y- `ᆏ`0"<19P0<0$'`P dP%< py ow <bVD @"$Y 0#$0@0P!Sv `VH⸨p 0 n?C0 < n?n/ #0Pp < 0S `0S  Q B/o" R 0S! m0H $8HP`$0F00pI $ pC rp:0S  (, PQ S RPQd T :$'hz&Dzd@bwQC 7 `#@O-`-d,MPp$`` &p@($0S0$020S'$00 P W 00 PSk0  0"%fT AT PT xh@pT$p@,Ѝp00` 0pP , ? o0 000 00 p; p@00 0`Tqp p V@p@`$'z&UG-Pxp` ᅒp@<P10S<- ) p% o0 < 9X $$ Rkp@- `&W00S $$ AZp@ Y``V @fT rT GX`$$ $ =p@$X$'!>Zwz& @-ooA-@P`pP 4)\ X厓T DD ሓ8 &U  A}A %mu(' @- R0ЍpP`@ TlP0 0S 0SS 0S $$1!BS0S :P +., P/00#01"$#@O-@`V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! O-088P@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR !O 3 00G-`$(PpO@P 0'0 0 Q P ᒌ@Ѝ xPC-P$4 p咓`㓁(`@ 0Q P Ѝ  =P404-0@-  Ѝ Ѝ/-@-00@ 0 Ѝ@ Ѝ/-@-P 4(w 嘒 0Ѝ Ѝ/uO-MPp`@PЍ P P 4S T 0T0P$ Q$VP 0S 4S $ X0P4 S $SG0!!p`000  0 0  0 @P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڠ  0`  L0 0  @"|Pb 00pP0S(p+3tHO-,MX\Pp@P o 2R 4S  0W,Ѝ@ 0Q Q0 '  PS[  "S d 0000 00  0 @P*4S 0S6  00 000 0 @0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3  1 # 8 0$0@S4S 0$R  @0 RS 00 0 00 0000PV P0P 00000 0  P1p>UtG-`MpMP`@PЍ#TC^t E@0$4$ 00; p+]p u g@գph @4$$: S R B.D ɣp4 $4S( ($,40-B. ⹣p E0"dR04<$4($,40K>؀C$t0  p0E  00`d؀E$t0  \P0`P 0,4S    0p 0Op 0p pup{ p 0pps P P 0"I Rp5E*pA_ Z0",8d@D[d@r@-@P 4B BRP $p <N4( XЍ@訡Ѝd@>p@-@PP PP \ p4PS4 P PA-p @PP0T ` Xp4@ p@@$$ - Q EAQ0 "(  0T 00 /$4 0T0 / $4 0T0 /O-`P-p M@7P䀟䰟`   `P0P0000 V:Ѝ 1000*0 PԎ`P10 0 ʎP U Pq('L (=3C$$0A@-P@-@ p`R`]ЍpP P 4 R 0 H+.SoO-p!PR0_o|M`@R(0S00S "R0oU |ЍP dPU 0SIQF (0QSB!RS R9"R S R0A +00S000P#  7/p  7/p 40   m0$80P P ܩP s@-`@P0zPЍp 5/p 4  5/p 4 C-(00pS4`  Ѝ$T@ 0 *0 h 0Ps 00 ( 0PW0O-0 0`P 뤀夐嘠p@T Ѝ0  0HP 0 0S 5p @ 0 +. @*A-P$`$p@0 ᷌@T@FO-P$Mp `@Ȁ\İ0     Q  p0 p `p R0 \ p`$00P0  $Ѝq@"TO-M Q8`<@  00PЍ  P P0S*B_PP  00040  0004 pp `040p` 04p [j0s@-SX`@ Pd ?o2R0S pЍp+.o@- iR sR aR p` *T7@-@P ,P=P 5 Ѝ0+.p@-@T 40`PP,pp+. iR@-. 0 aR bR LR) sR& tRP 0P0S00 Tp` Ѝ(h0 -+.p@-M `@P` P00͵00e0S _ ЍpqFQA-@ MP Q   ЍA~☀ p$0 ք 0`Pp `B~ `PP  Nz>i$O-$MH@P`P 0sP`$ЍpP 0 0 0 $ Y># P0*aQ  p0 0?Y S0STp Y0 p G00 pW 0np $ VP 0000 0 lP y4  $\ P  0U,S( 0$`84 0wp{ $Ĕ'{!#,  RP P{ T P R*L0Sg 0p^ L004 0 000 0PL 4$$   $ 0$$?4p6  &K+k00S 0@-C^M E@$,$$E0: 0. P.Ѝ0 @x("(!"`#XT 80  @P8$'z&  1 C 0$ 8O-LM@Pp4 ⴑ崱 1D0 p  0S$ ! R t!LЍfR lRJ  I@1` 0S  %P ჊P   ] t蠟 ܀P  fZ ᑙ  0ḉ@   Z  ~ 0`` NP` p Q` $'|r+.7z&x' n A-p`(P@P 0p`P @00! 0$0@-@P$0S @O-$MHLPPDp`T   V  \ D@=x` @SR00 Q ^00S P UP 4 0 fT0 0X0P$0sP UP000 P1!!U111M@^P 0yPPJ T0 0X0$0QP 00  R@P TP0 \ 0 0@;0 0ZS  R@PP0 V00IP  0 0   0R00 0P0@SP@@4($Ѝ m     O-4MFpT0X\,! 0  0  0z  ᒴ1 p 0 p 0  0i  ᒄ1 ,0dVL 0Sk     R b A  [  ]00[$000(00$ 0S 0(0 0 0S 0H 0S0D 0  T0  0 * 0 1%4 00$ ( 00 000 0,00`4ЍT0$(p 0 (00$ 0 0 1!$00R$000``O-M<Pp 8EJ@`LU 0S 0 0 0  0@`@ `000Spa. 0  0 J)`VT `@ T0 0 P@` 0T0 0@ ` 00 S0 00 Ѝ  0  0  J)` T'U@ ` Q  R0P  UpP0 0S 00 0 0 RU Q T0P|  P0 T@ 0000Sp@ `     0 T  P/0S//P/0S/C- `P R Q  0X0 RU@-@,MP@p`lP<=,Ѝ, p`dP0  4 J@- XXPX`@! L0 PDDDg<<<@YTL E 4 j  (' R R R D@-R R/////  Rp@-0@P! R8ԀXDDDDDD$ R̀P,4<pp B R"Sh h@\0X pppppp 1 pp- d)2 TO- M0`K@PPЍ0!S R |8P(P0p \4S\ 00$$ 88P44 8S ἀQ QP0 4S ڠ0"S1 @y0 U <03/p 8 H0 0($  P 0P 0 0 $ P (, Ppm WEV   T- d)O-0-,MP`p$0  ӄp@d30S$` vP 0" $ pT AT fT )@,ЍsT0 0$Op00 00*:@=qp 4 `0}p0ᴐ00004S 0 0Q-$2!0  R8 +R.R+x$$$$$$$$$$$$$$$ Rh!h@\1R R8 0S8d 0S$1 +10` 0`[plpr kpn 0oO@@ *:`p@@[>W 8 H00 8 Y$ (, ` $' z&T - d)< A-@ĔQM pp A^PP`|t`QPd PЍpP4 $0 P$z>OjG-@`pP& V4 t" An⸐帀 ` $$ 0 P ! p" $ppP P 00p$Bn  0 P$z>G-`-M"@ep ЍG20SP`pPx $R  4S_Ѝ4S_P R 0a $ RQ 4 DSMP 4S P P 0UpL0 08  0P , !?o  020 00 [pPRP P  V0p 4S 4S  0z&$',^U@-P< q/@ 0Ƞ0 0#30 \S0 P p" $m0 8 Ѝ0 0 pp1S1S|pЍ@2\PL  PЍ@ &J0\:>qr6 p@-M(@,`6#,P X0{ P00͵000S  zЍpqap@-M ` @T $ D0S@ P $$0 $$0 0 0 P 5,} 0 tum0 $8XmTk#H  #ݍp~t7jRyP `00CS`0p S00 P0S X0X /X}x'C-YMM P0"05,"  1 # r@TYލЍ    Q]    `!0!0 gP\ L~D~0!0(~$~$ ! @<#≦P$ !<#~ ym0 $8J ~~#  I#@P~~   F V67 t71\qJyG-0|MpP `@ P! }pD20S!jP$#@1 9lP`Pa@ P ܠuP @ЍPP 6pQPP0S003 P 0S0S \^ 0 Q t $~  ~"븀帐帠pW ~  ~ Q ~   p }$'{&67 @-LM@P`4 p L0D0 }p T$  SP 00S 0TR lRxLЍT pT8Yp:-$'أE {& @-0$Mq` 0 0@P!! |p$0S00r P 0SC0S@ \^; 0T 00S!   0*a@ P ,D\TtOpT ET  u$Ѝ$'{&E -,M0$00 0 00 00 00 00 0 00000000 ,Ѝ7@-@ P00z0 0t0 0n00 0 0 0P  S Ѝ0C-M@pP `X T0 0N0000 0 0D0sS̀@ PP0㓔$ up0lS|p@ <P0㓄$ ap Ѝ@T r@TpG-pP8M(@ 0S   wP8Ѝ70 060050040030020 0100000.00,0  P #00R R 0S T `PP0c# BXPp@-PP@M <@` @ `  5/V@@ЍpA-`(@(pP0 ,|PU@<4p@-@$P` Up p@A-PP` 4  04000 00:#:900 @0<<0@ 㶎p@p ^Ѝ ᡎ PXRᵎ@@ R40;pW᥎Jd~@-GPp&0P0T t00ЍQ+.$'{&'7s&1>L[hvh67 O-@-ZܚܪM`p xp :0S ЍO^0FS iSPpC>؀C$dP W DЍ{PvP W00 9PapP ^P$$0ZPT^PP ^P (0ZPdST0 DP 0$0 4 Q 0 0 0^FP 4P0P 4 Ps  <P00 00 0 00[000000S$000(0^P `^0P: iPP DDD U`P' U 0$rPP  0`5qp R$4=,, 0$qp$0`AK4 EPa 4`9P `UP @ ;DPP HH 5DPJ @0 SD00H0$ RL0( 0| F$4P `$$;$4P` V^`P ^P )d&| ^P -iP+8,0 T`P T@&?  0`qpt p CP3po  CP   CP  CP   CP  , CP  ` CP qH CP  0 CP q/  CP r CP 01S 0r/Ss?Ⲱ, ղ Ѱ  CP s/ CPz$$ᓊ$4P hPԣ{ S`PS$$  0 `"qpS p0|< DPi <p5P < @-< DPY <%P iCPN  cCPH P ]CPB << DP <$ m8 #CP2 8 Y* 0b$ Bp $ ! P$4`  0qpt$  X$ @ 800$0 0(0$000N(040P08\ ,` 0$00P00T0 X$$0`}qpY$$ω$4P000H00 L0`$4+` 0\qp8$$ᮉ$4P`Q+.$' |&v?ah|s67 U&1>L[hW3s+0@-M@ P  ݢ 5mp@ @ô8 p(㻴0Ѝ0x/'i/@-SM@P, 0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`p D Sߍi@/i/!i/@-@    0`( "4`#Ѝ1p@-M0MS1`0`Sj@ A. H01P A!Ax3vP 0`0?oS cP 05P PP,v0 0A. 00`0kP A ⾸Avuu0 0A. 00`l0LP AX X⟸A\u000D 0B8uލЍpj)e)q/////0s@-?PP ͳP Ƴ N@`TЍpP  00STV * `u@0>0 R !O-@-MPp7p#㍳`P"  / +ZP+ aZP8ZpP `pZP `x t@0P0&h 0R0 0 p "( ]@Px 0SuhQr @ vpgl ` 0 00  R R R[  0PW t [ h X (oDW 0f0S, @ h;P@ `5pd HQ L 40R ![W01Sp0S 3/p\ R 8 Xp \ 0S 0@ `p Ѝx/0|s(000U:0t0I0i00@-`Y@P@ ЍYPU PP Q\pKZ P 7O@PT ~YoZP@- AP ЍA-MP p*@@P00 p`ЍpP  x4 ឈp !0 eAA0i@-@p @A-P`YpP00_P@?0_  FSA-P`YpP00_P@:?0_  F5@- $|?Pt00 Ѝ丼p@-8M@ (Pk?P1!mYP# _0 Q0s0S00_PP"  Y@jN$`8Ѝpp r  ^8 PY`PNV0*8 00i0@-BM M@  Kp 0S 7  /  (0P(@0S700$0/ (h 0dP(@0S Bލ Ѝ0us@ms @i0,1A1p@-Mt`XPP ^P@ T0T TVy^  4 p LЍp0Q10is1@-M@  [( p@oЍi@-M @>P0 @| p 0!Q0s0S0< 1p`Ѝ1*8 .1iis@-`P p@@@_>P0  V@Pl^ P@ L۰DXP 4 mЍp1*8 o11 2(0#27@- P@6p` `㻰X0X PH08 DD0<80X ` Ѝ0:0;2E21s(07@- P@ ph h㒰0TㅰLX P<0( 8$XX ` Ѝ0:0O000E21p@-M`WPP00Ѝp]P@Uxj@PdZP0 "p@I8 P@ PP mk:O2d2}2i2@-$MpWP00$Ѝ]`j@Pp d0 pPHP P`@ p$l722i2@-Bq ЍCUq2p@-0M 000  P&p `Yj@P `@pt 0 h`RP00S qlpU }qqPxi 23'3t0@-M@"PP  %p 㪯do@3p@-Php@@@WPH0H H%]Q P ㊯Llp|E211@-P3@-MX @<PD0D D08 0 p yiЍ *8 1i3@-MX @<PD0D DDm0< 0 p$YiЍ趆 *8 &1i3-M0( 00 P .Ѝi2@-@8V P,0, ,,=(V `;2E2/1(000@ S/a0@SW@/A0@S=@/@-i00@- M@ 0, 0 p Ѝi2p@-` MP@WVP m\ Ѝp` v   [( PV@TK$`6vi 0@-,M@ P<P0  p,Ѝ0 0R0 s0S 0   0$ [PP 8 `V@K$`3*8 <d16P@-M `@ @p {< <G  ]pЍ  S?qCU33"@- X@;P@00Ѝ  p@@  Qh3Ft-$M~@TPP .m`0LP00 0P   pt0@`Vm``X0 @ @@@@P0DDpJMn03/`T3p|&q333('4//// 0L0L/p|& 0T0T/p|& 0\0\/p|& 0D0D/p|& d0 0d0/p|&p@-@pP 00p00D S 0A0CS0$P=>P  0@pp|&@-p08e) 0`P/ R/p|&O-04M@@ !T10* D`eďpt P(0$!pSڰp D@T PoS@ڀAP`@ @p00L\pP` R  P Q R/6 0TS $P\(P  1/ P @0S  p "SR(0 Sh \0 2/P W0 [ X Lm8e)6ɚ;6eĤ>6O-MMPp  Y p`$ pP$ 1000$ 0-n ښ plf ͚T p Q 4n jn8 p# Q n$S賟X@Tx ⦚X00@0 0ȂPnZ 0 @0㎚ p,0@4@层p 0f0PH0h 04 40,@墂p ^ 4]n%i H0S=I0S:Y`@T 0 3/@: " Ⳝ렢M0S:00%  p"妜pM0S  )n@ !n@03/@~ J'I1PJ/INpI!1Qa`"%J` 1 0 d1 |tp 1 `T!1 Dm@`#%J^!1 @ t1 x!|1  wmP@Tc 03/@0 3/ݍЍZx/+6966i6~i666p|&i7i7778e)6~77ii6< 77"?88'828O-M@pP  p {T R@RPT!g?R P`P pd PddU T1O0S mGG kW    P/Z    P& f:P! K0S 0 L0S 0M0S 0 N0SO0`S  PPV l *#@3a<8>8e)'@-,MP@lpP rR`P(  pU0S hP 8P00@ @۪0, ͪ,Ѝ0Y;j)8i(c;&p;;@-@ C 0 @ 㹪;C-@1RPP0 `@ Xppp:X-X nP 峕pPP H@@Ug@@ Ѝ; &2;j)s@-@zQ@P00ЍpXPWTn@P <` 岕P&gu <j)j]s@-@PQ@P0 jWPW+n@P T` 剕Pfu( hЍp= &;j)j]A-@!Q`P0 ;P@WpWmP >p< =400@@Ѝ^ &;j) <@-@d ]7PP0P PPL 0 S@@00 >00Ѝ<*8 &;j)!('<0@-M@@QP;QP 6QPt1QP d0P P P P< PNp$㢩Ѝ0^=<;j)7ih<s@-@-hk MP LkHPH`Z P! ,xkЍpsk@tu<L; ~<O-M`@PK Up pP"`(  {  f p% (m( px" <@T t8P9kl2P\2k UR TЍ0 PDd@P $@Qp 呓 kt 0R kk)j jP `\|q|||j` R#Q\j jmMP8ЍOeP\ 0P   1Q   j0! RSA jj" rj0P R ` V 0P`p`` `0'x/8i(i<<'<<sc;<jB &'"qL; 7L'<<<Pp@-P`@,OP V  [P`P E`E 00pOTpEp@-MPP00Ѝ`0 000p@ 0 P U0P 0 p 0 `P0G-@(P00p( G P1r0`*0PU!V0"R0 "00"SЍfG0Pw 0,  vp 0 @0@-@P D @O-`,@pP(0V0S 8UbP$P$P 40S 04S 0S(0p(`8P0$0S(PdO-Mq00W $000Ѝ`Q Q 00 5 PP0PXU 0P x,,rA,h4@[T /@P00 D0800@00X5{8 "10#Z0 B00o 8 ]@pG 0YP@T 0CS0 0 xC0X0^ :T 0CS00xC 0xRaDPW@DADP7@D@S 00@D@ TSS0Z`S@McTh lㄦ YNPCU8 @ 0 0 0`0긼 M O=X)W= 2#2A-X Pp@`P00O<0P 0 p 0 `P0O-,Mp`@ PP 0VY: P X 0  P 0` 000   0$ @-&p_Ii9>p@-t`tP0S s/o" R@ ps x Kyp@@pP@@&j)O-0PU` 00Sp1 000xSP PLD1p@ Q Y 1P @ `GR B)`U     >@ Ѝ W:UUp@G  @ TA̠WL ΠL̠ 0 B W B,B,  G''U>>l>QA-@Pʰ00QQ00S Ad00Sp0 000xSXdTp`Vd`   @0'>='0p@-` MP@ U U( P00 Ѝp00 0TPTT@ !!0P!!`\PP  @ 0 `A-p`Pp@ @P(G R Awx|/0p@-M@P` S `ЍpO-MMpPP!"p`p!t  pX!` F/ 0  ⺦<1W@4444TV ݍЍ_0P0  R P 8W)0  !4  x0px[@0 "' R R00000O/ 0P<1S O/,c *0x/>ij)>>p@-`M@Sp 0+SЍp㣡P    ᨏ R #D wp 01S 0/S [꒐ i> 00S/@-@nce)>A-P@`TpP @ 0SP s('>A-P@p k`P h ePX0 000 @ p`W'p 3Q? `I0P 60p 2Q8z`8   p 0S0 *`8 pu p t  p 0@\ |PpD2Q <L`Bߍ10S D`10S =`:` 0  `0000p&`PU0``0` Rڬx1000 0:S RL 6P<``(PpQ _V pWP ,_+_H0S L_ _~_On_`0Q _ _8i(iAAiAe)AAA) AAi8iii;+#BAAA']@BBBq-B7B0@-_-_tO-MM`@ 4]P04 lP7EgEP|)7U 0'S`@0 `F@( 0R tPy['V:0:0: 0:0 :0:0 : _(@!0! P mm0 /C BRV  0  00=C$0Cɟ"!``F 0^l d9EIcCP S@BA`p80P0 p` ^!0@"0$0$0S= f^0 P0B'S 0؍Ѝ h(S   BS>C0CH(S  $ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C00Q0g*S SS!" "   "2SK Sp 0SC R< )SS0C'S񟗶((d'''((((((((('(((((((((((((((''''''''''0S 0 tht0 `^0$ 0 B@$ ^ R 4&S0p(^$$$p`W>] 0R 0 ]`0S ]0S 000 ]00C!圥娀`pXP0  @ ]p` ]0S 8WD 04 8 <%S8]0S 0]] ` 0dY)1 pG(  `0,0t4判pY$( 1p, sgqpW!ևӅ|Hu]yW-0S\ ,  W ((I a]3 $( P  #P# ß P# I]pl3I#S0S ;]0S%  l4] ST.]0S @(]p 〙Ѝ轀 *8 ~+?D0 /4&/-@- M,00@(000 P  Ѝ@Ѝ/P00  @@@@0-@-  WW ЍЍ/@-@WoE 0S/@-\k)-@-  WW ЍЍ/-@-  WW ЍЍ/l0@-M0S@ 0  0000 0wp@@Ѝ\k)E@-@mHmmp00oLpxEEE@-|MPڸ2P0PS 0P@ 0 000 0`5p TiP@H 00@4P8PFF4&'GF.AG-s@-P@0`00 0 SЍp@Ѝ/0C>Sn`!0310@- Mx 0 f@P \ _RLPP @ , 0@@SP 020Ѝ08&dk)s@-4@4 Z  yZX('+HgHI$P@-d0 !X !T@0 60\ (0000/GGHPh0@-d`  !TD0 60\ ,00 00/GGHP-P040#^4<\$0000/GGHPD0 40#\00Q 00/00GGHPL- 0:# ^4 0Q$0000/GGHPL- 09# ^4 0Q$0000/GGHP 4 <# \,4Q00/00GGHP@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00GG)J=JH$0@- 00PWP ЍT3@&A-PΎ@p`WЍ P 3M@P p7@-0P@U , WIS Ѝ0ᾄLA-@0nS0oS@p p㰄hP`OP,S0nS0oSTPPTPP' @-0 XVL('O-MM<(0<,0MLMAs TMNkۂZMpk)yMaMvn)>= JM Mc: MLMMM&QC \M'MO-}MMȐ⨀p@ 0@ HVP,b,,OXU 2V^0E Ÿ " P`0 0V0SP 1PP$VGPVa0SQ tU'x V0SP h V&l %V&\ %V0S;@!0 P0   P00@P  0S ṵ 0P@UލЍOk 0 0S 00S P0l   0U0 0P `p0Ul<ލЍOUPMJ"L; HLCU&q N!Ntpk)/NAN]NLM|NQ p@-P@AQ00opP 0p/Hl)A-PP 0nS0oS0 P |@P0DtMP,WpWMPP`8M3Pp@,3@P@Hl)Ps@- VSR('O-@M pn"P0Px0t"` P0`"qTp1D2 0CP40%0|0&0 |`P0 +0000 0p00*`&0p`e #ipS  rPdPMP* UP? GP e@ PFXFFXFXFGXFXFFXFGXFXFDG 00 0 00 0< 0}x`|P 00 0 ~PȒ~ 00 0< 0etw[,0t0Z00x0W 0;;0|0Ѝ+.+.$'RqPR-BMMI^@0 P@A00d  0hpL0 ㍒0 0/  0ބR SdR7@-P @lM0Lo S? 0 ` Ѝ0hS@-@(D0P @p@-@E0P @@- @>M0S 00S0?  4ЍzS@-@ P8.0/S  -Ѝ@-ЍSSS@-d TaRdU('O-`@ Pp(,娐'뤰0 0000 /Sp0@DTq oP\0 }P@}9 O4$'S+.+.R@-M@A> 0@0D00 p09gp-0S SH & P 00,0 0㩑Q- UUUU@-@偦 P8㟑0/S  L-Ѝ@G-ЍSSS@- :TQdU('O-`@ Pp(,娐뤰0 0000 Rp0@DTq oP\0 h}P@YY}9 O4$'U+.+.R@-M@A> 0@0D00 p0fp0S SH }O 00,0 0jQP8 UUUU@-@ P80/S  ,Ѝ@,ЍSSS@- EQ('XO-`(,p崐崠崰0@P0 Rp00@DT oP0 |PTՐ|  QA+vO+.W$'R-MM0An @H 0P ,0@ fp 㩐P Y@-@} P8㛐0/S  H,Ѝ@C,ЍSSS@- 6SPZ('O-PM@ P0r`"Qp+x2 0S00)0x0& 0 x`1p0 +00*`&0`k VfpY >uPfPMP9 9P$ GP g@P000V Op60`FVQp 2@FPXxXHWHWHWHWHWHWHWHWHWHWHWHWHWXHWYYHWHWHWHWhYHWHWWHWHWHW4\HWL\HW\]HWHW\HWHWHWHWHWHWHWHWXXY8YHWHWDYHWYHWHWYHWHWY@\xXd\\\\HW\\40S =4 40S4 0<007aE0:8d$0000000D309@0;g)~04 0I 08(0@0080 5zP&0@B (Q  Q@        y20  | y000$0 X y000 0 4 |y080$0  ry0:0<0  hy0:080  ^y090@0  Ty000,0  Jy00000 0y0909Rg01ra00$00 0 0tT00,wM00 xF00007000+040 F Ѝ̅&w`&+.$'|m)tm)m)[R.xm)Q ;`A`J`T`^`i`o`&A-RMMI>0PC@(0L P@Bq吁H`( L0`bp0KSh0  R<( Lh0TMT0 N% 0 ( h0^/P  0LPP 00,@ 0.0T0 @5P (0$00 00000|00x00t0 0p00l00\ d0XP,NRݍЍtm)Ra S,^``@-@吡 P8㮌0/S  [(Ѝ@V(ЍSSS R R @-鎌/a@-@M0P`p 0Sa000 bPPЍ0P0 0 0Tb0 3a0P wPs@-`000/@P  aP0 uRЍp 0`( "4`#/0@-MP@ 0 0P@h00SP P @@ 0N@Ѝ0l)^a(002P0/p@-BM`Q+ @P41010 0000000 0P VC->?n}C@X=X\:\79>9>:>C:>CF 0? AC>C>mGۂF؂E~EnFӂGЂ 0X J~ pXW}m  $$((,S>,᫂S>GᧂFᤂHHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P  $!4" (2 !8!"2" Ѝp0P:/ 0#O-,Mp0PTXP`( $ X! $0Q* @T 0 㥅bQ) TQFQGA BQ! 0 gA \ Q|{{{|{|{{{{{8|L|U@@@ @ @ @ @UT0 0DS d2Q "P T8 DR 0UQUDTP 0 @@@0 X0 0 R 0P   [0 h00S P P  ,Ѝ,0 *0 xgggm)g h@-m@PU  xxGpp70h`Sd@TpPP0SYED0D,G  G@m)>h('hkerhh 0`( "4`#/00S/@-8Em)s@-@00S 00S Ѝp@0001!Ѝp@˦p0P0` ,X0:V ,C 0$F"EЍpm)q)q)q)q)qp@-Pp`0@S     D00Sp "4400S "440p &q)R/s@-P00S"0@00S |000 Ѝp@p ?,4`L0S:V B 0$_F$DЍpq)q)m)q)q)r1C-P0oS"MPMRTaO0@OS@ 04 1#0 q 10/ P08 0/Ó U000S,U 0 "܍ЍC0*(t`V 0 S Y 01˿0*n"܍Ѝq)q)q)q)gO-CP  dϠ 0@Ì `t0 10S  g0@c0S 4Z0  B  R\ ?0!.0S  G dϠ 0@Ì `0 1 0$ R$  B ,0X0:T 0E p0  J:0ïl!2\%`R 0 0/. `x 0,`0 C c00 d`` @b 0`:c0 0 n 0P!\pQx 0& 0Ss ((XJQXdPCUml 00 ЍO 0St ppЀ:~ XАP3~UmP,uq)q)U ;rRrTTt0p@-@0Slk PL00S0000008B0F02pq) &P400/1000/0B10B1/101/ qE|r('O-ЅM  dϠ 0@Ì `0 150S  00t Rl[PU[\pЍ ` ,ş5B P` bL?0 RW@QWbR3`P/RЈ(x\  "D P D!!D!$ " P "! D( 080P0 U PPp  0$5S?00 1>lV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00030SUd  0@ `?50"ST0T00  B "0PSX000Y0.d  0@ `5?먠ʿ 0Ϡ:,0 0:1#  0 0! ?0 00C000 xS p10S  ' dϠ 0@Ì `0 1! ! N4DJ40AG80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30q)q)U ;rrrr(' &sO--MM̵p,N 51N_R0ePS yqሢ儒 ?D 0Sdd/~D ?0?D4OP p؍ߍ51BWV 2@ŒD 0L 04;20d04 0[0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#8p 0V4`0S7x 000 0p0 0 0`  0S 0X 0 0`S`a , 0#\0Q ?,040<09(080? $0P@X  0@Dő$ L00 /4;0V.V 0 d0@0o 0P 0r ₱`W3 pV{S< yq0//~D22220OD0? 0 04\0hl 0@DE 0L /0d4;00 0@$ @` 4 <0019VU?{\0X0`0d090?,0{({{{$0 "@őDL  0?$+4#VU 0( d 0@Ì `01u &m)q)p&&Aoq)q)TO--M M: c>0?0 0 0UD0Dp0S3 80`V/,0P0 0 ?m)q)q)q)q)} 0@P`P84#v P@ 4 vp] U3T@  A>CP` * 6>P S(y0S0,5 S<0x0(5002 0,%S0022Q046AG 0Q.A?b" 0 04 0A  A1 040A `A( 0 4Q@A 00 Q$*A 00Q(@ 004 Q@1 0 S0 C' \1\cX屺Y1X0S|@ 0X RR $%0 bH4aLBϠ8A<Ń@ϠPDŃPT\TR`8\PR001@ `4r0 P c 2# SQ,Qd0Q38$Q<4R(:#q)q)$&(&%sLsq)q)ssst-tXtq)q)ttq) uT>uq)iu &tTq),&q)q)q)q)Dd@u PT0\5 ?>C00`#!3x00084$0<0D04t `@`000`XcL5P5| P4`F   ?H8@pD ?A ?t0o1&"  A00@&"n@0  4%8$05<4R@@11 p84000 0<SoPx8S @P0@? @P:PP0* : @PP(5#R0:P@0$- 000Z0 a``8 !0/  !.1 >0Z `  b0 R[ Q[" Ϡ  ! 0   B0SB00FP`0*2"0$ 0 ?2V`1V`#T0`10F 0vI : p 0B@TPἐ 嘀 00B1  BZ!0`0Y3B 11 0S B!I0B? F0 `똀 0 BZ` S2 B Q 0Sp ?%\u @P`x1 0F<Ĕ84CP0S`84<$-0BPQQɑ,`RB1ȁ@L0 0 0000L60S|0` ?L4 40H 00 6lsp>'/\#R2\3PPT``0 S  |(7\5?>C00!#4t x0VT7(T0#2! a, A3 31  0 P 04 P  0H$4  $ (  B, @%LV.  R*h ( < (R X $( \ ,( E.?.XT+BA.B,-0 HUPgx8 @40 PK ,p8d A YZQ Z 0{X RA pW $4?.t{ 4 R?D4P00@$04 0H4( 0Āp@2 R 5#< 5$23dr0S+됺 zz000d0S CQ c6Rc`P z'z {'+S= @ z0犸 08z'(Ȋ (+Sl,= 0  R0:1P000\hP2#00Q@@00 Brp00 R00&A0 0S_` R= PP0 t`y6 K  ;Z⋰>q)^Fuuuq)vdgq)/vex'ht@'[vq)vTq)U jB qTvq)m)vq) &vq)q)8 q) `00Sh  0 #  0+ V.|00S  - 0=S,90S 0S0 0" ,0 0CÁ!$!\^   0 0 0/d! A, a3 1 !0兞 1@ p QPP04SP0 0R0 S  B S0 8:0,0 0P0B 0,0Sd啰 p开8嘥ȿ+" < Q \%|0R@.$00 @DU`@,( 4Ac2( R,0@ `0```0T0D (s 0 ` p`3$0[`0L I9pQ004 帀 P0x0 0Sx0x0t\00\ ⨁  B`[d HQ   h ` lS2  B±dd 0RX%J8U0   $0 C00 0 0 R R` ` = 0$5S  l01` p00040S2d0<%ST0T00! !\%0SP5bX0`P5`S$0dV먰 R  L$000080` ᒵQ 㕵@0+@  P+@ ㅵ@0-ᴐR㰑 ,  BU (0n(000T0 10X0岁0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@pw 0`4 8 0 RT:  $5SʸG $`$`(0V70S ,4 ; d,04  0,4 $[ 00`  VjX80S   0帀0 Xx0#`Hx X\># P 0d? @Œ `0 1o @h9\%R tI0SP+i\`/ `ƌ$  $ k0)`S`0 0$5S  l01` 000:0S/d᡿0T*ST0T00! !t*0PSX0b``[d먠    y00080@$0C40 0400T#*< Q`?0@$00$0l0h`0@ppT:S $S0p0S $S00pW`@Pc뀐 H)b 00@8p`0x1 pZ90J@Y!@b0@0  T: 呵@$\ Q  @080$0  $0d O@L LB l; p  o0ST=0S0 000S.908C =R= 0ł."\5S 00 0 d 0/ @. `3,0 0 (90000P0SD> 0,@0P0 l>0S 90S a9>0S  j U900|:x*0XP>0SNc C>`?0S3030404040p3pGVW*PlwV.PhoV.GV0S n?0 PS?\5=S,u??^ E?[0 0S 04 4 dLĒH 0@Ì `04 1,$0S0S 04  d ,04 05M 040Mލ Ѝ)M00 Emp@nSaZO-RMhbP   R`$4;r2+ k [S!Qq 0BG 00 S 0008cS05=0:0ᓊ 00UC 0 $ 0$P   BQ 0 0  ܸp0Fո0L  00060 6Ƹ< 0 p$p0,(@ (X20740<080@0t U,<0DHLP\P`PdPHG 0T0F0D$A_0TpepeC0CP!:P`\` :j $ +$ P@0& 〼 0,0d0040\0080<<0,08#8$0200 0C8#8(00D00`pPC0SNTZI0 pS` @!*&A 7  3) 0 ( "*3 6 !"0H& 00 9gPpD iH&$0SS(9 R0?0Tp`pL00\0f,D0 0S 40S YP 0S 80S<0  0U0`00 CX(000`01,0 p@@|K$0R'0 Hx0S 0S /0S00 0  0C##'007P p FPPpuWPp 0R SpG S^P8:@`0S ĆXHL0S d0 P$ 0D4#S 0+ 0EŻ&0#࿻ H&! B8  ) 0  ]60CT 00C0CS\: B H넖XW:h刁XS:X 0686(㫱 + H &TB  06 05&(6XS:0TSL0S d0 WP UH40S!`V=@^ SPRȌ01 210! !0 S30##0dZ0d$6$[:06 0&l4r.R1hF 0V4#0003 1`P0SMVPEPUI h30SA s1V .1@3PUBL0S \08`0h ,  PP1x P#z37E6|0X0000)E09630 7Pp`613o P 0`W xM\27kEX0000Df& !?<# 0R  *d "y 0 |P0'PPP!g vk)w`P!] c)P 6 t!hT!PU:< U*!:0U:+0 +0 xp L0S]_UB: 9Pv),v){0v)|(v)<|i|||&&|@v)6}8v)&QSNb}v)Hv)z}v)} v)}}u$v)(~,z?~ex'ht@'jB qvAvn~~~R0i/?p ݍ ЍL0@ S40@0 k?P x$t 0 @ab@P!Dz?p b@P $Y80S 14L : SRQP7  |.PPPj VPrPE_oR0: b=p 0g.P0U p  P  @DP$ +3m`Tb:*0 P0*0 ::*QP *:s@ w,0SPD`Ap0 S1|0S1t0S0x0S 11011h0 01,0Sp0| RSt 00R0x R0S /H; P0@S 00 T @#P U,  ;,pPD;P0 101000WT 0`S`Sʈ0S 1S 0S 1S 1S4L04 0@w?0 0 lp^ p`P`C0S\*Lp` p1S?V?`#0*@pT a1S *6pJ Q 1S A0  1C0 S Z000 Z00 000: RS3#*:Q 00S+ PY@00T Q!>P@ T0 k" ?p d "B?;;@0DKP?`|0 QZ# Z Z  G ZD0S t5,0S D0SX0\ 0D0 @0D00 (+\0S &X0S    T*,,00S0 Z0S000S"  0C 0T 0#Sۯ0S0T0S SL t 0S 0C( 00T00D0S0h0 l0Sl000S1\0S1X0S1(0S /㍊(0P: &S⮤0P:  k=p`b>0P!* RaQ ᬮV000S(dR00S00ZY` 1P00V`5U0A $ Y$pY㤢 0< g'JNU0u<0D<00S:Y8$  2U e ?(0 S:1SL5 R 1S *(0: 0`000 Z P011$S3#SQPPQOU Q1S 3 #S RP RM Z P3UP1P Z 0S<00C<0ծ`VZ0D  ʮ*10$00A00 @00,0d0p 10PUWP1 Zd0; S9:Q0C?o20S P PR*> Z  2Z$ 02#ዮ@ d0 Zp0#d" Z΃6#0\0:Pp> 00@0Pd0S!0$0$03 qW 5q:$ *R" P    G$  % Zpa ZdabV10A0 ?d0S$ 0@R"0PP0G11 d000 @P!d01SW*;,?c$wNktYk'(pp؄ȇY 1:fމ/? %?iي@CUqsx6Q|*>('bgfff+ЃU{RRaArrAa׋ߋ(/v9 / Z0 Z00Q* 0R P ?o20 Z0 Z00 |iQPE0! (1,QR0TL(1 00S 0S000 Z01 00S03 15p5 1 Z40 d00 Z01 h0_ ?"802Q` PP }f8w<?C"Y$ @0T2#D0e Z00D 0080001l0$40P0<0#40T0,0#40X0@0$0   Q*" *  H\  0d03Q0Hh080 S (s0S 0d8800T0 `(00(0S( Z0q@#W030#W 0W00S  pR:`*pB0V0S ` :pL T  ~ 0S Z1 S C/o" R P0 00 000$00<00T00,00X00L00p01t01x01 00 Z40 @ 0 1$00(01,0F?03G?03 )001 01100 04L"/@!b$ 04v 08 0#$ #(#< 0  0%!\?h R(0S00d00H o00 0 ST ް&?   :p T]  H R 0 Q  !R R S 0S60610110D @QS*@ C৬QL000l R Z  R   0D0 00BQ?o20S (0 00 25 010P C0024 01000pZ40S&$00 @0&<0S &0,0S &0,L0&?Yp0 L &<0t0A?0x0! 0x&40S &Y!&&xhXQ&&Q& j&80S Q39,0S$y 0`( "4`#/   k B*@-{S-h A 8 /eAD00@- 44@4P\P 0B"" |*-@=B'Ȉ*@-鴰 '$Ԍ('G-@P ` y!>0>P V0 0  5 PP GhD pP`0)X 0/d0S < (d0 ᔯV |*+.y0@-@tPM 0  $7\ \0X媇PЍ0  P 0 07 0 ☇|*t|*@-044KQ   % Ѝ䴍s@-$MPp  F @_1 @00 !0 0%))%1 p%6`P\pAT%6D%TV@D:$Ѝ%꼍!3<p@-0M,AP`   0 0 010R  2   $0Ѝp@x%R  #   $R ׮0S 0!$$("( 18#! 0Ѝp@O%0Ѝp|*:[|  @-7pEc}*P@- 0 R * 0 #  @0*P `00CS`0p S00 P0S X0X /XN&x'p@-`z@8!RP#<10<10 .810CS81V <1S 0<1p0 hǘdŘ`0SPp <10C<1(0 810S81|*Б&'('}*0@-@-4MT $A`$d$hQ $`"R d2RK$ l$d2SA = hk0:P{PST1B k? * +['Hk<[E{7 ! (+S PPP $ 0 @@zj{ k[@  k[+Sh$4Ѝ00B:k{{'*k[+SZ$@@?-C6?Y@~*|*َБ&O(*H*<o@-;i0d2SÄ"|*@0@-0S0@d2S%`2"R2Б&|*H @-@ 8!<qH 8!s{  { ,00X@ᚙ?333333?|*Б&O-ppDpd&> ^"44-"P40MRP=p3 204P0S0S `0S  &@금+'ܣ++h++0A-0S 'P @`pT V @\PT$@ 0S$p$00a`@금+',h+MO-!1 0RR㤑S q儡@P  P0: ЍS DP`P( 03_ a000m PP@:SR  0Lm Q {p`P0ti0 000&_000ꨈ+++'f++('ŤD2O-0S 44}0b00- 6o 2 P+p P@ 0P 0pb: P0 *@@ F W0: R0*0 S, 70 R S U0!:W00#03RQ00S &0P0000  0 S 0Px0i00` \0  P@ Ѝ踈+'+++('C-MM Q@P 0S  0 cT000@T0S Ā@p T0:ۍЍ`PP@p0 > >Y 6  #000PU* 금+'-<+0A-0S p儀P` U0(@TP`0  RF000S 5@금+'G+`A-p`P@P pVpDorPT 00 0CR?o20S $P v('p@-/0@PΑ 0Pp SRpꌔ+@-8m0S$ $00  0 C빥+ݥ('$0?S/ @-_P댔+&A-P0@0/0000 Snڨ/0>+b!T0 L< |_P0? 4 w00?茔++&0@- @000@0Ѝs@-@P`P @TZXX O?0 00?Ι+"+R  + >*ЍpN(' 2G-@`BMVy a@0DXBߍpTW B/ ᐠ0 S'4tx'xp  w@PQ  L1b",4b4#0 440,10S 0S Q0000 {'{{gW:0000R%*0S J0 0S A0 000R*Q p`0S L n`X0`S ! ꜈+P++'r+p@-<)p@ P(a@P0P0)p& p3O-P0_MS XXTsTC P L0H#hx0+b!L< ]P L a0?0H @L &P$PD i P &P7P|_ߍ踈+'Ȧ؈+++&+)+&GUAs + j\:<<8+('&@- @ 00: S+G-@qaP U+ (P00S 0 S00P R GRڀ00S |paP Y X P Y 0:0S ( I++('٧As O-AM M` 0j@0 pP@ Aލ ЍO/9/P( 0`!`wPQ D D @P ,ÚPD }@T ⹚PD s@D 䰟`T Aލ Ѝ  A>00C 0  R + | D M@D n`0 W  0 D m = +x ('8`C-M Mp p0 /R 崀@` GPP 0S P@ۍ Ѝ00 D :|`D @P 0V P`As +p@-0@ @P  P@p@-@'@~3O-tM0 S ttp300RS`3`  T3T#0:v@C0#S<88tЍO,\$P   ; 70p`00'ܢܲ@?` _0@  W6 ! h`V5VW " @P p0 s?0@! $b  he  ?0@ N TQ$$tЍpJ`10xSiSP@P 00@ 000 0C0X10S 0S`$Y\ ` ('X('h0SS  d38a30S d00X00\ `0U0P!^c 08d&금+'+؈+&+Gͨ('+ ++2LmЈ+ @-AMMP 00 pPpP'h!h]&@PX TQLs< 0HAލЍ QD D<&Pq`UP&N& U + *& p0P ֝ t0S%p T0TP 4 뾝8 [Eu('+++9d@-%P@-H@0#S 0@'4#S 0 @6'&&0A-@P` 0 P0:| 0pp ?Ɍ0@$aH00S$`؈+Ȉ+zCUqij+ܲ+O-hChs5 SW0 R_<<P`)0SW  0PS9S00P0S 0S  09Q V?o20SKUNU5E Q5 IY`Vq``t\2 RE R; R< 4<i820S?,P; %+2j909909 ЍŁ01 +"+R ! R x EUY0+5`LlP d8  T$ `e !0S K PaG 00 ?#qp V00S x0S 905 ;#;S X% IK\+ iP+++'('B+Y+&+pɴ++47@-M0MS@WPP P P `ۍЍV0S60S 婿00P 60Si ] ""442hBh|B004488<<HHLLgBdBaBxx||IB9^EEBEBB:^E>BE""442""442T0ASy$yXxtxyXx f Pi PJ vPb|T0Sp40S dd00eb_ \ Y!"441RO""44"2"44"2"44"2"442(<(,9,T6TX3X\0\`-`+ґ 0# #100 0222#0 2 0 (0#(0/,0H0T0, X0/X0\ `0/`0d 0,d20h0005/(0, d20=S" " \" R `LrVCDS@"@ < #3 (  !0!x30=00 1R # |00# #X0/80\ /`0d 0 %0L0<040h0T! AQzyzz z29-0CS  ` R0 R R 0N\ \0Xx0- =09!`E꜈+lTP++'k+&C ('>VoеC-MB2P000R0 r 0M0 0S a쑟=聟0=P  RP 0AS^,}`|$}{}}=0=ꀁ`0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ 0=ۍЍt0 h0P0`0\0S H,@^+U+TP+x+؈++j('+ 4QO-AM30L(0 "S d#Cr0(#͡ A5/0(0#R00 Q#00Уh Z0 (0S @(#C5/0(0,0S3,00?0!P#0,0@* %P Aۍ<ЍP(0S #Cr0(#͡A5/0(0#r0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  B 0S 8#R00SR 00S \0l 9P tlx3  P8P0S+TP++&++'ڶ0 +\@-@0SS+O-M@ 00 040<00 0b@P 08  b 0@ @ H0LP Dp1* `P` R  R  R;  R  0 PL RM  R"  R`60S TT L60S 868PU),-}P"* 050S  eP% R P 0  t% R hh K PЍLU000L%LHW0S50S ( .40S  PP 0 0 8$$ ] ]W00 040S t 0  I$ R < #PU# R C :  0?P w 0x < <W 0 0 8|$y$\30Sc X \T 0 kI"0#P00 020S  2PU-20S P>$ 0  W 0 0 8,$)$20S 0 0 "P{00 0f 10S 403/  !TPYW00 0BX10S00S 0 0 8zw00S  0 /4\p 03/PU 4   p0,P [+&('+n'++P+A&TH]@^^l++ { \+p+_`K 3A-1(   0 !S@ 1 1R 4S8 !4|q04u|0`a@00S/ P0S  R+* RS-<P- !0 010000 QP 0PW 0 $P "P ЍPE"0P;C0P|;0S050 000 @ 0@0 0++TP+A+nS@-M|c0S pp岹lClS0S Yx0S0#00,0 R0-3 6r 0500K rP5"0C590C990C9000lP|n xh0S \2d"`2Q09T09 <0S 420C90S 20tS2"CC25P4n 0R0%S  P tZ H;#;S ;0``1 v0@%S ) <0+C? R 0 0B 0S \)P 00S )XK0STP=S 000Ѝ踈+'P+&+G('+++++/Tk+I++Ȉ+؈+x V߸i|+++-@-  t ЍЍ/('@- 0\ m 0P  0 84$Ѝ(Q Ѝ꬈+('+'x0p@-P@T 0P @ 08p,00S   @꬈+!('+I'p@-@T`P T0:pKP 0S 0@P+p@-@PT0*p3P 0S 0@TP0@-@  0  xh 0 dP0 P80 < 0@ ( +]fox} +@- @P @0 40D0Q3rЍ+('A-Pp` cu00CS0@ T 00CS0 P yTnTyDo0 @00  0 0 S('Ԉ+'-@- T sL00S @P@0PЍ@Ѝ/('+oR@-p`P0@T$9P!0  ЍR0@T<P h0 X@H00S <U8 8 00p@꬈+('+'2@- @  P   P  P  l$P l L\0QX X , H@0TI('pXhz̻߻0@-@MPPPP<  P$0$ $KbЍ0P+0@- M@ \0 00H H^+~; ۍ @-@0S g,00S x P 0@00ڊ H0DЍ@800S ,,Ѝ@Ѝ*+>('+O'C-/``@P @Dp/0S Ѝ/SpPP.0 0P000@-@0S  0S  0 000|00S  P |b H0DЍ@800S ,,Ѝ@Ѝ]t+>('+'@-@0S 0 000x00S  P H. D0@Ѝ@400S ((Ѝ@Ѝ褼+>('+'@-@0S 0 000cx00S  P  D0@Ѝ@U400S ((Ѝ@LЍ˼+('+ 'C-0M.S4P@A`p0/SS 坵0 0'U  卵  凵         p  xX  d 00@ @<=Ѝ谈+$qDL SZclszS@-!=냽C-PAx@`p P P=00 S00 ЍW00ro+̽p@-BM @P`0E CR V USP0FSd0  AS t|P0P S00@(; <ȩBލp+A-P@`Y|<0 OpQ|W <A+p@-Mx BP<  㛈 0S P  P<0xPP 0@ 0N^PS ! 0C R: p  d!  `.V$@1@a00@-CM@P0, _ 0   9Cߍ0]+@- @ R-00+eU@-$M0h ` ~_X @PHpP$ЍPU D0P;hSk+p@- M0P P@ Z_ Y{4`  O K Ѝpm+5j -\M0 P?_  \ЍrD*Q -CM0( -_ Cߍ/z 0`( "4`#/7@-P}0Q  0!S@d \i; ㋆!>T0 0d Do Ѝ0 +uO@-@T T  0HET ,=(Ѝ@q*  'P 7P P / //-M M? y-7ۍ Ѝ'4`00CS`0X EX0 X /x'O-pQDMDЍOp@x`pP W200 RR00u0PS0C000@@ Rp@T+ W-Y* U U %     ( 0 .N^   х  .0  p W8' +c: t3<0S/@-@PMQ PЍ@ p31Q``yXv00CSTTTTTTPܨ   "U2PЍ@M I!0S S/   9d0AS&ꐩH* <840  0SPЍ@褠    0x1hS fS5004003001 200j0CS PЍ@=0(0<0$0;0 0:0090080070060 05004003001 2001jS$ $Q Q ( xVPЍ +uq%9XjgtCqm+JRt}O-@R@P㺀 8 8㱀<T0 <zp<@D0L0\0\ Y0 DDh+AOU:qn+CU@-+0@-6S h+!@- tqnxkpdm/$ @P\" T> @ 4s, @! !0.x+t+@-销 )('@-0h@  0@ 0\0CS @C'p@-@Pp00Sp8PU``p840#U:X 0rX0X00P4080 0X0p`P -7@-@0 P0W 0PR*00B0 Ѝ0@Ѝ/O-dM@P @DPU 0 S [dЍ`p |0 J0]0 0^`[W!0 QW0  0  ` .0 V0B,P ~P|'A-@p帀`P@"!023 U 0 pp p3 >P@T0S0foP   Ѝqq-,ML0$0H00D00@0 0<0<  $$0 !('-7@-`P`@ T@ R 0@  g000 Ѝ0@Ѝ/&u+Bp@-PP@ 0S 0CS 3 00pw]p@X T 00 kQ, ,Up0SpA++KGA- M`0p0 V6 pЍ P 2 F@P 0 PP=6pЍAt01Sh0h 0XXpX2`00S g` FP `p+&L; q"C-@qM10`Sn1SP1SdV1 묁XV :ЍCVR 1S  @1ЍC <V,fp0S) S S }X   Q }X  @VЍC:   }X  `- TT( ЍCVЍ+&L; 'u/v9 ;De4 0Q 000/ +&A-JMxAM1ShG=pS`0 `P} c40 0`95p0S JލЍ;X P0|A7J. H00A1$L  $Hp`00P0 pP05p$~  Lq0S8j!10 +GG-p\Q `1S1S@1SHV$1$ 1SV <GV1S 0G $;VjS0  夠D@d0SVGX1S  RQ 1S J <EG V+&L; 'u-;=C-a$M0DSP@ pTp/ xP 1! }   0S\ 0S[0St}0S@@0 s4po$ЍpT 1S!0T0  rq 0 0CT !10!sr 00 0204 0*00 0"+H5O-hbM0弐SP@ mpTp> ,p},0 4pYЍ F 0[ H0S  |0S@0 3poKpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0s! 0 d ,S, 0  0$0(0_!008 0d,S , 0 +Tf0C-,M80P 唐R/ ~!!QP`,ЍC`@ @h{(0`0$0F P&++As +O-\M`o@PQ% 0rS P @0 l 0/0000 0 0P    RQ  \ЍS @0 J 0P@+A-P 0 5-p Z %v0 S0!v4sP40S$ 000    $ $ 0 `000`40 0 0 S 8pz'0S 0R 00C0 0( 0R RX,( P ,( tH0 ,p0 1wH0 ,p0 p g;㨀H0 H0,ppu0 SpHpP H0 ,p 00H0 |W: 8pH0 ppH|,p0pHu@P0P pH0 ppe,p H 0H+(&x q# L; &+uB +$!(2$ &j9JT]n$+&O-᰿qM`=P`J@Pp Up#*0Tp?SpDp00`.X/`P0.0809` R   1PST @`  s00 14@s0 ,&@@<@%@JJ pP0@ @00XW!3X0 Sx7 JRE0=(J@@P 8   8@8@oP T ,JP  oP+Y =y - 0S%T t 880Tt  0St0S 0zoPY@poP,T ioP doP0p40 \oP0p40 ToP OoP0p40 GoP |  p>o PT  0S0!C:P 0S0=PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0Q0 00S0&g04 Cm:Pꌱ,,,, G-MP?,04 ލP 0$CN:P 4@@/ {PY30S CSc _5PP /3 cs@0S0S PU~T30S4 0 P. H30003 0E>$3S3Q 0Q300?o2G&Q20S 2 0P0002@0 0R R00 R P (2<"00P0 22\ Q100?o2& Qy10Su 1pP0001ph, $e$0  QP$0S0Lr$: 4PU Q 0S 0S 0P 0 00000Q Q000?o2%Qx00S d0 0ZP00080ꌱ,#x ,h +D,d,,,,,,`,,/G-PJMM0 000 0``S+1 @ JލЍS2 0S! 9P 0S0a<PP V0  t1t p1 R0 0S0Q)Zp% 41 @T (1(;! 8P&Z@#P͡0 tf0S @$00 R   R 0D X't0P04qp %R0@ꌱ, ,,,,@,K,޳{0 0 0 0 \긱,0 0 0 0 R긱,C-KM MPh*|2 Kލ ЍP0\"Cv8P H2@@@2000(`P 2 0S@2媑 . P0 caQq0S 0S 00 i3@P -`1@0S ps5PH1` 0-P 818!0001 0K0S WP+ 00 000T   /o" &t0Q00S 0@0P0 00d0@`(ꌱ,x ,,,@,Kh +D,d,,,,,{,`,޳@-PAMM )0 AލЍ@PP0 ` pF xt0p 0hphp0+Z7P0S 0 `Xꌱ,@,, 0P/&qP@-0@c)000 W0ꌱ,@,Pp@-@PoU p pQl0l0 ;pP `@P00 P +)pq@,&0 @- 0l,,P@-)(0 00S/0tꌱ,,@, 0 @- 0A ,,Pp@-Q !0?o20@0`Q  0S 0 H0S P (00p`@tPPX0 LGP80 4P400 0ꌱ,,q@,&q,,P0 @-R 0,,0 @-H 0 ,,@-(@(0 = 00S0  ,,,0 @-- 0,,P00P0SA-$a q(00Ѝ AP0q?oѣ2 PP%P00\ Q 0S巏000P ,87`0 P0R00D00$\(  ,'ꌱ,, ,&@,q+|,0 @- 0?,,0 @- 0H,,P00P0SA-@ (00PP.p`wP0 `0 S   S  0S00h[PL04P < 0?o20ꌱ,@,& , ,q~dP00P0S@- '0 ЍP 5P 0Pd00}S`00S T0T0HP80 0 00( 0ꌱ,,@,,,,p@-0PP00008@PpSp hp@sP p@`'r2@ 0S80 0T00庎ꌱ, ,,@,P00P0S@- >'P0 ЍP8 N5P 0 )P0 ꌱ,*,@-M P'H1 ЍP0! -5P 1@@*ZP0P`p A0@P*0@!0 S0 0S P Pl0  Q0S P0 @ 0P000$0@ꌱ,x ,h +*`,,,@-P&0 ЍP 0Sx 4P 0S0TP0@P00 ( 4Pꌱ,<DL,2G-@PpHoᩒ @/]P510S1ЍG܍Za01n&x1 Ѝp.ZP+P]@PA 0|S@= 7@P1 T ЍG\lP*Z \ `0P0`ZZpʤP0 Z pX](PPP 0RP U5|0 @0P000 @0",@,^T,Q$Y8A- MP%2 ЍPO0S! 4P 0 1C\P 00|S H7P P 0t\l1@h@) PP!8Q@a@q@0S 00CS0S )0 0 S  3P00 T0000^! ?"Q|00S p0 00P00D0@ꌱ, Qx ,h +d,Y$`,,p@-PPMMa%1 ۍЍp&)`@PC@@hT),-W(A/P@a+P600S `垌00CS0 U000 01|0  0 1P(Pt00(a@ꌱ,V ,@,T,0@-M0P 0$d1 Ѝ0PL! 200CS0,P@0S0P PP P@S /_T T 0%0S0 @ʤ @P @PS _Ul0 ,0S0D @{S ^ꌱ,@,(d,p@-0p@P0 p@$\0\`0XPS 0S/0S0p@؋ $h00p茱,,,@,0Vp@-0`@P0 p@Z$L`LP0Sg/0S,p@趋 F00p茱,,@,lP00P0S@- 6$0 ЍP F2P 0h!PL00}SH00S <0<個00P 0 ꌱ,,@,,P00P0S@- #0 ЍP  2P 0hPL00}SH00S <0<E00P 0 ꌱ,,@,,A-MP`+ p@pET` P!+ wW+ q@0 ۍjB t,@-P#@0 ЍP( 1P  ꌱ,q@-P#@0 ЍP( 1P  ꌱ, #@-Pf#t0 ЍP 0SP s1P 0S0,K e1Pꌱ,)Pp@-?#@0 p4@0PP0 /Pp*ꌱ,,:E0@Sp@-$#@0 p4@0PP0 Ppꌱ,,S]Pp@- #@0 p4@0PP0 Ppꌱ,,joQoP@- "(0 00S@+ꌱ,d,wQoP@- "H0 <@0S 0S X댱,d,@-P0P@-000P0S "P0 ЍP@ 4 @P@$Q ]ꌱ,|(p@- M P"1 ЍpP! 0P 0#p`1`0S@1D0 0S 1( P-&P"0 0S 0@T 0幉&`Q@P&Q d@ ~30@ /0 @ 0@3/H0T 00S00%ꌱ,@,+ d,|`,k,0 @- 0,,0 @- 0 ,,PA-PPPPU㈀ !00Ppp@h0hPU00P0` 00T,0PA ꌱ,,@,y,h,P7@-A P000-00 Ѝ0P!0P%0SʰP 0 00200S@ 0 S  @2@00\+0 S +<4 /Pꌱ,,@, T,D,h,h,Pp@-@ 0?o20 0P t!00pPP0 00xP0t tS00Pd \T0DP(0 4P 0ꌱ,,,&q@,+. 000 0@-S$000 0 ,,L,,000 0@-S$000 0 ,,^,,p@-@Pp@0 @- 0p,,0 @- 0},,PG-rR@PpZPYTP`Q -`PbTJ -@PP[$$ UL1`H1@W <10S $1$!0$$ S !  U1`0@W 00S 0 0 S   q$ n$PKP`pP `P P P Ѝ,,,&@,q,,"2  @-u0茱,P@-j |0 p`P \00}ST00S H0H忇@PP40 , 00$ 0茱,,@, 4,,,P00P0Ss@- 7 0 Ѝp0` 0S P@P  0Q R   L 0Ѝp@x$Ѝp@ꌱ,,@,K,9WrPp@-(0 p@0P0Pp茱,,C-PH2 m@r0S424HP80S20S 1:0@ 唀 0ܑS C!!"  A   㒃# P0 U0CQ00CS0F9 PI00CS0J0 PAT! -PS0 "p` 00` Ѝ0 `` V`0 㓂" Q000P UQ00h0PEP00P0 0 Sp(0L{0 0 Sꌱ,, ,@,,8,8,8,x'?P@-00P0S`  =00ЍpPl  N-P 0,)qpP@ 0 $0$U000ꌱ,@,hP00P00@-SM@  00Ѝ0P  -P 0K)qp P0P0  -) 000S0000ꌱ,@,qP@-$0 Pꌱ,w|@- (0@P0 @@,P00P0@-SMp  00ЍP  ,P 0 0`P PPP 0RPvM@sM   - @ HG C00ꌱ, 8jB PG-00P0S  e0 ЍP  u,P @P@ 0R@1Mp`-|0 `@P0:0 00000HH0 ?07ꌱ,8,,,{PA-p 00`@PP P P@/*p0 ` S P@@ @00 0(0ꌱ, @, , ,A-p`P @Pd0 `AP 00[-400SU0 A@, ,!A- PP   R ЍAP   R   @0S00Ѝ@`pꌱ,&@,q8A-0p`P0 APPp@P @AxP 00 n00茱,@, APp@-fL0 p@00S40p@,„(@0P 0OPp茱,,@,R,0@Sp@-Fd0 pX00SL0p@D墄@@0PP0,-Pp(ꌱ,,@,, @Rp@-l0 p` RT0p@L{H@ PP0 ,Pp ꌱ,,@,, - BR0 R  P R hO-M$M PQ |3 ٍ$ЍP 0\#C*P H3HS`@pX ,3 ( PP@) 0t'` P0S 20P @B 0S0B600*pK\"l<"0SP$S \S00P$ 0""  0## P00C   BR 0 D)b0V 0=K@0SPiR 0PS 0 D )bA0 )K@P$18奃1 R ! R0 R Ȱ厃 &   尰2/ R 0S `0) P0 0000wX& 0`SM!ꌱ,, ,8,@,O|`,'X,d,,\,l,@-@P 00P 00P00p0- lM X00S \WH d0. P000p  p,`,f@,+-lMkT00S 0S|0 /SP'|| 'P>|0S |00S(1S(O 0 0 -=0S z_|P' (1Sh=- m)0S zOR)P$->N 0 C)00 JQH />0S->@ R*p` @,|0 RW|MP<0P |00|SL 0X|F0S<0>| ^ZPN = (> 嘢TLL, <<@0S  (1RS  S ;, 0qS 00S K? 尐0P{ 0Sx Q&븋PE`@P@ 0S :SPTEV :FF@PU h@h0S(1S h0S\ 0< 0 P\$P A%'P  0P!Q/1L1H1D100p P10D1S 0S LAT# 0S TMP D ZQo0 0 Y0S 00S P @S0L1%LGSQGύ00(!0R _@@Q a0000Pp9_/01010#`pP WQ0(  PdPd0S ! eN_Tp`HPVu  0g_0P0/TP90S ;PPxg/B` ` T  00S 0g?/90 S00?o2$PP0 P70S P 0S:%P 0S2%t7tG`pWGL@P3P)L 0D70<7P 00@T bD OP 00@T SD OP v00PP ^Np)F\P<ld'( P<70S"@h`V$$!&GV&& 0( g| &  `6 P6`V K?00t%1| `p$!&X50S L@F P<5<%<& h(%(5Q&&px0SPP4VD@X `50S 5 ` f&U 50S 5 ` V&V DQ&&p Tr40S 50|$De0P:xP0$ 0 PG  %P  о0 R$ 3000@ @p`P@ Pr$ @p`P@4#0  `P[; P CP3Q00S G[ [ 80$0 PP? P 0*S `Q0-S pQ P0000 /R *R0 0Q@00000S2 0(lP 0, o<0bN<0oP 010S}o# y+l)3,Z,,Q'6+,/ 0fAs p,q,, ,8,|`,X,\,hf ,.@N%bw , "ȣ&'+:cr|>i1,,,7 e =M ,+j,%,@B@p,,(@,2,,P "PP P M$P4Ekp00p0LP \P xP B0x0 "xP$0S S 0SX $0K?CS3 U 0S1 0 Y  0S  U  [U [ !h"2Sڄ"$2Q0S G?0 0lH2 SGAx2 0SD 30= 000Q00SvzT30 00 Q 00S% 30S0l003z0st3@VZ | |0S30|~|F`B4 RT<4<$<<K<4R P q`4`D! ,4L4p\0ǟs \0\0*DpPU>  I%P>M0 t0 z 2t RP M0"0C?o2? M "t"0A0H傻~0t0t0 R ;R TtHP 0t0t0 R RU 0S;0S(0?"( ,0"-p0S ?0-U0-͡P!͡!--R0m "0R0-͡ 08$`P#PPp0Sp0Sx60S#PP )%&8000-R0040# -0 x(D @@D pL HWMHL P #P V |d R|70S x70S|7xP #6p0S PEU0S gB  1Q 0!PZQ= 0 Q0 F#88 88pŸp U00R0SG PsPq  M$P GPUc e80Se8 Q `( Q08 SU9#N=6 <9R-sr VOY-pQ!03/P|p9@ 9 R09PFTJX I\H`G'#0S-4:| 0R/G0S ּ00x0S xϼ0x00S ȼ000S 00lݍ Ѝ0S 03/|0S |宼0|0Y @p`@Y@p`@s@- P@?P  ?P0P gЍpP`P  ?P 0 FU 0S S TP 0S 0 ?0PP Ѝp@W@-M0h 00P P10S 0S00 0 Ѝ5  qQa @T0 S 00S 0s 0 :!P 0 S000Br@T hFP 0|S 00 0S00 0000( ,d, + ,,Q@-$MP` @0000000[p>0P/S:S T>@ʻ* L v`&8 p0/0L@P/: L`P ᚚ@姻P $Ѝ@/000`0 ?@PV`@00l0@@DcT@@0$0@0CcS1S@As 2,PP00/@-K,0 @  000J@p,+@-Jx0 @ d00S X0X0 p  <0000S {J@p,`,@,+@-J@`00S T0T0 p 8 10 10S WJ@`,@,+l0 @- X00S L0L0 p 00 1010003p,`,@,+x ,d0- lM@ Hd <000s  p,u@,+0-@lM@n 00 00 0rS sS tld `d ^T000s  n0(d p,x ,+,@,+@-`PP@ 0@s8#80@U 0s8#8000@? P VU 0A0T00Ѝp00CS0 S0 S 0 /O--LM|00?xp0  W`"?p0pW (oI`PPV0W B8a8 (0,0R< @ 0PZ0S= S0Dl0Y 0   @P*I0S I0#S I|0Sp L1 R 0@@0`5 pP`5刵P<000CS00 S(P50S5U <% 00e y20We S00G00S,+ D0S 0 S Z000S800CS0PP00CS0l0d !C20 @P00CS0 00 0 s`83 ap0SS 00   00BލЍh3@@<30S VW@@ c030!Ѿ130 V S$ " R 5U Q Q$Q V RV"d 0墾0H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U0    0ZR2@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/+ , ,4 ,, ,@,8 ,0 ,C ,,,ƴ',-A-` @T 0 ЍAЍ/p00$  P/xLs1l0 h BoB0S@ uP 5/0 ,!,+ @p ,wO-FMs M`@  @!F F 0F0$0p3$ 0(00,@U0P S RG80 ,ᖖ$3 @T0 @,Q(2@@ಟ@aGT  z2  T 0 PD0P2d JP x"xd]l Y0S 00S DD 0d P PP d⩴@0S00?o 2PQ E06T6D01@ @app ဴH1p4D0(66S0d000 d0>(5 A  a/0PS P 7P 30 00S 0 0OP@ 0 @0 0@p, 0@Fލ Ѝ+,C,,,@, +\4 ,0 ,O-JM$GMs~0`0WXg700S00p 9 PX 660 9Pl`60 00L0 97S\4640S# (X6&0S0 0]%Q0*P! R % BR$5q00E0S P,97S9 5qR00\h%h0.0 RS0$000(0000  0 PV 4 5X )0000Y4qq40܀C XSX t4000C 0h00d0$ 0`0 lT CP $4T!>\ 0h0d<` ((0# $0$c#!$c4"($ <7 $ &R 30 R0S R3""4408'0PT3Xi97S JލЍ00000 0S  0 pJ8'P\20 00H0 0  C pt 087PT忲97Y^ SЁ 0S [R0sO0010S ;70:70?70='>7<8T0S0,< 00 00,1 GP!1 R  T 0 0ZP 0S 0097S0 0S} [[YX  SS00000 J+,, , + ,,d,, ,,,@, &8 ,k+,Sz+%Dr 2@-`pBWLM LЍ@ pPk  pe 00011 0S<0 |q?!( ( 0R0 0SZ=9Q ='/@#b?!"/p87D0S 3D0#S 0(60 8pp #D0S D0#S Ʊ{ pmp 90S0 000 0xLЍP4F]00,, ,Mb+A-0Pr@L0 @2T ` R]$B P 2 Q  ,00EE?AA?R1 $!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 0SR >0 SN , F): 01RS 41S ,00-S 0S : ʹ:, ǴD0S , Gߍ(0SX: <0sk@0sl8JP0080Sf40Sj9 9 9T00,0S  T,  T/00P90S 8>0 S,P,.>0 S,P,H <90SD09Q0SP@P=D0S! 0S'P+80S (P  C <8(p80sSt8  h.Pw 00S @#Pl4\440SpP 7 7 R0YgV41SC,8P!700D74! @7 00p00zp 0: S &00&0`7 R,T7T'TTO;,00|S 4@,000S,1p64! l6 680,$س000S6,6R P ĭ|6V!6PU 50S 50SP5P50S 0CS0D0S 5  0p0 5Q,40%p4000q005P001!/PM!=0 SF4C80S 8003/00044L0Sx4 SDQ 0d40S 8 4R  qp `%,'`0x0pw 4, X@(  ( 0!jp偪P,\{D0SC4 00CS04ppe WL0Lc0L0 W(s=s 0 @0 0@岙P`m T0000 0㥙P`0 00CS00jpV P @`0 0@#{%0 ? 0!%U0  S0  4 000CS04:p WH0S, 000@ U0400@ R<0 S81000@, s4 0p0 7WD!000hwwe0'4 0pf%P01 0#l@L `WTg@00S 4 .<@ 00S 8003/4v,j ,,,,{,D, ,+ , P Q,@,*,,As x ,@,tD,, ' ,=3\6(7+,,ԙ /0dg@,FQoP@-X@ P0 S eP A0 @ 4 ,,S@-@i;0 ̱Ѝ0 Qp@-P,@P@p>P @& - BR0 R  P R $@-T@0SHP40( $0R p 8+'}<+@-T@4SHP44( $0R S 8+8@,q0P  @-PU @W p`W VN ^ Q/8&O-@p$M`x5T oTP $ЍO+T 88@DT#$Ѝa1 !Q Q@P $ЍOW 8S 0S P0 0 0pP  P X0   03/ , ذI8+8&81($Q!QQ% Q( Q Q QI @-Q Q("^*  ^    0!R/\^^ QQȃ((R ( R (@ ^@ "^  Q(/(R ( R (/8+̣&p@-H@H0 (8@08080$8P  Up$808+|`,| ,@-MAa(8S e0 S 1S#LL0) P p p( $8S 80pP U 0S ,8S te (8S  JAp0 08 8$ 0p3/48S 0S 3 D0R <4 Ѝ8+<|`,x'4, P/ @- P0  P Ѝ@-@@0s,00p E0CoУ&@,t4t$0 00/O--KMPt0 P 0 0SZP=9 =: k{`Y0 A8 P@  A{ QP@0I03 3# `#(0E{x吚Y`ڐ p(\ d(@#Z43(004# 0f-` \( P(Z (f" 0`< K( ,,,,@,`  < , 8 ,    @-0(@( 2+P[h, # s@-Pwd`s T @P @ @P,@_ЍpQ k  @-@P脤,0 A- 0@0PS0p`0밀P" P 0S 0"S0 R S  p`"R"^ 0 00ꀠ, ,,,>,8 ,p@-MM P  4`F+PۍЍp@Pl4/Sd# @ ⠧P;0@TP/Px O-@`pPV1@@P`3:*`E*0టP Y/  0-#PT@1SZ 0 10S 0[0 R ;#0S*00 0.0 Ѝȱ,@,@-/P0P0 @p pP0 0SP0 0/@Ѝ@,ht@ȱ,P  P @-APx0000Q/`0000/0S <S0C00S/ S/0C,, ,,0@-0 00'  R Q 0S0000S b0C("( R S             Ѝ ''@-`$A0S0 0 0 0!0ὸp 0S:S50P0S0 0 00 0᥸p0S:S5000l d0TᎸpT帜000 $0$Ⴘp(嬜Ѝp ,  , + H G-@㌠pA\`^ P \T1:00"^ ^ N W\^ \ @2O-pဳ@`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V0% V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&d,Q,|,q,,/A-p`P @-}P0  T  `00T   0@ R   `FVx`00CS0 ታ PpTL000`000 0 ST00e s x' A-Pp ` 0崀 @TC0S  _X$ (0Q`$0SZ=9Q =)/@#b?!"/0 0p7,0S ,0#S [,0AS  T0 0000 0p 0S ,0, 0 ߴp@@qX80T 'kPw,<00 , ?  ,Mb@-@Ѝ@ҵꩴp@-P`L@R'P@ 4L'0P@ 0S pM N@-H P  Ѝr@-{xP@-x p  ЍP@-P @-0lMPQ@00 00 T  40S P U00 P L0 0g 0 lPIcsPI 30S @@@ `\  P `(P@ 0S  M@P@  c*  P@ X*TN T z2 @0S 7 xס@p0P @P/T2 Pɡ42 P ԛ00 PU  %* P ś0 0PU  *P lЍ埡/m0S @P@$t )0S @P@f )T 11@T 0 0P`pV&PP)Y000tk 00 0@Q XHP@ ,.$ ,@,,'ON,3x'( B(|,D,d,, ,8,|`,X,\,,,7@-P#1 Ѝ0Q0S 1 1Pʐ! (0 CRtA R hS0R L1P 0S48,S 0)P 0S 10S 0 0ڠ@ @0@0 @0 @0 @0 @0 00S 0 Pꌱ,d,,[@,,|, ,t,, H,D,@,,,ب,Ԩ,K ,,:b,,,00S@-0M@, (0 P0S8xy@@0Ѝ0@6,/-A-0000S 00,S 00 S00S 0  P 103/P ᇬH0Q  &  000000P,|,,\,# ,_&,&1,,ySiAuBk 0b&\,@-]& 0 ( T,@-8 0X,,P `00CS`0p S00 P0S X0X /Xvx'C-@Pp  l18C8S t`w ֮q0S  0`V $ Ѝ\,&T,s,@-@&% p( P@ cP |@%%Ѝ%%X0/LA' P<00Q,Q&('@p00@- @MV1P8C8S 0S N EL A@0 Z0nS 圛Ѝ08,& @,H,-\M`P { P L00SD0\ \Ѝ!Pz@,&@0@-@0T e?K 㲙P,D0@-|AT 0S  0  &\,@-/8 LAg& 0 PЍ& @-@0S S S 0\ \ \P \ @P0PA-@` ?렀  ?p  ?x@P P@T*\ЍA}?01 !QTUQ s00ߚ4&tG-AMMP`PqB|R p2 h2h ^\2\ w 0 0 0 0 k 0R  0 S"徹$@D`’Ppᨡ0S1 I10S00 0SR'@@T  T H?D1< ȠLȠ\ 㖒 P0 \!1 a$1AލЍP0S S  S0 0< ȠLȠ\ Cp 0圠0CZ ӬZ <>0 @\,,X,8,kH,, ,,( &,@,0@-EM,P ⻭P @P>Eߍ0 ,PP ֬ Ԭ ¬Ϭ #x0 <  #^TP凭幬 m>0)?L( &m3O-PM t@`hfp`p#T#"D3D uUPE,ޑp S00CS03p 00R0S eP18C8S5 P1 P8C8S 0 0 X'VPp2d2l18C8S  70 P\S,18C8S 2 0 S 18C8S <18C8S pUl18C8S 00t1  RK\1P+  X 0118C8S V`F(TP`# (#<18C8S0 㶫 xЍS R   R^SP0 U0A0QLLD=8,\,k( ,H,,&\,T,,@,,{p@-BMd,@P4P1 Ho"",!+ 1  ~PPN=`1";"Bߍp [@`⠷UP|@ȫū+"""<i8,k ,H,,?&@,,\,0@-4Mp@P`k0T P<<0000<<0 P L4Ѝ0\,&,0@-4MDP@i4H 0 P88 044Ѝ0\,&@-MD, PJ0A p 0 001 U1 010000 0018C8S 1 0118C8S1 011t 8C801 012 02 28C8S܍&8,?&qT,@- $@$孫@ 㦫\,{t zt @-@JT@=p@-@PPpP p0@-AM MPAލ Ѝ0PU0!ުPPl1LAd1T@G8!0Pfu1+©@ک tU 0 0S S00 MT   T l増t  10D0 S B/o" R  0Cq&,('Sk,@-MxP Pppp pyl@PL\܍@貖P, P ܍,0< ,`,-L&0@-MMP P%@W0@SۍЍ0@;P551d d:PPTۍЍ0@tD 5 4  ۍЍ0,C,K-dp@-P ||G P dd  PHPЍ@JD@Lol18C8S(0Ѝ@ԋЍ,r&\,p@-P MP)P0@Sۍp@:5P5t`@P`ۍp@T l!5(B(R< <  4 +ۍp,,r&@-LC('O-P4M <5p88p4=0`~0P@p0p 5 % mp0G$t `V V Q 0 *P$0404`` 0p$pCh6P`k pXh TTD T<<u44 U ! R ! RK ғtS)`S FSJ (9S /S 00C 7'pa0CSE D E D F D D F D D D F D F F E D D PF F P{ES 0SvePS43@P{ Pe @Pb 2 P200T2P  PW  PS dPPA d2!00:P2 2 0030SD$2/ $ $ P %y9!,00!0 ء0 &0,P K 1 T T@!00!!00PP@0  R 0 " l T&`&,,,,|,,,EQa1 u,(T,z&_9HAm~ }$ ۂu`,h,&t,&x,p,d,l,*8 `,\,X,@-(@(   㣐('! @-0S ㅦ㐦,tT@-00CS0p0 00S00x',@-@%PP6 M,[ w, r(,0@-M0Q@00 0  P 0 @P00CS02p0  h00S0@oЍ00 0 P 0S*000,Q tx'Aq 0S/S/0p@-L^?P\` R DQ t pl R `0QR@  0R  PT,GPP<0  dÅe"ÅP^ @?d" ef"/,T,A-|mx@xPx`xp 0TS 0T `0h2SlZ T 0T* 0 P @TX&&Y],0@-4M@Pl 0<, p"lR < 0 2  8-C8 S  0"!8( 0B(0R><r> 0u4Ѝ0,&@-`0S@ Pu0S 0000q20\@,l5j 07@-l000Ph@ R R l  R  P4Ԑ03/ Ѝ0Q P&,L&tp@-P(A(a1S 0SP  AP00pPP0P  P0 P P0 t pDhf0X@X  "  \ p0&,W_'> z('ԥ&a,00@-18C8S 0P Z㱎&h,(0( @-0@  H,,@,p@-BM` P@0 S`0018C8ST01y0 0Pn00x0 BߍpB/ BR 0Ԣ00P y0001@,&h,H, 0?o2 0/&H-AM M$r$00000a0P01 ⟢Pھ0  㓢P 0SS WS BSq1 +• P  Sq-0S   1 0S0PY @18C8S Ԡ0S  Q@ K|PY 0@^ST00CS00  S00 P0S8,X \,,&,h,p@-PH@P@pP P P @&10/@-鈢o/A-@PP" p00CS"] ^ ] ] ] ] ] $^ `V PP P0 P00TA3 0S P0000 !0S0R 00 GV< `00CS`0p SX0X /X0x'7@-P\A00C!S 0000CS/@_ _ _ _ _ _ _ _ 0 "S 0S!徎0 0P0 T 0 d嫎0"S0P0 Ѝ0@/34堎0 0P0  Ѝ0l,t,=c[0@- R RR \R ^R^@N  @0 N@T 0N@T!0N\!, n0^00@ 00S@kG-@|P2 pqp =`P`PP2 00PF 0P 89 V @P 7@0S@0S200@PP?P PPP P  0!SP"2 v l,[&A-M@PP\1  } ᪎@P `p崀  gPȝu00u0ۍ0 eP 0@ 0000S ᷍  P00 Z&,p@-`@:PP 0 8Tp(PC@p s@-@P`@T働Ѝp  ᵡ R 㮡| 㪡(R( d0P1P @O,P ,K'P \,f@|xt yt p,0@-M@@E0(@,0 0 V@P 9Ѝ00,x0 PPP P0S 00@SPe p,&\,@-(,9p,@- @@} :hkP q` 冟0P3P xt_h \ sUD 塟Ѝ\,xt yt f@0@-4MP3P4Ѝ01<18C8S 岌A5  0 9 0H 8<O4M0 00E, R.  % !8P 41PP 0(0S"=Rp00ESh h h h h h pddb`\XT HUK&!\,'-[38p,s >IXe0@- ֞@2\,[-@-傆0 R   ЍЍ/,-@-rr-@-bf0 R   ЍЍ/,A-ARp`P@1T ᛞpPPG`@DO-P-\M @hPb0P0 0 ( 8$@ P@ p P @ `00, $0S\  R?$0SUXN LH P00P$0o0$00娂0000Uk l l l m ,m Tm tm m m m m m n Do o Q 0S0nW U0S \ЍP_L4 @` 0C$0K PP QQ F 0CP $0 Q 0CP $0 0CpP $0yWPv pG   0CpP $0h 0CPt $0`WP\  PX Q P0C $0P  PL Q P0 PppBW P>"80 G0PI  00S`n n n n n n n n 0 0(R00S @` [7X0 (r  K   P  0@0o 0[ 67P8,00SX d P80C S  R$0PS  P0C [$0 X 00 (c 4pl>@` UX ,2MTj|(NO--lM $ ˂`ȂPVPP 8@ 0i|  0<0hh2 @0`2 @0P 005H@P 8 @pP YJpP@0S( P @p ۄل$0 lЍHp<`@40S(   Pt  ( (J( 0PŸ4 0BP,0BP<  B, ( ( ,0pRQ@p(S<`@ 0GP%<0%800%4000 0(<0(800(40` 00K  P$@p(&Mb5j SkvC-paM00PS@ p.0 00 qp  5?sp >@0 q00`9 Ϡ pppppW0@0 @ 8@Op`6t00 }>0?@` 00 S @.  C< 80ЍC30(& ' p@-M_P! 0: S0 0 S P@` 000vЍp p P @TPT0dHS 8$    _,*O-]M0 M-SP0S 4P ]ލ ЍOv/x]ލ Ѝ謄@pP$ 00S0W0S 00S[\ ` .pP@  @pl0: S  SГ0S RPP Vu ^W ]ލ ЍON⾜P Q|B0v: S+%( `P@` P P p  00-00 0  0S0S`-P`Y`vL`0S 0 'P V P z{ RyRwᾚpPT 5Px!1Z[ h 0ἚZUរp`4 0S!P !000vn P: v?b 7 0S -v}pPv尗*P-Uႚ 0S }p<m,(&sJY ќky  0 L; j x'0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000@- @P@@ !P bHP00S D00S 80 .H"TZᙅ,-4,,&@-[J@-΀Pp@-P@}p 000/,p@-P@0-S@@p SIP0Tpp0p@-@0@MS`P0 @  g P@ЍpPU P$ X00PX&,^D @-@P @100S@,@-@P$00SЍ@Ѝ,A-p `P@P000 P P0 0 q@-@P P0P00S@ ,A-Paq`MX> 0S; [P2 @@?T/  `00 @ C @ H00 *S 0 000?0P?ZP10GG>P  `Ѝ^T 0@-$M8P0S 0@@$Ѝ0X&0 0/,0 R,A-`0QS`0@S@ qp0CvQ P%0 0@R*20 R    @ @   " @@900 S005f:Ph09p 1{B   `! R !V / R  Dx1 )ϬV[C 0 -R  UR +R  `> Q?x0:S >p0@cS .S bS S@0,S@pS wS< O8   O 3wP ^@PZ@PV@P0 0 @ @R0w*PP%PP  PPPP lP ]q`H,T,`,l,``D,`a9aDa&,Ma[a,aaa'#a)a/a4a 0/D,@-  01SP 0 Qppqh ЍR @0!00P< 4 Q 0T! WD,: ea,ia 0S 0S 0S 0S P////// 0S# @-@PPPR0 `0aR R S R0/0 R /!0 R0S //@- @P< T t #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* @!A-!@RQp0p0!? Q0*=#=p00 !f?0Q 0*--p 0!? QP *!p !\q`?`p`ĕ @?@@D,0p@-P@P QT4@pTT@DQ`V D@T0t0S :@D,@-@hP\PLP <00S0P,,ī&-̫&@-@hP\PLP <00S0P,,ԫ&-̫& Q 0/D,P7@-fp Ѝ0P@JP @ $EP0pp <d0T! _PP <0X!T 0(00Pea,iaD,@-@(6P1Px,ܫ&00P0bA @SP//D%A-R Pp `@X@@Ѝ`BP@`@P0  PP@@,A-P` @P x pPdT @P 8 @sT  Afeeefep@-Pl@P XdPpH_Ppp@U p@PpfQ# O-MM`p 0@P P0: SXysX  RP $ z@P> ᲈލЍ R R R00 P@ P PP @ PP 0"SU T 0S0C0ʡ 6/ JRP 0mS P!fл&Df5f&=fP P / ,0@-@PM  ( 0 BЍ0A-@<`Pp R 0S xp@Jf@-P , `@ 0P FЍp,@-`@ (8R808Ѝ< 0 CS  8 0C 8,,p@-PQ@`0 0S S 0U P 0U xVpP0S l` x$0SpD8 xp@ p@xRp꼻&5f=fkJf(0 ((((8 0 ( /,&0 ( (( 0 ( /,&C-@R뼀`p0S Ѝ @tP0S0S P 0 ( ((089 PP00D,,7@-P@@@@00S Ѝ0 =P,s@-PP@X:`8 R8 R8SЍp 0 80 S089 8 0 8 00S088,p,p@-0A M008S/ 0  0S R(0 (S8`0P00 0C?UR B( 0 8 80C 80 CS Ѝp 0P,p,p@-P@`8M0 0 0 00C?UR  0 R 00C8dЍp f0P0_0S0 0,p,@-@8 R 0M 0 ( 00R0 8 80 8[880S Ѝ0CR80S * 0SE808,p,p@-p@XU J8PE``VH0 ( p8Soppp,&(080S @-/,p@-D@0S PX%8 P 0( pp,&p@-`|P@p Q0(0p0CR0R:(0 ( gp00,&7@-@@P@P  AP Ѝ00P$ /,0S/0G-P0`Sp@U!@000pP @@@ X GP00pp @ 8P008-P R/X-@-4@$P(0,0P $8  ,&H7O-P0P 0480 QZ`Z ` 14 币50 0 K 0 Z@5X A (,}fp@-t@Pp$R0%S!S0C Sp S}    `     0C Sn        4 L 7S ESM /Sp0  00 0pp@!p@G?0P S+S@ AP l0S0pp0 p@0 00Sp p@B0!S $P slw$t00Sp$dP`p@&L00Sp7D00`Vp(L' p@4p(,,,fqff7@-P0(0@ Ѝ0@k(,s@-P0@@@`0/00,0S V LT T 40Ѝp@G (,ۄ Qf, p@-MA0 70000t0  z0  u0  p0 k0  f0  a`P0Q3 0 SPU0 D<<H80 Ѝp(,ffffffffAs ,@- 0@&0PiP/(,< S /@- 003 Ѝ&f@-@0 @ (,|0p@-@M@T 0S P0`P V@Ѝp`F0PS ,@-@`( 000@S 0(,@-@@P@-@O-0O夏0?堟0LM0?0eP0儯p0Sp0 !0 pS @P?0S 0S 0S4|4/P P ?kPо0S P @?[Pp吾0Sm80pS$ d1s8p0SeUY`8pWeUC0S' /S S S] S[ V V7=P 1[ 0S c:z1B q"17S> iS0S` 0 8Pl `Pi MPf 0  0{P P BiU 0EcS h ` p x ` x p p @ P D D d T  P t p p ( X  | 0 p p L p p  ( p d p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p l 0pF.V WppVdP ePO`>, 0Spc 0SP0@_V0 ,0Sm V V000#=V00S pL W P+V@  V !VQ00-VQ00  @0#0jP P 0 a0CS000 p.P  1000P 0Sa0@S @GP{00 0S WUP \ 1i,0 0@0S 0) |-]3P 0S.P +  a0FS000 +P ,0 /-S-PVV0FS񟗘D x       ,       z 2*V @V !Vy|70Ss07S0|9W0k 70Sf07Sc {07S^ p0x'#  /10@S @pph07SyF P 0S S60S `PP p0S860Sp#0CSP  =P `0 eP0 S 8&0!R0*?0e60S  eP0 S %0!R0*?0J !R00 !ı>t50S!R0w !R0 0!ı+ ( 5 "5 !R00 !ı40S!R0O!R0 0!ı !R0*?0\40S @40S .P0 S 030S x0 S 0   o #8f!SR0p0 !00pV0S0 !0<00 eSd0C0<0S 0d !0<0<W9P02P04+)0S 0!ı2 v4P00o620S 0S 2@ 1D 1H  P 1000!R0 0!ı10010 00!R0 0!ı3 0< P0000!R0 0!ıj P P<0Gd,g4g,Jg -`&Hl|-`-0-t--- C^&^gQ~gg,ggggqfhx-h h,F-h8hEh,Qh& hgYh,\-p,0,jB -800SpRlPP3 )P ^/  0_072!5?P!R0 0!ıP& +P P !lR0l1l10|?P!R0 0!ıP !R0110!R0 0!ı'?P I}P>qp ,2 !R0 0!ı(?P`!R0 0!ıP x2PPcP 0P0,P;`)P 00,00$ 30SW(#(U PD0 l`P V V ?U!0 >`Pt V Vq  "0 `Pd V Va )"](40S 8%`PP V V.`!0PIp$p %(`)0 !R04 0S40գ?0/0 $0 S00C05 !R05 0S(50գ?0/0 @%00T5 h50iS ,0 tI50S080/00S/D,p@-@/!PpO-S`M8Pp`m`@ pP Z:T00)1 0T S@D0X0@D@Ѝ0 0 0S00P0S 1 0BS0 Q 0R RR R0S 0T@1 90P R*0>0P    eP mf[0J0CD,0   /G-pȀWY+p S@0T @PPP ZPPE0S`0S P B 0W 0R R@0`dhM-@Mp @U00PC  RT0Ѝ `? `8>P ?0? `P=P@p@-@R `P c0P@ @@@P 0p7@-P@Pe0;SP0;S0@?@T AT `00SBC Ѝ0D00SCB0mS$00P#, 0 4-(,,A-@P`pTF  p\@Q=QQP gP3 @P% @@@T AT T e00SBC00SCB0!@00CQ#0 DP|dP fPdP Q gR  R R0  0S E00 i4-(,,@- @ @t, @-4P@B,t,fh @-'P@5,x,hG-P2@T @Ѝ{PP' P0`{@bpP 0@5qpc {{?V Y c0I0 P 0S0MS0+S0GS 0US 0US 0UES0UnS0UdS`0FXp` 0 @vT cT eT G@P 0U~ x@T@ 9@P 0Uc  +@P 0U P+,,hp@-`l@PPY<@,U<0IV@ ``N<D mP|+pt,h 0 t, 0 t,@-h@ P P  0S P Ѝt,Po/@- B+ ЍtA-`QpP P P@P%U0P 0 P l @bT @P 6/Pbhfh@-~x 0pl ll0P \ \D0P P<0P@04 4 &&i i"iL 3i@iOiXibihi@1C-M0SI ,10SE 10S@ P` p CPUiP@ Pe@ЍP@ 0@Sd@ 0DSd@ Td@ 0DSd@dT`P PEU@4,0,8,C-@$M`0PSS000 @ R S#\R# :R RDQ Pp iP 0H3/0S@00$ЍH!P/@- p ( -*aЍ00S @  h *\0PT T ' 8Sqp }it-iiiO-@Ԡ԰z`IPt0FPPPp R ЍWpV R  0h0P@p U  PPUP@QpP RpP&&p@-@QP >0S R SppQ0 QA QR P/@ PRP/7@-PP @P *T Ѝ0@A Ѝ00@-M Y+ x@sr  < PP  & 000Ѝ0,,400S/@-$@P P@-,@-@P  ,P/ @-p@''0@-M@'xPx00S@)PaP DP OP AP z)dP oPi]|0t00SЍ0 xPP0 00!qpx00@(,i3j@&wjO-M(0S p0S v0S@ R P 4W e` s@~ P 00 P``P`P# PP  P``$0S PPP40SWPTAPQ ((@(#`P3P00P0P0 xP0P0 @P X l( ` 0cЍxP-& 20SP TP   @( YP wPY |2 phd2 p ZL2p@20WF0R,2P 0S aP ( yP11P T@E&0S )/1 \ AP H<P h1 P_L10S T_ 010 (0 qp 000Sp 0 =9P =  R0  [ R 0qf 0P: l X &,,C^jQ-j,tj,,--,,,0,&-t-ܾ&jP0@-@,00@-&P u'@,jQA-`pP`VjPU@JTkkP0t- 0 ,@-P@0 @ , 0 , 0  ,p@-P@2@P Pp@6pp@-@#`)P)PpVU p@ Pp PpA-@Qp`P r^^UdG-M@ܠP`@PUЍppPq^60SP f^4p0Si ,@-V 00S  Ѝx,0 R/%R%Q sQ00@-(@0SP00,7kEkG-`dd@p00CS0 sp PP 000 P U 0D IS  Y]p@P@- 0Pak{A-@0 0Rp@`0S00 R0S@00`P0S U  dP@00&&O-MpG@ P~ 1 !`Q[ Z@qP[@P* 0 000p0_ЍPP P I X0X P VP>wP  WYP00pWp&&pk@-@Bp_PPP Ѝ@#@ @@?L0L 0P0`<] h@6] ЍVه A-P@Ѝ0S `pPPP[@P D00@ 0`W uP]uAs 3@-  ЍfG-p@,,`P@0S P@0S0# CV* UR@ R %S #SP @# C V* WR   R %S #S 0P X@,,C-EMP PEߍ@ 0@qp `,tPڬ嬐P ` P:T0S EP @  y0SpS`P  P@D,-A-dX10S@GeD1 RpP? ,4Q 1P````P50p0000 00Ā`-\P@pW Zp\W P@0S\Ѝ Z\@,Qkwk&&kk\@-  R@@0T P@p`P[@[[ Ѝ,k@-@<tP 0oP joQC^j@-M@P ѳPۍ@ ۍ1G-0S@Ѝ10SPp0P  B|Q@ -Q@ d,P >P @#`PPM PPl0 Bl[ ` g[V X P uX%XIsP ၇X@@P@T 0p000H@`@P@g0S8[@T-,gQkj0C-`V8@Pv P0 P ЍCm#d`apP PP@0 pPZZ@ZT  ЍC Ѝ,kk-M 8tP  @oЍ0@-P@M0SP @VW tP @Ѝ0@T@0: S *@V-&&@-M@tP͡00 0Ѝ0@-M0P@| sPh0  R\P0  R\ tu p0St00Ѝ0,,,/@-@>P P0@/R@-@ (0@0T#0@ -@-i 40 R\00S@@ ,-h00S /pp@-qp #qpP@ TUpp<,@-P#P03#0 R/  ,O-$Ma0So@Pp0S\0SPc@HqP@100CSc$ЍPp@ 0S#P0{u0 @ 0嬐00R᠀000  00 0 0 000000 0000PGt P - -p,(,,0,O-M+`.+000Y J*0Xs@PY ЍG"V V ((,--,X-O-M`P P @P! ЍO!qp@PV00SЍO0A"P00 0@ZЍ"pP@PX!p 0^!qp0 @P<,(,t-A-p`x!qpP@VЍAxl!0  0@6Ѝp@-8P@0SPpTqp @(,0P  P/0&0P  P/0&@-P@p@-@PptP0S T0 0S @ 00C0uWsWp@pW  B 0,0&,0/,G-`Pq@T P7) %Y* LWHGWT$8;@=z0 "0UP00040000( @0@000S 8 000@   00&,P/P // / /00//0////0/0/p@-@4PPP V4Pp4/O-M ؃dP @Pt@@ 0000 0 *)@P" 0000 0 )TP0@=TS@>0000 0 )@P*ЍT <ЍOo O-4M(0@X0P ,0ut @P4Ѝ40SW400 ?Q_)(@PP8400 0gp P9n  s [0. L^p` P P@sP3v V{ `9V@P,0S2 h3pW2 p@P5)H300X30- 0$ `P R $0 S S P P `[Ɵ`V: P `T_@P[ p20S  P0 (0 S 0  %PL20S @0  10S [A; P Pb p 4ЍO V P0p 0PA R L10 Pp``81`@P p!pW 0 0@P_ V V@P P P P P@Put 0x 0@P_p~6 0S V V0 0 0S e@P r`0 -,<,t-p-0,X-`---@-@ X P (0 R  000Ѝ0,O-`qp`1_6qp@PA40 P0T0A llx-0 R R /p@-Md@M00X 0P`G P*`0 ?000pۍЍp,l0+p@-P@@Ppp@-P@ \R ^R3 R   0 tS(jSbS> !0CP@0 S 0d# S 0 Q$DpkC P= < < = < < < = < = eS  100C000@PT SQ  p 0  p@@p@@x0 00 0@l@p@`@p@T@pQ 0xS QSDSp P1So BS0< C^R`! 00 0K0S@@@pR C&Rp? > > ? > > ? > > > > > > > > > ? > ? ? > > P? X? > > `? > > > > > h? > x? ? > > ? 0@@ 0000 0000 0LS 0 0 000 0000 0 0 `B0000 R      R +,,h&" [E  mqmO-`PAMM@A`ܕpU!p`9*(p5*00,p<00*pQp tPhuR d"WpPM!0 0 0*XP0  #XP  XP ,00 /P(fAލЍ XPg WPY0`=V+ !V( <V 0F^S0`͕ 0͕0$0ࡷ$I>V =R0+` =R0-`4 ) 0S =R0<V +V -V !V00S00=V0C?o2 P00S 0P000P000PR ` 0 S+#Sp 0R\S 000SD 0`SL =nPV*0P+Sq)`0P0& <Ÿ<30 R R R000#=R00S000=S 밡就&0000 S0`S $ 0 Q 0 0 0Ppd`00P`0[0S v0P~ |qLOip&,&Qx'DmJmmSmqzm$m6m?mmm+m$0 RP  /,0 14/,$ 0Q/P/(&@-,04 ,    00,,,,G-P匐剀BN@>NPT`ppP kOT gO   !  ZO XO @`匀,A-@4pP0`S 0P0aP ,@-@$ 0 @z,P 0 R   /-p00S/p@-m\@PPPpP 0S8@pPp  -,o_p@-@P00Ph0 0  ;0@'<'8'4'0'00p,.Fpp,,,,,P/0/,p@-0@P0PP0 S 0.PPPPPPPPPQQPQ'L'H'''Pp P 0Q000,,,,C-PᘁM0@Sp`5p`pp1 00!0Sm0@ 0  @@$aP00CS8 `PU8 0 Ѝ 0P     U  R Q   R l@S `P 0R  {PwP-X--(-,P&H&$-,0P$0 00S000/X-$--(-p@-L@P`0S0000p01S 0$'P,Pp@-`0 p@X10S P@@p(1@0PSP5P/`0P@@S  1CP0 1C%@QP 0SJ000|  0p  0d  0@@P^ 1CxP D,,,,,,O-Md\C00wvP1S4& 1S7 p 0C# RpY( Q 0 0000P20S P P1S  000 0ap1U 0S 7 0 S1C10610S6X@ 1R.sr0nS `0 0`Sx& L`0FY$ 1R%Ѝ  ` 0h 0P }0IP0 0Pʼ U & 0R 0Q|` @ 谄P1U PExP  0,-(,-,p,<-A-`00pSP HP ` P f80@L@ 00@TЍ-,p,@- 0W 02P ЍA-`HPp@GE$1S 0P $@@4,7@-p@Yq chd0 G+p Tt #p@  pFqM ,C-`Hqp pqp@@PP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   ,@- -dq.Pp@-7 $P" 'P; Pp!srp p^P 0 &- P& D06 pWPp\0`\0 L0̓f&P,@m006p{q,,l(,@-G-@tPp`4T#0 5T Ta0'000P0p0 ]D@6T` P'0,@-o@-Mj@P o srЍ8!P 5D00 0 &,,@-JP!sr@ 0!0 &,@- > sr @@@6P0&6 D0606Ѝ,,C-8@P5 P`j>T6k.sq 00P6 C06PU p;rCP0ЁP   ЍC * P Ѝ,,x-@-P ,0 0R  ,ql0l 0@- ^ @^TSa04S '005S #,,,00@- @P QA6R 00,G-hX@pP P`PkC`hCp6W @,00S/G- M`FI@唠唐pqpp6W @ Ѝ 0 = PU.P P 0 P"I,-k,Qq0@-00mS Ѝ 00 Q =@P 0 S#  PP0P`0 S @ Q0 R pV`PPp Bp00(,!0@-@MQ0P) P P0Ѝ000Sn@PP B^PBЍ0@D00S<Ѝ0@ 0,00 ,q,q@&qr r0 ,<07@- R ,0,@P?@0 Ѝ0&(,@Bx-@-P M# @0.S 00S Ѝ 0S0 0 00S000 p  P0@  0R 000@0,0r&r3rx-Grirpr<07@- R ,0,@P?@o0 Ѝ0&p,@B\-@-P M# @0.S 00S Ѝ 0S0 0 00S000: p ⷨP0@  0R 000@0,0F&rr\-rirr@-@PP  @ Ѝs@-@PjP  @ Ѝ!s0Sp@- Sp00S p@t ꗿl0p<{`:P p@qpP@ 0 p@z,Es-x-P07@- S Snl0 Ѝ0XPX0@PP cA@u Ѝ0@ZA00 0 &&csP/L0@-@0S D00(0 $ @-,-As P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PA Ѝ04@P,0, 0 10R &&-&-t0/0!-P/ P @P/E@-@| pl0PxSPLHD@<8@㎾&rs&xsssstJtttt@-0@dS?@S 1 CR&C. 0ЍA C#R @ | P    (  0Q1 / Ѝ@k C Q R񟗺8 H 0        @0P @ u-=uduO-p-hMVP0`0V@'*0 RB @0`00C S ? ~ 0V@00C/  0?%W[ E0!R1PT*0 R 0,SU\0T P0EPE1!0C@ 0Ѝ`@U L,X&\&C-PM MP 0-@ݍ ЍC` @;0Sڐp吐!P\>0S`;}P0P M>D @ݍ Ѝ ;X&~uL, u\&utP@-  0S 0 0ЍP  R `ЍL P0< 040800 0000000&&uuP@-M 0   0t0 @ld P 0S>000D ;0Ѝ,0P CQ@-<-uP @P/x 0 /u,P/00SOI4-0/@-@0S0-0/@-,@0S0 0R00Ѝ(-u0/@-,@0S0 0@00Ѝ$-(v0/400S/(00S/@-sqp@-,P@- 00@ ^S00S00 Ѝ0 &Wvp@-P0M % @!`P@@0,S  T0S 0 ,R 0p 0D0S\ 0Ѝp40@00 00( Z @- -֏qvvvP@-P A) ЍRS,DSSS C1 CR9 0Ce C Rꐌ ċ ċ ċ ċ ċ ċ ċ ċ ċ E CS -S0S1rSdSWS ^S wS     0z0  E000 0 FK N R WR Q S-00 0  -vv800S ,00S 0P//t- --$0P/0 0 0C/|-(,-@-PU  $@ Ѝp`@tpPQ 00S0\Q0S 0S@V ḢP 00$Q00vD-@-0 S 0,, *o Ѝ * g- ww@-i@ 2<- wP/0S/P 0  //oP /@-T q 0LP/- 0@-L   Ѝ-v@-`MP@0-S0p00Cp S T 00ЍU X P PTU $PT00W`w5wO-P$M cLP 00S S03/0L0$ЍcL0 @ddsP 0 R @@-PM >$P P$# 0@03@ ZMRaDY@Tb0SV+P0P0<0 P 0+S%P <ⷺ<9P/Pz@0nP0Sn@z@-P00 0+P0P0P>* aIY   00 @ =RP    B  dj000000 CR ԓ  L 0U ?o200S 3/PV U Y RR00SL@30 S 0 \P%00S --,wxwNw@-@PM @PUp`0@ j_ЍU  _  B U R  P 00 CR l ؕ 0 ؕ ؕ ؕ  U0S U3/U@pr 0 W`00SXSX 00S000JU= U U 0?o20 0U. U U V `Q``Q`V  `R``R`0ESU U U / 0S00 liPS Ud 0 D0  ^000W Uww xvx&xRx,s@-P`@000C S0 ` 0 B ^ ST00ЍpT00V , `S 00w 000S/P/--@-XP@PL0  0S0S  0  03/$@x`&- 80S/S/ 0CS/$`&O-@\aM0  R S? 0S 00 ЍpW/$`  0 w 0PP AAQ-P $ UQ@0  U 冽 0@@OoB Rp 0 0S 0X`& @-tPP0Š&/@-0M<20S0uP 2      HR1 0S@ 10@@0Ѝ! 0R0; $0"1 S 10S 10Sx1 X11S'  2R2 L!2 R@1 10P ! R  R @000R 0000S@ T0 0S T`0 !P P 1 10S 1Ʒ0St 0#Sp @---t-,L-&<,&-@--@- :7 Ѝ@-P}c;`ᨼ@᥼@@ķ 0`pᙠ Ѝ@-V; Pb8 ЍҊ-G-` @$pP 0ᡸ !%0  @@ 0^0030#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-< 2?A3c/ ( 0 0 bQЍMb@B404@-@@T ,QP0  &-,@-@0@&0$R/ $ -p@-@8P 00R:0 @0 $p&--p0s@-@@d`D \0 Ѝp0U4 @PPt--,@-@@PC- M`@\!d0pPƟ0  0=0 0 eT-00EPN4Ѝ܊A-PX p` @ @ ַ 0P0dU-00D@B4Ѝ܊O-0M` p! 00@C QaCQW@CACQ7@C@T00??0! ` ?0 !@PPX ZЍO-PMpP 00@C QaCQW@CACQ7@C@T00? ?0? p ?0 ?@`|`PZ UЍO-`Mp` 00@C QaCQW@CACQ7@C@TPP_? 00 Pp?0 0 P@D0`Z VЍA-PM@0SЍ%S p@pnP cP! dP  %PsP xP   ƺ@`D@P 0 `D@P s@-P@`U딻@pH]0 $Ѝp-@- R$00320 P00S@ s@-P 40 4 P Ѝp@V00SUl1h0`m`Tx L0@l<0@0@S,0 Ѝp@-H-,&,p,,0@- 0 Ѝq@-@  PЍ@,0 3  0wЍ& p@-@P᫹P # @ᢹP 800S00 QTp p,,@-P1@0pSQ c000 PlT @P 7` Ѝ7QT T0 0R S `A@P 6W 9@- -,$@-@P ؇600o/O-|MpP `@; ᜹1 0Y0  S ABX ^Y P P 0@ `0 W" !Q0S|Ѝ@0/0S00 0 0P P0AŒ\Q0X0HR?!1P^ A A -/4p p p@0@(0@ 00/0@(,-@0p@-P`40V0 F@ ӂ!b1P@p(,-@0@ 0 C\1/0@-LAC\@c0(,-0 0/!i(,-d0 0 P0L00\/0\@-@PC-(,<001P/0 R 2:/- 0A(, Q @-q00A l000CA|t A|t 0 Q -(,@-`P 0R@T 0  5厳00@zrq 02C Ѝp(,- 0P0PP@/(,0 :R R .R ?R0 \R RS/0S7@-,DP@0K R@D @1@D" 0  Ѝ0 -@- 0 W Ѝ@- P Ѝp@-@DP0Ts 00CSp@蹹@qpp(,p@-@0PS b0C0S 3 0PjS BS bS0 00PmS tS00p000kDx-p@-hdPd0d@;0PܲٲN ղ,PVѲβp\ ---\&O-$MV0pSp f嬖@0S 6R$Ѝ:S%  %S .S| 00 0Jv?S \S0So @Zj 00zxZ@KZBZ DZU @XLJ,Z ꘴ @ @ @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  , @ | T ` ` @ @ @ @ | @ @ @ @ @ @ @ @ H QQ40S P*߾P0S 00S Ǹqp @n P P P qp P00 P0꠸ Pz[Z 00BJ@6Z ̸  t ȶ ܷ $ 8 ̸ p  Q0R 0 qp 0 l2pzKP0T2T"0 \ P B B?߼Se)qpJ_0 P:P01P 101b_[ l3= P T0 Y0 S0: P0P P߷ 0P \ 0 ʷ0 S0:0P 꽷qSA Pg b PDDspP -q-,,-0,Q-(,,?K 0;&H0@-@@00SOoB(0(0A*0 -- -&,0& p@-PP\  P$@R \p `$R p^ R@ \p@R^ p @$R^\  0R0 P00\ 0/ R0 P00\ 0/@-@P |200@p@-P@T `0S`0 0 p`[0@W0000`S @@@A-@QP` @ @p0W+0 S 0 R000 T0@ 0 PP )20T0 .`Ѝ 2P 0- -A-pP@U0  P \ Q(P  R`Q(SS $0RQA " $ \ (P Q S ^ V 0S `$RQ $8 0S 0 0`P PQ0S ` \V 0S00 P` 0S0Q  R @T ` RQ`0  0 V A V0Q`A00  @-qoP/ -C-M@@8p0CpG!`/ऐP< A XЍ0 H/o"P R  ? 0 Q 0  X0 ? @8-O-$MP`d0pP@0L00SK RH L    R Q R*H)  H00@00000 00 ZH  )-  0S0S @ 000 000L0000C `P$Ѝ@ -0    / -0A-@0S PT(`V0(0l00Sdp@ r(`1qp ,IlP@00CSr, -,(,$1O-`wvB 1!0РS ЍOG00S BPА@00CSL0& ЍOɲ 0qp   0Z|V Q P@ ЍP&,H&,(,p@-P@T <0@@@ @p `00@ -8-p@-PH@U p@\Qp@L(0?o2(0 -:`-p@-P@շ 0 0P !U0pp`-O-M,070( 4070<078F @zx70Sp d7 ?P0 {x , (0@0s 007S(00(0,0 0,00$0 P00060(0, rs 0 (0X00000S (0S0 0 0000S0S $Ѝ0H 0C00` L0' l00 00p0zy.0 ' V"qpqp 0 9 0p|00 0Sp 0S@50S @IT@d T 0 *Pr40S 4L H04PU0#V4P R 400P40S l400S0R0S PP4L0SP4`@4PHL0 9#PPU; 080<X0s000040X0'L0`     h ` D0D0P X 0PTX\<P. . @ P PUMP 000 0`0hP0`PL0 P 0 000 00 L0`r$00CS$0h20S c000 00 L0`]408 0C0gPPJ h0S9 Z6 !`` 0CQJ0_ p$00 p$0S0* 0pP a0o $00 $0S00YPPPY<1PUp,1". .0S 00.`P0S 0S < @0CBQ  BS pa 0o0Z00Yp0 p0Pp00$0sp,(,x---t-- - -----`--0,,p@-P@ή < 0P !U0p P$@`-p@-P@᥵ T 0P 0 Up PS @P@`-p@-@`PV0000S0 sr ^ U00 s000  0P tu !R0(P Vp00D00S 0Sp,0(0Spp pX-P&H&8-- -p@-P`aU 0SPP@TP@0 p`B-@60 00000@Pp@.- 0P  P@ -,@-0PP -O-P3viP xC 00#  h PP P(Ѝ8s0S ,30S 0S(0S 0(0v0(0pP* W0[*qp0L#0@3r00 -PtBt 00 0(0e0S 0S F020SW@ 2@@DX0 0 ^0Wq!|s!@TJ0SIW1@0@T00|s D0p@qp m00S 00S sW 00000 0  0`,똀PP 0S 00SJ UHVE qp QP 0S 00SP0 -Y:-X--(,x-x0@- $ 00000S@ t--0@-$ 00000S@D t--と@-鑭80 000P00S@ t--@-@P ҹx0x0S˹dȹŹP@㾹㻹㸹㵹 ,D 1A-@TPP1 㢹-뤬ᦩ㚹㗹CWB㑹㘩ڬ0 @ `Pp0S0S 0d 0?00<0 ,00SAt-D ,p,(,,P-G-pl0P`  @ 31P 0S 0S Sx-A-` pP@Ԭ%0Up0P Ŭ%p@-HP@T<0   p 0 )))&x-O-AM$RM/`)V A听p P >0S00 00AލЍ0!S  0PA>04S S S0<0S  00 [Q*0S 0 C% Q ? 0   ^R000 Q\ S$R0C 0 O00P000\\ 0  C R  C0&x-O-pQpPpMW M ۍ Ѝ@pcPGTp\3\C  TTDs PY PU@ 3T BUpP@DT2SPث@ իҫ @@ 0 'X (| T@ (T@"0S 000⯫P ;04P ST@ 1 Pp 0Q 1T TP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S P? S00p000.x-&x't-'^0@-@PP ۲P pֲP `ѲP @P1@&Q@-@P ?P P P,@Y 꽋ʋ1O-M0SY A0 ЍO%`<10H0  0p `xw&@PЍ00S  0 300S  0P@P  㨥0 000 y ' ' 0S@Px-t---\0@-PP P^0S @T  0@ x-&\0@-PP P^0S @T  L0@ x-&0/x-0/x-00S /x-@-LP 9?P4?P/@-0-//@-L@ 0p PS0PЍ-Q \R0* /\S \ \0 %*0000/@-@P &000000/0S 0C0//@- 0#3P Ѝ@-@ 0PSR? P 寤Q`  W&` PЍpA-p`P@T@  A-P`"pF$@ QP ,00(00 0`PЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`Pp?P@P$ ?0P0T0S@ 0s@-P00@a0C`S     D        L   T  \  d    P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 &i \ Q [@`V1!0 i[\[0F?o20S7 @`^V0`0]QQ! ]Q0[Qp.GQ 5 p`0W]Y0`QV0 0 h\Vp0[W` W nW \W`Rp0 V0!-!- ;r7@-0 P @R RP L L DQ D   Ѝ0@芊 @'!-!-1G-QM`딡@``P0pW0 p+0PK P1 H1 000 0\h\W R T R 00P@0  p0 [R .BQ  [TS[Q@]R  00000T[@T[T@  ST  SR,0 R Ѝ!-!-!-*-00@-M00 M/SP $S, +S00, 0 0 9S$\S @P0 0 g0IS0@S0 W00ۍ Ѝ00@00 S00@!-!-njO-@((MTЍ0tS bS rS aS @{S000`V Fp` 0S0QU 0W0 0 0P PUP @0@ `<0 ~g2pPA$-P*-!-!-O-`-M蟟_? @}Q ;Q <,0 f \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4 P <40 @ R @\T;0S00<+<:p( -f  R @   R @` @ R @S 0R @ Rt AT0 1p @ 9)0 4" X 0F0P0)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$,04 @00T0S@ 8 00@90>: 009 Q00A0 0C S0 00,4 P8(0 t\QG THP R,4 R $H,4 00P@0) 00A  0哾0+0 0 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 00P @  y\R0)0\ P0 A  R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS00 00 h@0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQL4@ S 4$0 g$40S $!9p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0  p!ppdp2p"0 0 $$m!p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0 p!p000p WH 0S  !p Uc$ !ppXP 0 $ 0     囱!1  ! 00$$p ( $ p$p|! '--!-!-0d&Vύ"!- t]-1Fd-.֎eˏ]8'd!-!-~0 0 (\<0< @0 0c00܍<ЍG-`@p娀@XP䘐U@T00S Ml0h0FX0 0S0 0  P-!-!-P*-*-*-*-p@-P @(000P @pd&@-@   0@0d&0p@-P`PUp%@P 00CS05p o4p0 4!-G-plBl` 0S2 SQ S$PUVP(00S S  \%$0P, b0000 00!QP+$00P0T00, 1PP (00S(0 #R nR0V ,0020#00$0,0$0J4 P( T0R #R nR   PH \T000(0V0(00PP P \$0T\ 0$w 0(0V0(00 000TPr!-tm!-@-@X0  0S 0S00CS094p X夊0 o!-G-M0DMX0`Sp00S 0S a3X0X0#\030 `00d0̓XSXP 00CS04p XkX Q%pP0 a0 X PލЍP2 3p0S ,7$06P 06P p4S 7!0p0p4S \PP r3P 00\0c6Pp0`0d0S0000d00S 00Si }7P00  2 02Ka00S +e+e P0 :a0+eJ0+ec r7J2d 0! P*47\PP 3P#P\c 0 p, !6\0 r! 6 0`PS(00#PX2000+|0\`0P l000S S0P@ 0 P00 00l C(00(01!-x'[&-!-t"-ޒ(@-6 P ` Ѝ4P@- Ѝ P ` Ѝ@@-30 P ` ЍM0@-@XPMP V 0(&0  &Ѝ0*-@-M Q qM`0S000@03 0@ج0S Ӭ 0]` 0 0S S ` 0jl#@P *0 g" P720 i00ڍЍ*-!-!-@-P@   0S!`0 R `p`   W70P S t `ЍЀ*-^G-pA嘁00`PU , R:(,500( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(     0*-'A-@P p0R`*W0 0 w 0P P O-0/OM00PЍ080?PU 0PH0\\e R7 0ST?0 C0R 0i Pi PS4 0PS>0@oP 0 R >0R*0 0HP0S40P 0 R 4>0R$>0 0S > 0RR0S0S4 0S=0@oP 0=0C>S񟗐$ < < < < < <  < < `  < < < < < < <  < < < < < < < < < < < < < < < <  " X  < < H |  < <  <  < l @   t" < < " # t# < " L0 R: L ` 0p0080800400S\<; 800 8\4 00h<0S  H0SPP80S4PU 0`  E5P080 A E4 <0T P 0   004 0 0  0$;E{40 0:0R᠚ <00s 寠0P 0S 0S 0T( ?4P2S 0 H` 0S0`V: $L I00@ 9@M0S H. 0] H0 $P x0 H$0$ [89`0V:, $ ` 00C 0 0P0 80 R:`8 0 Jg `[ p Y`80P  R:L`LL8K D/ `(1 S:` 0  0(8  0R7 800 g4 00g<0S  PdP0800 0 TP80SXg4 00f<0S  80S0p4  H`P <000F400<0܆4 0f<0S  kV 0400<0,6 800 |V4 00f<0S  SsL0 R: L -` 0pX00pY R  Q T5 50\4000  P 04`Z Z 0Z 000 G 00 00 V,شZ0 0RP  0 0 0 PQ@ `VpX 0  `E0P  ßH`<(LpLHp<(L(0000S c4 00f<0S  ` P/ 000Q00  0  0`Vp P\   `VXp0  `Pa 80S0s "0p0  \04 0040P0 0P 0S 00P80S0s"0p 4 0s040P l0P P R`03D0`<pL0p<q80Sn4Xk 4!p 0`R$l0004 0V^*00000(0S!0 ( 0Z0  0<H0 0 1 R:0P' !-*-4*--!-T*-'l&^ht@A !-x|!-*- tq8'l*-!- !-4*-0 0 $ ( 1 0X`PH`<(pLHp<(x0h0<0 0R,,0Q 0{Q  -qT*-p@-@P`Tp0wS {S sS 0p /P 0 H [0`@p /P `tG-`PpaPW00Z01 R P @1`0PV(AGU !R <BPQd' ' ' ' '   Z    :R 0SP0S X00 0P00 0V 0S`: V|PP 000BS s*-0p@-P@0`T P աP# 0S( ) ( ( $) 0) ) 00C?o2S Pp0S000S000V0V@*-#.0@- MMP.@P X :Z .p82Z+ . P.ۍЍ0tѓH0  BR R RN /x'('@00CS0 S0 / 4x'@-(Ax0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@d+-0-01S ^00So^ P0\ S0S Q0S R P0S0S00QR 4(.+-0@-  `Ğ\ @ T\    %R    +-4(.A-\A0 5S <0S 304!0<募$a$q$P0U&%0 ! R8  (P v0  ,P m0  4PP Aㅉ00\P ᆩP D Q04 0KPS4(.) +-('+-p@-@0`  A-T  t寎h pdPPT p zP000ST @x'('*-s@-P LP:@P-0?S0SP`@ p Ѝp/㵥P@MP 0S S 9@0S00uXIl 7#@-鷤 ?('0@-@<TQ T00 0001S R0Slp@dTX` T@0$P@ 4T(8  0@+-('4(.Ȕ@-m jw('7@-@Pၤ  /0S 0@T s00 Ѝ0m0"S p`@-@ P  p WЍ辕d0p@-,- 0S00/ @-0L|-  @-'*z-@-.0- @-L|-  C@- ){- @-r-  @-,x- A-T`)qW D1@P |A0 㞅蔓-MA-@PP 0S z`/P @/`1S0hP /P 0p R[ '/`@-@PrF P x h0 0|h000A-@`\@*T<0p " RG\<0d$N 2 R&%@-@%@-@Q@-@R@-('p@-@PUP,CPP( g\]OP ~ ]Ljp`qqC@ * PP , 0@ S< 00p+-".&O-@-,M0P0 T; R0AT| 011!0 S01  R01;^P |,0S  R3/00S 3/[1P PP s0P 0 0S_:` p` 0 011S`@S0` $0np$0P᲌$0P``PpU$Pe$UP0S000 CL R RڰDPCPE_ C B R@ Rj^ 1  plPd  `0p0C0CS0V`0Z `1Z0ZF^ 0000 0 k 0 "P P FV`x 0CÀ  S CUPPEPE_P0 VvP ^ 0 80 0P@BP Jci1 0 5v { Q 7_v/!?@!0CSa a c c c b h!0 R0P8g8w8WPP 7000 كRP0!R0c !ġ1S 0C" !8C8R11$`V4j0Vopo0 uP vp{u_a*`P0PSY ' ?D 5i0 i 幍yhhxW Ph50xP0afzfDU S0S 400C`%9]({G1Sa !0C B/?!1!1NSQPN0Q^ B08C8xP00S119zP`PxP@a@1S.020) (P#J @@P8e de Le 0@S#de Ta e Ta ` Ta e Ta e Ta Ta Ta Ta Ta Le Ta Ta Ta Ta le P h3P?P <P >P PP P$VvP P1QC P uy1S(ʰ1 sC P  uyP 00P1 RF40S 3/e PPP e P,Ѝ0R0 r\ 0SpW 0| 3/pv P 0`0C P t e `mye0010A\70 b"P }00P000xPdP <P >P qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P+-Y('".RS'".1' 001/+-P0 R0//+-O-PPp`*@ [ ! 2 0P@ Ѝ0a00 0\"<P 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @+-^P/D0 R/0@-A1 P d< @+-O-0Bp ymW |g0 00p0冁 Ѝ`(Z 0S mP  W00010P@P 0S 00@ Z 00 mP  V0S  V00000 00` Z0S mP  V V 0 0 00U0 P0HS0SPPjm 00mm0S hm+C P VPU j0X!0C0S8 3 000 PEV,-VUUU' @O-@-$MPZSQ0 T 0 (T`C? ;0X0 0S 0h MfẈ븳@m m m0P@0@ 000000. 0DSDU 0 E 0U00ө?0U0 CR C 0E R 0 0flY 2 f0 BT Pp} PC ! PZ P P#0STkpD EjPE@ DPfMf0Jf@P002P? P AP7 0JSI1000 C 0 E0j0@Pp1P1 pW 0p00@0p00@pW E@DpjPEYwpGT@D¹0 X@P MP@U@§0S 0 B0U00000S 00 0 0L$ЍO0XS ,-}9 FR'('A-`PlPp `l@l@0T `P@ P P0000,-@-@PMp 0`T` P@@Ѝ0 00#pp 0 0 @>Pu 0;@P ˴ $&,-IPp@-@TP0Ps D` R :පP 0S@@A@p$&,-@-@@0000,-0i,-0i,--@-0 0d Ѝ Ѝ/-@-00 U Ѝ Ѝ/-@-  z ЍЍ/@- Ѝt@-@tp@-MP@` ,0 0(#00 0`Ѝp@- ЍqO-P0-M ` HpL(k#kUs\0 0_X0 jYPc 0S` T00S\ ᰆP@PT00PXP@ 0sHਏȀ0 0W 5p hPUWpV`JЦo`0 S`J 000 pPF 000 `E;P\0 0X00T00 P0X &?Z  p aduaaЍ@00Y00S 0S GT00P@#@3@pv?pP 0 p뜰PE Ercuc >+~ 0 E0GoV`P5ED`VcYc,-Q".@-,, ($ Ѝq@-`$0P@ 0 ( 00 0`Ѝp@- Ѝqp@-MP@` ,0 0o( 00 0`Ѝp@- Ѝq-@-00X  $Ѝ Ѝ/qp@-Pi@ip,-@-U7@- &@圈8B$VWPU % {00h@PU t%T {00000S$$ Ѝ0$x-f@ x-R (,-('i O-CMl@`P \\\ PCߍ@ & @aq<0P0 lgP@Q 2 $0P0Y pW     0 =RP P0 0 J@k?p k('(1@-[O-0MM 0p@$`P2 LPP* P #P 0S0 0   S P 3PmPᙌP 0 Q0 0P|ۍЍ0P 0  0  0  As ,00S/ 0P rI@-K|--X@-铇P P <)AH(W"P@fAs C-@$M S @00dF%P-   G0S$ }P 30Sm Y0] )Pf ZBPaD' D* RB^($ЍP@R<s|P@ [A`P'='P'`20S Ap0$A P<I| $ X$P 0)AT )P P  AP  pPP0 +Q !X0p 7'WpT+ApT3 @p 0T3:X#  VAPQ  R@4Q p0Q  R@ 6AP`Vp003/P,00  h0S  R l 410!8@̆--l-t0@-M M+@(H+(QHB+(HB+GH(Y@PP BT@PP l0 @@@@@ @@@@'Pލ Ѝ0B(+?! C #-MM+ MHP+ H+ EH+0 H @P  ?ۍЍ! C 0@-M ⡎1@@@ #P @  P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3)P/\P+X@P'@P# 0Pz ;z  0S 0_ Z'P @P4o0m&)}*00̆--a! ! ".".@-M 0@@@1?j#P* '@y  kP 00*!R00$Q 3*@P  L0S 0` 'P%(6*Ѝ̆--O-`M 00[#*0S ` 0B00 SS@@@Ap(@ 0 S0 0`0@/ 0S :jPP @B 0p00Q %Sg0S iSD %S* dS $.$0T !PsS(200P 0 倠ಠ@Z4!@ P %Q0 @0S0 aR7 cR0 3/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S 0 ! S 0 @S$SS0P @U:U 0 F'7@- @PU \! w00 Ѝ0llP \ D!L ~ w( (0[x-R ! ! ! " L; 7@-@QPT80800 S    0 Ѝ0@5x-$x-7@- @PU ! ,Nwi00 Ѝ06PP | 8wd00S ōL L0[꼍0 ,$x-@ $" 5" t-rL; I" ('s@-`4Q@9hVyh ^)ca^@c] ^cr55c^6xe 0A+j@Pxx(T/5~P ?t?]] ւxЍp".tt('n" O-`-* {MPp(c0  p6@ E 0S  P R K 0S l dP {vTP vv>p@T Pcfd K)RZ0B? 0J*P  (g@P  ^00tˇPdƇP; P  @; D;0S @;nP <; ^00x3,"0{ߍ]L3 ,O0z"!03ˋ1,0ʋ H0,0,L0 L  0P,0 0 pz?"!!03  PM p WU $ lVh2P ll?I0S$P0 nT 0  <SR 1P u1 S @U,2 @vPU  ^Pz?0WC(50P 0[ 0R0SQ ᯷eu0SG 0P]w0SP @ v 00TP@@ ,2 @@" |-&ptbt" f@$x-x-# " krx" *z-" " " -Sk# " " @p0@-0,M 000000 00P0 00h0 PPP@P DD?@0Q ,9e,Ѝ0@ԋ &(')# $x- -O-iMs?!0bYP 00iߍOЍ/Lx`P81P ,!,0&`P z[p KP@P)PY-U0P 0w0GSW030#[0S {00pP@ Pp00'$x-H# _# -O-p-(MT@X  pp`V4  @Q'U` I`PP~PZ@P o>H E0ݤPU 0'SP0U*S!/ vP00 xX/0 0P }0@: 0H: :}1P0Z uɣp`PUQ=R c2S022SP0220C2   S`` u000 0 0PDU  @0 0 PA asa0 R` ! [U 0 V0C?o20S \[_Y[_`buU @ v 0P| a@B[u(00CS0000QP a0P nX0S  5 SSeyub`PW\UU S  0%S @S, B B*⨈& 0.R> 0*0XP6 00Zp X @P 0A0 0*ݣ! P5eR4u00F ASz K_Zb_tV PZum(ЍO Ѝ/r# # =# jB ht@".x'# 0@-CMlbPP 0S .Q^@P8 ACߍ0 PA ,,-+--G-p 夐夀PB`A@T:00Z W ,/Z 000 ^P EQ 0 {`@# 'A-`Pp p@ 4 pyA P@*.-A-PU|o@Q|t paA0S DQ0Q.SP @$ $A A,,-x +--@-M4 0PDP  4A 0PDP  &A |p@ ( ⍇ A P/U&p@ l`lp A @('PPЍ @ @`!i*0-%iH0-*.-8i(\0-< O-p-MQ IFr@cllP0S {V:=80$d w-B0$0B. { 4G {0`Q>d0 @@400{0 ,40P,   TTrA@W R?2, 0/ptp x#|3 R0:P$P  %P <@Xݍ<Ѝ;pP<]J.̟ 0  0/P `]? 0 B0 u`````-$\ 0tD0D Dq i:@>0a X@ B@P  <P;@ 1sS1lSD;"00`&a`P nZP@;⭂@P,?*0x*0wr╂P\8 0\8TY0 yV *0z*0}\8t*0|_\:VT* Q0:$DR@* , Q9ʟP \ʟW ^/H0U>H B0C   FPT  8TDY p0X649 @p A\)\^0p HA0sp H0S[, ,)A0$K@P @0H0 H0A@sp AA`LVp@fv& ᲅ! H⮅H p |8P l0 0\6S 0 D449@P ]5$ 30-*' #[7S  > l7 P~P7'A]A\@P l@P 7T'XP\8<'08\8(GP8 >8 [&8P00P8L >8 4[&8P0060S\80\8P8 >80S \&8P8 >8 [P000S\80\8P0S\80\8@n 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   [0S1 pP 2@T `G\xH@Hp#p00S X 0S d"<n 3S3 V\ #C?00N?C0C Y`0  0@F0@`x6P;A?p@x01S$ FoP j?x%0J?`UV$0S 0SAT FP rzP @`X̠p( =p;$  f !$0RMY 4 տP 3SS X } }00,?p p؀ܐ0kP 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@$P P  0P ,04! @F<#pq2P  @000@"0U@0@N?@@T@0Sz?0 C,04! p@<#x!0 J  | |T I|00I? 00111F01p00 84p1<P( s1S%4p ሠ0!g 0Ab 0],0! <#@ ) 0U,0! <#@t 0pTt,, P8 5}DΉ5-QNEFXۉ7, sq'A, O, 'Q`[, @-@M`p 0 @@4pЍ PP t 0 @@4pHS<@P 7/PD8jB @-0 0P Ѝ @-0 0PЍ4 O-aM,MQ0=@PP6 Qx `P- |KxPP- Vl"dT+"S5Lb+bK5`gpP@``VwaV+";5+b65M-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`FwP 0000!N9`P 00S 3/p003/NaV $P 00S 3/p $aV 0P p PP pb.x;9/0  PPpxP".;5/0 #X R1   4 40 0h}tqttP`V b ,PPY  HrPQy+"~4b+?"PPiZwP# UwP PwP KwP FwP AwP UxT N4  J4P ,}`). As @E --j, ۂ)>tT . 1n, 00C-$[?pMP `A@P00 >P C 0 1/PP0@0 @P@00003/Ѝ003/$Qs, O-UMMP|x.`@4Pz.zzQ`8D>g(USpWp$[ Z T  7 00 70 0P0@0\⠗z#P40([Z4S =\7h400C2<7\4=1 W =7h400C26\4=1 0 00 0000 00p㤖p  [0440g40s -14s[w0 00 0000 0 0z{pp 0440E40s -1tPw003 E "e35@ UݍЍP =2 (XL=1P⺀N0c ⺀  h \ p$w00?00[000ӧ?&N?/'"T`4`( 4@ TP40S N?/$"\4@pWL4 0}10  A 3 "2 204 1p$ ,01(.8,40001A B7`$ 1(11)1S04 $q,0(84q,0$1Spy 0 0t ^ pWn, 䒟@p#0$1 0H0$4;B2P p>{d {$10 $! , ,0 :0G80<@80Sp9Pn $003/$`uPE `qL(@LS  GPu<PQ Z<OSM 0.$10B04!8C0(1}1S 0}1$1S! >,!  ;6$40`040̆-".x'l YWtp&--H|-І-q$x-, ^PP ,0 0/0@o//BO- M@MPAE0*!Rp0)Q`U0 $0 P  P  Pp ,x**(0$0 P$(pP p4\,f ܍ЍH4p 2<0Spp0 @0 4p0SW00y , Rv  000;x8,9/Pc0  x08,;*- ~%|%z%0S u%s% E&`ލЍ蔓-c. X$x-h. . . . q/ g/ -/ / 0 0 ?0 F. RBAs #. (. 0. 7. @. G. S. [. / Z3 P8 . 6/ {/ P/ / . L0 y0 0 0 0 0 % O-BM@MT\\p P`  y @P`T$$ n P```PP@BލЍ؃eГCг @e3(4@$80 eDP@T@@< \  = P  ` 5 e443 0 88@4 ' e2 0 YĒ  P   e똢嬂  8@4 t20 eh2@DDAT T2T"TTs$P D2 <%PI020  ' 20)ATp !0 L  P' !M%0 Z#P@0S K0S04@ 0000@;x8 8/P6  %P  !%P 0  ~ @$$0 Gp@W: p@H0 . 0 P8 0 0 0 0 0 x m۶1 \71 x-c. -tI qaX@-0`M2 pRЍ!,^04P0 @ PP@4 xp8;7/P  PB5-7-(0 @-@"!P0(@5-@-$@2S 025-O- PPPBpPP   `PP h@Ft$ର@P`V*< ЍD P P    R0SP pPBND'@-@00 yP Q P 0 -Ѝ舻 C-JMM bpPQs 8Ms@4PTdHP`YP8 Yo`GFWI  woP 0000 !00P < 8<1P <08 <@XNo<0S0 0< 8`PW 40,0= 010100 0A000@00 l@@@@v,F@0S7 0S'8JݍЍATKP 08 RT<0$!QQ@0P 0 003/@<08 S 0S(0S 0S8Sj(0S003/@<08 S@- & 0S/p@-@P` !a(0SQ 003/@Qp@& R 0@-@4M`pP0S4Ѝ0 0L03/P 0@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0 PPA.xP;5/P A> wok1 0@o/b 0  11/;-10/Ynp@-@4P0 `+1111p;-O-Pࠟట@p`0/ C  !0  Pq00S   0S 0P1SR0B `p@P X 00,0 000`00 Ѝ;-   0@-MP@/.q1, 00 0d000 0X0@@@@@10 00@0  ,Piߍ0 ;-O-P4M`@p 0SpP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  *0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- 0R0 DQHa@ 1QRpB   !LAPAP,0` AU0Q     TTAU @@;-71 O-lB-X1MST2]X\1S429\X1S \QUЍ0C`1}`1S~_`Je10XP \1 XX1! 0`1V# 1xC0C:IdP 0 S 0.S  7* p `pZ"XcP \000X` 0+"Xp\LP \!p000: SX1 t0 0\1`0Da0 X1 ` SX10 ,0 e 0);-(&@ <-|  As @-M M`gP\oۍ ЍaPp@ PP+) P*T+) P*+) P*3P>HlAs p@-Mv&r@m(H`P4 f< 00cjd P (4( fc\D t@P Kލp_t1 at-h~5 @- L@01SP@ 0S 0   ;-  O- -M@c0  0袟p` W  ,pP 0 0P0S2P W%0]P7P 0 a0CS0Sߍp( `V2p0:08V0S`p R S`0a 0 0  p 0U? s [ 0\+ P 0 0p0 0  0S  0 q @0l0t00 00S 0  0p0P 0 0h![0R@0O  O 0 R*? 01BV4a0 6t1 I d@edA<--@ 1 ;-p@-@PsP p@!pC-pPAK L1h90D  &R h)0 S 0<1LPDTPaHcLP cU `1DP1 cU `1TP1 cUP1 `1cT0T U`1`F@ ЍC (0(0h9h900;-kq1 p@-M@ ZP0:CoЍ@-| 0S pP`0 X00T T0PFL008 80<F, Ѝ Ѝ䞆-1 P-L|-QC 4 (-){-l-@-Ml@p)t90 0 0T00.00 0 l&p $0t !Ѝ;-@-H7@,$ Bw@tG2 -?@-@P  + R4 "(0@%Ѝ0@ Ѝ/&2 G2 @-0  0' P L0L D@D @08P   ! !܍p,rg 8ngQ @P@Pڴa <T@@?8 1!Sf8<DQi\1 08808@TT OoBQP@00S nu<  R t00 00000 000lp@@ mv(X(0tQ!L|-n(-){-l-G- 5 Ι'h4 p -P- G-l O-EM08qSP @ c 0!@K?`00S`PW!000 @][@3/@P EߍW! 000Z 0SX 0 @7T W  00 0  0S h00S \  L0W0 ! ! 000(-*z-) -5 5 t#6 -G6 ;-@-Q0@ SS < N0 000]Ѝ2S M6 As W6 O-PDDUM244Q (1 /f$ğ0/S^P3sC00`/V`L# 0SPgKUc@ A@ JPtqIP `?XP`&tO-MM@p\@ @P <PP6P  "@ڍЍ !P P PiaPP PZq`P5XM 0Y WP0=S@  ; -P][T QP L@P  jꤠ刐P@ 9@P l@S )w2 t27 7 k/10p@-4 P@Cd 0Pp@@-G-P`4 0d@T$ `V! p0F&04 p0RSP pPp Pp40Su p XdPp@V/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PcP  p@'@-@ [(Y@VA-P@p`p0S 0pp RFAC05#Ph0020#X00Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-0pЍP@`< p̴. pô ὴ 0`ᵴV吿0 t@娴T d PL~P <zP W@5}DΉq8 ۉ8 @-M M@`p; @ p  PpFd`Bd`ۍ ЍA-@P bT`p P  0QPx|d zd@@-M M@p; @` p P0 @]R`cVc`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPb00/00/4\80S0 S001/\80S 0@- ``@0!SR0(SS QU S!0$0S\  01p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q P 0!SR:p040080SS P Q408S Q0  040S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4  B(B(Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X 000/0O-p4M@ PPp`/14ЍO%0 L03/P! Ѐ 0\ p* @D Z["H* 0*P T Pp a8``pp 0S0P 004Ѝ, [ 0-O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R0!S,0S 0 p0p02#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/PG K s 4 |4 H 4 `z 0O-P-t(0M000`S@p0  p00 % 80s"3 0[(h,@lQ@3p, (0p@ ` T3`R0000ЍV0V*8q 8 0L03/P 2HR b0 0 0 00<0,08`2, 0( N[@D( 04   D[00(p( , 4 07[P23W 4T0` 0P0,000SQH0 N L00SJ0S?000i h0,0 j0 40 000 000  \0 )0 00000PX 0 0808/zT0 PhQPQ Q(00*:` p. XXTXh ,0a P0S l^ 0$0h0 0(0  0D*:` p 5 0PN-Ȇ-8 TN-9 q19 C-`FtM0pSP^l $T0SLT0S T0ST0ST0SGT0SHS0SIS0SJS0SxS0S`|S0SauS0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 tЍCt( @S0SWCW@dB B B C 48P Qb Q,'0 b~ 4004 0Y0 AtЍ3003 0Y0300 0$3 0Y0 0hS(` 0  00 SH P0` 0SH P0` 0SH0\000 SH0`000S$H0d0S  0dP 00 <" 6, f0 Pz R>0 H0L0 H0L0 H0L0 H0L0 H0L0 hH0L0  PH0L0@ 8H0L0= tЍCz!SH0000 0pG P d 9/0 00(0-0PN-~K G s `z qS9 Y9 p-Ȇ-b9 4 |4 4 000T0 01P0100A*! B B " 8010C_ O-OM@P H(SYq0!g2W@@Dp,00`Oߍ W,0T00C0 [W0J$0 `Pl4 dğ[@0ğP @,0T00C0p0NC2WH0 0$ 0R}W% 0 0H03/{0T00 {{0‐ 9/P#%#t&0 080x 3/0Plp YX̍ 0 020200 07000 F00%@A l0a VK0W p 14t$pX0 PP00P0003/088q00|X 0L03/l 0 , t T x X h H 0TpX 007/P !` 1Rd 0  0!v!D W p0 B/D!2 B" /1ᴑ0C100C0 tXpWpvpW T00 03/`P 0-G X? 9 0D ;+04`Y8 P0a 0` 0d0 D p 00C.D!2 B".10C1010` 0S0100C08 !V ,0 80X L0T3/P_pA-Pp`a!@xP0 p00S p y.p W^`P !@ B"c. WT0 01`0(`10q00009dY 0S/ LP0 5/P 8 <0 @ L00P:P04p:  Q:  BZ:Aߍ L`0 6/Pg 8 <0c @`0`4000V 00 V0  R U 00 U 00  RD ,0 , R, 0 Q$( Qp@ x$00(0 Pp @0`r/ 0 $ Q0$ `@ QPpLPYd PP p`@U/0` O-@-AM~Ȇ-p-g: O-p4M0P\0`3/0 @T @@T@   ( P(S ,ß( 0 X0Y0 >00120 01T e0 0n ] 00CCR 2"uU€0E0 0h20d20`2 0J0@000H0@@@P,((@4Ѝ<1 @1pp0,00壽0Ph @ 0S[00S2[ ZJP P400S/ 3/+嗓)08q P , (0]R(0, PZH D000(( 0\P P@ (0,(00T,000(( 0H@dY 4O-_ H dP l8 z: l9 ; XM rTN-As @-@P0RP/WP0S0As O-pMCxb:TtU`4{ 00 rs ,b0  * 0` P  00@0 B )R RPQ 0R Q 0TR000US0a0Ѝ0S@0 pp PT00U00@0 \%41R7 (R3 !R/ R-R I 0` ` 0R 0R`[YoFT00U00V I @P0 /S`Sp`` [YuT00U0,`0qO-|O-: O-T8 T\P- 8TxS-x-As G--0MSHp`ЍP 2;X0p`0@ R 0GS \ 0O@@MS\ 0CS\SS\0X0+R0S 00000S O-@-OM M<00$00$(00 P08 @0 (0PP0D0 0P ,0 0H03/800<00 0!6 0R 0 , 03/ 0`` S04 `&P40P&X,U\40a`00000& 0, p`0:,`pp WX0h05R0p0l`h , `Vp SWh #`U TOh PUIh VU 00H0 TPzo4P0`080dPS<00O>0=C0H048 <0N$x{,U 0S T0 POo0 000H0P0 F0_PT0S x*PP 0S4 `Q00Q0S 0 L0aA3/P Ȑ0 0&003/f0F0P  !E 0 N1( $0Y(00$0 S(0 0R0$(@0D 0@ 00 RD 0S8X"a`" 0+0'000 ꀒ   0aNx 0 h0  0SN` 00 F0INȐ 0 0l01h 0 t0hp0+ +    [*pV 0 TnU 00p0 Tn0D TynT0P0%0 Q030#Q0S ,0 A, 2Ftp 0$(&?0 0L 3/PL 0`P!Q.VP S(0 0K$0 Y(00B8@aA-A0J?`V=p$X"0 xPPЍ >p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$aꔓ-S$0pQ@-4tV #"T R0//@-(@T@Ѝ0 0 0003/@PwE'/@-|M PP@" @a1!@p@P  +0@T@pT 0 @p|ЍT0| dp0p p &_P T s  ٴ(-; As ; ; s-; ; < x-< < /@-d $@!D< * ///@-0@Q0Tͺ@o?0 \ 0P000@-4M@0  @MP0PUH0U 000 00 0G4Ѝ0s-//A-pሀP@`VT0S0S YIPH0P$1UH0U0 00X0`p@; s-0SR00/p@-@PG<0<`P" 6D0# A0$!pȆ-p-A-`8P@IpP( a As-@-0@-AM L0p U0S XT@P00PU 88 0, Aߍ0bcL- N< u< < 1G-`1!MP@11P|!N/  ppqpq}l.`PdLv M宿H 0[㼹!ލ  @P f>@ @P 0=S@ !>A@>$@ T@  P p0 6P L 6<  :92 FkL; < $x-< < < t1s@-P1@/h`11PX N/  L L P D 6 00eЍp$x-9< < < = $= @-M00200p00`0P07@P @T 1\ 1T1H 1 P1 1 ЍQ7= :;$0 @- mP 2-C-`CM P@ `K[P pܐ܀0` 0`0S1 1 Cߍ5S  Jt tP\ ``\0S H S1, 1L~-U= K}-;-}= = = = = :ոIp@-P@1 1  pܔ-17@-@Pf@b0  Ѝ0@> p@-P@᰸P $~11P   p > 7U1p@-@P{1(1 eP1 1 p> U@-鄸@U > G-M@,pKT+Rr尒@`T5 TH Tom20$0@TPt"tt0PB`pPp0Sh Sb  @J 0 0`P@KP2M/PP ލP h8P !080 0'P !0}t1X 0 , ?, T010 ? =X,1O?L0b,`,0!0\P P0N?0P0@6 6A6   & 0F 0 0 p000  @ᯱ)P&s--> ܔ-K}-L~--̆-7> u> $x-> 7> 9".".| < JA-P$p3a@P-@T ( "P( 0 P 0 4 P @᲻oЍW``wX < 0ȿ> $x-> ? ? ? K? t? ? h//B{O-04pn@T Ѝ@T@T( ^& P@ U [Y  [ XY P{ UPE P P$@ @$0"/-O-4MpZ (%t,P@ P @R000f 000V0 0_D0 V0 VDV1!U@0P@0 0 000 0 U0 00Q0#02S4Ѝ;0 0Z   R% S  P@0     0P @V0V0 DV1!U@0P@ RM RJ RG  R ࠡ࠳$( , [Q$[3UU [ 0Z0P@V0V0 CV1!U@0P 0@ U00U Q Q 0   +0@-4MP!! 0 P P P@4Ѝ0@/@-@ @H? p@-P@/JP `@ HQ0P P `Ra BQQ pQQ 0@S:p @-Hx0RH #@-0@-@P4M0S!1P4Ѝ0 P*  P +0R0#@"*S Q 0R-p@-0@ ^T00PUPU' \$ST /p 2@Q^U@.P@ @$ $ 0 00C 0p0 ? }p@-,@PG0P ;pA-@H`HPpFRT0ԗ@0"T01 PSls- 00S@- /s-Ht-C-ẋ(pX,`0@P( 0 XWaV V T0     ЍАYĐY R  U:0V @ @T0  (@ -@ 1 1 @-@P 0  vF@w 2@ 0@-@0S~h 0T0"S D0 <00R( T4 0s---G-Pሑ`0Sp@Q 0Q02@1;1':X 4CpB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $B Q 0S T v| 0@1 00 0R"01-zp@-P@mP000p1O-@0pS`P  0PQQQS SK0UȰС0r 0 $R 0 0"60(Q $^B0, 1QX#  E vQ 00  R [ R @R L0L LuE R# Ѝ 0W1Q:P s-j@ 2@ p@-PL@0Ss!U @ p(0"E0P054 3050 0(2#ps---40@-@0SYDP0@Еs-A-`Q@0SG!V P p0 ST  4V(Ѝ0۶PP 0P4p0@00 Fd 0`pxL p P@ `0n0('p(0,0Ps---v9 r@ |1A-`0pS@P 0 PQQD R<0 E2  0 r!Rv?000 ( 0RU$0X3,000 1Q\RP 0 00  W1Q:P0s-K@- @00S T $匲@Ѝ7@sX0O-SMM2"`D\0@S2"`0S2"bd0S2x"h0S2\"|H 0SXȲ8 80R\ , I0pQSPPTPG  @r@ɼ`P. @  \00`0d  00h X 뜱;S/ʐ!@0:P@_oRݍЍ RQ8 R  ݱ0:S 000a 1 00 0 n0 0C0 b;0CS||[Pp@ 2@ @ @ A "A q   R@Cp-O--BM MpX\0ٴ@P 0` ;( `#pP`0 nP @Bލ ЍQ   d 000 50 00v$0!`4X00 v`$00 00; S PaP +RQ 0P \Q S0Rʦ0S R6 S 1 S S"0S000000 000000"P 0S  f 0 R$ ? ! 0$ S0S 0$ `edA B O-$p6# S0 > P`;+[0y>p0 d00`0\ h0|00 XT400 P$`P`l0(08 Hq000 00 00p;М[  0S G v00p1 0$ 0 0 0S  0"ıR0S 0$ MB"01-zO-M00D@TЍpܠܰP`@D0SW0@    0 0 `1/Y  S      Q R  0@000Q0 0`p1/P -МA-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A-Pp`@1S 3/P P`VUd0PT0P0S@000S4000S(0000A<Н--Мp@-@4`4P0Sp@,10S 3/@--0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 `P   ‚ 0S0P000$ 00//00/00/00/10/Q@-@@ 0A0003/P@$  @) tC-`BGM0pSP;0 H50S߭A50Sح :50Shѭ350S ʭ,50S4í%50S弭50S00$ R"000< R&0pG 8d 9/0 0(0 ` 喭 |0)( 犭40SW8 ` ̽  Q 00000 0B;0 Gߍ0000 02;00000 0Sl0 0 ;0 Q0 hu-~Y9 Qp-Ȇ-b9 G-pPM 0S1 Rߍ08 L03/P H0 8 L00S4A 0S 0 0 0000 0P@T 4/H1@ 0 : 0`: 0`hA0 R Z/ 00 0 Th0:/P h00S0V0S Z)4Z? V F 3?? 0!CZ? fh-0 010@0`qhu-Ȇ-B tO-MP埬0@囬0` P8 `(b(0 "000 [:p!@000 M:!ȁP00p@i 5@p@tجl3@gY  X!0 LP  4!`0(F$! 0p0 R  | PxЍ 0p!)0i ` ` dOT0 0 p@- Y NT R ` @qp-Ȇ-h9 u--B NB UB u-gB t0A-@\0P3/ pW@@P@`@P80BW  \W0 V  .  ! 0  0n/ 1  x   ]/  "\ , 000SJCT D0D DD=@0D@qu-  lB yB \ s@-@,`P"01Ѝphu-0p@-0M0P,03/ , ֮, 0@ S:000 00 00 0 Ԩp` ᡥ0A00Ѝp0| O-P-M@4( PЍ P 0   >< > `@V0H03/0S`pPI`pB 00, lPP x, 0 S!d22`]? 00000 0A000 d3孨~0S 9(00P L0 3/P X0P`Tp`\0p0 S8*P[ 80 S (, 0( S001w40P ≡0L0 3/0 0P0O-Sh- 0:\4UM@08 p D )P $`PV Uߍ0P P ,0UFD,30 00S 0RD 80S:(1SK 1400J ,HLAP4#0A4  H@4#; $冥< 傥< @0P⵨P:)11@T 2"B ,04 P0S 3/P|20 SU0%0c@D0ps `2RP)1Y N HH@p C(HD! @<#PpT@1P p ,@ ,0,00@ @040[ @ᕥ },   0 劥 r,0 健ᔩg,40P1:1!6 @0 000000 00000 0Vpp D#D0S, 5#7Q[T Y b`^,\w ᅢUk--qo*C mn5C B G-pJMM/0`@ 0 pp+PP+YP) V0S% Rt"`0`!` p/w90P T 0CT *0C/Q 00P8@m+ P:8?0  PP+0: S `V8>00 PJ>00C0/S@!0+ S P+  P*P 0/S`0oo`bS +p+ & 0 PV|+X P*+R P*P:8@68@]JލЍx QC L; As @-()@-M @P(0 : c@P X P ol "88S 00b"!4b4#$("(RSЍ O-p-M PM%@P` WȐȠȰP`p*0P"Ѝ R  C0P:0*  QpPq P W` 0  峬 C QC HC BG-MxX `P`P PP<G+J@P@;  0ᆬ@ 2(@P +JJ.0i+JJ.X0ZTX SPP~D4 JPPu$+JJ.0:PPe+J{ J;` #PPN+㈁刑PJahp0 0J>@P 0. P UT ލP@Y+J5JPPxpJ.@0ޫ+! ԫP h lJ>ͫPR WC `C kC qC {C C XC C C C C d. C C C D&QC *fC C C : C /00/00/00/00/0@-4M@0#|0$P 080P`  P0T0760 PS P @ئ4Ѝ0Ȇ-ep-v-O-MAAd2(0!P0B(0 0000m 80sS0`p(00$00 0?00$0 s 0$W h5 0/\%X500L%`n 0,0W45 # 500 0`00P0 00|W D4`D 0S_ @X%SYeP X:000`@ @`@0S 80< 03/P0p80<P AЍpv'80s D@0 0 0Q:8`0S}0` L0$3/$P & [P Tp|Gork 0$ Wt @3P3 y0 D Q%0C?o2000;00H03/WH0L C   a& 0X` 0;/ 1!`00;000Q!|  (P R`q02;0H0@20Lp,!<1H0``g0P R0$ 00 00S V0P V[0꒘ 40I0P+ 40S|p , S,0p  08q ^ Q  Q0 0 0 , p0㓒"000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`SppȆ-qD p-L; 'p-W6 As G-QM|0`Sxpp 00 0 P  "  l."  0@T0P S"TPu@"&0P@ @@,0S\xX@T"(0 @"#n4"P@&0  001 05.!00( XT岴XP!0( P@0p00+0@080s 0=0 |0 hT ĤXЍPU PP@@P (%$!X@0(  0 h000X@0 400t0S00XTc00P0 00X@0x (X @l @8q 3/PȆ-{D fD h9 D D D D 0@-)@M,0 p\*3 +Ɵ ,ß 0 PX  *㹟X [-㲟 F 0 .㨟0  0 Ѝ0!0P8q0 S+P ,㍟P X?l tp-(D v- A- @"(0Mb2( l0PQ2X1200500@10n? 041,01000(1800$ P$p 0@`PUp 0S0p\'Pp,P(FA᝜(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0 ( O-4P`pp00W)ZYp !!岢pPR 0p  0 @ p01Q 0S  e00,0 84 $0T0 0X01@G$, R,R P Q  - P8q008TPR40  R RP  P Z0000 Ѝpt2O-M04p@$.P`PP $0 S{22@|x]?  0100 0A00000ٛ@l娘l"x0ST( PPM p0(P噑!1P0P(0A x 0`R b ",0x  B  1 1 000 8iP0h l吾(0, 040x0?o21000Ѝ0~\Ylꔓ-X d O-pᬁ嬑嬡,M@0 S0 0000 /00L0S,Ѝ/S  /00P`pU1(ቡ`P p㘁!傡PP PP%0(` 1`0 00400,00 `T00X08`堝0100+ ,P 0 0埝 kP'`̆-V{O-p\M@P4 `儰q00 SpU  0  Q $0S  0 0$ p徠P$9\ЍO*.0 P0:0pQ ",^T ^ 08 `00000Y(0S`l ` 0 RH03/0p``0[ 80s  P!\00000SPU0$U00[P 0RP  0 * p0P0   RP P 0$U$p0p[PP00[}p P 0PQp0[x?[00S' q !P0!:0p00 0RP{* 0 1!ƒ \ 0 0PpX0 0S( E 0R 0V* 0 !0 SP0 0PU pСZ050Z0* Z%Q Qp 0S S0 0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S xP 0 0 0 , R 0S 1 `R <$ +P` $ +P 0 Q0``T R T  R X `( 0S0( L03/P <00S D0SS000(( vL0( 3/P 80<00S (0, S004 Q00( `rT0\qAQq0[[m8qiP U ^[p8|Sʜ0 :0 F[p㜀 SS 8q 0PUp0pp R 0S  0 (0p @ 01 2 0-h--As W6 O-@-M`,p4 00PVY pWpPT Pp0Z:`PU`J6ERUA 6&,00#h R 0  80s0`F`pHU p .h0S 00  80spHY pPp -h0 0l0L03/, 00Y:pPp7p00P805ЍOp0H03/,08$ $( 0RPP$P(0<00W]:< R3*,0pp0PP UP`p0$0$ PS(0=((0$ $2", 0 Sn@DS g0S 0 8P`p0V`:40S00004000,0(X~$0( 0c1!$08` 0@<00< R:8`ppLp < p00<<* `8q ,0,( 0L03/0 00 0`VV0$0$ S(0'(0$ $2",P p0a  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0Pr0H03/u8P0@0p0D00[p*p 0<0 `80s^00[ <0 0RU40@ RDp0  0H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/00  000 80W 0 "' 1!7400000Pm۶D ]"E -0 04 Q000Pp`,0 0U=:8W  0$ $ 0S 0 p0p SWp`P p b"P0RVp YV Yg:PpW 00U0#Sy %p`Ѝ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0P00  8 rp08Hp0!8p 40X 00 0S 0P*` p r*80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPv 00 80sh p G*Pmp@-@P(M,t(0SX(`,`y000P 0F0 0(PP` l PUP,(q(P(Ѝp000,唔(e0,`(P".d R v-O-phM)1$AS TP T(!0 "PPPЍ00> @ C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!R( CP$ 00S H @3/X|$HLPbU X],0( 1/( ,0P, (0, (0;P0 L03/P 00S 0SPX003/PX40PH03/ 0! P5/P%$%$)@0 Q0LpYI@/Q P, (01/(0, Q 2"4'X$Є  0/PP  0 Hp0  @D@儐 0Y80Y> ?PPmwIb,0S @$0P p@H H 8LP (08/P `  ` @(08P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000ꔓ-̆-qp408t( -D T d 4 Y As ]E '"E i@-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PWV`4Ѝ R00S 0 //O-`XP@ <b"080 0 c# p002 $'  0 S R( 0S% p q' R Q0 2'T 0 p < k+800b"0p00S   _$0!0R!/S01/w-0! /w-$1p@-S@ x1SP $003/p@px1mP$1 0SO-KMM@040`DpPH(00S >I @& 0o- 0<0%"P{ 娻 K@T8p]? 00U 0 00000@00 ,@@@@0 ppK܍Ѝ(ӍM(0S*o< !80a&@@l O-`MxxM0@0pP,0 0S ( 0R> 9 HV&00 0 <0.%"P@~40k`0V,p]? 0000000U 0 0000000 00峐p`ލЍ,|,0S*< !,00C#X0S000C0C0000S0 0,0A$Pw-l -@-@&0  !<$10(10,1P001.@-@%0 0! 0O-4M`@(0TX\d0hp`P 2"\ @ @,0;/,0P R7P 0F2PpC %p W 2 % "0  00 0(0 0 0`g8(04ЍO/P׽4ЍZ:p@-@Q-( )$)H)`)x)P匒 0  P兒40 P<0d p@PPv80 P<p,0 P(j00 p&rE '|E )*+p@-PMX`@X  V*@*l****t+0+L++++,PA0 kP8 aލp`-00PS' 0`40PP80S80  4 0X0S,!j@0 P\0 `0S T@ `d0Ph0Sڬ D@l0Sڄ :@xp0SD 0@T`Ǒt0P]E 9E :;@y=>E E ?ABC@-PAMH`@᭑  "V(,-@-h--D`qK0 @00S    8`V@劑 0 P傑0 Aߍ(0Sx  @#,0SP  @@00S0  @ ]jB .E /1E 2@-0AMP@0Q*$..0/T/l/////@ q0`N  z 0S (0S  p  l,`VL OAߍ q0`N   V 0S (0S  L  H,`VP$0 &P 0 P0 P0 P\0 PHې0 P4Ր 0 jB }9 tE    60S O-@MV M.Pm 0 0x R#p R0]娥娅qt8`  0@0S D` Pƙ ` PC H   pW00(0S%$B00,0S$$B0000Sڤ$$B0+ 0 t0B/PDdp᭠x 00 0; Q <0 Sy0n0!$ Bv0#0 0=,0Sy0n0 Bf0# 00;8Q30#w BU0x#0 ᝉ<0Sy0n0g BE( J 0 R $#X B6 0 R "J B(0x 7#0= 0Sڴ": Bx 00 0=$0St") B0 ᝉ(0S<" B0x 7#0=00S"  Bx 00 0=40S! B0 ᝉ80Sڈ! B0x 7#0;! H! B0000B/㝘pWxX0 0  @8 PQ+< 0 \x S0L@T܍ Ѝ/--wE E E E E E F F !F ۂ: (F & < /F ;F BF IF PF WF ^F hF C-`RGM8 C"U0S1 ` ` ᥑ딣0p⇞ 0S    `,pYV "n$ @጑8`O 00" `В2ލ@< 0   0S  "f `PV ' 0  "1 S `  N00S @0S@  2ލG,<0040!0"0W@0n$ 0DL03/00 Cp p q r0S !0 =HD` 0S " "p8`Y$a0 x 0QW 8 <0RN  0  0 ".@+@塍 0  c R0Ut 0"  F QF &G jB v9 F %tF F wF -B @-x @] +0 @0p0}d@ 垐F @-@ @J 000(0,0000hd@ 剐ꐯF p@-`xAJM0Ps]/   0奊1SB|>>>L?X?d?iJߍpP@0 00 PP@w(PoVU@@ 0 (o0 0(0 00@0^(AP(A4`,P,`0PP`x&356p@-0aPM,0$0Ps@]/  ( 0<$1 SP0@T@d@@@AA(A4A@A$1PP$PЍp1  , ,0S$0߷`@VTPP 0 00 000 00P00TAP0PAP`@@!n<`@4` @`@x&w-O-`DpEEEEEFFFF0 P 000 PP 0/S  !0@@ 0/S  ލp1?o21QUx1N0",!@<1(0@`1?o21P 1?o2 1 1S 1SaIOVTPP 0 0 00 00P0ጌ?P? 1S 1Sp`JO 1S 1SP`KO 1S 1SNo * -!"#O-4MbPp@rX Ȳ TXZY GGHHHITIII l bP ؊ X @@04Ѝ<Ppˊ1PeS`# "1S "N ! @ b 届 P0Pp姊1PeS` 㠊|0 1S  1SX!0 @ b< 1S 1S$1! @ b 1S 1S(1  @ b 1S 1S,1  @ b| 1S 1S01L  @ b< w-Q<L9 Ȇ-etO-0PQWMu01 `%0@ 0Vk40Sq 4000S4l`V$P |X003/$}1S}axh4x 002"+Q:  Q 5 00$XOY/X({0.}1{.{ K#%1 0  &(18!X G X"B R b㄁ b/ZxXXP0}11P }1aS 0S`  1P11UTk p<W2f0S20S D 00D0\b 000 20S $2D00H02`L00P00 0000T0D010S D 00D0p` 2'R!P0"x!  1\! 0 SP!0C 1ġWߍ  0 `2 0p0 0 0)1S080I$0X80`$P9 0 S6L0X 3/P h% V `V 00%$1/`-w-F -- 8QC H|-_-`t--$Q$[t0S _P V 0S0q000 000 0" $!   8 0X L03/P ht0S 0_Sʚ 0z  0" 00080 KG-0ĠĐ(MpP@0 T㧳(Ѝ 0 ^  ^ 0S0 @`P aV@@# -C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@,YT $0Sb S L L0S004Ѝ0CS@D&4$( ,@L-\30S/O-@SMP 0p#00O\|`P 5HH _@3P ( X  i  000 `],pP0S* XZ'0 3PP Tq 0 x0.0I1P/S <(⍇0(0 00e0SvU `P  ( 0S `P $ 0 SX2vU Z xY $1 0V7! 0l!  0pH1@!Q$1S  0Q p $ ㌏'pr ハ00!15:% p wP p Q 0, ($! p h$ cP]0 0 8a4Q101S/-,--As QC q?H C G H 0S@0@-S@00 0S/0-zO-0زEM 02@PT PP0 2P  i|1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 َpPP2@0S- $P* 0 x0D 0SP꼔-z-\I - y,-Q, -\h-iI A-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T @ T7 @pW4dpW1V 82# @ R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0꼔---h---\0p@-T00P DPPp0AS@  1SA H|---0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""-p0\ Q0/\P  ^U Q0000@--O-GM0M40d2@`T]? 00V 0 0000000@@@@  h0p@c<  b G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  K ,0h 0 t0`@W 47 4U|4 VH0G, <0," B-l w-0@-DMP@T P08 @\0 D@  d  Y0 0DЍ00Sw-0@-@DMP/ P0, P\0 P  T  0 R X  00S0000000 0DЍ000Sw-p@-@Q@M`P<ڃ@P  T0 0SP@Ѝp@0@00 D0U@Ѝpw-17@-@SWmmnpnnnn Ѝ0!{P4PP<<0P0<0P0<0zP0<04PrP<0 S, 0<0gP<0 S@  0"l{080#f{0,0$`{000$,=4@-@PD x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍp^$J@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P 0 $Y<  <U? ߯0$'P0 |! ܫ|Ѝ0蔓-80@-S`4M@Pc00 0P 003/00$1U Ut  4ЍS0  000 xp0 7/( (0㝉 1 I k1 p@-00MPQ0@$ 00x` 6/< ~`Px1؄x1a1S0C€10ЍpI p@-@<P ߋP $ cPp0S@}p ̋P PPp0S 4! B! ᷋P  ;Pp0Sp ᧋P R P0 '< "PppzI yI \I ˇI I O-uM M4p Z-H0cS_ Cު0SSyB0S  PBؒ0SyȲB0Sy2 P    P 2     PT2 LH   @  Pv00002 @@K @xP@ PHPP< ,\h@ ,D@51 0101010R0 0K000PP0 `|p@  Pcy} 0S10$1S10 0Suݍ Ѝ㍂P`HㆂPjPi1S |!R |uMP x&w--h--,-----L--0--l-T#\7$#--_@-(00S P  Ѝ Ѝ-I @-@PЍp$QU 0 `P > PP C 0 1/0P $1$00 HL Q>ꔓ-80S 0 @-/Um J G-`ᔐ唠@PX0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`8 @ fT P $Q冾$00S U  0|1 08ЍpP CP P Q n P / w P w-A-M|8 P"U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `pXM@080 3/PDG 0!!0#`'  03/P"0#"#0 03/p 0` L03/|t p` 0SXpH׽g  !0|1 01!0<0S P L3/00 L03/P @0D t0Rv`p00 L03/P @0D t0R 4 d00`RP  w00p 0Sw`<w-U J O-RMhbP  s @PH$@<  QPpߍP(  Opp{0S  !<08 (00,0 0000400!4 04$0D0(0 P aVph gl 0 p  HRR <R 0R $|R xR   p p   Кp 8p?pq8SȸPr   00**0@0 N 0* *dd@edA{zd@A-CMMPPp`;8 fp@P  0P;PAU00 ## CލЍ /O-T 0 X  1!^ 0࠱ ^0.0  ^࠱X p 0000 @00R00000 ^ 0(00R0#02S<Ѝ\ 00$00 S00)0R $X' S    0 ` 0T0T 0  1!^ 0࠱ 00S 0 84p< P ,04 WR,[6^ ^ [! 0 S000T0T 0  1!^ 00࠱ ^ 00^ R pR0؀0@-4MP!! 0 P P P@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`@@

P8p< l0P 2! !180 04 0 PpW00040080w-#+СТ@-00@T\3#%:/o"\ R0 , t 0Q    $ ( ,   @A-@0PpUP3#:/o"P RP`0Sm zW@000000Pw-O-]MMp 6060@ TR3#W:_oRRPUP  YD R R IR 0"1 0 0`  !R31Q 7 @3#-#-@0S D0S## #@ #0 ;.P`P 0 ⟗pR 0S +]ލЍ@ D@@0S $|а p, (,0Q^ $0Q }0P0  0$ 㒳+ 0Z;  0F   ,W00( S:}0 LPܕ 0000Y/ Y@ YD0S0 L1.D@0\P(!) T  0K0P ؠ0,à\P00   0R  sPd0\0\ h 0R T LPS@ POСJ yd|d{dЀ'QJ tUJ I E j- 0$\ (00S l S  S00/Q 0P//0S 0S P/!R808 88@- R )r0@/J UJ 80R*@-0M@"P0 0! 0!  P0Ѝ/A-Pd`0SU@ @T@p  @<`P pW@w-S@-@P ' d~P { Ѝ<sP {i`P (PP )0P` VP PP(  HP` D|>PppYPP 0SP` P -`P @00@0J J J J J J J "0@-M  㡀Pڔx 傃P p@tPxP_|Ѝ0Z|wY0S  (0fK ؤk@-M0 03t 0@S|( #7|0PXwT x@088  P 0  y ЍQr!9UJ @-%u0SЍ@-M@ tT0  CR$00SЍvA-@lP0ST 0S` @4P7 #P.0'% D0S(0 D (x0{S  0 ( 0 0{ ~@00#@#000@4(0 0 0{~d@=K DK UK  L K nK K K K KK p@-@P} # #0S S z300 00$00(00,00p@-MO0`0QЍ S 00W@0Mu #0$P (0Vp q P0W D W  00W0S U0ąA-P@\^ 0  `04pX T u0p04 4`X \^  R  0  `04pX ^S@-Pp`lM8V00 0! (! 0 'PV$8 80R:V t#@RD$ͱx@PV008P+y0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0z/L A-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* wPW000 l0 0004P 08000 <0S $0R 0$ A 8< Q\00- \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ phxvL @-@ 0S PO--UM M00 5%50S5%  P|PP Uލ Ѝ5 %:@0[|PHv@P T@t0 $08<0(40PP$tPD 0 ` pX0,D,UP 000 0SXPD0(00040(0<00a@08`0S XU D 0   v0U0Q0SpPX X X0S  X~ Xz v` v0P,0 XTP(00W80400<0tXHP0 000$0,0S @ X~PcX\vPP @w 0S$00)wI` Dl0pp0<00008``#004S``V Pp0p`00S00PP 0P0 0C50  0! 00$0080 0<0$0500D0V/;`f0PpUH HPLP尐P P`0tL`PH--w40S 4 R 000 0#ṯ0P 0S F៯뼀8 0<$ 0S P 0$ 08000S`H rP`T0S0P 040 Q\8<0 Q\   ǾP`L UJ ؔ-L L w-L k jB |d@-A 0P 0Pؔ---,M0$00 0 00 00 00 00 0 00000000 u,Ѝ7@-@ P00<0 060 0000 0 0 0P  S Ѝ0C-M@pP ` 0 00000 0 00sS̀@ P0㓔$ 7p0lS|p@ P0㓄$ #p Ѝ@T r@TpTG-pP8M(@ 0S  u wP8Ѝ70 060050040030020 0100000.00,0  P #00R R 0S T `PP0c# BXPTp@-PP@M <@` @ `  5/V@@ЍpTO-M8`@ SFf* "R]  BR^rq/P X" P0`mLP2!,,!ꔓ-O-4@MpP -` P- V \ P\& P!U q?rπⲐ0sᲠ20PP P 0P0Ѝ`VBTUAs O-Pp `@D 04  0S@0{+0Y0 P@@0@ 谧-v9 w-0p@-P0@SU$ U# U p0UpT 0D S\\\\\\\\ @$0D0 pppw---l--@-@0Sw-C-DP4@0  t3l pph (@00p @ 8 @Q%@@ Ѝ蠫-v9 r@ w-80@-@0S_ 0D0  R@w--A-P@p0 `   `B 04 8 <00 00S00  SR000O-0@Poo`#0S Zp`B0T ЍZ  R  SR S"0P0S R000Y 0 0 [YA-P$(@p`@0" 0 $ 0( 0,2Q 2R0 002S R02S0(2M 00SM )S"S=  CR9|||||||||||||B0C0#S S0 SS S S0 S , RЍS  0S0000@P    0 @-U8M p@-0@P@0S0j00S00ӵ0Ĵ00pw-p@-@`PQ Q pP  j0P00E00 .0Q  ;v9 @-@00S  ;MPP  00S T yj@Ѝ @D@$0SZ@w--S@- 0wЍ4 (P \P/ ‚!S Q /  (08 Q S 00SP00//p@-@Pp_onUp@nQ`00 QH0H H@-%Q€+q @  "2/>M RM @- Q1`0d1@@Q`q4ЍL nM >p@-@tP0S0SX DR00T0SR$D0 p"@ pw--08S^/ᠻ--p@- @ 0(  P0R0PS 00S=i ᲵppC-NMM@<ЀP`u 0 @ @ @``~@; @ģPPD pꠅ }NލЍJ ydG-xM` ✠堐@p#P@J!0@P 0S PU 0 R<\1\!\\00S 00" !PP0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍZ Z Yd   ZY <  @( гM h M I E j- A-P`@)P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 0-O-`BM Mp@P/0,;( @pP@0 Z@*0j0 #;$  e P!14"S; Wᰄxo@ U01U01Bލ Ѝ 0CjP 000 0e RZ0 0J$,#$0 0xl 0 RZ 0oS 1 SR 1S  RS1S1S `2?B冏@0Q 0STE 0"0S@0S@@kP9 Pn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 0墤4 卤 00N LURX@-04MHpL` L1L!LLHPj@P* T00 0R0 !?020 20P000204 pk@4Ѝ 0S" $0Q00 L03/P P P003/L |M >A-P2uSvw_10000“b\œҁ@FL@$H @A- P@ \T@@ 8ž\ @T8f `Č `Ȍ `̌b` ` p PČpȌ`" " 0`q`1~``Pa 9k00`T08BGP08}?0@ T\ Qp`82S40 @0 8lŽ~?`?̌p0hx0R @Q2T0S X 22040TP 2SXM O-P`@p\M(}4000PS2 0\  \^T 0SQQX W@\Ѝv fb(0,F 06!!S 0(0,0 P PQTU Q8b0 RW$4 0 P Z P\ T 0ZbV0V0Z 21 SR 00(,`80400Q!`00 $0rq? 00((2@ 2S 01 $  0iPMW30M@2S P  SR q? r?Ⰰsό(0 8 0 R    X 0P@TP@@ 0S 2 " i02#38( R,00W? Oe< 00 (0$0尰S4 ( 00q?0" 2o0,@4@@P# 80  02 S02@0S qSP i@D0S 1H R0!0Sq?r0 8 S 0o ₲t, ( ^\  Rt0 "0o~ς,ఀpȌ Q 0C0Ʊ#80±W,0'N nN UTtlM O-40M@`p0PV00PT8T(TTcPV@8:Ѝ}  P 0 "UࠓࠃR^PR\ "ς~Ⱀ, 4  0S 0Z000[ 00S 0PSVv? 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@240r/q?0840s80 0(8  R    T R,08 S000f0D0agD0P7V50Qo_P0"Pyh0S SP hh8 @VU 0 o?0 R S+ RQ  0^/o_ S㴒P!% 0 8,0 S0000IY0X0\04024 0P*h0S PS 1hh`B I m$)<1! R02 0C00"@P0 ^(T0^X0\0Ph0S SP gh,0T2S2Z 00fPR?" 01@22]UV 02>0"S0 L    L H0H0P LY0H0PSB 0D  $1!R0 P TP XT\ 0 S 0SX0\04"o0P|h0S A<SP gh<PR#38H0 01_HP2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0{, R0 V,0/N M N -UtO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8_"V0 2P0 4  0 P#P "0#"#0 D00 yP 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0-МO- Q-aM M:0@ 00/;㽜`PPaލ Ѝ p H6*P:0@ r,'W 2S 1S<2<"<<u0   &      0S!?⧻t  0 d T 9 a_PTRUC~L&HRQ  0 1Z!*??  @0Y!)? 0? cpP  $_?XT D , _e?X T Pd@UM Us@-RU0 3@`d0T `Š P";0H0 `04 oЍpO Ʃ M 'O s@-@P04P00 o0S  `VRUp }0P 003/8_oeVeЍp@eGJ ةk M p@-@0AMP 003/00; ㏛pP   0d`P 0}^ee}AލpO-p0\M0SQ `D#aS@0 P  P0bf0@SP0 0HL R ?  c ?`/Z[` P @10`d ἐ 09/0P@\Ѝ-G-p0@PHL` R0418S ^ @Z R  0\ !X0?Pࠡ࠱000^ 0 G/蔓->00@-M 410@810!T`0 P00 0LPX`0 H0PU ! 5/᣸Ѝ0蔓-}6 @- I~@ |@-  W 0ijhqP ('@-@@0s|,00p ^0Co&--?$M0 0  |$Ѝ-4M0 00 000P4ЍO-p-MM U o} " @f}4 Ѐ0 p0 pW(0 0CSpW"R 0pğ|D0S 0s d0SMߍ0S P $0_40S` $1`#S006 S鋟0 A'L# A0f{{JOdTd@03 x3R - B`P   BRڒPL"B 0@# f0#2`$ß 0 RSPSB010000 "fg 0 `S$0(00SZP=9 =:k{820\  0 A9  A { Q0 \RQGA f0 Q +"+Z R+"+ Pd@./+"+ "%+ /+"+ 0"%+C5 `! 41@P0'10 PRldP  !"%+0Am,Šˌ C5W7 @0S00d @0 00p zY@.A-----[-t-v-QqO }-@~hB P0 P C0  A=H0 A k{I{7{zW 0P | `|fP<00<@0 x@ r@-@@W<@SRG-PP2700@ RPąLp`P:X:00X 0EPw @-Pp@`P0S -S :S S 000`  0 P00 ЍU0S00T  n`P'p@-P`%zp@  zP1zV@@700pp@-P 4` zp@  yPz@p@-M@ V{p$ ЍA-`p@T/   PP*P. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M p 3ݍ ЍAs p@-PP@@zpIPppA-@Pp p` j 0W0 t0WpX U`0\0P P  0H 0hHЍU0 0  a-qi i i x @-`0tM0FP?o2p@ )pz lzpRyz@tЍyp h2SQzp D0V#4 - zh"yp0 p@-@ #y0 S " 0PUPUp@ a0 S  0 0S ``0S   0 0S ``C-M0Mp@PU `0S@PE8  0P{00+ۍЍXp700S @ Q@BPE@C000  p T0S P0#S @UX 4R i i j 0@-MM\ @  xpP@0SdۍЍ0 ER h1p@-0SM@` HHD! R>P0  0  0 &xp0 S 09S 'Ѝp0 S   000 00P0 PS @l0  j pHP{  Ѝp@pj YR mR 1j |;j p@-@$`P]Pp0 @ `P0 002 0pSp@-PxM@`  Nj0 0wp@) wp$  wp wp  wp  P L0   p(0xЍpt wR j |;j 0 0 s@->@P`Dp x0 @ p``X0 1p <0 @ pЍpR ;j p@-@PqP  {w01pP`q  lw0#1pPp60@-tM0 p@ ! NwpPLw@tЍ0C-QM M700ۍ Ѝ  Y0` @V v@pP`@-`R00G0Pp@ST]@PT  Q*R@00 S   0 0S0 S * ^P `^^  00000 0` @@0P  Ѝ|@-@@ R p0@-M0@M0$,p Ѝ  R Oj p@-P@ ` 0x8 , @U\G) 0& 0 008 , 81pp@D yj ]qj p@-`<1P:<1x1S0p0@Tp 0S  00:00L1p@-S@T1S#d1S.RU9lRUppbV:l@^lbp1C;^L10CL1L1PS3^0P11C-^T10CT1T1XS%^0X11C^d10Cd1d1hS^0h1.2,P0C2bV ^b!p2,P0Cp27@-@0 PP! H1 0D1E8-@@  B Ѝ0@s Ѝ0Q@-@  $  buP p f00` Ѝ@ Q 80 @pЍ@ Ѝj R ;j Q@-@    uP p 600 Ѝ@O 1S)70|],[P| 0180 @pЍ@ Ѝj R h;j @-@p t10cSt14 Ѝ@ 0d @ Ѝj 081/@-@`'L0S S P |080H0S S@'j j Ap!@-RM@ Qtp0 D Ѝp1Sj 0@-80@@@ PQ7@-@  ((R _ Btp = P u Ѝ0@ P 11P+|1@ R  |j'QPEUQ |`00CS`0X 9c\0 @p 0< Ѝ0@ X0 X Ѝ0j R 'x';j p@-PDtpp@00 @pup p@t# )Dj @-@T 0S x@C-MP`H.0$ :0 0 0100 & 00 0sD00-PQ 0a(!"4a#   0 >Q & Pp W  g 080wP040Ѝ 0b"!4b4# 0 0S %/%p0p@-8P`J04  :0 I0 P@p@P@  @Tp@p@-8Q > >0S **V  0S 2`0 S   000x1  @  0S T 0P0 S   0 m 7m S @m Vm C-MM0000 " @0pp 00P+ oP`UpQvJ07S F0 S W p00\!`1`Px1 ,ލЍP  P R쀟쐟PU sWxx  x0 S   x0  pP 0 Px1p  P  0S 00 PS jm ym m $Q@-@  \\,p07S@X0 S 0VS@lj S A-`R@M@p PP U 70 0@ЍASP"R 0S 0 'r>XU$  *xP 0S <0 *P p \ <0F <V>P  *@ЍAu@ЍT m n n O-P@Mp^P  WP 00 ЍO|GP{ hB@P000 @l@T >T@P`@ [  ` j0 00V``IqV먓3#@`` ``3Xx#p3px 8118100x1@T+  nPx1@F 81181kQ NQ@ 6Q`4Q`UQpQ xQ nQ   ` 0S 0 @0P 0 X [ o p 0 0S@T81181Ѝ 0 X [  R p0P 0`` 00M0 :0( X!0 S@x#P 0S 08  * 0000ST Xxx0P 0S 0000S x0 :n Dn Kn [n kn tn $'DU n @->@T( "44p P`0"@"44 0W RL L0 b"!4b4# 0@> *>@D Ѝ耼p1p@-SMP"!` )&@P T 0p1!V 8U@ 0S TX~RP @wtAtЍpp>0S a0x1@T l1S W  @>0S@ J`l1S   {0 @ cP 0 @  B00.%p ,.l1S v +v txT Ev hv v v 0 R/ 1/-/A-@P 1 !  XSp0 RqP 0`0SP000S \ \JRP0 S   000S00@00P10 paU0v T Gv w P@-|0| ||q0@00 R 0S0@0  0@00U@v T v 0@-@T0\@@^0S\P*\@0\PZ 0Sk R0@-M`P@Jm (0t`p`FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$P1P!PPMWD14!@81Z(@`P$1! 0S0S0\,0 0 @T0@TzQ@P0\400 (P p`P,00@,@0S  0 S0 0@@v T v *w ʚ;;w @-@^700 Ѝ ^   ʚ;@-0 Ѝ@-P`p@,p0 000"#k ЍMb@Bp@-P(`0 PUPUR PU PTP,PP@4P`P4\pQ@ v T v P 0 )@-0PT0/v T v P0 @-|0T0/v T v //P@-(0( ((i@008< D0v T v A-(MP` W10U@0$00 K0@p000 0<0S jp(Ѝ8010C>S{@( ( 03(00@000 0<0S80 Ip @2v T Yv p@-XyQ@P kPpR@p0P@ P00(P,000P400P0-s@-@T0P0Ѝp@Ѝ/ r Pp @/o" R 0Q000p {j00C0mRPU 0`0HcR0HPLPU0 P(P0P0V00 S   0KR0 S ,  0BR0 S 4  09R@-@@1RC-@PM bpT0SY 00C01@0S D3/x2x"xxo(PU0S Pm0S R>0 S ,  003/00400P4P,!0  P0V0U0S6 L0 S*H ؠP, HLH R# 0|S0   000 00!   U 0 HJ0SP(pzI0Sv E`ЍT0n0S R 8#8 PEQ 03/UT YP-v U v @-4 0$@ 1p t@Ѝ('p@-0`AM$MrP 0j0  p@ i@AލЍp$F P ڢ!PQP"@ 80 00@$   R&('-@-  Ѝ Ѝ/p@-MMP@ 0 `ηR  0`ۍЍp-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  | ЍЍ/-@-  ЍЍ/-@-  f ЍЍ/-@-  ЍЍ/-@-  P ЍЍ/-@-  ЍЍ/-@-  : ЍЍ/0/&0/&p@-AMp {hp@ PA>0 dSV '@00Aލp$P 0 4Sd&t0/&0@ R&p@-@PP; @ QT V00pp&('Q@-@Pu;@@;P@-@p >hp :h1S"@)Pi@-M@  |  0  ip1$0Ѝip@-MP@` c  0X sip 1@ R! (0 p`Ѝpii$00 H0s P/0 #  ///A-XM>PUrV0P0XЍUi700p@ `R}0 PU B0>00 0<0  ,> A"PP> *ATw @-@T?@Q/@-@T?@0Q/ R0 /RG-@P(M0'0S  LP P EP:\`P $0!00 0  $0S80 $00(Ѝ080 !00S # $P`p  P`0 P 0iS.S  P`~4$P 040:S'O-`-[M @F/P 0V9`0LpP$A Pp8Np[ߍ0S00:Y 0S 0S_0PP0 $ iP PU0SB 0$]P 0PSP0SPP@T1S<@\1S`1 $,P=\1 S S RP@L1SP1 $P-L1$S@COoB@TP!P"d$  ]0s 0$P<1P X1 $P@T1SPö@@00SLATd h1$0P0; @T$#!P p$YP00M@PD  ` $  0[$0E  P h0 S 9`001P d0gp `0 D000S0 35S S  CR0UX P PS y R 02 > 0*81 U48#88 S R  p %S 0 S U  R P!0?D0 p 0L0D0}>D0 P 0000H@@@U >zw w iw w 0@-@PDM QP@T <00p@DЍ0U  'P @0S@-`@MPpTЍ 0S P 0S0Qp   S=@P @-000Q/Px1P/$0/0@-MP@    UP 80 pЍ00 fi~i @- R@$M`0p0 PR  RU U 1 # 0PP  R@Tx!@T00$Ѝ R @.f@-@,p !p !p`Xe8- 8Q  8A Ō8   "  0Q5ã0ã0A-`P@P─@Ѝ მP\LL0P q)P pP "$U O-@P=0"Sp0W"SpGP Y "`P v700 ЍT V70`0Y\ T00W YT X0#0%: `T X3#: 0\Sf0`xSmS0SD bS S\ Tn C R|UUUUUUUUUUUT0 PT 0 0T 0T 00 0    00 `` 0S& T  J0P`0 NRU`0S  IT P00T0` 'P /0 S S /S/P0/S 0 S S/0/@-`R$MpP 0S0U00/ደ@P 0 00 0  0S l$ЍU 7PP0 T/00DU 7 x x O-p ~PP ЍO=K`Ppp  ЍO;K@@ Y42KaPP   "P? Q0A00 Ѝ K@ `@p 3J0P& 0 @ 0p00@[ =  @X  RP0S @P5+U 1x A-@ J`P,p 0e SJ$`P,p PP(0e S$J0(0$0PPO- <6, @! 00<&P0U H0X UPXH0P20H0P 000PH0P00H0P00H0P 00~H0P 00x(076002P  *550S00T01=5 =P5\HPPXU <1p0@0P@d6`&Pc 0SOLP=U HT5DdPTPP/U 81 800zP!00 00 0 5D00`S47`( "4`#4 4H0P800 P P0 0P0 0P0 0EPH0P10H0P10H0P00H0P50H0P50H0P00H,P';,U/H0P90AK&Od0h0U Z7 `PPAK⚿OAK'OAK⡿OP  400C40S  0 P}PP lP Ptf=rP|DP PPp` PZDP`PPph DP jPPp( P94DP fPzPph P'tDP xlPhPp nPDP` |DPi vDPl oDPb iDP#`Y <,  0/ 0   P;X $l?o2= p Ww ,P@DPc :DP 5DP` /DP` )DP` #DP ` DP@` DPh 0DPd D DPe XDPe l pCPe CPl CPg CPg CPl| CPlv CPfp  PbPP00CPbp pP ZP0, <Px >BP?  R3  R0 0,PSP00,0%00 0$0(00XH`  p @  dmZh0PP ʎJZ d0PPZ Z P<ЍUk C `P004000 0` B4Ypa:PP$ 0  hp`] 0S:<*P{?PS  0WPH| ⸐0P AP`&|6xvaPPU PH6P06H0P"800H0P80H0P7 00H0P70U 6P0Ph2h2STPxH0P00rH0P70lU `P 00`@P P PPSPSpVPpd P PZqPpP8H0P402H0P30,H,P 4,%H0P20U  0pHP9P[H0P00H0P00PV 0U0F lN  LPU` d0@T$(@<,>P| } | ! } } :} z \{ O-p@Ѓ8`P P kP PgU<1P ЍOB$0SX4 ,0840 ЍO Ѝ$U x l\O-`S$M0; 0@ QpP  80:0<1H0  0 0YBp0 0000 000P0 U  * 00$Ѝ$'n n DU +.A-PQH1`Sp51Sp:x1pS> PI@@G@TE@`fd6S?`?@hfl6S@h9@pft6SAp3@|f6SB|-@f6SC'@X%@A"@!@1pP@@1pP@X  RP T0 STd6,`0Cd6l6,`0Cl6 t6,`0Ct6?6`0C66,`0C6O-MDM` 0>P ؍DЍH0 3&7 000000 06<06]) E$v000 0:0030 0%0  Xp W +8 0 0 00 +0,r01 P#ZE0B,E>P0`d60,(@ZP4: U@0p,0@04C_P0/`6hv2Pd6,2`dl6u SMhO?pvP,t6u SGpF?&0l"&h6l6p6t6p"6608@  p450! ,~]0M0P 00 R @0<   C 0 0 =  @0 R R R P\R p@PP@000SS L3@ P4400  C0 ?o2P0@0000} ]   p@-@PQp=]  G-PM@` P `bp, 0 b ````b 1 pW0p`W% b 0 0 P@ bT  @PЍ00C>S`"P!@03@000C>S`"P!@03@0tT PT lT pT -3@- P 奯p @p@Ѝ0@ Ѝ/R A-@ 6 tjB R [ f v C p@-@Ppp p@RRA-P`p@@H0s  S  U@ p@@@dW0S  R H R U@ p@j A Q/p@-P0U@ST` 00p l<P@$@T:p薃 A-`PM1pSAT  p@xЍh D<PЍA!R 00 00 4p@ aap@V 0 !p@N`P Bp0S px=0 0 0 #40 PP0S *VPP @TnP@~@P@+`(/0p@-` (M00>0@SP  '0x Bnp0 0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 xTT0S (Ѝp0 8P 0T0S ƽ0xyPT+ A-@`|VPFPPP2Xp`Ex'-P x倂|"x20 塼V0  N|2P|R@-Mp@`P! = (9 (uX( 8pIGPU@ Tq700@ kЍi///0@-M @ Z_+PPЍ0 3"Qp 00000)Fp00000@ Fphl 00 0 "Fp8 Fp :g ʅ ؅ p@-@Qp nEc-0x1p@^-p@-FM>`V P00Fߍp@PF/ ᨻ9  00up01 0 `0 HF?F 0> *Pֻ0 F?F ii@-@MP4@ $⹷P P@ЍLg Q@0@ @@-a0SSL`/// lg $00 Hp//M @-@p000p0@0M00@-,M@P(  2  tT CFp 0 00S p,Ѝ08i(p@-MP@  `   t  (PFPЍp:iC-PQSM M 3 #  T0S2"`V2"@p@"ܺ0B01801T0t0H0 0C@L0@T0H 0H0L00L0@ P T0X00L00L0nPL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0T@L0 0$L0120@ 2ѺT@D@@@0@L0 X:  @L0  ᶺXH@L0  @L0  XP ឺUPEPPP@ D$("(Cp`Sލ Ѝ  ₺XH@ wg    C-0M`p" 0 0```$`erp@Ѝ P@ Z)PP `` 0 Qrp@ @`@"+00V :0 ( P|Ph (* NY 0@T*x0V*00p+@T@g @-DM`@ pP@  Ᾱ  Hs !> U 134  4R2$ @0 "DЍ0Ui@i)|0@-QM@ P ⓹Pp |20x2 "LDЍ0@-]MM#`Cp@ P@P -R 00@]ލЍ0S0S S SS wR@T Hsp@V@T@S  CRPS @@ @xpPP -$0 Bp 0S$ H [80Sr S~ S00,0S  R000@0S  R00@ H P 0 Hr!>50H \0DpY?0S ;01S XX0S|0 0 0 00 00 pxmPg>S S[  @]PWx@PK V DPA 0> HE@CTm50S= HM P N0(200S,i@g  @- 00 000 0 pЍg 2S/2S00/@-@@役V002S00/@-@@容V0002S  K/g G-PM`p (PPJP(@PR PP`Ap<00 ⮐ APpw0S p  >Cp PU0S p A)@! (q( $Cp | PCp 7/PP Cp F'P Ѝ@I R qB@] lBpBfB@0G-0 M@p`0PU  iA0S1P   P弑 0 0S V1!Y0 P000P0 PPP0PU:000000x  Ѝ@-  B ЍgB0p@-M2S@P`x (ηVP@0  `(B그00ލp@  g B@-P`2$MS0@p0  0*00ᑷ%T0PЍ 0p`@$Ѝ@-@@ (@(@-@pp 8Bp`~B 0`( "4`#/p@-@^P TQ00p``0@D^A"000œ\p@Tp0,R0@-0 \!Q0 # R 0@0O-QRM@@0 @00Ѝ1`Q V00P,p0 Q :@QpSI B\> \ lP lP U  Z4\[X\T p Q*S0C0 4'P 0 0r 家 0@ S2T0@cSc@-@ 000}P 0S00Ѝ@-@ 000jP 0S yЍ@-@ 000UP 0S d Ѝ@-@\0S 4\0\0@-@`q0'`?0`00@-8@TJ@0p@-80P@$ >Q! &T(0x1 RpR 0S TT0Q  >0S (p@ 080TUTꔆ A-p`KP#&P@00<000S@ (0? @0K0cScO-0GMⴀĐ@pp0 }00KC%`PPS d0S  GRW ( Q  R `)Qh 0 0000200> 0BS0* 塵 WW00 RS00T- $0K0`C80$`P0 DQW Wd\ h P FZ <(/$ h 8 FQ @p$Q DQW R <0S @FT60 <0 G @W 0FS80 0 |:@WWW 00S 0 84S 0 FS+008$A 8 840@W]0  0FS20 0  @8 RN  FR3    0FS 70 @000", Q2`6,0d&Rj I0Sp0 }?0S< N? FP081#<111% 1+ WZ W(,  PW:@QT; 0,S P T(, "   PW: ART ,000D0C00s W00FS9000 C8#< ^@73S Y 0 FSM007# K730@(1S 0 F0S=00(  9(100@ 0S W02S 0 FS<0 0" 20@W0081 0 Z00 FR P0@  2Sa P 0 FSQ0[02 0 0000[00  W 0  ^0 0FSst00pp95SG 0 FSg^009% ó9E@@6S _pp0FSS|00xM ⫳|6S @000DKP8:Gߍ0P 0"9 ħ0F R-0   ታ @  0FR000S0 *$   n0 00p000, ꬆ cSc25Ȇ 79 s@-`\@T Ѝp PP\B0S t0t08  PP @0P p$' lh /;j A-PR1!ȱ@ ` 0P p@ R1 0R000 N 30 00| P0 0:000r P00;000h P006000IP00ЍP 0000t 00 01p00 0%p0 000" yh r0 ] @-0`0i0 MS$MPp 1 !p ;p@0S i )`*i@ 0 P`  8QQ0500 0pPd!P4 T ۍ$Ѝh x'$ h @- 0080-PP@ `V@ @T ?!@P  300ЍpO-IMPpHLPL `PR H!0@PIߍOc#0,0i]#600 0s400 0 P` Wp00,0S2 V30a2@0 0!,0 CT~9`0 P q9X@PrIߍ@g90 P VT` \`00TS9D0 ` J9Pꭇ h Š@ ‡ fՇ O-P`@pQR帰,P`,2,ES#PU`,@ ,(P (, Q 0S,  ' `,P0h RO-\00" `pP@T:Cp ЍT  X ⢱00U *="0 -p0R0  . @80  m(p   8 @ `(pꇀ c: @-RM M 00`@PBT Tp@ 00 0p"  +p ۍ Ѝ D8 &(p UPU pt@- 80SQ S   000 PЍ 0S ⬰0# 0O-S-,M@ h@@ 00_0 P? 0o0 00 0q`P3;0T0 @0P000 0^`P 0   |XzpP  $c $8 `P@00 y05`P2 00S0@ 0> Y;000⣱   Q*0"00pP 000S0 0  0 i `  $ 0st $8 2 `P@ 0S0h0 0h0  d030,Ѝ00 !0`Pa @ \Y[ د $ԯ$0`S pP@$0S  S StVP4 1S 2S0 0h0Ep ^ [$8X P@0 q O-MP`0@0400`p 0 ##p#X; X8l0S,0S0ㄒ,0嚘 2S08`,0嚘 8d6S0l,0嚘 p"R0,80,0H00`2 S,0d6S 6h 0spߍ00 0 $p $  0^p 00 0 (p $06 0Jp $6 0>p$(6p 01p#0z0D,04l0K040 pl#0k@0"04,0940  p]]dk,0 !P !,d ,hS  R,  P ,  4! 0  0, }R, R 0⒮0,0aP ,  B, 0 0 !P ! YP ,0 0L00 0 , + O = d | @ p@-PUp@0L0pp@- MP#p@ 0` 0 0 `8p7@ Ѝp 0 `8p ` 0)`8p  ҭ0U 0;1008pO-`@p 0崀SMP$H` Y000 0 0000 ``0 0 `  $5  0h0004H081v pHЍO<0 $m5 4N000(4@0S4H000s$8040Z5 ;S J00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!-500 D*S:G{k({'{*z8 S zkg{{'{* z$ 500 H0S0SZ h W 0R<0S 0Sl2h2H000s8040 PL24 P828 P$20  804 00@0S0i 000. Mp İh` 0H  P0dh0Ѝ0SL1L1 P0 ,z08   00S  0R`V dp`yЍOxP0 ZptxЍOi?? È * i 7 lj @"ۉ  Ή Չ j h 2;j A-P@T R0A 0p8` l0 R 0i0P 0S <0S $4  : 5`0 \ ` ``000 00`800`0 Hp * 00 0$008 %A d0h0K2 O-Rp@\MP`@P; 800 #3P 0 RT000 -p` h@@L p 0  0& 0@P|D TX P 0\ЍL0S0 0@S@0L0L }LI00NP 800 "2P 0 Rztgjzzz{T04d0S  $ P $[ <Y- y 20; 1C<18#<410,00000400<00@0,0D00 <$@(@ A8`L@P@T@H04pt .wu h~&h0 0<108#<48#8 10 9E00`K@008#<d `(P00 0 \`vN F04S1SE081\0 *67S4 zDL h R o C DCȊ Պ  p@-`P@0 h0X T6S @h0 0 <  2  ,Ѝp@$0  ڊ L  p@- P@$ ;0 00L0p@  p@-PUp00CSp@0D $g2  (2000L0p@@  x07@-@P xG800  B`00P 00<0L008 % Ѝ0@Y }  MA-@P` h 0R 00vP3 081HAxp` bP08!(0 A TP G   D GPh0h hh 0 d0 1P0 $Aꖋ ȋ ы ] i 6 0  pC-@p0 PR  R $ RP608 `1  i>@ R PP  P0  lH8!<1$?'((700 Ѝ@0  Pk 0@-@4M8!(040P 0S 0 0P 0! 0P00  0000 0  4Ѝ00 v71  4Ѝ0@} 0p@-8 PR@  ~0P   0,Hp@hPpp@ꖋ ȋ G-Mpx0 P@81```P( `(1" (> *>Q  0*h   F ЍGAl  ЍG 80  0S 0 0 ß Q 040 PH000s  i`Pqp 00 P R   0 00$0C40 040800 8갂0S06 PU R ` h L0&0 P HЍGp0 G|0 $/  0Sm 0Sj 0Sk$/  0  d0S  0R/.0/Pk O-M000PS㴐 @pT0`S 0 tЍ> R*?:P 0S D6S<ƚ Hƚ [  S.  0 @!  Q 0 S:500 0_p00 0  c0 S 0 0Cs00S0 S0L0\0 !p 0 3 0 0 0&P0 [0S?60@ 600 0 p0 0 n O`P t 00 S\ 081Di,6@P SP0S0 0<S<0P0B!0 0 3 0 0 0P 0S6[[00S40SHt0  PP 8 l00 0P0SS0$KSK?3050V~0 [ xiT0 p4 @SS  00Cs00Cs40 > $P 0 0 0S  0 3 @0 R@ $  D 0ʥ 0S:0<08 0=0: P0 P3 000 000 z0[P00S* P )  p喥 @ 0Z600 0<P0@ M0S * |P ;  ph81 000 0 0000H c0 o\0 S   0h!80S 0 (@01   0S S0 hS 0 80Sg0 00 P0PY0 .[ ,  lꨎ ) S j  ύ Pk ! w < .i p\D V g RA-P@`, 0hA`0Ru, 0D0BSpb z0 AvЎ $ O-`pR 0䜠x1P@T ЍT 0S R T0 S> R* 7P  0 D@" G-(M@PpP P0 (ЍG+PE zUV`0@SR ZO "448#8UH:`aVD0UA: W1#ĠČ Ƞ,Ƞ\5 U2:1 S/ 0$    00 Pp   5aV Q ppQp% ! V +  L(Ѝ "448#8 C!B0#>i E d @-Q` M\@MP  0p000 p 0S TH  ۍЍ0 Q`V \@Tj Ji $p@- P@ Pp@8o0S0p@\0Sp0p@Wi A-M0M0 ;`pp@P @ p0^0<000C$00(00$0C,00@pV004p8 \\ GU0`$0 0,p /ݍ0Ѝdi j   p@-P@T  (@x1S0pSq ;,02p ,02022p R Rp07@-PX0C @P 0S0>8 Q'Q'+  A R "'     0 #0 Ѝ0@};Cz  P<gjzz+Sp$0@  Ѝ0zD dp@-@P0 0Uph0Spp@ dO-`@PU Q Pd0S  0 4Tt0 d0![ ЍP0.Q 0S 0P T*  08p|0 봐8 R0, 00C0 080<0  fP`00 00 r0S $0 pW ! 03 0 0 R0H0@SZ 00ppW\0H0|H^   pC00ꥏ Pk Ə $ `8 #$`4" S /0 @Rp@-)00pPQ0`PE `@ѡ@d @DLd@pP/<0`( "4`3Z1S P///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScx1O-`@ \MT. 0S pW$    PP@0Sh0S d0S4$ d0 0S PP\Ѝ|0d 0|00 0 0d0  0 00904 ⤛P Sp8ePkP  0|0 ‛PP$0 00 PP 0  0 d8dX| YPPk y|0d 0|0Xxd͚U h0S  P 8pP   L U`  P < $R R0 0#  Q  P h % < (  dpP> t0<0t0008 dQYx X P  gUb ԚP ĠZ 0$8 0  h % <  <}d\ = qi *I v p@- P rp`01S 0S 0S 0S  0 @T 0Q0 PSP 0'U d0S0h0d0p@ i 0d\/08 /   0S/ p@-@T PP@0Fpi G-Pp`P9@Ѝ0H @P00 4@P 00000P00 000' ,0 w$0  00 0&0  ſ=pL0S t00@ 6P  0@R 0 0000@@i 00ݐ s@-@T`Ѝp`PV08,*:SR h0S L5H.$` P (0R ,0R  a `P ⚿800000( ,0AP؟0S 0 h dd0S  $0R 0h0d`0SHN / 0S/0S/   O-MPRD08<`@H0x!R00ЍMpP P0 U@ UP R R R0 2P!4y @PЍO    p @@0 0%  0 v0S SY000000000Cs [@UЍOi 0S/C-P@$M T 0p `x! (00 0@0 0 @d@$ЍP/@-@TP@[0S   0Tp@-@PPP Jp P 00p0000S0p@00:S 0S @\S000@:S @(-'P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/' @-@A0S :^|^  ^ R S \0L:\\ |\ O-`-CMMd4!SP  I SLEpWH `0P0B@ V PJ 00p@@ ; 0400S 00,0:= ypP 0 R0 :R00Hd4 0000pPP u0S x& mCލЍ  P ; 000PYPV%00 0ĕ0PpP@0S!+ 0&0P R $0C&$0SG ۝@3ם@P  &`P000 P00 SWB @DpW:SZ @\Sp S Spp0 0T:C % @D P  0SS &Pp0@ 00`Z@ S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[ @D$0 pG HP  0S %0  @p P D$0r$0 r0 @E 0S % D0A0 0T* P 0P:SZv(-'e. @-0  0 Ѝ@-(@ P "0 0(-C-MB0M00pS 0S`! \0S)  R&    RA^0C R[ y0Pv Ps @ U" Q0#P ލЍ y0P P 0@P:"0 PP U PP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0S@Z\R    B{:R|R  (-'^ @-@DЍ@MG-p= @P@ dF Pv: 00@^S0S:S^ `00A\S`0S:SQ 0C^ @ 00LT1 0L\TS`ASBC\ 4TTHSTLTHSHSHSHSHSHSHSDTHSHSHSTTHS04@ltlH RnY? 00$0S 8  ğ0 R 0  40><LT@C3^A00@C32 \  02` 3 d ! XC2 hhh 00C0'08S 0d 000mLLǎF8p| ,徎,p1PPD`BލЍ P P 00PXAB9P񟗈mnnnnnnmnmnnnnn n@nntnnnnnnnnnnnnnnmnnnnnnmnmmnnnnn(nn\nnnnnnnn  L & G % B L P B: 8 R5 $ 0  R B* (L @P# R B L @P '  (  )  *  0  0!0 Ѝp-'qԡ sO-$MPf@K 00[0SPs )P@P 83@卑030 4/X(0S@k@XEPT[0T @6 0``X1000#03,*[ PePB RP: 0L6s@P  KLp 0% D2 10Y0E30 1%Q _*0S \T\1)P@ PY 1@.1 ꇑp K@D;Y202 K 0 PEP H1 L05300P[0[PK PPe`P @P00` K E K  E@   @*%Q ᱏ0@PP0'0S 0T 0@[$Ѝ*0S @-'q : (-s@-M@p0aPD(0SWTP )@T: 0@壐0 4/0#880 .P0U)@P  `'0S 0 ( @Ѝn@P %Q|0S0S Pꊐ 00-'qo sO-PQP$Mp(0SP P^ q@'0S  pP@$ЍW 0U`P\ U*P* 0`0?o 0c  `o `S @P U 1e*B:40U$P00P03S X 200301S%U#2Q FZ*0U00S  EΎ@P 00P@P0 0#  0|0S0S < @pɈ,廉`0<0 0 Sp@   @P! 0   %U#2Q JZ*0U00S  EzTLP )@T @0@嗏<0< 4/@Pꭏ 005-s'(-q @-@H0'0S 0 00 0T Ѝ@Ѝ-sC////'/'00/'00/'00 /'00/'00/'00/'00/'00 /'00 /'00@/'00/'00 /'Q P00Q////////0P/ R//A-`pP@0 P @U*0Q R* /0/8'0 0CS0 S P0 /p@-P0`@ẉPp@ Tp 0A S00// 0P/!R/P/P/0000Q/  /'P/000 /'P/ 0S S//@-!@r00/'00/'7@-@PD@P 80R,PPU; 0  Ѝ0q}9 ('PQ 0S///,' 03P/qa0 AC\ 0AB0\ CSo \S / //00S00/(!0' 00S00/Ἀ!'" ///@-@HuD!P ( 6 @Tw('-F-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A 00ЍQ@P |@0p@-P@ `0S  \*. Q  R R  ,  p 0 B##'T-qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00x Ѝ0S/1>3 !/0S 000/T-0S/A-p0 @RP:``S * )LP` A0 PQ0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-@0SP`(0aL T  $ T $ Q 01@pC ! b0`0A-ŝMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0TT-A-@`P0S<0R"0!31<0S0 0PPR0S! !x000S!!!,p (J0P A, (0 ,P8'''A-`0 R*S\ ]\ tpPB@T Um P~PpL' @-R@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00T-< 08 C800/`Q'Q!//'A-PRp 0@S` * GJP 0! PPA-@P`p0 SV1 V00W W0St,444T|P 0 B  0  B  B " A A`0 F  B  B " Az  kpG`P  B0  BZ`FpGP|S`FPvA\p@-P4`@C@P@p Tp Q 00// ,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0P`8'''O-@P 0RM H P&  A P 000Ѝ 0@  IP ЍO 0P  S @ e 0 00<00S*^Q000800R ]R00-R Ȗf0 S*]Q -QR\V0]Sj- 0 S{:0S00L6000S8`V 00000 60S|p0@W Ƞ@bS ,0Sh40Se$0Sb<0S_(0x[ f 0(` pc0@`F `@ Ug 00C0b-Q [QR:Q =Q 0Sp: Q 0R00`S00`00-S]S0`S00`t4 R*000pBW R:0`S00`0 S<*R9 :R6 ]R300@  ̇0 ppBuP 0SK<0[$  HP    qP p$0  0$ 峠0S00``0R00`S00`00-S]S0`S00`=  R:0`S00`0 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S. W0`S 00`0S<0W00Z0S Z40 GP   pxbGx400!0pᲠ40 P0`S 00` (B(  P   P: [i 0]S~! R, V08C8 0  EB#ЍO8 ? 8'T-' 0p@-@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@'''A-@ `00P\UC S:0S004000 p4\U R[U*U .Uy 0S0 S xeP JU @0p W1@p(` ~0 S *R \R0)S ) \ W 1L  e0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  <t  3 0 D #OU &)2U  0  4 000p0^0 0 0 0]0000p0S* *Q2  0  BG  B   B0;  Bu  0S> 0S 001006PX\QV {RS0050SP<* ,R9 Q 7 810000  U0 R     0 S *R\Q}Q00 0RR \P 0}S |0<0S 00,000$EoЍ[Ut`T-)>{'A-@0`pp?Q $0A  R S@@@t`@@^QO [Q \Q PUOO{Q |Q020W:0S00500 @0P U1@P(` "0 S*0)S  ) U 1L  0 S:0S00400P 0)S  0P  $  $ RK*0?S{S*C\Q@{SP H$ "!,Q  R  $  U   R  #  ?S l*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^0 0 0 0P]00P w|o0W:0S002000 <Q >Q x3PP jT &UO F^{S0 SPp* ,Rm  1000< U0 R  !   00 S*}Q00g 0RL}QF  ] 0  BY  B   B0M  BD   B0@  B 0  B5  B  B " A 0000S 00000T-'0S G-`Mဠ PQPEwPL@P 6U: ppP PP $ @pxp20  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D t000Q R:0S005000 S=:  ]0A 0CP  H00Xo p0 P>3S, 9S $S S <0RQ00 p< 00u04|04040 .  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:_00P  B08B0U0 RB@ Q U B!U  E1U, ^0C \!1L0XRU!U! 0>Q% Q% QS 00 080Se 0S  00@0000 0H  @  0S QDЍ0R 10C/TUUT-\,Ee,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0_P`8'''0p@-P0@SQʡ@QD8@ p<0S P pP0@H0DH@P(00Ppp@8'''O-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T 2P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R''ĥ O-PQ ,@`p+ V >\# (\ \[ \G \S `P \[ \Y P @\` \ \L \06\ \ \; "\^ \K \ 0M \ &\y.\) *\ \08#8S00 \ yN ^0s00 0@0s08#8Sy[Y00>@4N5>5. `F`FPV0@0>N>0> ^0C|0>@01>3 St 0O-4M\00(0000 001@X( 0 : 0R00 0 Sd 0 S0^ PZ \00$0000 S0000``P00S  U E0F V pR p#08C800_U0S\ v D#00000_V0Spu\ 308C80000_U0SN wpK vI 0_V0S\p?Pu0 0p$ V 00 upv00w(0ppu0 v0X 0 p,X,w u08#8S0 p,,d1u v? 0008C80000_U0_V^00 0,^,000_V0;0  R" ( ZP $00 0`,@0,Pv00_PU0PSPU R S 0 04Ѝ'O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0X7  IS~ S F S 0>#0DϠ2@ 0p800 0gX I0  0]P 0 p @0P  0K 0TPPP@ pP@07800 0p.X G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R''ĥ O-4@08pP#8 W Ѝ># R, .R`" Rl RR Rd pP Rs RZ  0N0P BRz R Rb R 8R R M RG "R Rm RP n R &Rz$.R7 *R R ("(R8 R z  ȠLȠ \    r8    r ("(Rz  SZ > E    R P RpG pGPp   >  e  ># !>c V  >  !># RHO--,M , l0*4 0*0 (0* @ y   0 h  R0   z0 Rc  R ] PZ   R    ``R   0 0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p]X0w u ("(Rh pK0!u vS  (B(   _U _VP  h *0  0_Vh P R  R5   0$ = 0PZ& 0$  y0 S 0 yh `P0: 0v  _PU PRPU0S 000S00,Ѝ'O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--,M , l0*4 0*0 (0* @ w   0 h  R0   w0 Rc  R ] PZ   R    ``R   0 0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p=X0w u ("(Rh p+0!u vS  (B(   _U _VP  h  0  0_Vh P R  R5   0$  0PZ& 0$  v0 S 0 vh `P0: 0v  _PU PRPU0S 000S00,Ѝ'O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R''ĥ O--lM $PQ0Z @$QU ``R     Q 0R S h  Z5,Q 4 Rz 800Sv Pm 00D0 ,pp3P 0S 8 D0I0C0? 00S,0 "@0 S40%0 (1(01 SP HP 00000D0 ,H0SPH`Sh  Z,Q~ 4 Ry 80 0Su SHP@@@@ P$P(P,PPP PPP9"`!@p03 @0 p@& 0 Jnp@ 5np@  p@`Qn  0P3nJnPHn 0PvAnPdЍPP0P  0App pp`00pOm`Vp Em``pp0`0p8m 00(Lp@-@PCM2 /BP4 4up@$ ` hPm00}u5 :{C>P F0 @4EP@ F{`0S@ VS 00 SCލp@@0Sl@l0l 0P@0 D P@1:l?0@0@l0@0@p@-MQMP4@SY TD /(BPA QP0s* gPQaP` 0pP @ 0@wdqpG H ip@ ۍЍp(0si/10p" +$dl@0 P@0 C P@1:vl?0@0p04@hl0#S0p@ _l00[l@PWlPL%@@-qP`O-$(Y,PSp@`3U-00ï  0[X0 0 0w[ 0R0*00V&(0 `#{`0q0 "4x " 0xkP@r`Up@-@M@ ?P, 0`0#L` QC?/P FaS 0L@U/1 0S2 0 "#@Ѝpꫪ*O-@4460 `$M00@=+@ I\b-0@?o2S00/ 0P 00d 0u QS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@\?o2  y 4YP$Ѝ0 0s 0 P$Ѝ0@Pb (P bP (P0 )P0CS 00}P Pp\ 0 41000.P0S0 0S #  00000S 3R2 x 0S' lRe d#S[ -^PU PL @s@pdP Q X eP  Q000S rp!~Q eP  jteP4 ``cQ eP0.S000S00F R ࡟  Q eP  /-]@ 0sS9 ||sqeP Q 0S 0`0 4a4`n]eP) Q .S0 0SQ0 EeP` QA 9ePv Qs0 0  V  @ama.m.pmp.m.<-,LHD,+x L+*HH(A-@PU 0U0PUP!A`FFqP ``yP 0!Eq1pP 02P''O--MDDp  (0,4(00p 00: H0T ㋟L0X 300@0 SE  !o0CVX f‚!   3Sf,"!]ZY ~"!{81*#bYI@21&%#tQ <200,1SD(" 0=S 00S1X"R 8 [9T  1@01S  OX< A {{P XPL0QEaC 0 ?L`XP0L0000X0"t T 04!0SSQL HX a PA&*021,1S\ U1X2Q SP0\XL Sp |0L0X P LX1/ @KTIЍ؍x(ȋ8hq<l'.%""""8 Q !X"RL P0R:p} L t[0 1LX Xp SK@QV,1P  PV  0P0V:pQ L`XP1 L 0 1X  @PVH@(00(0000,00,02XP0,^0# <P0  0=R%0@Dh0$0SXP"ExXP A PPH@[XP H@RS@ XP000 Q0S{8< {XP 000 Q0S{8< { &XP(0$S 000<\  =RHNQL0X \ 0@0DhXP0S <\  NRH LX\ 0C00000S ^  0@D h0$0XP0$0 0XP0 0$0S}XP"x(0XP0(0,00,0x(00(0sXP 000(0mXPP0L dS`0d 0 `0d E0E E0E00#OXPQ0? 0LS0$%3@Dh=X0\ 8#:PF p0v> 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#XP(0S   R $ R`d D& R  000d 0` #d 0`d 0` %&0`XP 0dR  X \    Q&PT8<XP0 SE P\0sE `0d XP E !XP 0 E!XP  \0000 Q00SPT8< XP000 Q0Sv{8< {{XP  0 Q0i*0^b*{ r0s{P T80<_XP 0 !X0S(0SH XP90 Q00=:c 0 ,`0" R  #Ό " d 0`  \00 40*XP0E0$XP00XP00XP9 0 Q00:($^0<P0$ 0=R%0$h00@DHL0c 0 _0" R  #Ό " d 0_  \0 4XP:0 Q00:P0 0<R$0h00 0XP0  0C0  BQ $0 h00$%XP h$ 0$% 0S 0000000XP00$0S{"xXP}XP0(0y0XP(0u$QhXP0 S P^ " \01"?!x"0X$0XP2p rp t t NXP  0 R< P9#R4 & E%9H R*  \Q%8< &"# &0(0 0dX D D00@$0 h00% 0A0\0@Dh0 00 0 C00 00S ^0  $0h0 0$$% 0%#P " R01"?! r0rd 0 ^d 0 ^$O-P-Mpek`0 0e0U0 W 0 2c1  删?0 048@P/ 0v> 0`0?d000P0?T0 0804 ?+0<000000000000 000P :0\0P@ 0TP 2 dP 0 P{0Sxʴ Ruʠ RrʨQo001 0Sd `0?#0S/" ES}> `00d 0d@P0D E   P`d`F0p0t0Q RPx0|000H00`0X00\080` 0  vN@h 0)Q @D P \P40dPl`p@8 SW0 S S0|0\(8p0Tl0Vh0 Rd0U`0 R\0 Ry{  RRzP8 @0>C 0C0p0tR@ix0S dpPt`0(00(, \0 :*7PJ p'?0! P ό 01l"?! R1 R?U0v Po 0]87v~@ pG0/ QPpp 0q]0hRl Qh c 0  7qp`P  0qpc0S [R@Q @T c 00 ߍ0c\ _70qpK "'pR01'?q 0S?P; RTP\0 P0,P0  PpFZP S 00@ [c0\ 0`Rc0S0000 W\ ZR0``o d` PT\ 8<\ @D\ HL\0pX\0k c0SQ WA37#p3gS:3ß0#cP3: 1PN~06@P  ሠdSdh0 `ZP 6pz0pwb P\`@(@(,5P ? /& Rß%0Q0wt W0^\ 0" Q0P"0V#0,l`V10& Q#Ό3à\!=30S ( 9L^: 0( 0qp3 P,vsb#00pb0SK B0\|0L6" R60"c01 2c1[ß sR JbT00Gb0S"0?b0 R 1&`P 2&>`\3à\&=3&b0 0 0bT00abT000;Xl0P)\(\ ףvɻ @-@T p)&#TQat X00 R 0 R 0Q/  /  ,l\  DQ p@-0l` SPPH 0@#  T\  Q p/~~H  Q j.0 0#  Q/$00Ɠ\ 0@-o>tP 0@" \ 0 0 /A-@P `p@P@0% (P PPA-`X@@P pjNP@0& P PPA-`X@@DP pH@P@0& P PPXO-P M P`P8 P npP P @ @ % P P0Sp K Ѝy T p V T  m60p`0pS0fA-PpQ `@Q P 0@DDB(000S  C@- Mp``PP( `  100S@ `0"S" 0`000S0 6/ Ѝ`0"S1Ds\0`T000S @ Ѝ1Ds$ ),P@-@ @O- MpPW  pp2SV`PL OP@C gPp G ,P P6 0nS# p= 5@P00Q Q P ^  \0 HB" 0A 0@00oSp\000S \Z` Ѝ, OM`bԽO-@-AM Mp_` 00SP::5PP , SPp0:  R0P: CP@@:%0K PP 0 0p  00P: 0 *PPp p e@P# \\ 0dQ `k`V`  pP [ r{ ( ZP A@PP 0 PpR Q P  b_00P/U` P pBO_0SU  PAލ Ѝ 0H00 PP<p@  >P*_ Z000ft!: I600_P 000SpP`_0  ! .6a#_0: !^ ZZ000*|^ Z000qPo^d HZ000ch`iizd@\tD<~~d~- M 0  PЍ- M> 0  PЍ- M? 0  PЍ8-0M  0,KPЍP}--K( 0P    0/ 00p@-PU@pP^,0,0? `0  6/p|p@-POU@p8^,0,0? `0  6/p@|@-M@P 0003/|@-@P 0003/@|p@-PU?o20S@ 0 00 3/p\|A-P`UV00P00S@$0$0p0 7/{p@-PPU?o20S@ 0 00 3/p|{p@-`PfM@Pp]( ( 0 @p@/DD{p@-P@P p 0 00 3/p {-@-M  wp@(0(003/Ѝ@ Ѝ/z@-swp@0003/HzO-$Mؤ @00`P )Q0Sp$ЍW]<0` (P@6/$Ѝ輿zO-$Mؤ @00`P 0Sp$Ѝ,]<0` (P@6/$Ѝy!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////$z,y(yyyyyyyypy`yLy4y yyx@yxxxxxlxXxDx4x xxxwwwdx\$0(- C^ 0CQ$ :$0S 537$05 0$0(0, 0 0#  $0 0@-@$ MP05505#0%A0!0%d3P$00$0Ѝ0 $0R  S 5,3,07$050$0/S 5<37$05 0$00 /0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-DM@XP@fP, p@Z U a@Y UT US [,0  S#3@  57,050,0 Q ,0S 57,05 50RS,00# B R ,0S0 BT,@DЍD 0, R0537, 5 05 SR,  #0C 0S, R 0C 0S , S 5300C55$0P$ 0 8X@B 0S1 `@@0 SS( S R 0C3@ 50 00 P, Q0Ç0,  0, 0 P4@0S8@Tt ,0 @S 5>37,050,0iQ p`FQ")QP*0ASLJIHGFEDCBA@?>=<:9765432105bQ1?Q*0S' 031 a< A01`00@t 000P, \0Ç0,0,0P`@ZfQ?X0@SfQ p 7x hp@S H2p2 # C,s 0c0#00FQ 0, 00 P R05705, 5 0, 0 5P R05=37, 50 , ` Iv@ 1$01$0@@@0TSQH1fV=0A?o20S00FV:AoP\ P\=Q, R057, 505 ,   R,0 Q ,0 0,0 R *@V_ 0S\ @Z`@ 0PP @` RF p 7x hp@S H2p2T00]`@%#jo%#jx%ju-M{00{ Ѝp@-MP`@0 01 4/ЍpG-PRM^  `UpP*a@/D/P T1< 000pp Ѝ80S 1 00< 0 ppY0S ЍĠ Y0S 0 < @0< 000@ ppY0SY 0 Y 0 hjj0Q$ml(@- @MЍ O-EM MqX@`+pF AZ0PP@+T! 0 5Z@0PT 0 y00FA` T PV0Eލ Ѝ7Y 0 Eލ Ѝ/Y 0 Hk@-`@M pPP+ /Y RP  rR' rR  P   0@ P@/0Ѝ0rS\ 0 @"0Ѝ0 Ѝ@tX 0 kjPA-`@ p@ 0P/S /YP @0 Sp  0 SM. W@p@-IMM@`PP Sp 0: S p0 0sp IލЍpX@O00IލЍp@IލЍpX0@0fp@-IMM@`PP "p 0: S p0 0Bp IލЍpeX@O00IލЍp@IލЍpXX0@0L- M 0  MPЍ80Q 0 080/p@-@PP` G @PP u AP  p@)PPp-40- M,0   ЍЍ/`<--M  Ѝ Ѝ/ -- MIM<P 00  0 ЍЍ/<0-@- M@UMP  Ѝ@Ѝ/O-`,M @RPP00:A!0@00'Ppp @P GPX P@ 0 @XP Ma!,Ѝ(L@-0M@ %0Ѝ0 0 <p@-@`PLpp p@808 0@-0M @%0Ѝ<p@-MT  H P 00@`Lp  Ѝp@oЍp\<0@-4M@PLp k%@ \4Ѝ0\p@-@T0 00M`P Lp R% C0Ѝp<C-PpPEUP,M` 0R@@t0 0:2 0U P@ 0 @T YL ,ЍL@-0M@  %0Ѝ0 0 H<p@-@`P5Lpp p@808 0@-0M @$0Ѝ<p@-MT  H P 00@` Lp  Ѝp@|Ѝp<0@-4M@PKp $@ i4Ѝ0\p@-@T0 00M`P Kp $ P0Ѝp< Q 80 p8@-80@08 880/880 00<(P 80880p/p@-@0@00S 000 X[ t PP `00UA.L00p@BLP,$  <^^O-M@P cD `lH30 0+p@ P P00U pp00C |Y 2ATT00  RG LD@D T]:[ 2 00p0`K 6K0 V0 W8 P2ATT 0`Fs 0RB K  0l 0 Bf0SH  K@0Ѝ V0& 0P J 0 F0pHXB0SG 09 Jv B 0/  B 0(@  0 B!  BJ`FtZ  B 0  BJ 0 v 0 m 0 0S J00 0 0 <p@-@PJpp p@0RS00 /D0D0p@- P@ kJpp p@<808 0 QR00 /<p@-`@PKJpT T   p@php@-P X @ 00`/JpTT  p@p<1!0O- M  D`R, H1?0Pd 000PV1!p !q1 W0C@8t0 , @@KD Œ Č Ȍ A`|0@p4  W0S 0 ? ^ \\ Wt ,0 000IC1100Q0, 0è Ѝ00 00{<404 0@-00 @?P80@080@-@?P80@080-M0 Ѝ-M0 ЍO-@?iM0Qȡ̑qaP 0 QPz? `K͌U @PnP? K͌T /Pb ? F͌(Z PU> F͌(Y  PH|> C͌ 1S P:0> JB͌8W P-= ̌V P = ^B͌`p=@ 0S708T H0P, `P P P P P P(` P< P@ (P PD (PP PH PxP'( tQ780L0x100CS400 00C,0000h00/0P000a/ ,00P@`U 0e1P U.q010 `00V0q0 `V, 0U @ `dp少Wl` 0 V `Piߍ`0 1 S ,0 0 0 !1S 0D 0| 0>p00,0P,0 @$000< 8P!P H, $  B@  0S% 00P00C1 0@S3 00Q !1 p WQ  pxW,000 p0S,000P$0U1p 0 W pP~80Ss004 0R003180a0P0X000<Z0P0$001P0S, 0P000B0TJ0P0000C0P0X00Y,0 0CR0@,00`0QQT d!@YP p00 0W0 pW0T,00` pp少W䀍 0 [ 㔿P 0080SG  !< !^ v : !' !_ !| !o !* !! !Qf ! R |1 R 0S8 ЍQ <0 0 5Dh0  T Ѝ|iHih@0h0  S/hO-`D判@ M[p +m(p($ W+0CS0S(!3-2P*30H @08p|尰tl8 `%TPLH(D@P<8x40,($ sß弁q03=ؒ@30`h3:|p R 0S1810S \ぁ ЍQ P2 0 PC㘺qpz@ <㒺 ^㏺v㌺#㉺x:ㆺ'ヺ#〺 #}H#zp-w-t`_q|nokphreybz_{\@|Yh}Vi<0@i%(g+!,!-!.%0%`&i%j%k %l%m<%nq#s%t$%u4%v,%w%x#p#rd"ye"o{|z#`"g@dXfp@-_(@@k( @HT(PpPdO-MTT7  D7J]8'0  ,'0ᄢ pP S0SZ  p p P` . pS`HS  `r  aRR$S&0 0 N 0 ; 0⫹ $Q`B`q 0 ;0 ᜹p n 0S,4 0 s 00bR44 $S %5 0`Ѝ p P`1 4` 40 s 00bR`% 4 00$$ !P0S 40s 00lR Ĕ4 S4 40400d0S0S0 S 4$00`g pg 0@` `00 4Q0`Q40NQ  0r0  cR0$00S0I Sz? p? W0@`e p6 0 $ A` 0 s 00bR 40 ;0 p P p 40 s 00bR44 $RT00 #0 `0Ѝ0 ;0˸p4SL 0@`  $ `004S: 0040 s 00bR $4S4!SY 0@`s  $ `004Sc $2 0 2"00`}`1 $0$ r0  aRCo $100100 ?ca p 02 0s440040 s 00bR44n40 s 00bR400o000 ?c0`0040040 s 00bR44T000S00\00S t0t0! 0$ lwww0w`vuuAQsrpr8rq q #80p@-P@ 0 PE T TTpTpO-`T4P8 0$QDM@h v :Q{#R3Z 300S 8 0"0P @P`@-@@P% H@P 8PFP0S)[P& mR R@0R0 1BQ;RS S0 CmS  ;S R R0 S0S PS0 C;S  Q0RRRO-@0uSpM`d`Z|P DU0ɍ <r("( 00nI|"0R 3S(0$00 0td;PK?T0 ἳTLY;P ᳳX R 4$40T 4 |2`3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 7PR x3l2Z& L[# `P P  0`6 4V 0H5S4S 4S0?o2!8p2Y2t2 PV 2t22Wx2 P/ |2x2hЍ0 D $l h $ <% p 0$0(0fW ?P 2l2Ym ?Pl2<l2Zk ?Pl2?;~0l2Y y?P1x2Z q?Px2?;~0x2T g?Px278x2W  \?P@1t2Z  T?Pt2?;~0t2T  J?Pt278t2|200S0X0  r("(bH|"R1S0/ 4S+]L%R(SZH0t28p2d40t28p2Yꄼ4(0 00@0 0- $   Tt Xh h T  lp0tx"| S (`c8 80 0P X0 0//XO-\ M0`pP@T \2 !0S S0SXT Ѝ 0 C-\㠁r M Q Ѝ |Pl@P QR  ヱPK ,0 R "00 Ѝ 0 ЍPa Բ Pp X P F Ⱀ帐 少帑 QL״<0<0 0uȴ X A-P@pL6P @P `D`@D0 x0"P0VP@0 j 2P p@-`\@PU 0S1 RU0S@:0@S4p@1G-lp@`S0 SV0S"Q0S 0SV1C-M0M`@@ᳰP0 , 0 @S@0@0 J~j  唐0p "†0|" QU 5 P*  YTۍЍ U^H^ X X0@- M 0^  @ 0  Ѝ`0 Q0@-@L00S :T g/\ 0 A-`0S :#CRPQ# # pᚱ0:@P ##sC# B0:#!BQ##T0T-0 M \ ʌ0  - Ѝ8 80 0P T0 0//ᰮp@-Pw|``p@0@ A0SP0P0:3S 8 80 0[0 :L#p\(O-``3 0Xs0T*PL3B0 `p (VS p p PO p   r  `R  01Q @R R3 RV@ X d20\2#`lpv  @R `  R i \  lp P ` @q lRQ1  X6N @{? ` 0  S, (q 1lRQ    ?p  q`RBos000 ?c s 0`0`0 0㸴@  0 꼭DZ@ZPZYQ YXX  $WG-@P,S,3P`e 80$ RR a ʌ3S23pSzW " Rp *8' PQh100S 0   0P0Q 00  00 0z#0CW3Q  rP+p gPpTpir` `0 00 :\#3+Co 4(0 00$Ȧ<@-@Z5p@404 0@- @K5p@ ꈦ< ,0G-P1`AA0Y A p!ԱaW`F pW0 p R i i  T * @> T:V:p0D 00 H |0 +pq@V*00C  M 0 00 <@-@4p@404 0@- @4p@̤<404 0@-0M @ 0Ѝ舤<X0X00@- P4M@ 4p s |4Ѝ0D<0@-4M@P4p a j4Ѝ0@-0M@U ^0Ѝ- M0  ЍP0P 0-M  ,0 0  Ѝ8<t0t00@- @MP \4p , 0 00 0 0 PЍ0آ<0@-M@PC4p , 0 00 0 0 PЍ0-0M 0,0 000  Ѝ000 00:3S 2/ᴡ0O-J3\p00P  M21pa`P 0p 1PD3nτ`3 p  "  _ͭ `hi bF?Yn 㴲 `00s  b-P` Ѝ,0 #$ 00 0 Ѝ<xp@-D@D0@Ppp,0 $0h0i p谟xp@-@0@P:#R|  l ^- # 0p P`p:pP4lp@-@0@P :QthQp- p #P`pY :ꜞ4lp@-@0@P:#R| Ó \ "R-- ( p #P`p.:p4p@-0@DPSP @p (0008 <@%8 pp<<L0L 0@-@0:#R#R"#0:`0` 0@-@0:#R #R#""|}#0:ꌜ0 0@-@ :QQ σ #p P :0 0@-@ :QQ σ #p P :x0 0p@-@P :QQ |} Ãp #Ppc :fpԚ0 0@-@ :QQ σ #p P`: :Qp@-@0@P:#R   Pp @8 “%\8 --  p #aP`p:pp8 :l4<@-<@<0@00:3S 0 0 ꀘ @-8@80@00:3S00, 0 0@-@ :Q$Q' " ""“ "\`#p̌ƒ“ \`##ƒP` :Qp@-@0@P :Q&Q)  "" "`#\“ `#l \pƒ  #P`pb :Qplp@-@0@P :QQp “!h"L phƒ p@ #4 :lp@-@0@P :QQp “!h"L phƒ p@ #b  :`lp@-P@0@` :Q Q# hUh“l ƒƒp  #3P`p :Qp贔l@-@ MZ$qQp* c0 1|0 `00004| 0000408003 Ѝ| 0< 403 ЍT T0 0`0` V:`c3P`ē@( 0 000:P/᠒ 0 0@-00pX0X 00:3S 0p @--P`/@\0\ 00 :3S 0- p @-P`/ؑ$0$ 000:#Ro/l$0$ 000:#Rq/8000 0  :#Ro30/(0( 0 :#Rq30/Đ 0 0 0:/ጐp@-@P0P`M00 0s p 0S|000 SC q R0 :#Ѝp R 40,00 3/ЍpTht@=(A-MRBP0@Sw R `P 0Sb 1 P00p !1pN  0Q`31p0S0S  hx100S0S  \030p , 03, p .H$ЍP Q  `*P 0 :# 0`x 000 0090 0@%900t<dX<ht@(<@@-,@@0S 900,:@-$@@0S8009@-MT@@ 0S Ѝ< 000 00:90 0Ѝ9 @-MX@@ 0SЍ '90 R0 0 90 0H9@-,MLBL2@PQ :3SX0 b3p `3,0Sha` 0SR1p0SC x0 00 B)1`00|PS 1 20 0Q 8H 20 0X20M" 0 :3,p 0 P`,Ѝ0`00|P   80 R0 0 80 0<800D  8 20 0Ћ8x8pp@-(MP@0 0@ @$@R8 0X`@ @$@<0`00:3S U (Ѝp  0 000:3S/BꨈX0X 00:3S 03p @-a+P`/xD0D 0@-0 03, p !P`@0@ 0@-0030p 6+P`輇p@-@QP0P000 |P t0 1h000*j!pxP 00 1(000*C[!p`p00p@- P *C T |Ppd  10*p@9!xPp,  10*Cp@,!괆p 0 p@-P@0:R P( P PpQ 0 10!pht\ L0 r10 p Qp0 000:0S,01/Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//\ , 0 B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q>@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@a!80-^\ , 0 B\ 0 ^O-J#d-0RdMbZSUd 3,p0CQB8 ?3 Q:SD0:pP8  0, 0pQ3S0K0 Pp #@  p, , 43,  P 00 0( 0 JdЍ|B 09dЍOU/O-*,M0`P2U 0! (@Tg `p$@ $T+:0pS`KP  0 CPP,Ѝ@`00S S@ S0PV%0S/00 04S,ЍO:0@0S A0Q  B20RP 00C P03V 0 0 0C0&40PS  P3@0 C`PO-PQM 43P S-0S*U= 000  0@ 000@(Q k`@ p 噥P @0JS 0ᵥPЍDN P 4A " 2  -ЍP0PP{LP0  0 /D D0D 0M R *P ЍЍ/yH0H 0 M\  ʌP ЍЍ/py404 0  R *P /yH0H 0 M\  ʌP ЍЍ/x404 0  R *P /|x\0\-0 M 0@\ ʌP 0 Ѝ Ѝ4x0 0@-0@T J#0R4 |B0pQ $8@-P @Hw808 0  R *P a/A-PQèa`dڠ1@pP0$ PY 10 0 QTD$ 0R U E_pL @10 0 QTD$ 0R U EMp:   0D  Q SC$ 0R U E7p$ 0$@ P0*@0B0TP @T 80@Tp` 0QP><(A-PQÔp0p`0@*@ $ PP uX00@T  0Q@et<P/ 0S, 0@- \$@T\8x ƌ8 t ,0A@0@PU 0P0U00S00/Q?XA-P$@0S00â?2 0\-@ 0T `ApB 0S#0^ 0S0pW FJ@ 0 0 04@U/80Q@0@080/A-p 0 BS0@( P`0,,0 0CA1!0 04`@0S( X0@-J8  PE? 0R|B8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 O-RQ M48 nڌ`pP@Ph ူ儰到IP,c ^PP0` Z4$ 0X010 a ` `F80X0  $p<@ H | L0P T`6 t180\ ` d h l p  Ѝ/P47  P; 0 Q" Q 0IX   pp VP PʮU Ѝ@ Ѝ1 @ -+@' %# @   @ A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,3PP D0 D0H0RH00000 p$`!bP@0RЍPЍ5@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@q@ pHP^JU`^VMTPDD    PI T1D00S*Y `$@(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0|  P PEPh T IPIP Ѝ0P004|$(tt 0@-@d0M 00C ?o20 0 mPP 7Ѝ042<H@- @  0M 0PЍ1-QPDM00  ( 0@8ЍH18 /0@-0CM 00 @0C0 0 0D NЍO- 0D000D0   0S` (@2D000h0S80@080, 0 R0X>$ 0(0QS, 0!0 8C8S^H 0 ,  @HDHT&,0Q0 (00SE0 R  (Q (,Ht h LT,,R(  4 ,!0 !8 <  , !  <$ 0pH D00H00|00gp( 0H SL01HP0< 8 ,    e, 8 Y Y  RR A P<08 0,00 1 1 01IY0Cڸ P0D00 L  ^/o" R 0YP@r00PPP 00P P p,0 0S0R0S0 \ ɟ`V0JZ 0Z k p 0  P A RyP0  P 0`p PV  Q  `$Q^D PX A0 S04 ( R(  4  R( Q4  *#r LQL 0  P0  \, ( (B ,P ,=P 0!!!QY@ڵ00S5 80q  b pX$ `V \R JZ @ 0; 0@NN Œ Č Ȍ N LL\nɟ`V?;p80cT 0P TD0D0 R 0 R PP! YR *Y; $R   0E0 z0p  0E y D000P $ 6  \D000!R@ 9t <000V  0A B $ P=0X *1d"0pC5$  Z< ` 0PP8, ` TpP!Q@000 @0pI 111QU`q 00S4  <0pD P~ 0X *1d"0p<0V @ 40S pV0A0 0C0 R d1SCdЍ 1PVUPm 0 0 e#$ R 00S0 ?3xcQ@APL`@ 0?3T 1HX1QEP @?0D000L00@ 0@0 @  X X P7 0L N R @(080 { <00 $<2 0 p`dЍ80 00@ 0Cg00S1$ 0D000h0S(00S5<0 (0 I<00m< 0080@080^Q00C\0 Qʔ@t% -0$ 0, QNp! <,\&`@VP $(|`40p V@P P0@, ,p`Q`J @ <P,Up@WP  WP@ P0 @, A`,\,P T ,qDEq@DPP!@X   `  Y,00,0Q0 0, BCR4 R<0084 00C, 00S<,04 00@0@00,0 0400 00 S @`f` P 0, !Yp, 1@S  Y@pL bP0000 0S0000 00 0S 040C04 R00CQ8( 0 0, `FvK @A`j0, \ p(@0 <00  z 0PU`@0V0S 8Q004CQ0V0F0<00DPB  lPp <0P0pL V H3 D|p|4$  D0 00@Q. R+ dP(  % R d1S $ 5  DuPp:U U6p` 6`FV EPEE(0 @,,` 0E0OB0pu 0E B D000P DVP00:  ,0R<00Y,P 0A040 0 0C 0}ʴ& p 0&: 0:6080,@ 0 G40 0pSW!P0S00Y0SH 0SLS)0 S+ 0PUa8 0a0 lFP@@D ,HTH lF@ P0E0PE0PEQ!00 00C,0W<0p0,p,00 0R0<0 0,P0,0 000 0 0Wڭ@ 0S 0 PCD0U0 <000`p]P4/ pQ, S4S Y4SQV H5S4X  H9$@ 0 cD 00p0 V00P9  o0D 0 B00 c0P P90 0pV0 P-%PO p0SL 4S 4S Y00Q0S8 L5S;  f:$ @ /0 D0 00p"0 D000P D 0D 0 B008  00Q@00 0D000P  T P" $ <@ 0   D000P X<$  0 q R! U <$ @D0 001S U <$ D@0 0PL5S 0 0RU D=$ @D0 00LUDq 0 0L}PhoSPk4SP 00 0FD000$ >@ ]0 C0   0D000ȔY  z G0 {\oD00 H1UPy D00 " UP   @?$ D@00  U00 0D000H%RQC   ?$ D@00 HU0P0PU# 0``U @P @0:0yT0T TT0 @, @0PE___ep@-@P0P`M0 R    80x t000 0 00P80  H000 0 B/ 0C?00  Ѝp 0 00P<C-M40\` d0hl8p@`Pp\ P Ѝx80 800 0 pCB`Po_`PЍ@-@P @T1!0G-` 0 DRHpp?spS-, P !Q@QT :!80|0[p@U0 S00? \ R!R0 S  T0 00(< 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP @0 @T $`U0 V P`Vp`῁0P 0@PUpT` @T @pp  ! !@-@P@T R/0A-p,SP` @T @ӃT0`SP RQ A0@ ", "Q//A-Q*`@pP 0D "! "U0 "! "TQ 0A ", "^Q`X@pP@-@@@0S $0PC$|O-:z-*0pM$P( , pPw t00^b Ss @@lRXaoH\0 04@Y @A@0 @TH Q@@[@T@P i``FF\V0^0  | aR\ x`Q'hQ"  @CP(H ,4QT S I@0S $0PC$vX0C,4Q| @CP ^_ S]ʜ80,40SmʈhH`@0,0] $P,40 P@0(@0S 00 CR ((   pp' 8 7@00p(`Y ʞ| `nR`F`V00P0S\  $0PC$D' 00Q6 $70,'0 4(0P0L0 F @& $P)0S|600S00l0S% 0 S" & ,40Q%0 lP,0S  W$0PCP$,60 R(,Ѝ 6 0( $0(0\DEe@` % (00 S7$%P0C (00xP0S $0PC$H%  <0@ 0,@(@Q 4000XV 0Q[Q $ V 0$0C ,0(@  00 0CS[ pP40,H41 , ! 10z d 4`000 P ^$ $@$#@ P(@h0 Rv ,,Uq  P+ #  t# (@$@ ?#R WH( , #\ $6 (@  P 0(@$ R  d $@PB lP " 20,,40 SN  T2 0$  4B@0S 5$0PC$ $ 00P0 ! ı 00(`S7A@ 10(`0 V0!0`Fx P(`0S $0PC$~,@% A@0S $0PC$ j,@ d xlt$̨<(PLL<p<ܥȥ$ 8DXx\HĠO-PsP3pLC@00 S }4004c`(,P Zh34@2`0T6"0C S402P00S00h0S000S200ʔ 0@DS(00S0 0l0S R H"  4204@,P0T0hPr RP0 @P 0( 0CS P1  P1040 ,(  P,P@ @1(`0 R&T !P  @T 0 R 0 P'  q 00l P ~@T00,P0 0( 0  04@S\CPE@DSP4@,L04Pk _00SL004P(LlpH̜H(@- 004 (, (@- 004 (,踛`1`!0O- T *⤒Y|20d1 00!Q:|20t0`1=Q,00S|20lE0 0!Q:|20h7h0 s0!Q j0!Q p/|0| 0p@- @00CS0 S 0 S P00VpᵁP00p@-0CS@0 S 0 S P008pᗁP0000 0p@-00P{@$p p@-P{@p 0 @-@00J Q T\,Q    @<0J0P\@-\,AP /0S/p@-     @ BJR@P`,PTa@@@AR  Qp03O-0PQ`$MlC@| {pP 0 0C Stlp ,0A100A!R   A BQ(\ !1C K" Rv   IK T0?3Y00 Pq 0 wPP{ 00Y 00 W0(@p ڼ T D H0W D@ 0 ( 0C P7U$Ѝ00$Ѝ8T0 S80 D 10@  B@DT [p`$ЍHȏ$Ѝ 00C! [ @ D0| 0p H0001K [ @T @yT @ @kt50 0 t<p@-@Pppp@@0@0p@- P@ ppp@(<O-@dMpz50$0`Phn P*w0P 0h X0P40Y0000Pp0@STI6+PO`0PZP0p00PEPU=0000PS040& 00 P`0@pES1@-,40T R8  040 Bz$ h40p0PH0`00000S00U0E,zP`F'zJP`!z0`0C00p0PP 0PS4,00 !R0!!ر,(PQ40 0R!1P10CP E" Ry  KPEm X40V00 4 ,P` p 08`p4,0@,@ 0 D<8 PU` 0 p4a00C 0 S_ , 0( 0C0S00PSe 000< y$ 100pP u 00Gp`0Pq P&` p0`000S0C00ty 0`FopP SHI! U 0H 0000 1PE UzD0|0p 7x dЍ#P 0^40T R0P40 p ` `x dЍ` x P /0 0v<M,P   00ЍhЍ/<d0d00@-@ P M p T  Ѝ0@L Ѝ0l<hp@-P`0 0M`@  p T  Ѝp@.Ѝp<p@-P@ppT  p@pp@-P`@ppT  p@ p0Q /0Q /0p@-0P `@0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00O-S-M LPP` 0[ pH 0@TL !  5/  @T9 $T0<SX1 0000#10#.R00S0>0P H  0 v00 0KP8  #8 S R0?@P5/@T YЍ0H\8  #8 S R@0刀0@P5/@T'x&Q" @-@M  R ! R "R pP^ 0 0 @VЍ /@-0QM   S S PpP$8R@ @ ,Ѝ8- M 0 ЍpwD0D0 - 0 $M Ѝ,w,p@- BPP0@\SY ^S9 @% ,S'Sv{cSc\08ŸCA\C110D000000}p000%0>C0{)^A 00NS841@`00A 0 100C\00C0 S\S:S '00pP@0d{%tľQO-M  7sDPP 04'p p 00R0pp 솟즟 0@P` p ,R&Ti  \@  @  RY  QS%R +NG\ TRQONMqpJIHGFEDCBA3?>=;9876543210/.-,+*)('&%$#"! ?   R PtP 00Ѝ %@@ i^ @ `f`00 0 "!.Q *Q0 0 0RS@  RP % p0 @  d^% @ @d   R :@     A6  R< $@     A   RyP  % p0   @@ % c  RYP % p0  @ @%@ + c  A 0     B0  < @0   0 @D@   Tp P0 S\R$ W 0`C0@ T0  $ 0  <  0o /0000>  0 0S0\S 0 S0 лL!H!p@-`@0@PM0S PS   00 0Ph 0 Q00QH  < x0  Ѝp0`Dl0lkkA-M0TSP!00@0@P0S? `80 "0Ã!1!1"b2c0A @ 0L0L  00210BqP 0 pW$P@WP 0fSPЍЍ 0 0ЍlNgA-M0TSP!00@0@p0S> `0 8"1à ‚0  @00A 01! 0120BQP 0 pW$P@TP 0nSoPЍЍ0"0ЍkL>C-M0S!0 0@0`0S2 Py0 p!p\1G $@0!b4!b Gr1c1c0@ 00  0#3c`10BqP pЍ 0<0qW X $`0sSP p`VWT 0S ;nPp!PPЍt-?L*S0 O-LM l oPL $0$  00: 0 P@P:  @P 0S  R `0V G #V =V =`Pj z0000`tpP[  [Vp p  RR qP X,     PmV m0PSq@0 ᠳ  3 112cAp3L112c0B0L0H3#0210AqC0P0 `H0 1 $ $@b`Hp, `V @T@plmTP=0`@ @0`mHVP00LЍ`<0 ,rp "22 Â0  @00A 01! 1120BPQ 0`0@7` 0qpm l1#`!L04A 1c1c$0L2!b!b A0 0 0!3ca10BP 0tS0cS0Spp pk0@0`0c`@ p 0< pv0SppL̒Ng kL>h-?L*S0 O-p`@P0\ %\0pS sS lS@ 0\TT1DW N01 CR0@CUPBO-(?qMpQ00 P` P? 00S040H $  l0H [ 0  R U0 GP@T `%%T 400 R,B*Ph  4 @@pTP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+p8oP" 400p,1S* 0C11ऀ R 3@4 00Q,*P 0 p 40P4qߍ00f0\!0D]SA7Tf  ~x|{|x!00D R`@0A?S@:T AQ: AA DR3@D1p@-1 1OS 0 $p4lP 400p,D0?oq2tT 2 $lP 4 0,T 2, lP 400,@p0p0@ 0 p 0 00@0z0!T0 ~T00<'Zl00i&@D0q0VT񏐨S}tb\VM:}|{zyxwvutsrqp(nmlkjihgfedcba_^]\[ZYXWVUTSR 000p0w- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/9A-PQM`p@ 0S! WC jP X( 0x0 X T 00ЍPP0T0j 00ЍT *T$p 0 0 R T| Pp0S T< , @p 0S R 8(C8B((0 000ST00P i00@(uP i00@TǮT@4཮H l,\0ht@8dp0R@- MA0S@  ЍA-pPP% U) 20S`$V  PR |U@P0DV o PO-`RM pQ  0 Ѝ@ PPb % uPc oPd \%i0 FS  'jPM  p ` p pp0S  p  p0S  p  0S {0S s0pSa k뼐Y$ PT j$%iP !yiPriP G뼐 0$YpP " Y) $ @ 2 (B8BBxnS0 sS fSS0pS  U R00000 0 + [ @:B  뼰p[ qK +[p  뼠  8C8Rp 0U  pWe ?o2P  pGx?'x W !8  X P *   0S02 0C8#800<p  0 0U QP‡ W0僰 P000 0pQ pU00 0pj0X0  y 0p /U  R00Wi  hP$) ap0(C-PA!@M`p 0z P H00E0S@ `Ѝ@P g `0 ip  R 0S 0LP` Ѝ`  0 P  P`L004@@@+@ P*@PD 0/SN 'P hY PE SPP 0 ۍЍC`0P P! p P40  PۍЍ0P 0S/S pP phX0 ۍЍC  p 0eh XW P0P 0 $ۍЍ404 0 $A ?d?4G-pP @P  ^`ehV  UP l``@`P @T P00@0A0G hl4l-@- M@00 Ѝ@ Ѝ/G Ѝ@ Ѝ/@-@#h!hh@hh h0h@h 0p@-S@M 0000Ѝp0P0 0 0 0` 000Ѝpp@-@(PS:pS fP!peC- M `@V pᬐP0fU@@`V  g W0 nU sU \ @ `V@0R00 Ѝ R@@@O- M PU' `pfSPU  3 *@8C80P 0nS sS  @PU00 Ѝ 0S00PA-P# P 00`p` ,RR    0S,S@BdP   `p`@l C- M@`P(P@pW[*nUR sUI fUH0D Y)RD @ 3fP% H0D@ pH0@0 H0H0nUp@0 H P6 sUI fUA L00L0 Ѝ@P Ѝ @AP80pY D8 0400 {d 0S00 80 @H0R# ,0 0[H00H0H0@ HH0@ 400IH0@04 H00AH04 0H040, R0 04H00H0 x@O-0M @0RZ P KY p Dp(080H0d0PC 0 `00 P00  P 0 P⺀Z P  P  P  p Y    p p 0@ 0 0@Ѝ1!00@- 0 @S/ 0S0Q @\T 0S0 Q000@T0:PA_oRET  \S  R 0S0@x0T00~A-`P0PUM@p"S& dP !   开^0V00  pS000 00 0ЍPЍIc  p<000O-@P 4M #P e`Y`4 p|  PP p Fd 0P 0  ce` 1Pzd0P Te0 0 4Ѝ  0 HeFe,`0V (0 0$0,0$ HP,p, P AR   0S00XPr `V  [㼢  P"0 0eL0@ Z$ H0@0D0L0E ,pf[8  ` 0 `P+ Z+  RXEEhn[EX s[ "`0S  x ,P` `0 0$d 4Ѝ c R`0b0 0a0 0PV4A-P`0`VM@p(S, cP$ A  往2000 P)00 0!0 P P ЍPЍb0@-P pW M@`R {cP 0 ` 00P 00 0 ЍP ЍaO--TMD0 D:0,08:0,0`P| ||zPP00'@P00PQU P^T 9POPbP  P T 0U 0, P  H)0 8 <)$0 @ 00 0hFhvZ 0s 0 PS , P R 010#.R00SOR9 = @P# PP @ oHDHt 0n  P LaL00SPP P%0 ! 0S t 0"000 0000 n0PM0TS0 PV$0pW0(0 $0S bP: $p  0S` 0@S  S4 p 0`  '\S  R}WC%Y^SY @Yw 0` 4 0&0HS 'v 0P_ 6c TЍ @0@S hFhvP @0f  FPA P;0`C RE C/RVoTSRQPONMLKJIHGFEDCBA@?>=<;:Y^76OW3210/?-=+*)ESO0PpS@ Ss, 400 @ 0 @P$,   P000PpX`3( @ 0g 00P0p0 00 00 0 0(  0B‐St 0 S00 P50 p<0P00L^( 80,  T<0aT0`FPV``0pp 000 000000 s0 P`P hFhv XEXu3 @0n  OPJ 0S00 HP@  08@P0 000000 000 f0 P XEXu0 0@s 0  P0P   0 a TЍ?Y O  0 0u0 z0 rydD kr p&hP|hv t  l   d  P/f$P00// @-M@U0 0!1l!1"b2c N0L 0 0@@0$@B!A@C0PЍ赁N0 g P0`0K?// @-M@0 {0C B0  N\00L 0"2<@0$KAB@C1dPЍkL@ >$0P00?//@-M@0 ?0C@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$D$C!d!bA@C1zPЍ-?L4(*Sp@-0MP0`2@P 0Ѝp[00  R 0S"0Ѝp1!0G-@q0PP03 0 4`S 0`02,0~PP00|Q``  lVPe`EȄQ  aV|0`0ȇ`H00hh$8$@-@P a`_`]` [`$Y`,W`U`,00!R  !# 001/"001P//"̩@--@ \@\ @ 00s@ H PJI HH @pfhp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (Ѝp0P0 P 30 0U f U{kka!00 0P0 ~P L30 0U 0"P  0cP0J30{U 0kk wP  0cP0G20U 05{kF{{bPr  0cP0t20U 0x 0"PP=  0cP0x0 0U " >P?  0cP0|10mU 0 !a1""YJ'P2  p0cP0%ژ 0U " R b0cP0$d10U 0T1""P  P0cP0$10U 0 1""P   >0cP0@00U 010""P@  ,0cP0@ڜ00U 0 0"P  G??eh 8DG\t0cP000{ 0kF{U{% P  0cP0uڠ30{U 0kk Pd  0cP0\30{U 0kk5 {P  0cP0n30U 0_3""iPH  0cP0L20U 0=2""WPS  0cP0ڔ20U 0x2""EP  0cP0EP20U 06`2""3P9  |0cP0 20x{U 0{ "P  k0cP010g{U 0{ PF  Z0cP0ڌ10U 0`1""P  H0cP0H10uU 0 PE  70cP0k10U 0\1""Pa  %0cP0&00U 00""P  0cP0ڀ00U 0t0""P  t8 Hx$hGD0cP0(,00U 0<0""P  0cP0l00 0U0"/ zP  0cP0ڰ00 0U0" hP  0cP000{*Rk 0F{U{ SPr  0cP0`30U 0q3""APf  0cP030U 0<3""/P  x0cP020U 02""P  f0cP0Wڔ20U 0H2"" P4  T0cP0HT20 0U0" P  B0cP020 0U0" P  00cP010fkU 0{{{ P  0cP0ڈ10U 0d1""PP  0cP0 <10@U 0' Pe  0cP0Z00U 0K0""P  0cP0ڸ 0U "7 P  0cP0qt00 0U0" zP  d @G  0 x   t 8  ` \ 0cP0_(00U 0P80""RP  0cP0h00 0U0" @P  :P  00{kF{U{9"00 t3030vx303 U"&"00 aH30@303 U""00 Q30\3 U" "00 D20{Ukk!00 720202 U"$"00 'x20p20c2 U"!00 @20}t2 U""00 2020L2 U"!00 1010$ 2 U"p!00 10b10101 U"G!00 `109X10kh1 U"!00 (1041 U""00 0000 1 U"Bo!00 00400g0 U"_"00 00 L 0   \   ( \|\d(lH L,0 U"T'!00 bP00FX00`00.htp00Nx0 U"!00 I00{Ukk!00 9303 U""00 ,30{Ukk!00 `30vXd3 "ZI lI 3 "U"00 30{Ukk!00 20{Ukk!00 20S"00 "00 t20 0h20 0A x~ :PI S @ "00 "00 !00 ~!00 kkw!00 r"00 m"00 h!00 c"00 ^"00 Y"00 T!00 kkM!00 H"00 0Sk @!00 {0S6 8!00 s0S 0!00 k0S (!00 cP  ]0S !00 U0S !00 M-DT! @L0S "00 50S !00 -0SV "00 %0S1 !00 0S "00 0S !00 0S$ !00 0S !00 0S !00 0S !00 0S2 !00 0S  !00 0S !00 0S !00 0S !00 0S !00 0S z!00 0S r"00 0S j"00 0S b!00 0S Z!00 0S R!00 0S J"00 0S B!00 } 3 H "}P !H H 3 "0SG(!00 c0S  !00 [30 0c|30 0u"00 N"00 I "00 D"00 ?"00 :"00 5"00 0"00 +"00 &"00 !"00 I tI 2""2t0 02T0 0 240 0>20 0d20 0@20 020 0ޤ10 0դ1t0 0̤ 1T0 0äI140 0຤r!00 X10 0୤Q410 0तh10 070 0000 I0p0 0? p < P @ T < @ <  @ \ $ \ $ T <  0P0 0S40p0 0J.X00 0A|00 08\0 0000 *n0 0000 180 0o41X0 0 &X1 000p0 h!00 10 010 010 0ܣ@2 000B80 ΣH2 0004l0  20 0෣20 0ண"L+SC @AQ0@-OQPPP 00 QȠ\ 0{ +C 7G 00+C03Q Q 00A@@1 0^\nk 0+C {6F{7+S 0+C04 / /P 0S $0S 0S P? @4@P//A-pP`8\* ,0S( 02 ,04 0 S4G0CV@1@! V @D8 ,0400 G 0, 400 (@ 0( 3/P840, 0S00R4000@-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?0$ R(400  0=@0U 0PE@T$0S0  0 P=@0U 0PE@T$0S  ($  0  88( 90,K  @U 0PE@T$0DS, 0 G0+@\<0Uz 0PE@T<($(<,000@00<00SE 70T<0 00CSW0S; 08@;0 Q;0(0 S0(0u080 t0890@kL;0U2 0PE@T0S ;00;0ILQD0ʆ;:0\0T 00T :&0PE00@SU0 pC0 0,0 S P<@@B0S 00*S30 PC000000 00 00W0"1<0 S<@0@0R0 p RR<,0 0PUS0S00)D9 0 <0 30DЍ X R S R  %P$0 PpB 0Se 00 0 C0 S 04j0U 0PE@T 0 B00 00 000R00SP 0S($<,(<0$(0 0R 80080 00 80B4 R,5@0 00D 0R1 P! BD A   B\000D0Sx70t7 UR00\0 0 P<@@ *0|'S ʆ0  P<@@ ;TU 0PE@00 S  S7 S$ 6威@D00@T80PE@TULQ{X60 Ql H0 @S0 0CR*ʆ+R 600600 pC00@500 pC00ld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@T 0S 400l50U 0PE@T:0D 1ʆ0+8@DD0\Ux 0PE@T:0!H0ʆ0H0;8@DuDp840W U 0p1Wp!WZ 0 0C 00 00D0PE0CD00$Dpl `R*$0ATU< 0PE@0 0Rl @D⨁:R (0,00C 8 P0l0S>0p0P00X0?0X00 p0tP 200T30/ R=0 U 0PE@T20H?o20$0S0E "d2$($B0#22cR:0S 420020 0F$Q   R D Up1p!W'R0! D $ R! D $ R$!  $ R40,0000 l100BU  PE@T  & !X# 100\100+0008@D;Dx00 R 0 B D  0T005:  6?7?8?=?>?N?O?5? J?P?3M?( H?A?L? C? Bp 9?:?;?0@\4 @Dʆ+8_(4威@D0A D0B L4p(8#W" \40040SQ  8@D;D _ 4 +04HL0$ 6 400406 0@S4Dp0H Z0PE@ZU8tgx|p@ ⨃p ^&:l0 0:00pZl0 0S50P0;T0l50 0X00\0, @D5威005@D0 ;@y 60050 0@0h(4890(8 (8:0;d600D60x6l 0ZZj0PE@ZdU0L0Sd  0 6  0p41q岠pT*Um 0`4`UU PE1q岠@pW0`8@DQ{8@DD-8tgx|p@⨁pV7L00 PpC? 8(89i0+@]\8@D 0w@D(4l8l0U0 0 000P0<@@O0 0`pC( (0R@D0+S(0,80080$S>0p0P0 0X00tpXp04040P. H900 8( 89USR: 3@ 0@0I9@0i900900 pCp T  d\ 0  \ h gP 4:000 威pC0@D0d:00l:0 0S|:0W0 pCp@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000f@Pp`W2@ R2Q <00 00S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S 3#R0S  l0pS0pCp)x 000 0P,04D0p0 p0 0 0 30 Ѝl0Sl0@@@+TS???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPYP 0!(`3/@PR 8X8 (  0(3/PI 8 (!}P S>0Rp:oRS B P T  B T p X0Bp (0 #8_8@p 0BS.  p 8 Pd LP S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?00@C/O-MP@ @㬰(0^U 0C0 0$SP $C`0p sRpW(-0 p p0Ѝ0` Q`V00p=J\S 0W0T0S30b608#8P0U 00CP R"P @U\! V0! 01 002T 0 T 0SЍЍ 0D?o240%R00S020,0@0000,004@0D?o280(0 0  B<00 0$ 0 0S03@05 :^N , %0! ' %0 %`03!305(0<9P0C1P RP@00F3 0S C 0 $Q B("(R$AVG  ` V$  \ F ( Y FV(*Q BR  BR^ : 8 Q  Rb4 %Q  R\<  BB!   S @@ <01( 00 ,0, 0 00008@, 40ST 0O-0CDM000 C  2 00!8ӗ1х1&=  x l0tJB H0Hxt^Hl0:8HpXT`!4Dp`ᶐH@ᰐ00Rx0 Ph`0l \0S8 B0l0\000S[ tAP`tx0l h Rl R010#P60 6SB \0P8 B_l0\00PЍl8  R&0&0& PV) )h0\0P8 B2l0\0{00SЍ O-T$M t<4Yl 8H0XT0#D04@@QH0  ,0BA?C0CP`PƘ_p00B8#( Ƙ#<0Ƙ@l30 B0(1I>R<30+"8ӗ1҅1&=  `tQI6 Y0 60Rl00XP80tT@V` l H 0U#@H@0 Sl \P8 B0 l0\000S}$Ѝ806&6!ƈ9096tl I Qtl 1Y^ 't1QX 0S Q. Ql kP (l `f@ p400D`H0A `l @5!0 PH0  ` 0ll R1#:\ 6S \0P8 B 'l0\0p0P$Ѝ\0P8 B l0\0^00S$Ѝ4  0, 0CSO-0! M00@p0U\Zi6P*0U 1oPEo:l0\`匴`C 0 S[ P1[SEWo᫲ZSW 0 0 0B % B 0 0B 0 #40BV V0\ 81!  P\` 0  PE 0C ` U0 \`  Z  BP  P 0P `S , 8Rr06A#,0l06\00P `Sl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \6&S06l0R, ` 6V`!VW\, Q* 65@ 0CP!P 1RV G/o"S W  R  PR#P`1`!WG80  =\00\0YPl0<AQ0Cl0 6&S06l08R6 J  6,AQ  l00l0&n8 j, l0B0Pl0\P`1`!W 8 0 \00\0d  PR#P" 0S $0S 0S P0X*SES[SgSqS9 CS0//O-MP@`?o2P0S}@00Sx S t0Ss0,0S$ RiL0Dp 0CpB ,0lp\pv`FP0*SWtpWT 0k ,0V0pG**0  00 P  t0S"l8PLPXTD@p4`H0 9*0Ằ QH0岰0t0lt0Sl  l \  60x0`00 th  00Ѝ* ЍA-@P 0S $0S `PcpP l0t,@0S@1VTU@80C pp@-@P$ 0S! $0S ?`PP0 S0c```,0S`  *00 00(0p`p 900p@-P@P pP,0L D0<00 B@C 0\ 0 10 |0:l@\@t@Fx ` h@H@pp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:k`@`U@40C00 0 &PUWtPPA-@P P 0S $0S p`|P0p`P|0A-PpQb!Tc@Te?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟 0P0 X  0@S P X0 SQ\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 0 30  0#400  0 p0S0c0?o20 Ѝ0So= 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm q000*0S9QI B0 00 t0  R 0,0S0Q0Q0$ 0Q00R 000 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E00Q P p K 0S  0PESPo p W *G 0 ,0 SR0 B0Ztp 6l8&`6&6!ƅ909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\000P0S P{X: X!0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S 00R01 00 q000SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0  0 ,0 QR 0 0I000S'  0 0S0   0S,0SQ9:{ RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:M R+0 B0`00,0S!  Rg  S 0 Q*0S 000 #4090q000SE 0 B0+0#  #800#"0 IQ"V\ R8 C0 l0\000Sj`ptZ(l 8`pR B 0 ^L 6ƅp6ƅp6!ƅ9096&tRl0A0tl0 Qt QX Q Ql 8`p0 w X 0Sq0 B000 B00,00I ^ ^<00 Y Y Y Y Y Y Y^ Ioᩒ#Y0C0KS`00`S&&p 0C0ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 0*0[B :XF 6S \0S0,000= h0 0000 B00P0U0S_8 ` 0p!(3/@PU X!@ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/80S. @ R+ D PR% , 8 d, @@ _L DD Z V0 0C006& 0&;> 0$0;/ O-QM R0  \ " !#4"  `P `p  *@+)0 @$ %q 0 1Q`!;  Č ` 0#:  Č (9  Č p'4 6" Č$ !Q P%D R`  ! @0#   R#4,  " "0 0S"$,00# "0 0S"$, 00#0#   R#4  P% 0#  R#4  PUTp @RR.0R$D. R$.0#0A0R.$ AR.D$0#00R$D. R$.0#0APE.4$ AU#D$ 0 @  P   " !Q#4"Ѝ` " R !L -Ppp И p D  Ė C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$! C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$! @-@P xpxPp`@` 01ē!0Q0 0#B  H @-@P xpxPp`@` 01ē!0Q0 0#B  贒 0@-18P@\0 C @$!0 G-R (h Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H#H7cN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq$R'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /qR'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /q/x U/ 0`0//68ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O-DM pPjp5W@T4PPTQ=N0 PP0\ˀC Y Q 9ʶ 60p\0 1 0Q-p qX䰠 60C6Y 0 QI 0CAp P0 Ȁ  gXQP4 !\˒0C`K P4`ˀY`;T$Q BXKT$T;往P PQ͌Q-PP ^ Ƞ 1 ",ȠA  `{6P4pSTP I0`T$!\. @   p 1Y㲠bQⵟPP 0100W0 [.0^A  װ& 0А##U60 6<,Ɔ0 SZP. Y> 0  JJ0RP LGP 0 QR0C Y> 00 B 0 \0000C01 LR  0P0N  @0 00T0 0s P\ R @00SC00 R0P\DЍWP 00YQ / !0@[1^PG65#6pQZ p J0 0=A-@1^PRPA@D@0+}nR- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O- MⲐY``00RCJ!Pk΄  R7 Q. R2 ৎP01nh Q&80pNFh0`0#4``06cUQpPv R0Sz P`0 [ ЍYf0q 8YC8 !.P&pe(WB(0 `p0p00`#4pp06PE`0cQ38C8f6PaUx0Gx#800P``pp0P't``pvApg^xGx B(Q"(a0APP0#4PP06cR!0C 60S 0 SP`0 P`0 R+=ʲPpeW6y`p8C8000`p#406PEP0cQ UAVfN.0 APP 0#4PP06 c^ 0C6qpPp6gQ0#80A6`00Gp`p!0aUQA6 S, N.0 APP 0#4PP06 c^ 0C6q`0f /P UAV B("(PV^ B("(06VʀO-kn6@SMN 3003P0030 0300300%10 Jb ^@$HN@@p@p. BnS.HN@ἦ6S&00H DH4P  p, Ḁ! @b T H DH)& B @@$D @F @dXDHDH&qZ" tqN.r@jTHp DH'x&pp@@p$D@F J @d^DHDH&0CS㎀ޕޅq᷀ಠBj^@$HNI @@ @"$ &J bX.HN@ἦ p#Rs `D0C8#8JO6S@ἦj 0c Q.AP`kNP!``0C0aR! 6Ѝ@ἦk. 06Ѝ` P D 8 , 6@-S k>@@0 #400k.06S0 k΁0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&ʀA-Pk@8` R.; pNp "$pp &bS0 B0&0  8#̠   4##<V0 0 7    &*60@-S S00k@@6 0C60k>@@@!PPƂ0k΁6 0@-# SH$(<0  PDHP@ 0@#4PP06 c^ 0C6 S0Ҽ60k.@@0@#4PP 06 0C6S S00k.@@6 0C600 6 k>@@ @"$PP Ɓ0O-@ MPp,0S ᔀ&]P+(+%0 N. 0r?010S!@P j600&6 0!R1Q  S030#Z0Sk 0("( Y9>8C80 00#40编0iR#8 IC8἖(+ ,K("( Y98C8k0 00#40编0iR#8 IC8἖ Y("(98C8k0 00#40编0iR38 IC8἖ Y @("(98C8k0 00#40编iR I!἖T30M>0k.꼖ό YȠ,LȠ἖ ! Ɩl^ LƆP | y 0x"0 P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 0G.0 0R0 0xS0  0LSI>W&&&& Ѝ ЍO0 &k0! R2 ʸ006N.V g 8C800 0#406 cQ 0C6@!!἖:8C8἖8C8἖8C8἖ H L :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  Є p@-@P`d0P \0P 5@T @@pVp!(@ pyaratcid@-M @PoЍ@oЍ@-M @PЍ@@Ѝ@-M @PoЍ@oЍ@-M @PЍy@w@Ѝ@-Mp`P @P h@Ѝ 0Jp 0ЍX@0T 0A-S ` 0@ Cp'PIU P; 0 0A-S P0@PCp'`IV ` 000A-S ` 0@ CpPIU P 0 0A-S P0@PCp`IV `00@- MP Ip 0S p@0@Ct'`~IV ` Ѝʿ0 0 Ѝÿ Ѝ@- MP Ip 0S p@0@C\`YIV ` Ѝ西0 0 Ѝ螿 ЍA-Mp@P `P \Ip / 0S P 0 C+ @(IT@ Ѝt`Ѝo0`0Ѝh@/T` Ѝp@-@lPz0PPptcidp@-@`Pn$0P p!00ploobp@-P`!@P   @ap@-@>@@-@8@@-@2@@-@,@0@-@&@N@-@ @]@-@@{@-@@@-@@@-@@@-@@@-@@@-@@ @-@@"@-@@8@-@@L@-@@b@-@@z@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`{@P   @pp@-P`i@P   @pp@-` PV@P   @pp@-P`D@P   @|pp@-P`2@P   @jpp@-P` @P   @Xpp@-P`@P   @Fpp@-` P@P  z @3pp@-P`@P  h @!pp@-P`@P  V @pp@-P`@P  D @ pp@-P`@P  2 @ pp@-` P@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-P`@P   @ pp@-P`p@P   @ pp@-` P]@P   @} pp@-PZ@h(0P p10P 0pgntsp@-P`@P   @Z pp@-P`@P   @I pp@-`P%@3HP p5P U $00ppatadp@-P`@P  c @ pp@-P`@P  Q @ pp@-MP@ d0P @Ѝp  *`P  @P`-Ѝpgntsp@-P@ (0P p0P 0pgntsp@-P`3@P    @ pp@-P`'@P   @ p@-@R  @ p@-@"P $0P p00ploobp@-P`@P  # @ pp@-P@P >#@y p@-@"@@-@"@@-@"@*@-@"@H@-@"@f@-@"@u@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@ @-@y"@$@-@s"@:@-@m"@P@-@g"@d@-@a"@z@-@["@@-@U"@@-@O"@p@-P`@P  j" @ p0p@-P@P "@ pp@-P`@P  G" @ p0p@-P@P "@ pp@-P`q@P  $" @ p0p@-P_@P ]"@ pp@-P`N@P  " @ p0p@-P<@P :"@u pp@-` P*@P  ! @b pp@- P@P "@Q pp@-P`@P  ! @? p0p@-P @P !@. pp@-P` @P  ! @ p0p@-P @P !@ pp@-P` @P  t! @ p0p@-P @P !@ pp@-P` @P  Q! @ p0p@-P @P !@ pp@-` Pz @P  -! @ pp@- Ph @P f!@ pp@-P`o @P   ! @ p p@-P] @P C!@~ pp@-P`L @P   @l p p@-P: @P  !@[ pp@-P`) @P   @I p p@-P @P  @8 pp@-P` @P   @& p p@-P @P  @ pp@-` P @P  } @ pp@- P @P  @ pp@-P` @P  Z @ p p@-P @P  @ pp@-P` @P  7 @ p p@-P @P p @ pp@-P`y @P   @ p p@-Pg @P M @ pp@-P`V @P   @v p p@-PD @P * @e pp@-` P2 @P   @R pp@- P @P  @A pp@-P@, (0P p0P 0pgntsp@-P`@P   @ pp@-P|@P @ pp@-P`q@P  y @pp@-Pa@P @pp@-`P6@ HP pP U 00ppatadp@-P`k@P  = @pp@-P`z@P  + @pp@-P G@P d@pp@-P W@P S@pp@-MP@x d0P @Ѝp4  T&`P  J@P`(Ѝpgntsp@-P@W (0P p 0P 0pgntsp@-P`@P   @Ipp@-P@P @:pp@-P`@P   @)pp@-P@P @p@-@Q @@-@R  @p@-@0 P &($(p@PPb!0S ]!p₱V!0LC@- @@=!wBPlP 0R @-P Q o// 0S p@-@L`P`PpwP p@ P d0 0 o@-h i i @-P Q @O@ @0@ 0 a( (0( 0 bi h h `i h h 0  0< @-$i h `h m@-0P M`0! )%@P 0P0 `  Ѝh'ppp .P`   V'@ Ѝ M'('j`@@- $@P $0 0 0 QP&PQ PphPPQ Ppp@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@|[ `Z $@-@P@DZ p@-$!@P  !PP 0, 0pf#@c#p@-PQ@` 10 S S   CQ R 0 S S CQ\<S0S !S0-S 0F?o2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ DPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0`000 0`pL L0L H0 ɯ0`tC  >R00pV V `U P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /0@- CoO-p-KM `X됊0:P10 0 0Q@@0 >SS @S@B!P@hR lR xR 9!A-PRM`Pp`0 @T- 0@0W  WV 0/RA 0CW /RW  CW0  B/Q p!@C@T@!  ᬯ;@04D .00У 0 S*  Kp@  8U 0@8-:녰0@ۍ? 0 ۍx 0 ۍ S08p E9PC9D 9p 88pX@TP C-`M _PT@P4 ,8p`F  :p@ pEe0R8p"0 `dZ8p)    000RZp! 0PPЍ 0 0 `BZj8p  Ѝ_8T @Ѝ9L @@- @h9@> @-gP 0 0 ⋭M \M hL O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`ga P0 p0 3/V@ 6/T gT T @@T. 0S2 0 3/P V 6/g0S @0 R 2/0P`g P V 6/X3 003/Iߍ 0 0C/ 0 0C/ 0 0C/ 0 0  0 |0 l l0l 0C/BK |K |J K hK XJ K 8K 4J K K J EdK J I ;@K J I p@-P@PP  P $0SP  R PYpdAP P ZPP , `PPI PI P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT00 0]P $ 0R000 Mߍ R00 0 0K/$DH G F  0/0/@-@@P 00#0 0 P 0S S R/P/ R0/  @-@0 0p@-(M{P@ | { Lh``VP (ЍpD { <P j(ЍpDH F H $@-@QT@- @@|ඦ |Ep@-M@P` `0Ps0*0 00 Ѝpʭ0"Sp@-M@`P Pqp 0 00 Ѝp謭0"S 00 S 0 P:\03#/S 0 P\0///A-P``F@P   (qpP -@P swW@(0( (0 P dCD E D 00 S 0 P:\03#/S 0 P\0///0@-M @P  @ Ѝ00@-M @P  @ zЍ00@-M @P  @ lЍ00@-M @P  @ ^Ѝ0@-@P ,0 00R8A /P/0 00R / 0  Q 0R* R0:/- ^ : P *0 S0*/@@/ / @P $0 00R //@P $0 00R //?P $0 00R //?P $0 00R //X?MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/?P/l0 00R / 00 0  S *0/ ɒ\* /p>P/|0 00R / 00 0 S *0/ - ^: =P/|0 00R / 00 0 S *0/ - ^: `=P/@0 00R / 0 0 S /<P/|0 00R / 00 0 S *0/ - ^: |<P/l0 00R / 00 0 S *0/  \* /;P/l0 00R / 00 0  S *0/ ɒ\* /l;P/|0 00R / 00 0 S *0/ - ^: :P/@0 00R / 0 0 S /\:P/d0 00R / 00 0  S *0/  R* /:P/d0 00R / 00 0 S *0/ R* /9P/\0 00R / 00 \: /!S /9P/\0 00R / 00 \: /!S /8P/T0 00R / 00 R /! /88P/\0 00R / 00 \: /!S /7P/d0 00R / 00 0  S *0/  R* /`7P/d0 00R / 00 0 S *0/ R* /6P/\0 00R / 00 \: /!S /p6P/T0 00R / 00 R /! /6- P M D000/o"^ R Ѝ R Ѝs5P/L\ /  JQ\/45P/L\ /  JQ\/4P/P\ / Q/S/Q\/t4P/P\ / Q/S/Q\/4p@-@ 0M PR000 0 Ѝp$0S `0-S 0S0xS vP T LP ЍpP`P3 Ao/A-PP@B@Pp t>0,p0P4080<0IP`p @'@Pu@2  @-@ @-$@@ ǡ1@-@ @O-4@T ,`@D¤@@`T PpQㅑ ˣPZ P PZ  0 0 p3 5 (3 z @-R 0P< P 4Q ,  D D0D @0 I0 000 0 @0<5 2 2 c5 2 p2 p@-M@4 00R<SP,0 S R( 1`V9 P` 0 06P 40, 0C40P0 `ЍpS 0 0D ЍpeЍpR t t0t 0D \ \0\ X0D H H0H 0D a٥$4 <2 x1 a3 1 1 3 (2 0 q|3 2 0 A-@`,p3PP W 0 !,P0`],P0`G-@pMP P  F`00Ѝ!  0<`P (0S1  0 0P (0S$`V00 0 P 0S  `P  P X ` 0yP ( (0( $0\ P- PX1 0 . K 0  0 @-?1 . l.  0  0 @-10 / 8. 0p@-S \  Q @PPp 0  0 +\0 - - {p@-0S h`@`PPpDP p@ 0  0 P / . - 40@-S , 0C!40R @S@ @0@ <0B/Ҥ, ,0, (0B/ɤ`/ x. , h h0h d0s/⼠T T0T P0s/Ⳡ@ @0@ <0s/⪠  \ H  8 J   I0P/4  ?o2\0S/00 S/0P D- ?o2 ^0S 0 SW/DP/0 000R/P/0 000R/ P H0-000/o"^ R  R*/p@-Pp@P EP 0 03/P VP @rp@kp0S /A-`@P)pP $P pd0P  pAX9 p@-P@PP x ePP p=0@8@p@-@P 0@:  @-@0P xvP 0R R@-P0S /4o/808 80 㭟$0$ $0 㥟    h  O- 0S: @`P1 X3qPp 0 R" ~ 0S wP XP0UUUB!#10@<0.B,? d@H0SO-X% X0@#r 1P XP=6P =1P O    L O-@MQ0 p' 0 00 07吇 0P0 0` A QR Q <Qn =Q v P Y Y^ Y [z W B! Q Q Q Q Q <Q =Q v P} @ WyB " Qm Q Q Q Q <Qe =Q@d @gv P\ [P WWB ! QK Q Qe Q Qx <QC =Q@ Ev P: [ W60 B  PQ+ Q Qg Q Qx <Q# =Q! (v P [ @Q Q Q Q Q <Q =Q vP @ @QQЍ[|Q 0A QS Q <0ASu P @iQ 0A QS Q <Q =Q u P @Q 0A QS QeQ A QR Q <Q =Q u P @Q A QP QPQ A QR Q <Q =Q u P @-Q A QR Q PyQy 0A QS Q <0ASpuuPj  @<Qe =Qw `hu P\<QZ =Q3 8]u PQ<Qg =QM Tu PHQD 0A QSY QW <0AS;@uP4Y `10<SM80S0P) 80`Ѝ @0S <S` S` C SR S 0<S S 0 S Z Z<S`` 0S <S@ C SR S 0<SS `@ `=S0 P` `0` \0X 5@ 8        8 l      $  @  UA-`Pn @P d 0 U0 0 ^ pP  Rp Px@ QPp@-P``PG @P 00` Pp< PQp@-`` @P1 `P  %P( @P $00` Pp@ QPp@-P``P @P 00` Ppd @-@P X0 0R00S  P000, P/0 0R / P/0 0R/ 0P `@-o^P  ^^Q ᵝ/l Pp@- 0 0R P@U T  `P  ᛝ@pT X X0X T0x A@p8 808 40x 5@ |   t  P/0 0R/0P D- ?o2 ^0S 0 S/P/@-D@T  ?o2^0SY0oA-M$PU@P` !0 P 0S7Ѝ 0P    " PP 00 0P7  0R3  P, pW-  @P6 00P @ P>p 0  0R0"S | |0| x0 ⌛/Ѝ* @P Pȝ0"S| | 4 H /P/<  ?o2\0S /0SP/@@-M8@8@H 00CЍ80S p @-@DDMT, Ѝh@-@P (0 0R P/0 0R/P/0 0R/0P D- ?o2 ^0S 0 S/0S /$0p@-S@ P 0P   0xP tth@@ @)@pLLL@@808 80 㰚  @8 A-PP@ @Pp |```0,p0P4080<0 P`p @ @P$ @$@-@@ @-R 0P< P 4Q ,  <0< <<0 R,0, ,,0 Jlh B GPG-3 pP0`W2W@ 404 SS& 0000,0 10,0$ 1P0PP* { y v tPP@ @0@ 0( ( (0( 0(  p \  8 p@-M@400 S4RP,  R S 1CaV1 P` 0 0P400C40`ЍpR 0 0< e㽙` "\ ЍpS L L0L 0< d㨙4 404 0< u㟙  ` p t  L   A-@`,p PP W 0 !Ӛ,P0`( ,P0`400 p@-SP8@S 4 <0,04Q<0pPp 0 0P &T  $  @- M`V' @Pp P00 Ѝ|  0 P (0S T @0 @CP  Ѝ$ $0$ 0`  <   B 0  0 Z@-  T  40S 0C40/ 0  0 @- ` P 0p@-S \  Q @PQqPLp 0  0 ؘt0   Zp@-@P t0`0VP/0S R<0  0p@"$ $0$ 0 ]㰘  , A-`@MP 40SO %P@Ѝ P d10X pP @10041000@SB00 0< 0S 0/0 03/@P PH 00CS 0 @ 0@S OPlЍA,L@8 808 0,7 d 4  $ H G-S p&W@ PU 0` 0R 00 zP tU  G 0  0F/8 t P MLA-PP 0 0RP4?pP 40S @,0aA, 40a@T:8 8 409pl@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP 4@p`p@-@P \0 0R@ p`P00S@#:p@A-`@T 0p0WPP \000P0000@S <0 @ 0@?Lp@-P@80080p@p@-P@8@@@pp@-@P 0 0R`P40S ,0AT p@p@ 0  0O/$ RA-@P 0P 0R@ p`i8040S !,0X Y<0, 0Q<0d@R@f@D D0D @0S/ז0 000 0S/Ζ,   p@-@P H0 0R@ p`P 8@pA-PP0 0Rp@ 4\ 80,0!aV! \ ,0\ <0L04<0AAD D0D @0W/u0 000 ,0W/l\ t <  P  0P D- ?o2 ^0S 0 S//4p@-Pu@P JP 0 03/P [P @wp@pp0S /p@-`P@}P $0S p p@F< p@-P@PP  rPP pJ0@E@p@-@P #0@G 011/A-\@`pP \"1S 0 €  P 10P !`p P 1@0@ @0 B㸕,0, ,0 A㰕h 4  @-\@ ^ \)QRS  T003 QL R S "  T € 00 0 0 Zk h  0@-@R00Q,MP! P! 0       L坱T0?o20S00,Ѝ00  0@-MP@0  0v0 0p0 0j00 0P   SЍ00@- M0P@T O J000    S Ѝ0 00@-Pb"M!4b4#  @ 0- "44 0% "44 000 0P   UЍ00@-M 0P@  0b" b!  "440 0!$$    SЍ0p@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 V P0V00(Ѝp@ R 0S V00 @- @KT00@-@p00T0H0I0Jr @-@"T @-@T000 000S/@-<t000 000S/@-,t000 000S/@-Tt000 000S/@- t000 000S/@-t000 000S/@-t000 000S/@-ܕTt000 000S/@-̕t000 000S/@-㼕t000 000S/@-㬕t @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^  \#t001/,001/ 0 01/0S@-@1/00/h0h0@-@ M\P Ѝ;P ]Ѝt/(@-*-@-0 000 000S/@-HtAo//p0@-@ MP 8 P Ѝ0 0 0 ;vt p@-@M P P pЍ(0( (0 ;wt@h p0@-P M@ T T T  0 Ѝ08 @ Ѝ0 0 0 :t X , p@-@ ,@  0 0 8㫒^t l 0  p@-@PP (P$Pp0 0 7  p@-@PP (Pp0 0 7| p@-@PP $Pp0 0 7p0 @-@P  Y.<+ < 00 0 ;R x @-@P ( 0 0 7A(t h @-@P $ 0 0 7/$, X R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@| P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pႆ8000 0@0 !0#2 /UUUU3333  Ĵp@-PQ@ : S d S V Sb00Z r0-0!-w- R00[ >R-   @Rx  : r -  w -   RG !R-   Rx  !r-0@w- T8 T2 T8 Tx 0    p Rs   ! Rs   0 Sp00  Sc00 ?00 S1  Sw00 Sl00 S  S  t 0 T 0 - 0 h0h h0 9: SqA00ua0-00pd00ms00jt? ( G-P8a`9  {pPA P<  ҉pP$ 0A0}`@@T&  P0=S AP`0AT CU!  뀊ZL0L L0 >-AB 0 L pp"p2C-hM 0 PLP T0X\m ``P P唐嘐圐堐夐 p@Z xp  p@e ,P7  $(08p@] `0<S0<0x0@S<00<0@DH,<,,0,<1<000L0 00,X %ґ0S qpp@ 㬑 㨑 @Ѝ~OoBЍ@ꬑ00 ㌑ ㇑ パ| | | T O-PMp 0GW"S00` 0t@؊P-TPe +T@`0U ǯ 0 忀 0 㷀P !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ <P"00 0U00S0S U Ѝ0pS 0F00T& W p p0@ 0` 0R0 0 Ѝ0 0 ?܎i00XS00 C R @0` p0~ A BRWhp pqꙙ  0 0 09\6O-PMp 0GW"S00` 0t@P-TPe +T@`0U ǯ 0  0 P !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ sP"00 0U00S0S U Ѝ0pS 0F00T& W p p0@ 0`E 0R0 0 Ѝ0 0 ?i00XS00 C R @0` p0~ A BRWhp pqꙙ 0 0 0986O-M8@ 0U0! V WppP`P`!P) 0 0 00㼀@D $P,`(p0W PpPpV W dpd`p`TPPH``00ht\p@-@PMP& U 0`1S ,0S $0S  pЍp@0@ @0 <໅(0( (0 ;ಅx H X \ $ @-@P 0S$ y0 P @0P 0 0001 1 00y404 40 <ぅꚇ 0  p@-@PP% U 0`1S ,0S ⃆$0S |9Hpp@0@ @0 9N(0( (0 8E $ p@-@P \y00CS00 PZyp P0 0 7 h --M  GЍ Ѝ/ -- M0 0F ЍЍ/0P0@-$M R P@0S#  S!9z0  B0!  0 0%$Ѝ00)zL0 0 @ P i0S$  pg M T fP 4000S$/00//f f C-PLS RyVP  >,1,!,0 v .@yPV 0 0 40 30.<Ѝ0 0 YY@@P PU aPx 0 l 0 @2]yPD@P@4t о 4@ \ \ l < - M} ЍG-`!1 0!M@PP0<80H 04p0040 <1p PP $!1 0 <8 30= !ݍ  „0 00PpRP@T Cn✠` P 0 P8TۈPP @T@႓D0D DD0 ࿃v: `  !1 C-!M0M@P`0<80` Q P00 4 1 ᛈP@4p t1p又 P4\00 $ ( ,  0 0 ppPP"@T Cn` 0 P8TmPyP' @T@0S   t0 0 <8 30!ݍЍ`00X X0X T0 98@~ ļh}T ,}O-@$`4 0FM MPQ␤t嘔0d40 T V Z YX ( 0Kd 00; P0S 0K  PW  0 P(006P e $ .P )P$Y W , P(P ,N 6P $F W ,B   c X#P3 0 d4 30Fލ Ѝ, 0 P1  PPg / mP@ @W  CXj Xt " 0 7|| Ap`0\ 7f@"@2@ < 0eTQ$"$2$  0ZVH"2  0OZ?!1 0_D5 Pn .0$0S㔑 / ! 0 P  S7\1\!0 @ G7414!0 @ ;7   iB : 2q  x P P 8 T  ,  yؼ ܹ t z H { H Ԯ d d x T 4  @-P`!`1 0M`P@000: p }T T) @/00!1 0 0 307Ѝ0U000 @G @P@00ށP "448#800U0PT T0T 0( lꅃ0P 뀃@Pl  @-@P  @ 0  0< ~Hꐸ d 4 O-P-GM M '07  (00t406004$0C (0SL 0SU 0S^ 0Sg  X@`9 HL`P`T`H0Ja p@? d6dP00800pp,0 D@P! s  u Put 00S/ 0=S0`S0`V`X`V `ሀ gP0#S PU  @p%X5 0 t4 30MGލ Ѝ000C00, ӂ0 @p00000 0ᲅPĂ @kP0p00000 0ចP 4 |  :h  :$0S000C00s  040`P $hp00 Yu  Pu0U,P0008@@`r  Pھ0 ,0pPC   Y$0q0S S `u x `zu q  `su j   P4 R"g G0  . 0l2t H $04P00A 40 S  X P 00S $0j h !1 0H (0S!1 0H 0S!1 0H 0S!1 0H  0Sl!l1l H 000004  p嫄PO PK Pa걁0S W Q (0IA0pLд <  ܱ а \ , \ x , T ̮ $ hK C-P "`2 0\M@Pxp|0T00E UN VW W` ! 4!48#8  {X000000 0 $(,0匏PLQ T,  s90 p@Ž!1 0 T0 307\Ѝ 0 P 0~U 0 P 0~V 0 P 0~W 0 P 0~ | @ P.G뼬0 l< 4 ܫ   X -MXЍO-`|"px2 0dM@P∀匠吐P0\00N VW W` Xi 8#<("4<8#8  W0$000 0 (,048Pc0Q ,  8jP 0S@ 0 @L!41 0 \0 30DdЍ ! 1  \ 0i@~V!1 \ 0j5~W 0 \ 0k*~X 0 \ 0l~fv0  @弍@ \n j Ԩp h  D L  0  ت -M>ЍO--M*$04 00200—: زrX 0S [ 0Eo 0-0P 6UPf 1 S Sh #@ # Sb  000 S SU S0 R R R R B RQ@ B RQS 0 S1@+S8 -S\QUp @Up0S Qr : ]00_op`R0+S6 -SI vzPPUpw^ WPZN Pp@ S S 0QUp @U50SY Q; : &000+S_opR0S @S: PP  _opR0S @S': PP`   _op`R pPpU2!0 0 2 304ߍ yPP .  ) d 0 d 0|| |0| 0td |0S\ \0\ d 01|8Ȧ@X إ H  T t O-PL#@H3 0MMpP`080v T X 3 0U&N 0AM.0 ;vPY 0SV ܰ + 6+ 6g 0  0 s 0h PP @ -P3H0: SX (2("0 & d e"1 0 8 30p ލЍPP 0 @JP. 100S1!0 &l!l1l t 0|TL!L1L Ht 0 |Xv0!010 ,t 0|l P \0S  S 0 0 &0 0 &H0 0 0 &0 @P b a$ x `D`L ȣ \ h Ȣ 8 p ` _ _ A-@P0M`p- V6 W? 0 s|00 0 P: @T@T 0 pPP @0Ѝ @:P0Ѝ 0 0s{Vd d0d ` 0h{WH H0H D 0]{Pp < $ ܝ  < ] ^-$Mxx0  0 !Π0 (0 0 0 30$Ѝ발`-$Mtt0  0 !Π-0 (0 0 0 30$ЍЛO-p `PMP  B{(2("( 0@  0B ^ aB\WBAB\7B R Q AL\  &QIDD(00 D0S0R0S? R0*@D T T0@Ѝ T:0 0 }z0p D TD [ R [/ : ` 0z 0 \0\ \0 wzD0D D 0Cnz nܟ T ̞  x T p ԝ P G-0l@P?0 @RP;T !3*4q4444ap ?p??`.0S   Q#2 0* 00 P* 0U 0 R*Q * 0U000?0R*00x?Rp1?p#`@0 0S ?0Q*:00T: ____ ^^p@-PH@H0@`M000 @Ѝp\|@-@PM  0 0 0P L  @SЍ$0$ $0 3y] d ` @-@P(M $    0 ;P \00 $  (Ѝ( (0( 0 Byꌛ ]  ܚ p@-`P8M@P ! T* U3 40 000( 0,00 $$0 P|;P+" 0# 08Ѝp 0 0 RyTt t0t 0 GyUT T0T 0 ! "0%0 ?0%0?S@@h or0hV@Hp` 0V@@p`F AVrH H0H 0 0q, ,0, 0 &q{ z p{ { { H{ !1 p@-PP0M@0 00A TJ  R00113 R0 0~? S ``4` 0~? S |U PE "001<3 R0 |0 0 0 30Ѝpd d0d `0( pTH H0H D0( p<s{ z rDz ,z y z y y  0 0@-@P0MP000# U+  @ 0@  "" 0S0(0t h0 0 0 30Ѝ0L0L L0 FvpU)PP 8ry qw Xy $y G-!QMP1 0p 0 500E4eP;0F Z08C;t0' T DPP!  oT0@To0Lr0@Gr@ y 0 0 5 30"Qލ+5r0@0rU@ 0P PiQ@p p@`|q p- M0 Ѝp@-P 0 0pM@P`0l00 # *X P0 0 l0 30 pЍp0 000 0 oD8onv u dv {40444 000{ 0/#EgܺvT2O-tM@@ 0p P?D @`  0 p, .`h d` 4   *d,! L꫅appl[ P8 ` P%lk.0`&P p``{[d[ ppmܼvmzNSdK P%P[`[h0nbk*@`<nbk& @`'i` .DfinlkajK(l @%LjK$ @g a,`dMbKh &͠iˌb+h  .e+ "8 j f$jlf!  idah d  b-g+d)h,n h ) g{T苠fp`! g|e{D`)fk`" l )e[Pe]n[fjLdka( Ha)dK@ 'b )n8M X`Kllˉh& h)` h0a a0%g;0# f;$0f;#`x2@ahhlʠebˌ *b+ +g+bd )@lhf`fk $0n )g{Dplxe{`!)*e[`PXm]dkn[dKea()@dJ`KTDbhn)( h&L. 隠gllˋ *4 jabaj+ f+$L "dˌah(,d+.e  " , P -8f+fkl̠i gˌ g{p8ye[h (e n ( j{ pp'` d ,` ph"+H`knn0`lkk,`H`gz@h`i{`!ik`mb j !jk`nekh` `&`fj$lkfh (@`+.d@bb+T@gnK(@<@ @!l˄ k(! ɠb-je[`` \!0ag;g{S 00 00//K@-M `P @hppPU0D>S 0!31000 hЍ>SL 0!31000h00h00HK/-p@-MhP@U@0 ` ` ?Px0x 08 R;0Ѝp@Ѝ/0 a0?( ( ?dJ S  A-@P`PpZ =VC #X0FS#S !  +0F0 `0UPP`PU`0000+W% -W' =W000U0- 0 0+`@%2!0 P0PP0P0@0@ @0 ]f000000 P ,Q P p@-@PPa 1 @0RuSpWSQX0CSG5 +p 0R \PSPQP\     0 T 0+S -Sp0$ $0$ 0 beI@DO 0O O O--x[TMp @@0 0P004080<0`| (g @(?Wg@ T9<8(0p00000L 08 0:80: '`a0GS#! qg^`g00]g0 @Xg@ TЍT700L700+W@ 0-S=W 00 0l0P @X B R h `ZS  "=W  R!  ( P:0,g@ ,Vf R(" @,0ቑ(  J(X" (@ T:,f@ p,Vf0S{"(@ @D,@(@T 0V0X00@(@pW ,WupPBS(P Y0,fP ,[Vf RM"(P0 PE,P(P   P(=W X+0G?o20S" Y,f P,2Vf0S$(P"2 PE, P(PU 0V0X00P(PY,kf P,Vcf0S(P"2 PE, P(P0T0 00(V  ;I?I00V  l0S(@ T:,!f @,Uf0S(@,0 @D@(@T{ -00+0D" 00 P0TЍ'mp``=W   0 0!0 ]c :] cka1Ese00 TЍ(0[pI p X`+P-@ +0B XR Rm  p+0B0+R XR  -Rp  X@PPQ`p0p p0 ]pczX X0X 0 ofcEN N 8|M 4M G G ? T6 > h@-PPdA M@I X1p0S)H1@T2 `0`S@% 0SV- 000S$`Uc0S1 ApP P Ѝ0@T0S 7c0P0h\0 0 L L0L H0 ay4t,Xx0(l= X= = G-`PHMP6  p 0 p@ p@ HЍ P 0 p p@ <HЍb0S @XH0H H0 >`0P R@0< `< 4< O-P!PR@A%OpQ0 00000(02h10`0d0 00000p(0&0 TY0 P @ᐺ0H P@ᐺC0S0  ' `00C0  ' P㐺@% P㐺@ P㐺@@{4  4 @d  l t @؅   | -0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFpP WP Ѝp4A-P`@ A@0S(A@Q0,pPpPR @3 P lp0 @BA QA3M@  Vp0 Mp0 ,0, ,0 <Qxt @  p@-p`pP`Pᇽ@T T0T0 R@@{pP00pdDA-`P@P@pb0S |@@F R"@`TR@P00S0@Aꄚ@@- 0 0 C-`\MPI@P- 0S8|0V $"$ * UpЍ 0P  $ R%ЁpYTଢ 0N꤁|0ࠢ|||㖢0R1 0QG B&Q&R-.4 ꐀp0 Wtqd{ SzڙHv l8  7 4 7    |7 6 1 t $ @5O-0-4:050u00%AM M0p0 0 $ 000 0000+0 P0 40 4 P P @\ 5P 0S p400#S \ &P 0S 8d84`0`\ P 0S d4`0`\ P 0S 3 0   \ 0P 0S s30\ 0P 0S rd30\3@E0 + DcD3`0P0@\ @P 0S {EP0[[ 9MP200xS0xS0Sc 0`" $2 Aލ ЍdR @P\ Pk 0S 8200#SB \ P 0S 2R0P\ |PV 0S 100xS0xS0S 10 0sS(0wS%0S"x! t1tQ0P \ T0P 0S ar@10\ G0P 0S Tr!0 ! 00P00 $ 0000 00LPx \T  \t xhh+  0< M P   |lPM p@-hPP0S P@L@@p@`@` 4P@h J A-PP$ `0` 4P \@@00ȽO-@P V4M0P7 0S? 0Sz 5 5( 0$0000 P  0 0Up` 0A  0 0?S SQ *S U 00  *Q .W Q8 /Q0S %P @[S8 \S 0S 0@U pp  R?\ \ *\  @[\ \\ 0S Q@ @00yW 4ЍWn /W U 00 ^\!\00,0  0c ` `/S \S V U0@  0SC -R S0 U@ ᱰ0]SZ,0`S * tb cU ⊠Ằ Q]Q \Q > @S QࠣW /W% .W&0S# 0Y 0S 0Y/S 4Ѝ/W0 0S7 0Y 0S1 0Y/S.0S@0SUu oVU@  ᲠQ@ (` [W@ X414!40 {MM0S1!0 |BMQ@ "0(C0@p0U0 $  pW 0 P/W[ ~0 / $Pt@ 4  @0hP@-@ P O 0 Q 8Q > ?o2c  p@-@`PIP LIPT00pT00pN 0 pd T O--  " M0 "  pb @T ` !1 0 2 30]ߍ蹼PW 0  pL  㭼`P: 0S;p 0 0P`P* @@0  p@ 0  P0PpW*P< ? 0 "C 0 p@00cN`-0P0000`0 `0p O--  " M0 "  _pb @T `᏾ ፾!1 0 2 30]ߍ-PW 0  >pL  !`P: 0S;p 0 0Pᅽ`P* @@0  )p@ 0  P0PpW*P< `? 0 "C 0 p@00M`-0P0000`00 `0@O--  " M0 "  pb @T ` !1 0 2 30]ߍ衻PW 0  pL  㕻`P: 0S;p 0 0P`P* @@0  p@ 0  P0PpW*P< ? 0 "C 0 yp@00KM`-0P0000`0 `0p@-`H@P@ PPpPpPP l p@-`H@P@ PpPpPP  p@-`H@P@ :PpPpPP 0 00 J-H- M0S0 00 0 0 0 00\100M \0    R8 00 0 0 30KH Ѝ/-H- M0S0 00 0 0 0 00\100M \0    R |8 00 0 0 30KH Ѝ/, -- M0 0*--M  --M  A-PPp`p Q @Q PD@L 0000Al$0$ $0 J 0P R   0//H|@'@7O- -0@T@!P;P 00pUX0 B@T@!@@4@0/S @ @꠩' '  -0DM 000p 800S DЍp@-`Pp@ P p V U ph 7p`  V=@@| X Q?o 0?oA-@c^?c%^& ^ `@6$6T&pc@c$0GCH6(0c1C  1. "0;:(0C0 /0 @- /? P!Q/o /oC-@@bT?b(T) T `P6&bpb0xBy66U b1r1 . "1;:( B0 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J\@ @-Yp A JQ@ @-Np J@ @-p J@ @- pP `I@-G00p@-P@` Z<Ppp@-P@ O<Ppp@-P@`D D<Ppp@-MPP`V @T |00FЍp 0 : p@`$ {ԧ 00 R ?,@-G00 0S@x;ܦ /"br1 0!@0lR0cR0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`Y: @:P PXY  P 8@-P@, $1M`00\7 00@|p\ 00#30#^0#02S000R0@ | l0 0 2 30ߍpP @@ @(@$+\DO-`P⨏DM 00 ?0000 P 0  R X4p@p%Rt @0@0S 0R`0 S S0&4//#b!!"AK/ "bQ3:bQ#3P. ! P0 !>?3c112AK? .##.cR 3: .cR # 3010!00C0 0 0R PR02R0kWhp`% FURb,`_^]\[ZYXWVUTSRQPONMLKJIHGFsRq(9(<;:865 +*)('&S2on ,{sk"f  ; 000V `DЍ0@@0@000@ $p (Ph`8  0`,pC@8 P[9P @ T 0S $p ` 0`(P,pC@8 P<9P @T 0S  0 00S MzV0@  000 GR +Ro -R 0400pp\:S 2a2c2SR0c$00 0(000 50400nU V 4 00000 @W^00qWZpWV8  9 0N00 494 4 W B 00> c0400@0@0W%S.UW+ =0 00v W\ ;0 0x0p S00W000 [ 0h00  0Y00A c04N0S00C  4/"b!!!4    (0 404c030S4 !!!v.B B4 00 ǟa@ 4  0@@0@000 0 B R0`0` W G $0 0` 7 $0 0@ 8 0P `v7 0@ 7 0P0 00 Qu4 W ! nWl 0 Rp00ZXW^ 000O I 50400 4 04 4  B 00=4 40444 v.B B 00, 044 00@aa B + WP  RM 0s 0v0 @@?3J⊡j ` ?A1c1c B  B0  UR ZRW R   @M 0 0$0t3 @0(004X $p,(P0@W00  $p,(P0@W00 #/#b!!"A0K/ "bQ:2bS0#03"10 !A 0  4 DRd 4 0 MRU 0@^h  @cQ 0 "#^  z F 0/o"#PzVt 0@0 0 B8 <000C Sp10^S10L0"1 `GO0!0 BV 8 <000C S 8/P 000 TR RS p @H0 CR > A ALA p \WOJQ @ 00 0b$00(09 LP)\(\ ף8 Q n l'$I Z Q00P00C4\`000s\qT0?2c 1A;S40f`2ca12T @0@000@-W@ A\N A R$ M a"b"b"@000$ (0$p(P, 0$p(P, 040 @) R& @" R 00@ p40 p  0P 4 @0000C!( .$0`00 p  0P 4 @0000C! ( .$00 0L"0p  P l24 0!0@0c( 0$0| 0 0 0Ohp@-PX!X1 00Mp`@0,007 U?   P00Q Q Q A 0   , 2 '0Ѝp 0 0t 0`0` `0 :?UD0D D0 ;?Dt,t,t,T  ܮ ȿ p@-@PP U 0DPp P @pD0D D0 7u?U(0( (0 8k?l l t | D G-pP`' X/ Y 4V @P0PES  R  D0PEV R  SS0@0D@ D0D D0 H/?X(0( (0 I%?꘾ ؾ x R@- 0BAs@ @Q 0CR ?@O-PP⤡ M pV WC 8@PI .9PU  _8p`P 64D101S Y$9 Ѝ0)80P8P0 0 0P 70 0 ?=00 ?|0| |D0 >7@ 0 D0D D0 C>8ꐫ  ؼ 0@-RQ M@@ L0PP TU @0P Ѝ0 Ѝ0@ 0 Ѝ0G-p!1 ਑0MMp P`050G |1PT pG @PE@X0^00pAtA0O000 TAXA\A :qύˠ$@P,0  (@ @H(@P )P 0 0 5 30ݍЍh0h h0 D>@&@0@0!@0@0ꂷ8 0 ĺ 0 -0 |`--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-@P− M p`x X X00?1)00P @ P /00 P ! !  61XP8  /VP" WS V[XPVppPp2*0`0 5V0M`l!l1 001 Ѝ`ᡭpP: P1XPC0 P P001 Ѝ0 0 Z=0`f0`0 0 ?L=}mpP V fpP X0X X0 6= `Ц\$ 8 h @-@ MB1(0S2 k(0 `(0` 1/qp0Pp  0 0 PUR <0PU(1 ЍPPTp 0S  0CP1>P0p0@-P M0(0S< '(0 #p(0p 1/qp0@`3  0 0 @ToR <0@To01`VP ЍP@T` 0S  0C@o>T 0 0> 0 0p@-PPE 4A0S5 @Tp1 Rp0P00 P 0S P0 c (ޮ 0P0 ٮ0 SԮ,P Ю4P ̮8P Ȯp@ŮT0T T0 MG<0Sp000 00 K;<eE, D ȳ  г p@-P$@@WYp@ߧD܁@- @@اXY@ҧDp@-,PP˧ oZ@ħpdDtC-@PaM`Z 1 P0p00S   0 XR0@ @ SM `8)@@ X80CS30I0 S0\^**N^&^$ 00^X   "\ ^ #R.S @ 0a A 0C ƒ`0@ЍD0D D0 F; "^ #Rꐟ ܱ 4  R  *4 8/H 0X\S 040:8 R РS /enxB@-Pp`Y=P@P@0@D尀 ᷳU  S% ZF  - MP@ Z=0 A-`Pp@P3 T(   PPP P 0PExog\h\Do%,00888(80 : 8 ( 0 :   &00'    70C YG p @W  0   J0PSE"QPA 00pW ;~P) Z0 PD0 :0P0 T 00:00Ѝ 0 /0}8Y 0 |/08ZPJ 00L L0L 0/!}8:0P0, إ  l 0 ~ 0z0x  갮 A-@q`pPUi !2"#12b! DqW7 0S$ RP QP0S! 1003/P P $@00W L!P0 $@o0V0 P100S) 3/000PP0S 000S) 3/000(&000p3/P WPVSP 000SP&P0P000r/>3|r05 4ql4<4=A-@q`p PUh !2#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@00W L!P0 $@0V0 P100S) 3/000PP0S 000S) 3/000(㛧00 0p3/P WPVSP 000S㛨P0P 000pPp3 2o@22A-PP} @,`Py qpPg  00Rc<!"#b!0CaqV- pW 94PWV $00dqp0ST100S004 k,1003/P00  $000``0S 000S+ 3/000(P`0003/P 003/0000S TP0000ln/>3m0\0Tm 0/=A-PP| @+`Px qp Pf  00Rc<!#b!b0CaqV- pW 3PWV $00dqp0ST100S004 ,1003/P00  $000``0S 000S+ 3/000(〦P`0003/P 003/000$0S 〧P 0$0000lkT.$.k--SR: G-P000pS` 3/0Y @IOP T0 0 0 0 Y @IOP w TT0 0 H H0 0p`P   /,iii`i,LiSR; G-P000pS` 3/00 Y @IP B T0 0 0 0  Y @IP / TT0 0 H H0 0p` P $  /+hh|h@h*,hA-@P QP P@`p\P#0`P PpW 70"S 7@00@`O-PM M Q0` 0 Q /QE P.00G *PP7p/Q/ Qp @0/SS.Q8 0E00 0C S$/0 D 0T6 I0 0  p 0: S-  S/ A/o" R_/Q PP37?0V0/0000 內ލ Ѝ DR .QRV  u/R0W01ʨ! Su0P3 06*0  R'0 5(/QpPVP/0000ލ Ѝ `P `d6006>006006?006006  p@- P\QMP>  )HA@00ä P@ 00@T' 1`0@@:T `^ 0 \S 0@ S @ 0:S@:T T0 0Ѝp\0P ٦H0 0Ѝpt6 0 0`,$d0ccp@-@PP`2 U' 0Pp:P@0P S P:V P0@Sp0P P@Sp:VS:SpH0H H0 4000 00  4ȝ | 00/d$p@-@PP" U+ 0PE Q  Q:\|\00\0S!R B|S0 0:SSpT T0T P0 3U8 808 0 3p  ( T O-P-MM T(P8  p$00<40O 0SX 0Sa t4!S S wpP 0P0!  㴣PP 0{0S < Z' 0 00  P] 0ܽP|00 ` @Y  R( Xw :R \R R R  T:pG{@DP Yp@P+  P  ` RX[@ #QQ -P@6000S 00,0:P = `P| 0:RP[ PR0t4 00 04`IP pP p:00e00[  0 Sgb00\:R[ @40:R0 0 R0`FC,0EC000S:S :00 H0GY0 D0i  e 04 @PC-00EZ@DDvpG p{@D`FPE:P p@`PP0S $ D0AT0: 0P#3 0 <4 30ݍЍ00 0c, PP@ ③PP ʠD3@00@S{0;0`S8Ϥ`#3 0 N2 0S"2 0 B20S"2  0620 S R6 H40@埤C4@00 ៼  #@ዤ0S? 0,0Y'4p,P0 `0 6/p P0003/n00k4`X80,`0C00005' p  PP0  03/P$0p0H?o20 0PE!1  0130@9300@120S4-3 0  0$03/!0S3 00| ! H~`  y | ؖ L  }   4| h p@-PPM`@ V T 0  Ѝpx x0x 0( i1VX X0X 0( ^1T8 808 0( S1t T H  dz @-4@@ P 0 000VVO-`88$ 0M M0pP ( 0 V 4D0 @R` 0S S P@T 0S  @P 0 0 C R 30000#30:Q0#Q0S(  0R\Sz H3@0 T  P P 0 0P0 QP 2 0   >0S00S\S00 RAP 0S7\S5 00S1 :S000 0 Sx4Sq A 00S :S|S@0@ A@0S'!1 0 8 30] ލ Ѝ q@P 0 0 Cp1 0 Y P >@P/  @@4QP P  @1 0   !1 04 O0V( 0 04 D00ศP 0 0oPX ѷ @UꦩTt8tVVUUPU TTqdS(SS Ԏ  T  p@-PP@ T `` P 0 0x0 0p@   T T0T P0@ /T8 808 0@ /QQ| Xz P Č G-PP@` T V = {@P dPP 0:SS   d: p \S@0* QP 0:SS ^S 0S:S 0Q0@P PBd 3P 0P:SSd Q0 B@A0n0S:S 0C\6BC2PBYU?PK<;:9876?432802.-,+*)('&%$#"950+000C^/000C\@& @0 0 @0} @pz 0 @0v 0 @0r @o @l0 @0h PᱠPዡ@ @ 0 0L /V8 0 0L ..x x0x t0L . @ @a `@]1 0@0X d ĉ e < xv  A-PP@`J TS V\ = }PPg dpPe 0S:S@@c0R0:SS   \0@AdDdP pA\@A Tp 2Pp @ 0 0X F. 0 0X .T 0 0X t.V 0 0X i.@P@y0 0@0 Ї t ̇ t @ " <  #t pc $p@-`PP@4 U= T& # P? 0Q 0XS  <,00A ^aPAU70AAAW0A^Rp| |0| x0d .d d0d `0d .UH H0H D0d -p  s r d qą ` 8 rO-p# 3AM M0@P`0(0 0 0SI %#/004 QPPO @P8T   C/00CS4%210/.x,+*)'&%$#"  4$  0:S 84St/0S/00<"(2 0 (0 30| K%P( BKI8T 0:SSj䡟0 44 440$0<4 0 S BKJ4$; 44/ $0C 0$C0$x.<4 $0C 0$C`BKPu0 I8  S:S: R> 0B44 R0  0R!0100@M P@I. ᡷ0:S084  ;/ 00ULPBHp0p p0 E-.00ꉦ@0 44 (g  e| l Z Ti d 0 00 Tc-H-M0S000 0 0 @ 0 00^100M ^0@    RL00 8@ 00 0 0 30KH Ѝ/2cc|b4@-oM$@@00L @D@ O-P"2 @`0,M0$00 l20 R^ 00@`pR 0 QMP Z p P p J  J PP0 S"3#: t- U(10 r# 1$4S!1$&@@x!00P @P0S?"@!1 0 $0 30= ,Ѝ100S  U r pP Р 3P 5SX0(, VT00#    ፥PP ZP0SpaCB  \`TB|K0 @-;(@M@@00=PЍ A  { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T j-P0 0# 00Ѝ ]-0Ѝ-$M0 00 0囵P$Ѝ-$M0 00 0勵P$Ѝ-M0 00 0 zЍ 㟶 㦶0㞶/C-`4!01 0sMPPp010. V6 @X0^00pAtA嶖0OPP0P0 TAXA\A0H 0  $ @4 t0 0 1 30sߍX0X X0 G*V<0< <0 H*T\LH[LU z dz hz pz  0 3 30  ߍ ᢲP0 %P 0 0C 0 S 0 B `0 zRO c_^]~}|{yx_vutsrCp?>=ge,`\[Y``YBR0000C`0 PB 0S 00 0@;+ 0 )U;+ 0 )@00S0  @DTG = ͱP0 %P 00CS0000@ 0D S*v00@00 SH0`I @80 H`  D0 4 BPR '+f 0|ZpC0P Ml:ljWp!vPP p` 0P + @MR^f\dZYMTSNMLKJIH654321A@?>=<;:987654321)/.-,+*)(!   XM P 00CS0,000pWP0 :S XR    0 #$ 0$        00 0P0 0C0000 S000@cT @0 %$P0@ S0 B0 0 R ̰P 00S00000 0S0W >. #RR 0@00T0C0 0 >. #RR 0000C T0 S ᘰP Y 0 00+ E   BR P X *P@NU 0U00CS0Pe0X 00U*P@ XRz  BR  PMR*P #P0@<00 B#PG@0U0S00CK SP0 0[ "*<@P @0ESH00SH #P 0@0CSPH00 000  0T0y: `4 8@DV*T ET@0 PT0V 0$0`0  P t$00 400S P0S{ 0$`0 00000S 0 @0CS0P0T 00*P<+ E  BR P X E*P @ "P 0 @0CS0P!0 IU00CS0P0X 00$*P@W(  R D  R~ WW BRpP  n 0@>0 0@8>0 04`#C0 0@ 0   +   +    )     00000@ 00 * 00@90 0 0 *  + 00@00y   00 0 !P 0 0C 0 S ?P `000@ 0V0 0@0P @00S<@@XL  M P@ !PS00bS. !P 0@0CSPH0  0 0 0CS0P0R#*P00 P P00X Q!P00<0  P 00CS0P0[ *P 0X 2!P 0 0CS0P0R*PYSv00@0?H0. #RR  PR  B   P 00J P0>>03SS 0PU0C0000P0007 0S 5P PY7 Q| 0$@0 0000<00C P0UP0 PX*0 @PN 0 P0 R*0P  P R*0P00 ESP00[ K*P @YT6$@`PPP0 ) P `V0C0P0P  0S ͬP 0 0 0P0$@ P0PC ἬPT*0<PS$0xPpp$00000TPpX` ᳗ P @0C >>I v%0 fp P p0S ၬP0SY0Y 0S0 00 0 Lp G>>3PS 0pS0P0C0000000S QPdXb*0P0<0 0 5 NPD @0C >>`F , vo!% 0 0p. P p R`8` 48-P 48<`` 48`70 `4 @C8v0 S@!@30PUH$P  0!P 00 0$PGUU$0X`$0100:0 `pP pPf @0C >>p G D# 0 v$pR P!YPE" 0pS$U PU MP0T" P@D0 0-P U=/p YPE`0pS P W P 0SPJ00@@0@P(0( (0$ !00CX V V hV 0@-@ MP 00 P Ѝ0p@-`M@P@ 4P0 PЍp<6A-@Q(R`PY v6 200S5 0P1S010n L000P`! pW@0PI  PPZ 0 "0 0 C `C0000/  Q  Q*RQ0 @<08 0  B`0n0 0 `6! P00P0 MP ; B #A ?#@ 0# B0 D@`54h/ HU U p@-@P* ܂P,p0@-P$L MT` 0S pW 0 7/@P  Ѝ808 80 8 0p"@ ЍS U T 0 0 20A-P$LMT`p 0S $X 0 8/@P Ѝ< <0< 0 p 0$"@ ЍU pS @S 0 0 010@-M$LPT`  0S (pW 0 7/@PЍ< <0< 0, yp 0(p"@Ѝ8T R hR 0 0 010@-M$LPT`  0S 4pW 0 7/@PЍ< <0< 0D : 04pQ"@Ѝ`S 0R Q 0 0 0<0O-MD@P@Z`p] UV 0ST$Z0 0S- [* 0 ;/0S0 $\U 0S H[ 0 ;/@PЍ 0 0 0H 0 0h J0!@Ѝx x0x 0 [00$\D D0D \ 0}R Q 4P Q Q P Q P P PQ TP \P (@- @MvЍ$.0@-P$L MT` 0S 8pW 0 7/@P Ѝ< <0< 0 z08p!@ Ѝ`P $P N 0 0 <-@-Pp`]!t@t0@l@ ἗U  X @0 M$ ⩗A- 5 c T 0ㅩO-,M`PP tE@0P0 00E00X5p0ʿ00 0  P @0 0! B1 b80B p  U\ @4B 0@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 D R R Q  R \000!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0$ 0`P S^?0@00 0  P 0J ZS 0  0J ZS 0-00h10000 ,Ѝ0\  r  `0\  s  `0\  a  `0S\000000 0``0\  b  `0\  t  `0\  n  `0\  v  `0\  f  `| @埐 0P_ Z0\  @`oT,A- Q@Pp` ᩐP=0D! D?o2]R0S h0$"0 !@1= 0 V V 0P P0 AfLJ I A-p@P`2P$T0 AQ_T !T '0DS(0$"0 !@1% 0I O-p'-7UM 0PP0L107倁0001儱<0 Y?o20Sm[u Yf y @㔎0P(0 b`ጎ0P,0 00S080 9P40 H  T. (`000P@Tp` U T 1 # 0P0?0S0 PP Pp6p&p0 (0@FDA T @! DQ`B0P$0. 0 :40S V D0$ 0C BP$0  5? 00*R  5` 0$0'R` 00` 00` 00 `"00@`\00000 upT- (`,$@T( 0 7/P@00$,(8$p4 0 L1 30Uߍ<0SP k 0 0 4 40Ss 0  0( i$@8 ,@$0,040$0@30@0 D4       T "t X $ #p@-@ PU 00S  RQ Qp|P{ 00P{  pH0H 0 R@-@(w0(@wtp@-PPM`% @T@T T0 Q 0QP ``0`P 0 RЍp0 0 i l t L p@-@MP`0 S.$0010 0`n  P# 0 0 0CR00 U S R 0S$0Ѝp\$0P0P 0 R@-@(w0(@vtA-p`@S PPO 0 00S (vP   > (v9 0S `P   + ( 0S$ (v 0S 00 dtp@-@PMP  0! P ` 0P``p@@ Ѝp 0 S @PЍp0 0 < @ t D `!`1@- @0,MT0$00> `pVP0STA 0ST@!0 0 $0 305,Ѝ o  @`:( #<@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@0 l l\0P@- D  R4   _  h0P@-X  S H@ @0( ( @>  A-`PpPp@ U! T 0F0 PU 00@^ NL0L L0 ? U000 00 @ @ h @ p@-@PP  (p@K 0 0 1 h P $ T00@-01@UT0P 0 !0DP00@-01@UT0P 0 !0\ 0@- @UT@UT  0 0 !0脼8P00 0@- 1@UT0^ 0  !0ܻ000/ `1#P #Qs PFR'000 0 0䐟 UPQ,@ @ 0&&```00A @sl000C0A100H H0H 0 utdut@ ,u@ttt < D p@-$@@ @wswPsspsp@-@P PP P @p@p0 0 At A-PPp` @P& P! yP  P@3* "0@0 0@0< <0< 0 Ve@| 0@0@  Q:// BQ://@1@0G-000 $$!0p0Q= AQ@P` 0`P  QԀ @P  P 0R@ yTp@0@S ~y000  B B!G`$Hrش r4p@-@P P8"PpU0 =Sp=Spp(' p@-@P PPP@Ppp@Ay 0 0 p p@-Pv@P 0 P0@p8pp@-@PP LPp 0S3#p$ $0$ 0 pD   10O- M Yp @To p `P P0=S] @PTZ^ A@PY1Y04 S@@@S*Y3 x<1 0   q `j0S:a d D!0 0 @ Ѝ0Y   RS@C `<0S a1S  Ѝ PPlİ@- @t,  p 000A-PPh`` p\&@P 0=S SP(00@0T8# ,@- r@P0@l,@-q@P0@\l,@-q@P0@$l0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R0000@-@1 MS 0?P"1$Q 6Q 0  R& @  @1S 1  S( P  P    Ѝ0\ w100 Ѝ0@m0000 0/A-`Up QU @ @E 7/P@G-PTp AT P PD 7/PX PPHPG-PTp AT P PD 7/PX PPHPG-P@Up`L\ @ P@E 7/0P/@S@@@ ;X; 1Q`0000$ 00@100a0@00 0 `PT1S%  ! 0V000 @0 @10a@P@@ @@0@` `010 @a1 S Do @000Q0 @-@"P 0 PC^0  0 R ^P 0@/0p@-P`@T0M \ [ Rv    T0"k \ ` ``R```0000000000 0#0 0#0000`0`000T ^pp@N ``P`  T2 0V0pp@:R /o"!T0#00#00!0 0PT 00pQ  T \0 !G-p`sP" Q@`@P`pWQ@Jd X 0Paao0ODopG00wX@Z_TaXa\a 000 D.@-,@@0@P0S@gA-P@`刀@_}`(p0@QQn0OoZO00TX`TQXQ\Q, ,0( 0  脪 80p@-05S P.oP0SZ sX@ 0CR\op@T P [P@ oXafa`/p@-@P $P:uP 6u$4uP 0up@-u0 0 $ , Mp@-PP@ T $0! 0p@/L L0L 0 T, ,0, 0 D  p@-@PM$ $` P0.tP P pp(S00S 3/Ѝp003/( (0( 0( ZO @ 4 C-DM$`0SP 0(p0 0@0$2 ^PP 0 (0W,00S 3/DЍ ΍,0 0 (3/ @PP A-PPM@) T2 0S Ѝ$` 0P kt00 @5pP gЍ00'pL L0L H0< T0 000 ,0< H  O-ph"yM``2 0(010r0 PP~ r@Po 2 [m20 RF Tm!1 $@  0 4008L0  00 0. $(p,`x PQ 80 03/``rP"  !0 0 1 303yߍ         PqsP ssPPpsP``Ppz"4p<X8T l P00/4_ 0p@- VM0PP0T10zp! 0P1`@၌ れ0P`` S 0#< ,0 0 T1 30VߍpYz3렳^p@-PP`M`@& T. cPЍp gP !cP cP |0000 PL0L L0 GT000 00 HD O-(,p`@(cPP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW qP@@p Pr00P WP G-`R p@P8/PPV @!1 G-@Q0MP`000S UI U 0P.00!1 0 0 30]Ѝ 0p  )0P00S000 勋PP 0 個PP w0SPUp$0T  tPp0p  P0p  apP  0P@00 0FP+yȯ~/ B/0  Q B  /0S %0C 3 0% %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 P P Pp/0S :p@-0C@0 P P Pp/0S P@-@b" M0Cb! 0 C 00 0Ѝ/0S/p@-0C PM @`0* 0b"!4Pb4#0 PЍp0$00$00  /00p@-PP@ T" ndP 0S S pp@adqbP p@kbD0D D0 T(0( (0  L $ p@-PP@ T 6dPp >p@dH H0H 0 X, ,0, 0 W L  p@-PP@' T Pp dP 0S S bP p@bp\ \0\ 0( xc@ @0@ 0( wY0p@/  p@-@PP U  p@ dL L0L 0< g9U, ,0, 0< h. x L 0@-PP M@ T# aP Ѝ0cP 0Sp00 dP P0P 0L T0 000 0L ꠓ$ ` p@-PP@! T*  0Q  psaP [cP iaP daP p@^aL L0L 0\ T, ,0, 0\  X @-PP M@= TF  R R  `V V  0 ` Ѝ00 Ѝ0 Ѝ`V00 Ѝ 0 Ѝ`V | v0FS73.*& 0  Ѝ 0 0l I^Tp0p0l 0Q R Rl `G 00 00 0000 0 ` x d %  @-t/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`' V/ T ^ 0S^  S 0RR00Ap@@TppD0D D0 :V(0( (0 ;L ( C-@!P1 0MP`030A TI A< ZPJ Y` P t!l1 0 3 30Rߍ(3@/0SA S3 p !0  0S 0%  00 0 fT0 0 \ p0  00Sp;P 00Sul`  l  O-IM4M@PJ p`$ PI=,0 0S S  pH@$I= ,0 2 Iݍ4Ѝ RJ- RW# " "  J= 00岰p +4# 4J8#8  - ,J=00PnJ=  050SO S UVZ J= 00p,$3 00$00':00J0 40UP @'0Sn0S  0S0s S0S J= UV 0 ( J= 00piY\ O < }YPa P m 2b"!4b4#"R<J= VU 0 p[pYpU<0J8 8J- 0%$ 01Pj J=00P00J= 0⦵0lS Sm#< iJ͍ 0 opp p 00SSL2Sp S SJ= 00Y0  XP pJ͍ GPpt ПL x ԟ O-`$@4 0MQ@pDH 00020P0CS,w6)('&%$#"! : QWX00 R04 0S SQq#3 0 0 30Ѝ30030H 0 D@pЍOgWX= "44 X#8#8 pP'T%0SR0S # $$("(4 "8#8 DPT QWX00VTDpVT 00" 0  X* ᥴP00Sz "0 T@@? 00y!D tPTp!0 giT 1i #vQ\倡們P0P p0X! 0 JP030#?W@D p0W0 0 7P030#?@D0Q0 0ĠĐ P0 pUp@D 0m   P030#? \   P@p6 P PV P&VO 0@S008#<tx'4'< 110  0 'xP 0 0 1 30%Iߍ [: Je Z"448#8WX 0S kP 0 0r 0@- M@P M0 o 0P  Ѝ0 Ѝ0p@-MP`P@@P@T 0S  R0S PP@PЍpPPЍpp@-@P PuX%Xp0 0 @괍 0. AAS0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0Rd10@- $M#B 0( A S0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S.  R  R R R0 S 0/0S S S S S00@-/ 0  00S S00/ 000S00/00@-@P M 0S PP 0PG@0S0S 0S  Ѝ0$0$ $0 nt , p@-PP`@ V T! 0pPpx x0x t0 PV\ \0\ X0 ET@ @0@ <0 :ꤾ D  x $ L O-P-M@"4M8 pP,0 0 0$02,0:10`0(000  ```   P:1000, 0 P@ 2] 1#X 01  8 P 0 00 000 08 P S` 00D48,013؍4Ѝ !448#8S 0 0PU 0S $0S! S S #`0 0 0$0t t0t p0 ao`0 0 `0 0`$0 0 h @t`  Է A-p,!`(1 0AM@PP0 40/ U 0 P P@,  0 0 4 30%Aލ0SP @0.Sp @@0 rT T0T P( 0_ 0 oД ܶ ܹ P A-@TT!0 MS  8 S* `V" pP Q 0S @ T S   0S QRp`Vx p0 0 0 30 ЍL0 0 0!  4o먇Ć@-PPM@p`- T Q Q Ѝ0SS P#P68#<8#8W R) R'  p0S  Ѝ 0 < 0q00S SP0 P 0  ,( Գ IJ G-`QPp W$  f@P   P  P!NL L0L H0H &W0 000 ,0H  ܲ p е \ D QO-@-HH*M 0 2 30ߍ0 00 RS0$0S0$0000 `P$ >0@>$0y?40>000=(080` ,@`V;6 f2 F:20V00S   S  R  RQ P  \PS`Q/o" RP\0Sa 0  `PQ| ,0 0Su Q0S %70P@0 ]PDp @  B0 ~0P<0R`VO @0z H@L@p@`V= 0SY 0S 0St S 00S PP0 0>P R R RP0S0S;0Sv`V: 6q`P@H@LzD`<0S``V`V2|0S0S? `4p*p: 0 h*0 @Y4 T*p$@$, `80< W 0 g372 G:2Z 0SW 0R P RSMQ Q D \Q^=SR^0QPp 0 p8`P`&0 000804 e?0$00PYb@P񏐔(8 r/0>0S YpW|V`Y p(K [ 020 P @ 0@TPU ^0P0 hX0`}o\0:  0@@X@ 宦PP_|0S 0S _  |0`0  (yP$w0 P R ,00S S00X  `P 0 0P<0`a0S `,`00}pW0 ,`` <0 0 }P}pW 0S S00S`P[ Y`` 00S 0p<`004 8n` <0`P <0 0A0P<0 <`` \ ^ $5 00V Q  P \ ^  Rb R t ] p`Y `V/ 娄  0vP@  AA a< `V Q  ?Q44 0  0` @@P ? `00 D^z`\P  0 @@圥P`H`YP\P HIH H\0 V@0\* ^@3z0:0$P|` P@z X`@p `n9ĐY0|0D Y0F00 000 0 ẉ: ؐq wP vP4D0T  T0wP00D) +| 0T S R SL 0 S 0CBR 003 Sኡ*0 S:0SU ]v@$P41 0 6z0"|0R00<^XP @0T 0@2^@0T@+^|00`` D0ml,X | H V XT np Xh  PuN0 @ c{ Ii f. W >j4 gwP1x00x0 ]d<`X@0T00\0@]PO-PLM_ Zh  &백a `@  PP00 Q0PE pp R R R0 T@A0Pp ((0(  P00 U pWpW 00  pW0S 00SU$@LЍTT T0T P0/Z8 808 40/j j , h t i G-XM`@t{P pP @00   0~{P 40S0- XЍ QP $]  0a{P ]8<8 0P 4PPT 0 D ȉ O-`Q-MV0: A0hV@Hp` 70V@@p`F AH H0H 0 , ,0, 0 H{ 8{ z { M z $!$1 p@-PP0M@0 00( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@U` `0` 0 zT@ @0@ 0 o^`Fz E z L y y L y G-M\\Ÿ T2T"0 `00  p6 0R P  0XS PP@-$M@ | |P|0p  P  @p @X@`V $Ѝ x> PP1 @- 0M`!000Jop P@ Z  kop m@ 0 0 0 30(ЍmP@pW @@T PU 0SoP@[TVh0@0\=il=p@-@P0U(0PU(P,PU 0p0PP 0P 00 0p`00[P 00 0pq L Pq   / 0@-@ 0 0 0 0 0 j 0 0 00@-P M @0`U 00P 0 C?o2 c0 Ѝ05 00 0 0p@-@P0 0U0 0pp@-@P2U0PP.U(0P+U(P,PpG-P0P] `ೝPV 0@00 S S0 S S x࢝pPE 00? pY(",48#80: ,卝@P q0p00S S S@ 0A S  Au0@P 0S 00 00SP  SP^0@|Y@G 8o XG 8G O-P Mp@,0(Sz: E(T^  =0 T0U 00SQ 0 RK@D@T0`F 00SB000 @D@DS `+ T0W  0!0J@0`H 00S#0AS00  0S000  0S& p0@4T0pp0T(0p-T(p,p@ ЍFSP  (,@(}0  Ѝ0 00@- M@P  0s P  Ѝ0 0$  0$0 P Ѝ0.p 0$0$ . Ѝ0O-0PLM 0F E`@ @$0 ``0x0PR$0rQpPM 0 ``iPB$PPU @0`Q QB QR Q0 0U 00S| CQbP  `0 @0p R  R/ RY R 0 @UpqS 0J[J0 0 0LЍ   @QA@  0U` (⼐p 0  ,  p0p 04`W G   ``` @` `@U 0@ @SLЍ 0@@SLЍ `^ P@Q  QA@ PT ^ QP @  ,  0 p    S QARZ  R  P@ P@  A X% X XB p X2 T( QX X X0` ``  `D ` =  `Q@t0t t0 ]@   P@U`tRj 0e he 4e @-@P @gR( (0( 0$ @[Rd d d /kO-P M<`pO``0@ p    $$[0`(0,`ĕ[`3,`XI0-0(ppP p QFpv&pUU`+ `U( PV%Y5X( 0XQ #((R8P P4PE2PE1PESPE`0h PEP:`4;P Ѝ 0 Q@ ЍX030#1!-05-0%0Y" #((R8P P4PE2PE1PESPE`0i PEP8`09P P4 :0 P0 80p@-Mip. @kp5 `0v0'0 @sPiu 'V Fs0Px  -P Ѝp"00jЍp|i 0 Ѝpsia A-'Qp@D P`sP0 A00` / @-\ ,@\ \ Q :\ :A 0  0 A-@$MPE P0( O4`6 6v:p`A6gL8'@87;p$2'6g37 L-A@\  \000 8L9>031  (0LЍ1x 0 0@-S@ 3/@PO- MP@X Qs 0`  @`f&AA! B B&"`F`F"f&AA! B B""`F`Fa&AAu! B L B \᧗" 0\ P3 L0 1 0T0p0`0`Ff&pGpGt'PEE!0F0C!6# G B("AA!0C0C1# B B%"AA!0  Ѝ QTr0`   J 0p Z K`f&pGpGt' B B&"`F`F"f&GA! B B""`F`Fa&AAu! B B0᧗"Z P Z Z 0\ 0X0 T00 p0`Z$Z5 Z1 Z3 0 p0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[`@p`G0|0x0t0l0h0dy7] d[ D[ @-@P  @M0 0 /A Z tZ ! 1 p@-`P00 01000C 11.Q   @@P0: S@P P p0 P 00C1 000APP 00LDLt$f ʚ;`e d4 `ğ0A- 0@P`@V @0`C0APP@`@ 0PP@`V PP`pV p0`C0qPPp`@ 0PP@`V  0`C0PP.S 0`00@000@ 0PP@E0C2S20/.-,+*)}'&%$o"! kf ]OK@2S2[0/.-,+*)O'&%$J"! I; /*)000 @ @  @0BdABdAdafAAFBdABdRnAA0000paP00` O 0PEQQaP00 E 0PEQ`P0兀ಀ00PE0 0` 54#0@- M@ 0$BÃ!l! A1!1@DL 1D0]PAD0@%! Ѝ0̔` QXT O--(FM@ ' M8 t d$ `!0PP006RPPU0@06K0P40 0 060: 6 0: 6P0: 60: X0,0h60< P0<0 0  `P0 ?oR20S 80`1  <0` 0` 0V T ST0P0S50:,0e?Ⲁn5`0x0 `VJ X,0p?Ⱀ]d50? X& Y80*wSPT,0? )R d4`0   FP,4 -40 e ᐄ40 [ p40 \Q T4 0 `H 0S@MP J0P40Z0 #3 0 d4 30Fލ Ѝo`: @ \0S 00SU80`1   1N@ R0#2 0 d4 304Fލ ЍOLX$弐,0!?0"( RYZ2DP0H@PJRIIY:`d 0!$4$(#"(R(. X R` R Z0 ᛙ1@ 000 .>,ZI0 I↙YDPH@ ꈡ0   xXh0 p 0 j<`L` _R Z0 ` LR0@ 000 .+ VM >RKYS0S S LT (T Dx (\ ,R LR (Q !Q dQ !0PPU R800 0Q`1S   ;`1S0 ൘0 0 PL0 0 P9P P P&0 0 P0 0 P0 0 uP0 0 iP0 0 ^P`1Sy40S{ < P p0pW  0R  0=QpW 0pW  0R| ,0*QpWg 0pWb  0R4 00QpWHpWE 0 PS 0 Q`1S   40 ` 0 `@0 `0 `,00 000J tЍ   40S _2P 0 001p0 001p0 001p0 wx1p0 ZT:LL PtЍ tЍ 0 /0 0 y 0 r0 k 0d0 ]x0 V,H\L DL ,L xJ 4J I I G dG 8G G F hG G |G \G L? ? > > > t> > l> > > 0@- MP O@P Ѝ0 0( 0P  Ѝ03 0@- MPl0l@0A>@0 @T U Ѝ0O,0@0 P Ѝ0\< ; Mp@-@ML ` 0 Q0PP@0<00 00. T @D #C000T H0 0 <0 30 @Ѝp@Ѝ/.0 T)3N h= O-PM`@P Pv 5 p 1 0 R ЍPv SPPP -\00 +\00 |3P0 0  R0N1011.\ 0 @T@ ➀( P 00 S #3@  PR Z 00 S # 3 #T$P+<0+80+40'<0'4 0(<'( 0(4 0((0P p 0S 0p X 0T00  0R00#3@0\SP   0R00#03 3TP ,0 T P00 S #3@ \RP 00 S # 3 #T 00P 000J00  0L   ;(O-pQ- \M0 R Č  $Ȍ (̌ 0,l8,#4 5 5 p@- M`GP`P@≨o0 v> 0 0    $  >PS Ѝp4 C-`@P@ MPpOP @U HP@ W @ Ѝ @P@p0 0000 P(#0S0Y@OoB@#41 4 C-`@P@ MPpx@P @U `HP@ W @ Ѝ _@P@p0 0000 P"0S0Y@OoB@#9 2 p@-@P00CS0 S  P 0` Pyp1K`00CS 0 S R 0/K0@-M@u0 0F00 !R !LPDЍ0@-:  0S0@0Q R  004S 0@"l@0QR Q  R Q Lp@-@@P@0P`0pp 00,p@X0 L D D0 p@-@`P0pp0,p@tLHH0 A-@pP0`p0 A LC-P0 M0`ppp@ HD@ <80  @Ѝ ;LxC-Pp0  M0`pFp@ (0  @ Ѝ :L0 0 /L0 0 /xL0 0XLXA-pP0 M0@P` p 0 pЍ0L 0 0_L|@- tM pP0 `p@ ( 0  @Ѝ:LC-Px0 M0`pp@ 400  r@Ѝ d: L8@- @  M0 ЍLH0H 0p@-@0pP p@=:pPL0   0L R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp M@` q0T 0C0 ЍL0L 0p0<0<0 7/0S 0 2 2 O- Mqp@P`P'X0*00T+:Y@M XX  T+  ᄧp0 @\  P0 P0p00000 Ѝ0 Pp Ѝ0 vPpDWXW X0X XX0  Ѝ0 ]Pp@ l2 l2  d1 3 ,1 O-M8P 000<0 :/=00- 0C0H;0H;` qx0 0x=<;:9876543210/.-,+*)('&%$#"!      "  0 P_*R 0S .Su 0Sr 0So00S.Sbj7YD =400S 0'0C  ($: B \P5D0SzH@  0D;pD+00S t`【0`Sp 0S @0D+@T 0Y4  0d W 0 xPX&= 40 2 ݍ<Ѝ诽800P04 0 [P`0 0P:)=400D SR6d D;0D;50 0 8P ($: B PH+,B0?Q0SH%H5H 0<T ~H ,0@$寽800P0 0  P D;0B$ 4Q7040d  0 PwD; Sw*4 00 B$0#8 (0$00(0D+00pCW``W ,p@D+ I= V@pI  0 PAWʸ 0 P70 0P/|3 000W#80X3 D0N 0C0 .  . 00CS W0A 0 zPD;`0DkV:H+,B0?R0S"2 0T H ,0@`D  0 PD;D"0F ID;4b0`d 00 0 ?PD+0D  d  0 .PD D 350D+ D+d  0 PD+0D;`Vn LqpD;`V0D;n 0d 00 0 P0($p`C : Pw 0 Po 0  PfD, + + , & po T> % & % $ %$ $$ @$ 4% $ $ u # # " ! E@! ! x!  p h L h *4       P       ` p VUUU  p d   p   t    T $ <  =400SD 4D; D+D `40 D;0D;1d 0 `I 0 jPP:D u4D;la0D;`d 00 0 QPD `4D;0D;0d  0 >PD E4d D;0D; 20  0 +P ($: B PD `l2 A Pp$ PZ  `/X0 0 FP0H0GWZ ᬿ 0 P=400S=D 3D+,3DD 0d  0 PcD `3 A pPW W  `/Z 0 0 FPG0J 0GW f 0 P9dp`D D  PD :Wu 0 P%+YD  =400SD;d0`d 00d 0 P D0D d S 0 tPD;p0SD;>* e`D;0SD;6*0d 007 0 XP=400D SFY3d D;0D;50 0 ?P0($p`C : P@006d 0 0  P=400DS 0h&0C  D X6B!?C0 Sc 0 P=400D S0&0C D  0 #PvD;x 0H+D;`D &᏾ 0 PbD; D+  D `2t7*D;媠0D;7Z 0 PD ($: B bP; 0 P3D 2D;h0D;`d 0v 0 PD 2D;0D;0d c 0 P D 2D;`D 2D;pD 2d D;0D;80EDD s2`D D n2D+9D ``0( 0 0 QP D d9B!?C0 S  0 ?P=400DSw 009d 0 0 )PDYdD:  1R\p `` ````=00H+\&H ᵽ=00Pp T: 0``:`0 6/=0H00C0D; YH+D 0S#  0 Pb=400SD;x R5wl-4 Rk hk0`d 00 0 P?D+0D  d 0 P.D0D d u 0 PD;D 0SSgy:=400SD 1D;`D 1``2 D;0D;<0K 0 lPpD  0 P D;l`D  0 WP 0D  0P D+0D; 0EPD  0 rPv D; D   02P ($: B P=400DSL 0-0C =`D 440\  0  P0($p`C :  Pt 0 P:  Pw 0 PoD 00CS . =400DS0/0C  ($: B zPS4 0 PKD D 0D;D 0D H[D 0 28D;Hk0D;W=00PP?  0`0?0 6/=0Hk0 0CH+0^ ($: B 2P D; pBqWN4` `WF D;1 Z2  0d A 0 bP-4 R 0B+ P-4 R=00H+$H{=00P` 0<@ 00p00,;0 7/=0H{0D -p0C H{D 0 R:B!?C0 S 0 P=00H+\$H{ᵻ=00P` 8;X 08p00D:0 7/=0H{0D -p0C H{D 0 0 PgD  ($: B P[9 000#80- D;0Bt) 0h)0C  D;0BP)  D;0B<) 00Q0D:H+@v 0 P$3Yk  0 PD;`DkpWE 崨 GQk D0 10"3h( 00;D0==0;D020!200;D000300;D0<=0;D010 0;D=0;D 0 JPDk`Dk0S70: 0D;D+00S2 p〠0pS) 0S `D+`V 0Z6 :d  0 P D0 10"3& 00;D0==0;D020!200;D000 0;D=0;D;D;D D0 10"3<& 00;D0==0;D020 0;D=0;D;D;D;D D0%10 00;D=0;D;D;D;D;D;DqD  0 P@YD 0S  0 P4D; 0BD% ` SpPWWm  `/X0 0 FP0H0GW 4 0 P` -pPoWaWG  `/X0 0 FhP0H0GWA  0 [P0$0C N].`D D X.D;pD S.`2 D;0D;30 0 7P3d 0` 0 (P0S LsD;p`0`SD;0D;~ 0d 00 0  P0"0C =00H+O"H{ᨹ=00P` 30p00|20 7/=0H{0-0C0 D+H2` 0HkD+d 0 PTD; 0SD;.*!葟 * ` D+p@J Z 0 P7 0d ` 0 P)J`p@ D;S:4 0 P`=00H+!Hk2=00PP01  0`000 0B  hV \ h T VUUUd p \ h$  d T Q     l  T     < (    @U ` T   | t  l  x d < x l  ( < $ X d 0 (  D < ( h 8 p "-pD;p0D; 0`P1d 0` 0 `P|0 *Pt` 0 PlD ,D; 0D; 0`P_=H 0`PW=00V 10p0020 7/=00-0C0H; 0H;0 P3X 0 P+D ,D; 0D; 0`P=H 0a`P=00V 20p0020 7/=00-0C0H; 0H;0 PP 0 bPD q,D; 0D; 0`TP=H 0`P=00V 30p0030 7/=00-0C0H; 0H;0 ePH 0  PD /,D; 0D; 0`P=H 0`P=00V 40p0040 7/=00-0C0H;0 H; 0 Pm0 Pe\ 0 P\=00H+ Hkx=00PP15  0`050 0 P9 0B& +d D;0D;(60z 0 P!P 0 P` D  0 <P 0 P 0v`CD;p 0D; wP($: PD; R 0 cP3` pPD;WW( L `/X0 0 FIP0H0GW  0 <PW 0 1P70d  0  #PW  0 P@ 0 P\  D;0Bt( 0`0DkV:0(0C  D;0B(  0 Prؘ W 0 Pc  0 P[( 5 D;0B@) H  0 PId Wx  0 P:  0 P2 QWu  0 Pm#}: 0B)  D D 0D DD DDD]PDkpW`Dk@- @ MR,A L  0(; Ĝ0 Ѝ M- (040 1 2Ѝ/]A-PSp0`@ @V X:0@4#DDH$H@PU ])PP(00TPD0?T0S,0, ,0 lQPP G-0`VA::0P @4#$4T00 0 p4#4 0@T#0T4#400S0 XT0 $( ,0 P@@"( 0 QA-Mp$0PS@` 0(010$,0v(`V0S}(0S! 0, $P(0, V3100(Pq,0 \, l0U4#4 00,004#40,(0T0PT(0 SF0P$00Q (0, Ѝ0F P=, (` , Q7:048 BC, L0L L0 ?-404 40 >$ꔡ l H A-p`@LWP, T @00V 0Px0PV0*G.`\` ^0070.200p 0 S037#0W0 \00( (0(  0gܻh P ( /o/ܩ///x@-DM` @ 0p0 < 2 '0 RP *00P@0P< 00 0 <0 30DЍ5뀞 O-M0 0(r娂)Pᩒ B'r0 i C0pqB!aP C@$Ah!d`@@C34*T<WDYLX @00 SP*Z R 00L0 @   00 R 0P0@P0S, Ѝ0 W lP0 DbPW 0 HXPY 0 M MPX  D0D D0 e @Ѝ艈%I$: L@( d < A-`pP;0S.@ T$ 0D0 .R T  S\R C @D.R @0. 0T  S\R  @@ؼ( 0 0@-M0 M 0 P @080P Ah Pg0o8 ,0 0 8 30ލ Ѝ0 4T0-@- M0@R0  ṓPP * Ѝ@Ѝ/ |+ Ѝ@Ѝ/3PR0@- M P@*PTP0 ? Ѝ0@EAg00 Ѝ0PR0@- M P@]P-P0 ? Ѝ0@E@00 Ѝ00@-@Q M P8PP0 ? Ѝ0@E00 Ѝ0p@-P@EP  p@ p@p@-@P 0P   L  S P   p 0 pQP@- 0R R  ػ 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  xP  T@T @pjP ꉻ 0 pp@-PP @XP m T 80,D0S p 0 p T@pp@-@PTp (0":k0cSp: A pO-0-tM@@0P+f`pr60S @P000<@-X-+*)('&%$ w 0 00X00 00H Se 0Q00NQ0N < 0H ^PU   PEUIP  <@<+^B -^P P <0PN UP<@20^ :QgkR࠱ࠣ @E Rk@ڐ g{[{{R EP^ EPN%b @EPBP E ʓ <@[<00tЍ00XS <0X Xz 00Q005Xi^O I^L N^ @Q`P9 0  040Sy P<{ J{@ Y L 30jS*k&0B:HX 3L RH0s { 7 @JHFDPP   ! # \T⡰P@ ʮ@P T\Q0 0C AŸ 0AR Q6`v $   z (0 @P @屮P, @ ,(0@wPP XwyPPrP/ m< XL H0S46Szl{  ^l{MJNO{^! B"$ :co{@ 7 XL O{O{ Qt1h Z@ 0Y0jZ0S k6 C AH{{{*10 SYb{H0$&{0G?CVZ@0堭ឭᜭᚭᘭ kkf{G + 40S:0:G{G#0hI0 00<0X d0 0?A?|0^ Pg < 0^ 1 NR _0 N<  10MPaMP P {p`@k`@{'PV{LA5@Lk@{{'P{FDP q`5排d́L CL{:S03:XOO{O{ QO<:fH0xH@Hz 0HS 00jS#:k0c3Qd0Rq00 H0|006L066C#::L00H0/0{@ 7@  &p ?P9@  0 0 ~A-@`V pP0S @ 2-P 0S V@Ep@-P@PP0 S :pSS00 0R:ppp808 80 eF$0$ $0 f> | \ A-P`L@IT,EP: AP- pPW 0P P B $$P W 0 P d d0d 0 CL L0L 0 E4 404 0 DP ,  p  L 00 in@-@PDQG-^8 pP@`  00+00CS&OC#<!  5\U0 S\p RXV``W`Q`VP\\T0 S@\` Q@-0-rw0-0-0x0菴 0 艴 0 0S wS -S rS  0S /xS /  @-P@20 0Z 0 P P//0S/ S S/0S/0S/@-@n0@0T S R RT/ ?/PP/ ?PQ/?SQ $0$ $0 p@-Ʊ/᰿ ȿ  ??SS $0$ $0 p@-鲱/` x P P P`/AP/Q/Q Q/?0 H0H H0 p@-錱Q/?S0?/0?/Ⱦ  QP   ?0/@-齳 0 p@- !@P `P``害 PS姳0Sp衳0P#뜳@Ppp@-@PM` P0ES  aЍp 关 P*~0S   0 0 ZQx x p@-@PpP Q 0S P#0PS#p@#A-@Pp X P@PEX `<@P`( (0( 0 `긼 O- Mp W" @`IW    @PP0SW G!pG0p1 ЍP Ѝ  T#p \  t 010/C. *      RA-P(M`p |@ 0 @0@0 P0 0P+ P@ 0 (Ѝ  d00 5CS A/0cS#:*'R A/0CS!230 A/p@-PP@ T Pp S 0\\0 0NpD0D D0 LGT(0( (0 M= ܹ  t O-PM`pv 0FV"S00 0^ Pᕫ@P-UP +UP0B 㨬p/"\,@P00E QPa0ESWPEA0ES7PEVT\00U00S @ 0T00S0S T ЍSl 0J00U# V p `0P 0 0R0 0  Ѝ0 0 ?㰯00XS00C QPr ` AAQVr `ꙙ e e 0 0 0UmRO-PMp 0GW"S`@P-TP +T@`0f0TV Wb Xp pb 0 0   @Pp P Y Q P  S  RP !R  00B ^a0BSW0BA0BSK70BUH| X[ : Q P  S  R1 ! 00XS00 C RO A BRKWP ?0X  0㹪0b 0 0Ც "00"00 0S \0F0 Ѝ@`e 0R0 0 ЍH0H H0 ?㽮9@0` p0p p@a  ȳ 0 0 08j r  Q0?0S @-(-- M ЍЍ/G-PP`] Ve ᨢ00PE! R !@T3Up U< P, P@@D @ၯ00獢  0S0mPU00v o6P)@@D0 @0TP0 @0 0[`0` `0 B#VD0D D0 C XA 0@X CR00SHdX000X003/P Xy 0,(@C 0D0iP 0, PX0 L%g 00ܪ04!00038!r0YX}X0P  ApPX0 #  TW40S0X@@PG@X@8p @,< T%/D ,0 1Q * 0X@@ 0XP- " 0,(@C 0D0 P 0 0,`__d P  ̢ d d A-@PMPG 0 Sp07 S20 0oPPD v`P? 80 0PBP&`   00PlU Ѝ 00S S Ѝ0 0T< <0< 80| z 0  X G-@#3 0BMPP040 0 000S. SA~ ` @ p0v #0G P @T *Xdd" bX2P 0  @"(2 0 4 30Bލ 0    ! @PR ԪpPM 8 0 0@aPKp 000 0000 0 0d`VB 0 @ @IP* ᖩ00S 0  0@T2   0 0᧪ 0  0 0 Wf 0  ፪ 0  ᆪ 00S{ Sw{!dSd  Rx ̚ O-PP-M` 0Z0 Z`\0 0(;pP 40:40: `c`P @  " 0P@ S0S S#X`@T 0@ G T : @D0S X@Dpn P qPXp@D` R <0 0` ۩00ߍ S S0 S S bPP 0  0C?o02P@  0嵤 0P !W o*@SU @ 0` P 0 S S S` Sc W :* p`b`P @0S |0 0Q ᯜ T: 0C@DPwZp( Ip @DQZP ᓜpW y(pG P' P 0  0/  0 0h(  pG PW 0p 0  P" `SGE] ] { , ^p@-@x!x1 0PMPP0L00J X`0@S0  .0  P* T* 0 0 , 07P H 0  0 0 L0 30PЍp`7Pt @*T@ @0@ <0 ০& K4\ [J ؔ ` @-PPM@; a `p@T+ W 0 0 ϛ 0;7P  0  Ѝ >@T Ѝ 6P @ , ,0, (0 PZdy x |  G-M0`pn@P0P0 V 0   0 pPmЍ 0  PP 0   0ꔒ hM ȑ A-M`pP8@P ,  ( 0  P @<Ѝ, 00ЍC-P$MHpP@`W TU00SD 0S 0S0sB S 04=@P((1@D!0 @P 0`p;P00$ЍT T' ɧ/ 0 0$Ѝ0S  0 0$Ѝ0S00 @P8 808 4 009( @Fv \ J O-`P-@D`B Z @ 5 `FS  0  0 `F< V :  D`F@[v Gp p   `FAY @A [pA? 0P 0|!h1 0 40 30N<Ѝ(J@D P @pGPBӦ0P6    ڦ Kpp 00 0 P 000 0 0000卦0P0ppP\ER R Q B@-M@ 80 00ɠ ZЍQQ@-M@ ((  9ЍXQpQ@-M@P p]`P0@0 ) <0< 0  0 p@\ЍPQ0@- MPP@T x 0 00 000P T 9 ~@ Ѝ0x@T 00PPtPC-@PaM`PD UL 10`00 p 0^# 00 0 N R`0100 N.^3W @ 0 Ѝ R0XS 00 9^03 @ 0 0 m㘣U0 0 n㎣^ pG W Q( ,$U0 \ c#!$c4" 0厤@0(? R Q X O-P#3 0,M@Q`0$00y U V V g/ 0 XP# $ 2 ,Ѝ,# 3 0 $0 30,ЍOBT U 0p:Q000 0l 0Q  b` `$0 P P @`p0 zP C [00@20Y[ P  $0Y:`0  "Xq V0F S0 sbS 0!1 04 IТU|!1 04 JŢr =zP :Y2[ X:Q0 @ R 0 Q:! 0 0@ g 0 0@ [.Y P @0$` VzPt Vr`$<<t< N ` d N 4 N l x M D @-P!1 0,M@P`0$00 V(  00  0 p {P"* \ 0 0 $0 30,Ѝp0p p0 h,VT0T T0 i"; 0 9Є |8\L x @ @L P  O-tMp$ 0l4 Q0@0l00 X T T / 0 $4 0 l0 30tЍ#3 0 l0 30 tЍOy0S X p ᤢ0C01T0@ 2p PLT0`  0r 0S P r v \P  0S` r v00 Z0S  Z00``0"<0 @j0T? P UX*:0VT09 K0 zYPJ@Tp 0V00S 0SV:0@0Tpv `V0 S,*: 0 S&* 0CR00:[JPZ Z Z000!S0 K P v80S ? 0 ( 0 0HX 0 0I v00x  p| |0| 0 "` `0` 0 p7X7,7 ( H   G   G |  pG T O-@PȥM Pp- 500SL ([] U U U ݢ 0 `Ѝ0` Rz ( ?0[& + `P&P 0;/qp 00P @ P 00 0 00㳔ЍVp  a,0P  * R + L UZ p  0K,P 00 0SM0  00 0;/qp 0 0`PŸQ <`V:X0`v R0ޒ0ႋ0 x0P ;/qp0` o 00 0`VŸS <`VpX0PZKS 00Si 0 <`Ÿ8 6 B`V Z 0#00SYL`0`f? ` ;/qp@ 00  P  @ P Q00 0Z 00 'P)0 S&: `F v Z1!0 ྟ0 0C0`ЍP`T 0S  0C`ß1!0 G㞟0 0Z0 0 AJ `J`P @0P 0000 00᪓`ᥓ`X0X X0 m0ꅡ 024${ <{ z ) z `z y y y p@-`P@P T U @DV0 TU p`0` `0 I@U@p808 80 H3V0Hz py Dy Q !211!A1A!0 A]P㙳p X$0`0@\k0X0`@X0 @@ ! 1  0 +E@(00 Ѝ010 R00P[ 0k 3 ""p+"k +xp 0@00S*.00!X Y 4W dW V V Q$U \T tT  ElP @Qa :lP @Q㈀ /lP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] lPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $ $ 0 ]R& PR " YXuP   Z J b" R Z A @Rg .RP`@M0@,Ѝ P` 0D0C  [4:>( 0 ,Ѝ7 0 ,ЍP   0  Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYyS S 0G-pXaQ`M*0 S) \E 0P0S? @S2 0W:U  @000@А@@ P 0S00@BT00Q0Sp p0p l0.lAU0SPQP!P0Wz@(00H @(N M xM O-`VP3P# M0 VP3U0p\ @W @RH R R4 O(00 ЍW@ Ġ[? A @ GRPR@\ 40S @[0V0A[0S 0 0-  Y*@T*0P0 A\ Rɑ!" 40S 4 00|L L K - M| ЍO-`S,M@ [ ` 0 `S 0S0\0{ @\e ^vQp`0030Y?$03 `0 00[0000PUX P0S @S^  0 XL*@࣓U pP0U00S 0 Sh*`^` ^ F Y[ R0P Z PC ~(00P0S 0CQ * 0G S0S 0 p  0AQ 0"zQP1 ^0[ ` 00R@(00,ЍAUz0S ! " 0S@>4?<00 R^ 0 S)000R0 ABQ AAX QS R0S0[0Y0S< Y 0R `? 0)$ @C /P R 0 0U/ё@00,Ѝ @H0?X0S` `0` \0U/ⵑ << 0$ ૑HJ J G |G G JLG G F jpF p@-P0 0M0 10 `00:p !@Op < 40 0 1 30ލp@ A-P `0 0M 0 10@0 (q|p 0 p0 (0 0 1 30ލ @ Q:/R/0S/S:00/@-\@3$* 0^ @R R R E( 0 0S0QA^ R! Q 0Q" 0 ARL @-  RQ0A  RL   0 C( 0 /C/G-@0pTS* W XTP@0TS P`  ג 0 ђ( 0 0QSp@-`P@ xP`VP@  0R p/pA-APUQU@A`pPWڀ1AP荒( 0 臒 0 ? 0 Q" A@-SRB 0@S Ab 0 \( 0 /-- M- ЍЍ/@-M@ p TЍR/0-S0 \S  R 00O-P M@P 0DT"S} ` iP-Y_ +Y~ Q0Ya T @Q X`pa[PN`pQP" [-SQ& K0I P0aIQW0IAIQ70IS| V[SQ;+ 꺑0S \0J0 Ѝ Q0YXP(0@ \ @ꖑ 0R0 0 ЍQ~ 808 80 ?`_ AL\T@o\? T6 0 0 0I FA-`$! 1 0rMPPp010* V2 @X0^00pAtA0O00 TAXA\A PP l0 @t0 0 1 30rߍX0X X0 F V<0< <0 G  @> >  > = 0 -0 X  -- M0 0 ЍЍ/-0 -M( 00 Ѝ Ѝ/ O-@SMd 0YSi 00pS000!R !5  HPP E`#3?`<0P*Q30A !!!! - P? 0 ৏0 A U pQP 0@pQ 00S  Ѝ腐T 0 @00Ѝ@0@ @0 @Zs 0 0; ; p@-@MP` h 0pPiЍp0 0{\ TH90 0p@-00St@@@pdPddP@P8@P 0000 08 t98@@-M@ Ѝ@A-Pp`t@t@l0@ LU  w<0 >M  A8L  l @-@;P0S  3/000S@|A-P p@` F  Pe000 6@P p@-@P嫊Ppp@X!1@- BMM0P@040PPPPP#10PT t!`D0S d!p0 Pf P@A0@ P> 10 H!0 0 4 302BލЍጏP PP  5/P Q Q 0 0Hx0 00P n0 0 i PT t 7 (60 `7 \LO-MqQpP A@pf a@0` RD0 0]/k1PI 0SP p Z [ @@P P0[KpP F0PU :Y =`P`PS@P TP 0@U:W '@0@00NNQ|00p@@VЍPPЍ<00 Gd6 4X3L3 3 0@-@P$MP U" 0 P' 00 0 P $Ѝ0`0` ``0 YUH0H HH0 OL2t3 4 3 ~4 3 A-@PMU  RN h10d0SB P1PqPa0p`P0 #)/0PS-00允000S 000000 000 00 l ЍASP00H H0H D0 ܋ht3 k d3 3 2 2 2 2 X" 2 1 1 G-P9 0S@P$0 @S 0pP`P0S PU @@P 0U00 Hc`@ 0@ P` 0 000 ,0 ⇋`/.1 0 0 O-RDdM 0刐P@ 0S Y 0S X4000SDd`0S00 ,000$4 0 0  0P W003܃0 03U0@0 Q  Q P0S/ 3/0 0)@T&0U00L0 0 L00_PK 0SH 0<00@00 0<0OP; 0 S@T@RP-00S," 00C0T@dЍdB@@@,P20\} , 00SX  R2$ 0 @ $(0e@z$0S( @ ( 0p00SpR p1S `b!1 0( &㡊0S-l!l1l h0( ╊Y @dЍ@!@1@ <0( ↊@dЍqP 0@0C00$ 0 @ $(0)^P @"$0S( @ ( 0@c$  $(0\ t . --H,ĉ,l+(- - - - - , a|- X- , bh*ȇp@-@P`P` U 0 D0Pp000\ LpL0L L0 AU000 00 B L @, + + + D0@-00@S $000S 3/((p@-TP@Tp 0 3/P N@Tpp0A-0`pP@P UP ᠌, q0p `@'G-P p@+ T?o20SZ `v% :/@DP p@@TPh0h h0 G㊉ZL0L L0 H〉404 40 Fw4* \* * (* 4* ) ) * ) A-PP`@! ppT P `L2 @0L€00#S €^"R808 80 > T&(&8) t) @) %p@-@R`P  p@ 0  0 ) ( ( p@-@RP`  p@ 0  0 ( ( h( O-`Q MP倱xP2 LB0/p P2T- P R; S P@T" V0S !Q L/`3/L2 S1P2S?T030# T03S 0 p0p@T@@P20CP2rP2SW p&W ЍS @  L3/L2 S @$$$$ $#\# &0 0p@-@PX|`00CS`0p S  P X0` X PX|pX^` X X0 `00CS `0p S R X0X/X@4 -40- M,0  XMr ЍЍ/ <- -M, 00 XRrЍ Ѝ/ G-@SPpd XW30#03W00S62 U` <|0` V V0* (0J0P0/PU` `PP`%PF0`VPC0 00 | (S 0T @0 0 0 0S Z0 0 χ0 0C  0{ 0 0 =㻇h0h h0 Q㲇IA{ I9$ $ # |# # x# h# --M  qЍ Ѝ/ -- M0 0q ЍЍ/@-PP$aM`@) pP y@P 0P1 S*00p@$ 0,0 0 ( 0 0Ѝ@Ѝ0 0 >L 0}Ѝ[0000@Ѝ 0@ " L" (" p@-@P L{P%SPP{p0 0 ;! ! p@-@QPJ 00!R ! 00! 0S P A0Q0R0S`' 0S 00C000P0S 0 U00SpxP#0drP `^rP  `0` ` W0Ɇ  A<0< <0 <ཆֈ 0`0) * ) ) ) -0WM00 04@.0T10㽇  T 0       剈wz4 ) g@-( @-( @- RC/A 0\R#R! R/p@-`P@ T 0FP R }@P  q00pT P808 80 ?DP0P) p) - M ЍP/L -2M")2b3c1@2`1  0ЍC0@-@PMP 0 00 0 P*?p`Ѝ00 0 ;( p( 0p@-@Q r  P p0 S 1P p|PP   ! |@0O-M` p[ A Q P*5[$ 80Sy SP  @P Rs Q)Q0<0  嬇" $W `W `|Ѝ @yTQDQD@ Q A[ <0 P   C <0`0 <0 QCW   `V0BSTQ; "!` bz <0 V 7T P a}PPl3 j P!| P T@@W   2  ` 0  0@ ` P !R/0S 0C0/ 0RA-@P)p`B @1S@  C BS   3`ࡅ0 pg3wp1V@ * C BQ   ፅb{{PPO-p-tM0<0@0 : y0\0h00dp` -R-+*)('&%$  C8000R 00B S 00$00lP@T0PA T00Bd @0B Q\;  EPJ dpd+QS -Q,,d0A P0Qdd0Q 1AP*0Ad(d0A Y d0L0A Y( @P (,P(`(0S\ 0p\tЍd0W(XP  \(  AR  R /o"0 ZT@g{Xpp XGڐ: P9f01k5[X 0S# 0Sk %0hS 0pHpl00XS `d` 0R RKQd000S\00\0R  hz0 0SiQ IQ NQ(d@\ P 0 00d0\ 0(S 0h 00nQ 0h \0dp{I:ț\0H 0\00S`0KS0 h|Ph  l00C l0  0zzzD~z|z 0 l0RA 0 00S S S+ hlz 000 @h BAR \ *0    00  0 b3"  0Se $0S 00P0\0("00h YX   Z BXTd 0A P Pd d0A P lpHpWh  h501{'pH `m|PhQ ` l BpYlp  lp p`lp 0 A0S@0,0Q GY  Rh` rA0`000$0, Sl  @00Sh3,0@0000 00 0S?˟80(  J ( ۟ 0:DD@ayPP   ! ⎃h0Vy`P h   !ႃ`pl.z0G00@P S( 8 B p,0 G(8pS BpGpp W Y (0RpGJISGQF 0SZY z@P 3{pP 0S0S  {00SPX 0 S #r Z $@0, S0\0 [ht 0So 0CQ 0 R00SqaJ400H0000` l0# R00S 0<0I XT~{Pc TQ0hSQ yh zPhQ 0S A ^G@0, Sl`0A0` x xXJ` l0<04 CRoᩒY )K{8Ik{-Zɋ10SY xxxx?@?AV瞯<4 N? |,z`P> ~dp( pg  D0Hk01{p W'"00{0z?C0C'zp:0 0:AQ'0 0!:?C0Cp4656:RH k ,10{0  QH ]000d0 R' `00W'"610{0z?C0C'zp:0 0:AQ'0 1!:?C0Cp4656:RH ( (20{0  0Q l d0Q 1AP d0A `  QP d@PS d00Cd0 Pd00d0 00000h \0 h gyPh9 `0 0`0 s P300 (  J1k\00 {0G GPlP = OZ/ 0J4H0  ZPh A ^0S ` 0Q0`0x@P =x P4 w4 ` 8xPP Z" yPPhyPh @0 0C@0l00Cl0xw vwh00 Z 00H0΋000H^4U@Z{00S相 zI8 S ˋ2a]DxPA\00Q00\0b @000h0  0\0#"0 0 0000h Kh xPh~ l0` 0Cl0H.P@!0\0 0OJ4 H0 ,  b0   0 10w0w0SN 0000 h0dP\0h Sdp0p @00h@0l0l4000H 000\000  P ?N  0S 40v400CPh@0`0Cl0 Ph1L0,wL0L&wLQʰ\ (_l00000,P0 \0D [:S0 0!l, h:6 l0v, `0 Q:00XS Q0LR)Ao^& 0 0S  0c1# 00Ѝ QN0O0l1 c 0R:v00Q )Q 0x O-Mp<0` PH8@P00S 0 0P  B0@0P 0SQ^ 0G PP0 0Q DS ^^ 0S 0S S SK pPr@00@0 0Ws0W@ !7}pT0 Pe 0SUP 0@00S S 0 \Pb R  BPPa S@ 0D0CSڣ0SspP[ 0[0 0  RYd*0  TDQ @J \ T   @ T 0CC10BsPDP|0S0SCU 0S S S s~P@"00ЍRu  BPP @+P~ -P%  LP ࠃ:L @^ > L@YPl #@Ѝ   PL 0X@0Q 0S00r KS S80S ur0p00 0p b@0}"00@@zP  D21 2 Qn\  B\  ^   @Y 0Sg Sh S @0p 0ЍI r PePgu0S`erK}@"00Ѝ@ @QA@EspPJ 0H0Y@HT   21@ 4PE?@80SjU U EP  000b80S80S800c8080S Tp0+  RP!@L80S L80SH  @X \y0l 00f@`  BR"@^"1P 5"@!@V+P(&l A-`> RϠP@pl3 ^iqP 0 W`00 p 0U@PEPU 0 BqP `@ pVp  0 BqP0U@98@-`- M ps@KUs0  C00C2S6cА*ZKE̐* Q A@{ Ѝ@-@0AC^ 0S R0A@-B @SA *@Q0A0C00T D B @ z0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/plA-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0 !P@-@M: R @ 0S R0p@Ѝ@-pxaM@`P@ d1PJPP4 pP.0S  Q? 3p 0: SEv0P ("( @0 $ ,( ЍE{O000Ѝt0t t0 Ey, 1{ 0 Ѝ*{ 0 ( 0@0p@-@P m00CS00 PmpP0 0 =x@-@P 00CS00 @ 0  0 Ix|A-@PpT 0rSM wS aS_` z00\`0S e C+S/ ^R$ \0SPP0[S0TS0US0`SP`0 0 >^x$P(p@-@P7 0S= ulP00 P! !& 0S 3/PP೼000P @ P 00 00`aaZld0`` 0pscP404 40 8x0z 0P0d<@-@P 00!R !.P 0C 0 0 ;w\@-@P 0 0 S 404 40 ;w0 0 S@)cp@-@PQPC 100S2 0  OU =000SA 0!$0 3/0:0P7p00P @ P 00< R 800pkt0P} 0 0 JwbP00 jp 0 @0 0py0 @0 0p̎ 4|l8-Ѝ/@- QS S S ey00 H0 @ ,0 @- 0 @36@000 0 0000/@G-@TSPM@@$ Coorᡯ Ap$A A(T`G SS`z(! RʂQ `(q^ 0 0 P@ Ѝ R (q 0^s AT `V("Ƞ0\0rVA`@p`(q@ !$!$$(0 Z)\0$$1(q5 V(qTTaT0 Lv`T88804 v(!`(0 A^ S:0  F @PV (!x,Ѝ (qR 0\0($@ $! A(q\ 0 ;P(t r @TH\,P@- 0At @cxG-@ M 1 3/ `p 0  ` `pp 0 `pP@P 0 `p00  !``#$%&0'()`* "pp#"! 0'&+ %`+p,$p*-.)(/00/0.1-3p4 567809:2`,`3p2 1076059 ;`?4`8@A0?>0BDp=%|E F%(%I0JC`GH<`0LpM Npጀ K`OPGDFPEDEPFGPKJIP`HIJǐHPƠOKPƐǠNPMDLFEPG`P`P SR`PPDE`GPQ`P\F0` pP 0 A/p^ APM_Āmp[Q 0pPM`Q 0pPBQ 0p P8 Q 0pP.Q 0pP$Q 0pPQ 0pPPQ 0pםP Uލލ"wOw,aQp@-P P4ATp  @P 41S P0p@v@A-4!@ pP31S L@ @P!94Q x0P0W0S!R MoPPP $!Rp &Wvpvpvpp@-@P 0@@A-@`P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V =v0@A8v @O-,M R0  1 sp3/,0 (Q0 P `@P@P0S$Pp NZ@ PU@XX 0 `P] @^0( PUJ[d`pp,Ѝ 0 ZPPu@ $`圣PZ $ 0 h`P4 @^0  0 0PQ QA Q  ᰠZPರU` K@(  P0  *P @,Ѝp0  pxP ,Ѝ0  @P00,Ѝ$`  ʚP(@HT 1SX$0(Q$ (1ն`o0@-@ 0! \ @Ju,Du00,1S@-@0 @ 5u00,1R@-@1  0@"u,u ,!G-`(0S M# pPw/@P3 Uq    tQv 0 pt`KtP`ލ Pc  0p '0 VN pWK A/ q ((x 0(p**x* ..p.,|,,Ġ  !! !" p "x#"$#Ƞp  $0#4(, ))x)Ġ000#.'p.*|.*Ƞ*+/ 30 !!!"!"$p%"x#̠"$&##4)*,-p. 0120(48<@D )7;4)x).<.,.?C5p6809:@A0HBDEF =p|L 'Ġ**<*pB0BBB嶌(tǀp*<**0LLL尠p*40G **8H*0HH岀0(C **Ƞ*4 0pp' **Ƞ*4 0pp'**Ƞ*40p 'R p p APXl^T JRPPğ  8/@0PH(p3c'pP  D!B08 !0N⸑V QVUQ`PP4Q$0q$aPP ||sxx3xx@tC  `p `pލO`ß ps sQ{{sQ r 8 8 40D ! r@ rV Pq^4Z X!3\@ ,2$\ \@c4mP30 uD H  p$rP!82CG<,0(bp QsPpY s@`@q@8  408 D ! q@ qPP ?r0P07pW prPPrP^r`GPr @r@h{ adlXO-@(`  0A$!1P@. 0hPS0d 2\5P00H5 0 085W00,500$5000 S S q00P 1p 6+@Ѝ[ʓ 20 2 00p *0Y 2Z 00 20120ISؑ 1S 0 l Ilp@W*("(R w? 0 -P0 "l   .P 1Sj0Sg1Sd-zq00wq0Ssq -P  -`P pW0!10! 0 p p b. ^.0 29 20 29 20S 28 2 R{ X2@SXh0Cpa 20 2l 000x감 Y3Y#e2 20K-0 &. YP3P:0 "S  "J  "#,0 #(#4 0p W,,,Ġ$ ̠# Ƞ ( "! '$!!,0&"+ (""$* #,/0, #(#4!%)- .0 pO00P0 0 nؑ l0 `0@0S  Ul 20 27JZ㪠R* 8#8[* C00C @1 C 1) 01 0)@0?(0 0S 1S R[  R[N  o' 2  0 p _' 0R1 S0"1!1!0 b!hS F' 0 IY㩐7* )I ZV0 0PN0 +? {0!10CS` *8#80C S 0!{/ⰰ1p0p p0 bgX0X X0 bgi00~GU T Dl|HXO-(0p RMG @aP0qg0PP P FP G?*1XJ%8Z1 a@%X0  Q1R@10CS㣰O* 0 08#8S0 Q 1!1T10C1(0 0S Ѝ @Q! R0(0 2 0p0  0   mPO  0R1 S0C10 p p02"0 b*gTPh Y 0I p1P 10CS`-*8#80CY:YQ\10CS`@*8#80CY" Up崑 (00(0H0 1pP(00(0 1  161!0 bfQ y%`P  @`A`P=(00(0 % 1 ! 0 bf@P00 0Pp崑P ` L%`P[ 1`0CS㣠*0J 1.P(00(0  %(00(0 %@0@ @0 bf꼯t̯L Į ح0p@-@PQQp %P 00 %Q $P 0 0%pp2O-0M02`002,00 A Tn 0D 1$PP" T0ഠ p0 pu A@DT@*H$HT0S] P P @Ѝ0 b fp pp J=1xH'8X㴐'x @1  0 S001Q@10CS㣠7*0 08#8S0 R(1"(1 S10C1 $ 0 R RP@ @P@0!10! 0$@@ $(0( (0 be8,dO-p@-0MS`  $00 V< V g`00Ѝ(0  $pP 10CSP*8#8S 1 10CSP` *8#8SV# $V 2`0 2Ѝh7h0:0:XX7 0 0*PPJ  R Hh&hY *P0 mPPa 2`F `SV㴐: 0*b eaᴐ`FV 01`1*h&h `FS0Coo0b   Y 0@pB 0B8R#80`0QPEUP*X%XU)P`0%0 bd0 #`ЍV*h&hVrPio嫲` #V_` #*P P#0 :PP P0 Rz 40: 4 0:40: 0S0 #q, WT 㐪 h&h`FY a#q W 0G 1#PP aᴐW`FV`: 0*b ad3#0 bXd3#0 bOd3#0 bFdY m#x3x#x0 b8dlP _P Y# "PPU 0R J# "pPE괠W1 * 崠01`X0:1 0P1P`01'# "P"V#`&f0`0^  #*P 1P0:10: 0R X "q,Y` D WR4"q0Y `0G 1Q"PPD:*bc0I1*p崠v01 加1Pp " 2"`FPP 10CS㣐: B1* 崠V0`F1 " "PP((lht,P`,<`ȡ@-@PM 0 0P Ѝ0 0 5Cc8O-KMM #3 0@PP040l 0US00?4wpW0S0R CI T/ :P 1e00-ep00l"d2 0 4 30KލЍIT 0000 I;00/ Z,Z* 0J/S  000P0: S d0 p0 R C Rd?00D1D!D0 ?b4 <0 0100U# -p$d0SY 0 `0 S00R0K [ :Pd00}0S Rp psNP dppGoreh< ; 5R Q0P:Q0Q:|c@- @-@@ ! @ p@-@$P! ^P! p@ O-@-dM\0P T:Dc\   >c\p Pv 0 0 0_3S 010,0a`FV`*1, C3h )&h0` 岑ᴑa `FV`*h&h`00(8@1 00S~ 2 4 80pPq 4 8 }TЍpGWp3*8#8P *("( B0@ 01p010$0 pSpW M I)     f2 0b Y!1 0bY#!1 0bX40,0a`FV`@*, h&h`10,0x!x1x 0bXh\!\1\ 0bXJ40,0a`FV`'*, h&h`10,06P 0 $ 0qX b0X!H 0 0bX 0 0bXp:꓋TPt~@wTwyw,wyvwhyvv@ydvxvxxxuxuu\xuuO-@- M  pPPp @TH 2 o20:t2t0: 0@* 봐Y) Q0? R  t `Pd A`@DT@*8#8@0C 0 P!0 0RY 0 0*b "X0崀10CS`3*8#8X 0 Ѝ0 R0@崐 Ѝ` *V'@ Ѝ0@ Ѝ 0@崐0 0 bW 0R @ Ѝ pP 00 wt|trurO-p`-4MP  00 YY 0IS ( SUR0ISY@004Ѝ( @  ($0 p@ $0S (2  1 @P Y Y Y(0QUY  }Y/  @P 10CSPj*PEX%XYX Y,016춟즟0p p 0 b+WX%XU Q 0PEPU*01000PEP <  @P QPEUP: 6 & X%X0 bP0 VQPEUP:b V갥尕U,0 P1 +[  t101 01  d@P_ K[㫰: 0 bV(@R(@P %0 00(0Q00(0Pr?@ ( = 2 @?(004Ѝ0S 0S ($0 @T(@R(0)Q1P0CXS%Xᣠa* 8#8UYd P UH @P@Y P((@R( Q0((0(@R u@ o@Up(@*PEX%X(R,(@R 1[ P 0TSUA T0D K@2"0 bV(@2"0 b Vh2h0:`2,0:0 (@pR ) UXQZ0E 1 @P PUᰑPIXY%Xᩐ: 0*b U1!0 bU0CX 0@%Xk||  0PEX%X`0!1  P0 1 L@PG 10CSP: 0 bU0p1PP!0 P 1 )PP# @@ @((Roornq onqnhkhnxk@k@nPk$nk(kXjXmhjjmip@-@`PP 0 00(0`00Q(0pO-,0-M01D6D0:<6@0:` P pPN QpPEUP5*X%XU: @HX$HU * ἠ 0E 8PP 0' 0!01崠0 P4 T 0D*X 0*b %XTU 0z0 0p0Ѝ 2 TQ@l10CSP*8#8SQ p00@Ѝ@4@$@0 bT ]P P  ᴑC P 뼑0 S00 3帣0:3 0: 08#80CU 뼑0 S 0I 1&pP 1PY0CS0 0::*b xT 2 @ P7 10CS@9*0D@ 1PP% 뼑0 S00 <@YT, s뼑 0 R4 P0I 1pPpK _@R YY1!0 b$T Kp1@D1H $H @U0PE1 :pp @D!H$H@u ! @!p ! PEpP ! BR@: 0 bS0P[0:1 0p1pP01 k0P0Y!08#80 !p0#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,` @ 0(P0#0p`+p ?,P)1 ` @P) ?+1 p DP@.̠<3Ì` P0( .@ 0,0# 0, $<P0P\VL 0 000 00 00 00 000000 00000 00 0$0P(0$P0(0,0 , 00 0008 40 040 <08  0<0\Ѝ]x[Jip@-@@DQPP`U  0pRPQp b Qp Q0P0H MQ@ IQp@,R Q bP"p P@0A-1`@Pp fPXo 'Q@0D 0 #@0D  H00H0L00L0pGPpP3W_`G```@0D ;  SP@0D *H0L 0 H0L UpW PP@0D qp 00#0@pD H0L 0 H0L W+`G``P` P@0D ;  SP@0D *H0L 0 H0L UP@0Dq0  # @0D`R @-o/G-@PM )PH8 I `p `P U@ =PЍ@-@P 4@ }P P.P 0$$SR @-7/PG-@PM PH(  `p `VP U@ PЍ 0` a!, a c,/0@-0MzP0P@yP񏐨#[!  b\VP2,& Z5/xrlf`ZTNw~ihece^]\[ZYXWVUTSVLKRQHHGFEDCBA@?>=<;:9876543210p^6P 6P 0P$0 00P9?CP 0P 0! 0H p% Hߍ0<P 0 0 00cP 0H vp HP= 0 0! 0! 0! 0! 0!HP  0!000000v 0! 0!0 !z 0!u 0!pH0 s0n 0!_ 0!Z 0!x 0!s 0!n %0!i0R  0_HP@ e 0!T 0!O 0!' 0!" 0!@ G0!; F0!6 E0!1 D0!, C0!' B0!" 0!x2P 0H <20pH <0! ,0! +0! *0! )0! (0! &0! Ϡ 0H Up h   0H Cp D ?>00q 0! 0!z 0!ud} 0!o`0WP0RLU T`SRRRRB:9iNNNxNG- M0`p@  000 0dwVJ QP0S ؼPPL W`A 0S7 ̼P= Tp8 T 0S: P8 @V (! 00S1P0PW 0000 T 0@0 @3  Ѝ WPTU U @ U U X00YY ;ʾ @ƾ 766d L 0  ܐ 5p@-0@T 03/@TƾQNdPP ¾00@T 03/@T\߷p賾H00@T 03/@T$ྷp Џ H @-M@@P Ѝ  0 p P(0( (0 AKЍ\4JKJO-PRp M ഁУ@  `980 S# 0SK: r#0  0Z  0080 S 0Q>0 [# 0 0 Ѝ 2  0 0 2 0 @@8 @ Ѝ  P00 0 00 0 sP00 ЍP   P  000 0@-P RM@PQ   0 13/Ѝ0sr? 8P100@-P U1!^ 0C BS \ L0D0p@-`PV@1@!T 0N B@n\pSVpC- MP `@($L  L``0V#pؑI@ T`1 `! "@D  T@ p PU Ѝ ЍopP p`O-p-M؁ 0:PH 0 PU p  @P 0U`1`!000 0R"W0  PU0  ЍЍ@- M` @K K % P 0 q@pG @DP @PPyT  Ѝ Ѝ Ѝ0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-@R"2 0|MP0t00\ 00S80S `h"`2 0 t0 30|Ѝ4P  =P8 0 1\ 40J`08 04 0  0$ pW`9 P%8X= 1!0!` 40 N4PU 08  R88P@P`0X A@8H 12480Q8 :K0 S pK08P3KP8p۹P 8 ` 0 `P p8K00K08PKP8mK0`0h`e| 0 @ O-p-M *0: @$00 20D2 0S{ `Vu 0H"4SkSi90Vm ,0:0`00k0P . S\ ] } S`PI \ 0P 0  0CX 0 !>01HYK0 (0DpPK0S(00S1!R00:X Z c/\ H c/D0p 0S 0 Z00 0p 0SZ0SK00H2S708 R,0:, 4P,P0R\ ,0(P(I뀐4`0 0 @ p  (`VP` 8H7(0-47_V04`8X00 S  0 \ V Y P& P PX V0"2 R8\((\ 9P00S%8Q 4Y4 @ [`@- X`D 0SX 0 EPZ【PX 0SPc/  00 0SO ZD 0 SR@T =0S $0S  !gI0 0S 0@T `6  P0 SR@T y=0SBJ?00Z【 c/\ H0 SRs@T \= R 00$J"00($4 0 2 30 ߍ  p 8Qc0 SR@T 2=0SI00Z【 c/\p0z@ -vI0 S ,c`\8P((\X` `0+R48 0\R408  \P0` @ ;0 SRI@Tc `<^X P2 `0 R(S VPR V`Pa `8@400 SR1@T <0SuI00OM0 SRc @ c@ ``d 0PP ` UH8@P@,@ Xs q@ =@ ~0 SR @T \<0S@ f ؄ A L @~ | 0@-P`@$M@`@ 0姲80040000 00VPᙲ$Ѝ0z O-M\C\@qA^5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @H0@"2 0 0 30ЍhTŸ <qAЍOkT 04S:`W ~> P Pp` ; `X  GTpK`PYH  +GT  QX Q(   ` T 04S`WA @~p _X` `H`pQG`@ T W`@Z~~ @-@0V@p Y ! 1:G@pU VYp:qT?o20S` P@c0!H 0 ^ꁿ l  0 ! ƒ1p@-S@P  0P ! "0 2pp@Zp@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00: B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/0@-M<<1 0R020* ^3 0 @TQ*QQ P1D0"A^ R QQ*QQ  Rl d0 0 2 30ߍ0D800230ߍ0@  "H p D QRO-00P00$MSPp X 0#!  0 00 P `@0P`0r"@ (PP#  8/P 8/P 8/P Y  0`00S0 00Pc8/`PT*0 0 @T:8/PY Y}  0 SYz0 0 @`TP* 0 0C0C@J BS0!AQ RS Y B10V[0*Sv* S:P 0pC@00000g0SPd0@ r"T[*`c⃠ W*0 0[ P 8/P Y Y 0 *  U [0@0T:$Ѝ0  0SiY 0 0V~Y 00 0 `r0 0S0 e0/R $ЍYu  S` 0 @YF PSe  B[Yv  0R08/P 8/P 0 P08/ P P 8/P0 PJ8/0P p8/P 0 D0P 8/ PT 8/P 8/ PPP S*0S: ? 00S  fP?0  @T P?0 J 0 R0"! RS  B#10S8/PU 8/ PPPL8/P8/P8/Pu8/Pn8/Pt8/P_0 0S0 0 lB0 0 k~B 0 0C0C @JS E0!a 0 0C0C @J ES0!Vl,D,,H, ,R Q0P:Q0Q:)@-ػ 4C-S MP@  $3/t`  0 =QP `˭4P4S  $3/000 Ѝ?D 0 A-pd 4V:@T@T 0P R 00  0R 0 00 8@P0`0dp@A 0A-`M p@P"0: SPP P\ 0 =tdЍCP00ЍPЍ( $$4/p@-P$0r0" @`Pp4U $0000C0   0R 1  00 0p  0% 0{t, @( 0@-S N  0 0R 00A0 ׳4O-SMx`A`ↁ0P@p T0? S+Pk $ 0  < QPSά$R PWTA000000S@` 0 a 0`4 S   $3/ЍS   00 S`0a  0R` 0 0 0  0000Ѝ C 0 B 0 BO 0 0Q 0A00/0@-S@  R   0 40S/p@-P@T @T 0 Upp@TP`pRQ3@-P # 3Q  RM@`Ѝ0p 04 *Pp G =p4Ѝ%S B0T @0p 0!1 A-@P0xMP0t00W 0SC@0 SAa`\`a!p 0 5P5X! `p ,` 0Hyx5 10H@UU@@P@T  ;A 0 0 t0 30%xЍ0娀 S``  "BT 0 B0l l 0000 t0 30 xЍA Ao #### """ h"Hv@-0M@ 0P l00Ѝ@-0M@0P _00Ѝ-4M0P R04Ѝ(HŸC-`@2 08M000@Ϡl1?2c A1A11A@@>a\AD00ä?8P=<;:9ZDDW7/.-+)(5l_#$~|H F-  U [n 8-(= 0 |0 30}Ѝ #`!!4A ,P0 P $0(@:, #"0,cR:,c2S <  @@͟ 00C L``C@ @r  ^^A!/3b112A0 <  ̟ 0 cPp<5: cP` ;0!3b112A0 K 0 S 0! [ K 0R Qd;Q0 0dP  9 [ 0 S  R    BtQ1:0/A!b0dP   [ 0 S  R  0  ``:Q0 0dP   [ 0[  R  0  `i 9Q0 0dP   [z 0 Su  R od d9 / b !QQ0 0dP   [[ 0[V  R P8Q0 0dP   [C 0 S>  R 8 0   ` ,0 S0C0  B1D8Q/0A!b0dP  f [ 0 S  R   1 '(0 dP0  L [ 0 S  R |'1 00dP  3 [ 0 S  R  [ 00[006 Q0 0dP   [ 0 S  R  001?2c  1R11Aãd0Sâ/d0CS0c0(6dP0  [ 0 S  R  08   8  `S80S 0R05o005dP0  [d 0 S_  R Y4 0  `*M0dPS004 0  [@ 0 S;  R 5 [3 00[^, 0  ` 0S8 qp  Wqp 0P3  0S! -R? S30 [ K  S Q X# L "`1aa!B! #<0 dP0   0[ 0 S  R  0  `/  0  `u`0 0S=  P8 Pt [ 0 S  R =Ps0`8 i0 S  1h [a K 0PZ QT0S 1 [L K 0RE Q?UP 1 00 / b !Q dP  x [& 02Ы Q lP)\(\ ףmph8*\0D`TH< nХĥl`$I4   S  R \ 1 00dP  / [ 0 S  R  0L0800<00@0 0D00H00L08 0X0!dP  [ 0 S  R  0n0 S0Cڜ [ K 0R Q0S  [ 0[  R ~UPUP(B 30" !8$08 VS` gS 0  `\ " " P"N$0 ϠB!l8 0 040c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0d3dP0 j [ 0[  R  oP 3Q00dP  L [ 0 S  R $4`0?]<W+< T+ 0< d0 0D+ 0t$d 1<00 A- M@F"F,l Rl0l0\"RP*;<Ѝ"R 0S*0Z000C R\,`㸠  `P 00R 0R0S V00W2 z6 @S%V 00@0Q6S! BFLGkh@n&2RR |$1\0  @E00`=02?00cS00 42hVhO-@-0tM<SP S 0S 0 C R+0CS`@0FStЍ0-S +S @pP Z 0S0ƒ! ⃱10h "h0/ Y 2WCD00S R ;S,S S@0\- 0(\ 02F0S; >S``F0F2@pP<.@9 l@V|@hƃlhpp崠x|:… ᴠራ '/tЍ@pP @00c@0Pz  0 e[   100pS0S >S0C!1 0xH0:bP 0,S\0:XP R@0D 0 ,l&`ahp& `x|倆ğ4d ꨔaY 1! c["V `F  XaY*H-S +SDN P}DE Pu D00cD0$``(`8@̃ß弓$0@(`04p0f΂?$``() 00`48p<@0$0 Hp0R0C°1+.$0s1M00H2 )\ ף{(\3Pp@-@@0S p@xPP r@P x0 h 0@ᷞTH0 0 8 'N.@$ H [H2dA-PQ@ pW# dDpPS 0 `ጞVU,V( `|FWP.W,V hP!0PPT`)0V pp pqlhvlvhpv Jp`-{0:S P V LPVLg@P`_pMPpV`-`H2LA-`PQP p` !P@@W(PqpQU> POTR hQ8 X1X!0d0 P000U00(a]PP`F U0P0\  RP e?PE  PE0P0U0S00#  1 @呛PP  l 0 0W@ࣦT+D,гd@ h[\ X@-^F#-@) p@-P8 @P PPpU,@P[O0 0@-T@ M@@#4  F?P Ѝ0 l0@-PT@ M@@"4 0 Pޖ Ѝ0| |p@-@``MP` 10 @SP 0S V"`,QU d0 @LЍpz, 0@ P8 8p@-@Q0 0PP < 0p@] 0 0 0p@ȫP0 0@-@P M F   0Ѝ@ll@-@4M 0`  0$0 (0$`&` ` P0 g0Sp`4Ѝ@-Mˀ  hBP RZЍ- "P?Ѝp@-@P00 0S 00Q +0h T 0S‚ZHmp=02@T_r!a x C-P` hR bQ€Zh r@P@N\ BZ^@!hp @ W@\ BZ@T SRW͌ • @WR hP  r@X@\ BZ@ R p SR00͌ • @X͌ • P0@-P| M@ޔl00 0S \00P  0uP8˔ Ѝ0 @ XD h  0S S/P/$(0#   @// / ////P/0@ 0A0Sm)*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*A-`0Q0P0X!ST1 0M@p0101V9 T@P`0 80xQ|Q帒8O80TTQXQ\Q000@D 001pp@@0 0 0 1 30ލp0p p0 P&VT0T T0 Q&(T 0 OL LK @xPljP(,- 0  M ЍJ 8 - -M(0  0{ЍЍ/TJ 0--M0 mЍЍ/A- R P$@ R00 0a RH 0  a0R00S00L0A PA0 A0P`#p#1 L^!! C0 ` A P S P  R PA AR#@1`, L`!0C000A0 :YC-p@P@!W MP` F( ?(0S D!&00@ Ѝ00-( &(0S  !'(0 @r(0@O-=<;:9p7l3j10/.,+q)('%k#"i PmLKJxh RwtLIzS WWU0 W   0Q񏐩00@0C \$SjPg u0Sq0W p1!PL  u0S0W p1!P<  u0S~0W p1!P,@@@3 1u0Sq0W p1!P"  u0S p 0W p1!P  Z u0SU0W p1!Pg uq0S?0W p1!P `0*S1 0C P@00C P00@ S0`a`0`F0@ \$P0 uA0S0Wp1P 5 u20S0W p1!Pu%0S0W p1!P * u0S0W p1!Pu 0S0W p1!Pw  s u0S@0W p1!Pf > u0S0W p1!PW p <Ѝ 7 u0S p 0W p1!P9u0SJ0W p1!P,pn  u0SC0W p1!P  u0S p 0W p1!P u0S0W p1!P p] p p0W M*0P~ *<Ѝ@@@@ dp6c ]pz\ VpU OpN HpG Ap@ :p9vP/p. @0Wp10P" ϕ  p u0Sj0W p1!P^ B u0S p 0W p1!PIu0SA0W p1!P<$P}0`>P00 pu0SO0W p1!P)@J u0S p 0W p1!P p p pur0S p 0W p1!P p ypx  uM0S kpk 0W p1!Pu:0S XpX 0W p1!P00@ S5@01000C0@ \$P u0S7p6 0Wp1@PsP  0!0 p Wp1@t$P@0p@-PP@ 0S0pn 000p0 0 0"P3HO-@-oMM< /D0? 0P060 <0S 00 !R !0s0夔 0T0 0S   R H?c*{r]\[ZXWUTSQON+LKJIHGFEC[RD~9::83k/., fP    R^0s[ <0S3 P=*X1RRXO;XTQXQ\Q."0N@QD,TDl(8PD 0<< `P` P``0@0@0000F@ `A@00F S$V @J; \ 0!0J0`0S00p``%p;$ 0   Sp Q0@SPu-0@r0Xu0$  00SX00R@@ T.=0000 d`_r0( L P 8 4 `:$0  J QC Q@$  Xr  S0000  R Z @  0H s0 d`00d0 CR( l (dQN Qr0PP@L P 8 4 p9$0 j JW Q Q@$   Pc P} ,0S ,ϒ0@0S0000PP Ò(d8 0 6 30 oލЍVa 0aPmr0(P@L0P08040! R PQ  R0  儠 ARS 00S0r00001S 00S0001G?000 Z  (0@DTN0 (000`0S00 0PCU00P0|P0U00 Sx  t040X0$ SD0100 P | D040Sx00t0q 86| R1|0P@ x 0R0 BR0S@  ,0S I0P,0 `t0$PS-0r0|080s ` 0T PLR,ڐ70`Pdp Pl@@p `@DT\ P@DT `dp `Pl@@80\ 0r0 P PU0H@`PEU0S @ 0 PpPEU00S0@90P0 sP[00S0900000000 T0000S000 |@T,0@ 0(0o0%0R`0 : :P"0 1,00NS `Vr0xj`@ P (PL@P@8@*:  0, c<0SG*:  , 0W=s0  T0 `0 R R =yo000%"0^$B0f0R :NTTk``⌀@DT 0R`0  P@DT0   0R@0 e@ a PD $ D _ P0  P0 PL RZӒڔ HsLPPp`hPp4UZ`{4000U0PEpGJS000C(00CS0S ڐQ`0;S@A@TT0ڌ8PP@DT0S  0 LP4@DT08P0S0H00@0 3P 80*P80P=yo00!0^A00  0f0SP000F`B Pr0,T0 4P`` P` @DT0S0P/0 8 10R0bB+ S- C S!!/΍ L!/A!bCcS000@0 @00L0@^B0. ^L0X0X X r0( ( @ _,`( L@P@8@0S0h?000H/H?H 0@, x00C@0+ PpSD$01DS-0`r0͵X$  +0 0QL $$  P@QJ $$  P@P$ D D P@4 P P @-``4P0S0 >00@0K 9P!C0 0( ,`_H L @P 4 s0 T`00 $ 2 TO= 00y?4 (0H0吚8pL(p(4p 0 X`G0  G 0S U  S  R0 0P@ 8p(L吚 PH Pq  QE $$ Q Z   PD $ PQD O   V S $w  Ss $SD0$PQD0O0 { Q $$ Q (Tk(0`$0H RO 8 A R R Q8(  LPH( ( @_,`4@Q`Vʸj`0r0=j`: cPKh< `s0 0P0H `0y`S @O AP)4 ER.0 "!.0000AX0yPD $   D Z QD$PQ$ $ DO S$D10D$ i6 QD$PQ$ $ DO PD $ PQ@D QO $P$   @yQk $P$   @mSD0$@@D00SDh`_= 00c04 (0 0w 00 ! p P@0X0p x04 S; 1 0(0`p6S@ 8 H Bi Phg`8_,`@LPkt0@d2,' (P4` P` @DT!0S0kP0 00G0S 0c`GP@J4`(P0S0X600@0|@D$  P@D  D00P@DD$  P@D  D   @PD D$  P@DD$  P@DHpLP`Pp (0V`!D0DSD0$D000$ V?P ሠV 0mp@ 0 @0 0$4 D 0 P $Q $$ Q@  XQ $$ Q@  M$4 , 0 x 0B@00?T0c P|@RD$   P@D) 0  0 0  0tD$ PD@ D$ PD@  D$   P@D0< 0p 0SD0 D0[@F S$D0D000$ D0$ D00 P@D0$ D00 P@ L P `p00F SK@A@00A S$Q02SB `p0 @00 , ܈50`S `$@  S$D0D000$ gl 0  00< 0Npi `$@uS$D0pp$$D0i 곏@0< 01pL 0SD0D0 RPPV r0@L P 8 4 @9t dx |h 0 t+4>p@-`M@P@  4P0 P ЍpH 0@-@ MP 0 0 P  Ѝ0O-PP X 0SH 0|  Ry p@a) \T B,B R`  k V`!  0 B0`@ 0 p`BV` T0p@p@T T 1 !,03/Pf0p0CS@D0R)  0 T`1 `!0PVQRi,03/`PDY l 0p0CS@D0 T0@pT0  P@>P00S *V * R000P@D`V?V   R !,03/`Pʼ0@00Vg* `@ 0`V:᠆0P 00 ``F`0`O 0Y0C00 00uP  0`0C0000@@ `000\Pr p0p p0 HX0X X0 G 0  0 yytyyPyp@-PP& 0 `V @@D00T`0@T` ,0 3/Pʼ0@00pD0Spp@/0 0 V{|x|x0p@-@P0 0 Pp 0P0, @ᖀ bP᐀pX p@-P`@  R T0U:T:0T:p@W꿍O-pKU/ M 0`PltbX  ЍO{KE{&{0:0 SA. 6b@0c 0c33:0$0G{@+S6L0[(000X0 Z ,0Z0JPC0J_oPåRS 0S000[(0000 0 0pW00-`P 0SZ00WPPU0 Q1 0 1kHK!"0 1 0{0KR {0k& [( R {[2J:Wk{{+S 5AH k+C0PS3{01;:00G{5  [ kDk6k+ K R4['k&{;:000C{5{JG[2 k0U 00 pW0pp0 Ն00{00:k{{+S 5A{+CG{5{Fk{PJ

__@- M@P`O p LUT 0S*P  <@8p Ѝ$S 0T@p冀 @@'$p Ѝ@p@-@PQP9 100S 0  R 0  0 0c 0p  p&   0R0 0 P @P C0 0 $0 ,0, ,0 < p 4|^]@-PP8qMp`@, V4 T< p   ᇙP0 :RCo; 0  S  L 0(0P  Ѝ ; 0Ѝt0t t0 u VX0X X0 k T<0< <0 a @ dl] ]]D]\\]\d#d3 @-@PXS0lM0d00P= 0 C 00  #3 0 d0 30lЍ |0p0S2 `I}0P " VP000`S p PP000P"P2P 0 | 4"424 0  `0S"$` @65Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!`00 +{ 0 0{'{{ 0SP pp 0Q ```  00 ``P x [8[|[[4[Yp@-@0MPx00Ta#yV( )y0T!R Oox0T!Ry0`y00 UTX!\!R Ѝp@w\!y00Ѝp@w00UX\! X\!0 000S/4 t0 0p@- PUp@0w00TQx0`U TQUP wpX1P0X1x0T0`X1 th0h 0 R/@-@0w0 X10CSX1 @wOT1w0 @wd t0 000S/g t0 0 R/p@-@0P~wU00 \AQ\ X! BRX! p@nw`x00OT!w00p@cw tH  Q!460/\460//@-00U\ \0 -4M0 0,008 00 0 ,0 304Ѝ P@-@00 R@KP@Rp@-@`0P0RP*:0PpP  R 0 R VpP !0@i0O-M@S]@DPqp1 0[1q0`&:0  @@F0 0[ 0W0 *0 @0 S 00CX:X@D* R @  P `000PW 0*!1R 0CX:X@D* R @Ѝ /p@-@QP  (p@謖 0 0 9 t,@TRR  0S RP/0    P/O-M8@0 Y0 0[ PT@T 06S 0@ЍG-0q@p9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,1Vs1QsPU 0C  P 00Si`P! 00i0000000S x0)sd0$siV0S 80s ,0R0i %t`F`$q#G-P`0b@Tᡢڃ0T&P# Zp !p0 n .  P2)0@R0C`0P003 `LpG  P`B-0P!1^$23\ *G-P@0p@DTG !1PG*32^ =:P  @aP @0 0S 0SQ 0 A BpQ3 3 V  0 0S3#V0 F B S 02NS @0@PpP 0 0p@- @APG0D ` PR @*P `1<P0DR 551 16 +CpP56 +Cp4R `5<5#11 +Cp0?C- MkWPAP @4'J66V0`0 T 0  CND@D@5`@ Ѝ P `!30  0S  T0 C@1@` Ѝ00S/0 R /O-PMp 0GW"S`@uP-TP +T@`0f0TV Wb Xp pb 0 0   @Pp P Y Q P  S  RP !R  00B ^a0BSW0BA0BSK70BUH| X[ : Q P  S  R1 ! 00XS00 C RO A BRKWP ?0X  0B0b 0 0;"00"00 0S \0F0 Ѝ@`ex 0R0 0 ЍH0H H0 ?F9@0` p0p pd>  0 0 0\ 0 0 0/< 0</0 0 0/ 0</0 0 0 / 0< /0 0 0/p 0</0 0 0/, 0</0 0 0/ 0</0 0 0/ 0</0 0 0 /` 0< /0 0 0 / 0< /0 0 0@/ 0<@/0 0 0/ 0</0 0 0 /P 0< /0 0 0/ 0</0 0 0/ @0</ @/ /H-M 0ЍG- `Pp@ @T @'# 000@-/"Ϡ R@ ?#0! PO,M  P!ЍG-Q `@PpS Va p@RSV Pg 0Cs ?oo0CS00cÁs4V " rS% o?oHX0 0hs4ÁO@0Ϡ 00 TOOXp0VP0BV00R' 0b /ob7 4?oo0Cs! X7 0hs4ÀV pV e0o`10@@h47~t<ΠQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@ P  000Tl / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 00///Q R R  // U /Q R 0 0S00/ 00/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP  00Q S@ 0Q00 / 0U0/Qp@- S @ Q0CP S@ P` P 0U0pQ 0@p0@p@-QP" US QPEP  SU @`  0U0pQ 0pS PQ U //q 0/  //R Q 0/ 0U0/ 00/0/R  -/p@-@RP` 0S V 0U00S0 0p 00p0 0 X6\6s R S  0 /U/ 00/ 00/RQp@-`@P 0S 000 00 0S00p 00p 0   05p5D5R S Q0 S00  /0 /U/S 00/R S 0Q0 0S00/ 00/0 //q 0/-Q S Q R  0S 00R 0Q@-! S BR0C  S  @ QR 0 0U000 @-M0| @0000077001 34 ,0 0 0 30Ѝyܰ x -BM MRč dd  X @ $ PU3  0 220@- @-`RPp"@ M Mp $( N WG Ÿ R"@$@P  p`0 H"02 0 $8 30ލ ЍBn"` @0p r 0 B^P.!0 s100qp00P NP\A AL+\ 92( PPPPPPUH ZxF2a h 18Pa 1̮ p1L`` D 1^ 0 40  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 3"00 <P0ЍN00 0@@- 0M@>S   "0!,03,0 P0Ѝ*00- M Ѝ0 00/ᐧ ($0$0- M 0 Ѝp -- M0 0 ЍЍ/$ $0 00S0/ t@-@p@-0@ ,ppPVg0PpD0//////X //1G-0p(MWP` 10 0 ( 0 $5/(Ѝy@PL 0S TTT S0S4*4! 00S S) $S 1 0 0S0S "S *\pC 0RW0010 0 S0000t0t t0 <0X0X X0 2!@|H4 )()(()(//O--M00Q0P0(,S$< 0000Z Y; 0 0:; 000; 0: 0%SSppS> 0` pp 0GZSZ@XW:UTSRQP'"MJ~}|?>=<;:9876s43210/.-,+@)('&%#") ZU`W `cyW  $p` P0$@   ` P  )  R [ 4 P  R0 Y ˄S0CQ Y0Ԅ0˄PU*^ 0`CV`FY 0 Y0˄`V*S00G p! 00G S[    000Sp0v- S  0@00 "0!0d00C0FQPA00T@@:*p"pP @T v{  0P 0CV`P0f0PF0sp 0070xp 0v" 0SV`0P@`X 06 /   0pp@ p*W 00G S`pa`00G S+0p00 pR0 b0pp0pS 000  $ 0 000000vw 0SV00p`P@00V`S00C `0 >,  v QV @.10d0Q00S0/ 000D0@@0)  0  0 plWp Np倀K0 000  04 00g\a 004 02 v0 S  P00%0!: 0@Pm00  h fdT0*00@CC ^\Y 00_ [  04t [r* 0Yp˅ Pk  BR Bf0 Y˄ R*`  BR BT Y˄ R*N00 =  00000 [0K0"2 0 0 30Ѝ  x  000?0,& 00P  0 P`0 0Y00[ 0E @0("(0 00P0@  000@. 0@PL @0 0 4 30Aލ Ѝ>r눓  O-\!X1 0AM @ MT0407 0Y4:0px0(S`;  !4"T4T8X#8%XU"UPE/ @V: 1b -b 0 vP PU:t 0 WaPP D0 0 4 30Aލ Ѝ0x0(SqX D O--MMh .> l0060 @|>T000G 1SD 6 Sb`1  0 >40X0 0号0h ls @0D0 >00S/ S/vP`㨐0pS AP! p O0 0P0S1Ss+P  @`TP00ST0v`PPP0Sqs`V0@  ^ 0Sڨ @ \<, XP Th080v?@00<0h0: 8 T 0S<0#H 1S0 x00S S00L01< 021l0:ATY0D0Sl00h040800SAT} H0@P| @0PPPzz 0;4@ ?qP @0P-P 8 <0 @8 @ 0 T<0@ 0 P  SP  D0S,0SN j< 0 h0 S00D0!*px`tP␪60 0 P4/P t$*: 0 6 30ݍЍ<0X09 00T0 h d pW A8@P@0Pz !㽂@0P0 ) 4`0 0DP ,0 P: 6 x<0`SP0c  Y`@pV  G0 0P`?t0$00(0  i0( 00  F | & PP8 U0I  QP `1  0 x80X0 ,0&,0R  0,0$0 0 F0 SOb0!`倠?A9c!@00րP 0S @0P bj0t'@& 0n ( ,0,0P1 Q!  640 P0`1  0 6T0X0 0 0 0  +1 01l 0,0`1  0 H60X0 r000O 00x5L Pb0%0< t XXnW80x00SA0L0B9  00 @00D00,0oQ @U`D 100 p 踠V@00uvWU1 0#03^U1#3 1 $03 Q0Cˆ UY10#030 LP#D @EU  Vʐ$0 @ 0 @0Y0U   ˆ0v`100@0P ni0#@4#4 0m (0X00,00 T3 X0ఴ@00$3 @XmCi0"@" 0m0 AQR z `1S 0  Z tP, ]`!!! QY   T20 @t X0Q V0D RZ X S AT v*`tPh lx0Pp4/P? 0+S .0CS,@0P_Pq0 p1D@X0 60,0d JP0q@ E  0D0,00 0@X0 0`!`V A А < C   d | , `    \dhx$ S0P01SH 0T0T00S S00 0堠0 f$0P1C T0 Pn0 T0~P(1014@ `PD ] p0 00 o~0PypP 㸰D TP B("(RD D |~P00X0-P+0@:&@ XX0 6S$0S P0$0]VPK0g(Dp"( D T B("(R0D D  G~P0X0@0Pf g0"@# 0/lYW 0 0R` 0`1  0 30  X00V0    UP  E("( 0R00  T B("(R D  R,# }P0 3\0X0 0,0g0 $@P$P 0k0 84 X00̲&0R  5U 0tP> 0 E@`P V@ 0 j2ˆZ00P `D0S<0X06 RX 0 Lp0 P| x t0Z m(0X0@0 0%PTAP [1011S1= 0  0 0 46d@X0" 0N&0R  00 x6 X0= 0 0 0ef0&0& )k06 @ X k P0@K@0X0@0P4 f0|'@' 0j'0+S .0CS@0P f0'@( 0j P0@ uf0@(0T(T jkgf0x(0( j/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@}P$Ѝ0 }P0͡"c1010$Ѝ00@-$MP@}P$Ѝ0 }P0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-!1 `0AMMp0 40pPH djPC @ + 0BP7 \4 !P00\+ @ 6P0 @R  R R @ J@ @,_ @x xD ,0 0 4 30AލЍj,v u t O-@#<3- 0BM M0$40103Xd0:3@0:$p00S000- 0p  P?QP0\400 PN0d04 !/ S ' 0  h\40 0P 0  0 0  PP P03 aZ S1 YZ hP10$430KBލ Ѝ!448#8S0Q Q/ Q 3Z     "Z  "448#8 $$,  P("(hZ i\t $@ @tr DA-@T!`P1 0AMM04000t4P T : 0p g T @@0  P*8ĝ0  0 0 4 30AލЍ j  PP 0@ .RX @ @Y8  Yip x|8p |O-p#3 0BM M`P0$40P@@Y[: 0.[@[VS5.K2o11T- d1 0T 1 #R T40 0iPY 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 Qe{PN t"PH T40 0Z0 D DR000& 000SG .SB T400Paʑ0=S 1SA S5 S6 T000SC 0sL0SQ0S X00d1  @@T?00& D DR0 0 " 00000S0000   R00S0000< 0 0T400 P\X00V@;XPhdo Xn   p@-@P`zP p@Ep/O-p0dM2吐0@`P'T V  0 h#à  #4:U@  4e 0 PdЍ"0 %0  UfV`0 0 F 0 WP0x 'xOXLX0SUPP   B R`00 0 BmWP 2X/X0X (X뺐PH0?X0S0 0 \dЍ `F 0S0   X X X  XY  Z <0(k H,C-@0 M(p`P6@D T@B)WX W0W W @"44U0(@D",T4Q0  Ѝ  `-  H' < <0< 80  Ѝ@0TG- p崒Ḃ@P`7 F0S@`@0WV!< }W@yW`, @F0W0T0S?T0 *G @FdWPUPTPU d d0d ` 0L @ @0@ <0 @ =8PA(0`( "4`43Z1S//0O-䱐 MP0S5 DdDtD`p @ S S0  fP&  fP0 fPI  fP00^ q 0  SR 0  SRS Ѝd10P0d10 Hd0P d  fP  fP060 0P d vfP  ofP090\ d000<|di0:0  SfP  LfP090090| =fP010r  3fP020h  )f0P0[^ d@?P 1? # `Z 0 2M$ f0P0[C @?P 1? # EZ 0 (32 eP+ @ eP010  eP010|\|dD$$0o,ol\8@-@HMExx x{` |  0 %  { 00 x1xxHЍ@0@-$MAT w0   0! P P00  0w 0 0 $Ѝ0@@ 0@- Q0|MU0t00& w 0p`0# @0  @ 80 0 t0 30|ЍPP4e$_ ^ A-@P(v1 0!1n0SvOPpPp vp0Sp@-@QU x3s|p ]01P ]01000pucfwVxuP //ጧP //hG-p`@>W`PW00V0S@ 0PS1S ` Z V `4+4;O- -0_M MP@050T0* $ [T: 0=[`@',d!0  d! . 0`1111A05<09\P  0ʏ0J( @$zp d10 d1 &P* `@ X`0SH _D@X S\  S S00 Q@0S S R: 0CQS0 C0SQ0000 09cP 00~?080:} + 0;P 1#S;S 0(S# 8 R 0(S> 0(S 0|(S0 l8R00sS1 S S0@(  (8R1 S S 0S00 S S SS@@ `0 X_AQ0P0@@0Q"0A'A+S? 7R1 S S(00R00S 0`0 S S00 ,@U@0S S 50@ @@@@@06@uO0 8z/0H*jPd4@ R`P 04@ 0R`y`L0d!S 0 0 2 d1  AJt| vq1|uAp x0τ`0S [ `0`SH@DH .S0S[ P`.%KV00[0S  00P % "0$004 0 5 30_ލ Ѝ0, SA T T Yʔ4 P00: 4$P000 ᐪ,p T T@ TT  ;T RR@T $$0 `p ;T 0000@@T  P 0 0 P  80  qh1P- @@T;T X30 0000@@T;T   P 8 l! Y@ P,pk 2Rz1 S Sv 0S`00 S S SS@@U `` V _AaH P@`0D`S \R?* S S00 Q`0S00000-/}ObP.5P `W1 x#|# |DQ haD@`L`QL0 SQ  )P 80-1 `t @ 0- ll `7]2  (RaT\ \ `x jdomasearnamesortoption(iner|,U \Hch!1 p@-Phl@HMP ^ T 000HЍpp Qx#r ctV p 1 xT000000&tPT $000HЍpв4A-p RP@0`P  R P  @R0P\ R 0  0 O-P-OM  x4x0?`0P: pW0P0 @  0 P@@     *B`P m]P[$ RQ0  0N/ !pG00#[k 0PP K]P0S [0 0 R& 0pG0 PQ.  ` z0PaVpG #U @@W  * n 0 Y] *00 Oߍ ` ᐚ0 0CQ* @ 01!0 "U n0 S @ :0C S : @Cp  P`P @pR  ` VPE:p 0``:@P R @DpU+ ' T: 0 @Dq`V p 0  >Y jn[ 0  4Y} 0  v0 Vn 0  l ^Q`8@0@ 0@-@P @8 0 0_J L Y(0( 0@-@P,n00I 00/ @-@P @800^ TY@-@P n00p@-@PP  P 0  p 0  0 |K p@-@PMP( `0 0^PP#0 bzP @Pm 0  ЍpmЍp@ @0@ <0$  0  Ѝp lX @-`PtAM@J h!h1 dQ0 Pp 0 RpGS< `hYp> Ѝ [P 0 [P 0S@ R [@P  A0YЍ   0YЍh0h h0 PP P G D Ԛx<HH0p@-0PMU# 0U#0PUP!@@``FWP $ WP 0!E`1$(`P 0Ѝp2Ph'',O-0F@ MR ,0004 6Ė0Vv$ (`0 PpS@ !FaTx d(!< 0CSQ %+38< 6 0(<  A0d@B @`87( `4<0P(0P[ `㔵E 40@Sa 0S 40SpX6S P40S<00S S$504QW 440SP0440w,00,000S4 00  ( ^A-*02`10SL T10A S\L40( @40 0Sp $4$$0 @(4c8`1(5D\30 (``Ѝ1Q Q*# 04c!5# (`08Q(401Qs434# <ǜ1\ \0g 0T:p @( 20<1`5(P^4'20( 2 0(< p2 0(< \2 0(< H2 0(< 42 0(0 2 0  8 ( 0 0(0(1 0( ̱ (0(10( Q   1刱0 0 00p10Wp (4`Ѝ00p 0L*p  i \4clo`_0 0  S 00J W` ꐧD \0,, ĥ <p,̣p0x`H0 ԡDx81O-0 MX C*  ! 1 a Q0 `P ,0 ^_^/?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y$00 ЍPTLH(0(0 @-p[Y; hA-@@`V 0 CQPqTP pG P*TP 00`넞p@-@00 R \\  !$00D0 0@ ($ T؝@-@PL  0S  T0S@UU@U0P/0d 00 0Q,0/01P/0(00$ 0/Ḝp@-@P0`L  0PS(  1T  0 $000{`p4p@-`0P|R@P  PwRP 00p/< A- 0@S  P p00   ($ 8PP(p`P0|L :*O- 4M0 , Rz pTT: 0+^, 0? 0,:p : Z0 P ^_^?` 0000 0 0}OR `^ :R ,0 00^ 0:S Ve \90 P9Py0LY0H9p0P0,00 H4  S   !$RH S(QPOV` Q , 80( R? |800 R? l( 0S  !R L8p0( p$ p b Hd@(`P 0!4 R B  B QP70 pH'  ( |'  X 0 hG @400嗠 p20 0H 0C(01`,0ǟS(00$0  ,00$$SfS_(@CPs @T  B P$ , R  A  r,p p$ P  RP p  B RS RA 4Ѝ50wPP @ `%0 0 0  % 00@T:p5 B0P\500L50 4A Tn 5000C?00 P$ ,p0 R`1j#S$0r $ P@(vgp 0! P 1@ V @ P $H$ $`V `$ % @T: $ \ 030$@ \ `(0pp00>3 0$  T` # 0$`$1,hC@ 01$000b`,0Q,0 PY `F `($0 ,P0 (XP 0SJP( 01 (0WPP$ 0,P`1 0,P$`1~PT `@ P $mb0`($0 0$`1j(,@@ P $XP, 0` 1R(0 `<1!0< ^ς}0S0 00@P +.000@P$! /1:^0   ^00 pp<_뼚7 dP \`xP  \@t0ȔhP4 xt@-@P300Q  P    $00<0 0@ ($ Xp@-l@@`VpPPpS0U1pPE1PSp  (0$ 0p贎QA-pA@PT`QV0 O@P 0 pPP``p`0(`,`@A-p`@NPP T  0 000P   Dd@-@@0/ 00(/000/004/Ќ00/Ἄ00/ 00(/ᔌ000/ဌ008/l008/XA-x``PU pqW@PP<0< 0 ,(0@l uNOP/< <0 44 -0 M0 tR Ѝ䜋 l{@-@P V0`00@Y0 0 5##@-@Q C00 2 * 0 G-`P@M@pZ 0tp TV 00J 0000 00 000 0$00-mPP9 0 2  <R 2"  "V &= " 2H 0 p000 0qpn W* W+ 000@qV 2hP@Ѝ00@T00-0cmPP  02 2 2: 2( xiP)0? 2< 2D1D!00<1 0001 0 0$100100 1 00P 0 R00   0T 0 2 1 3/pn0SW 2: 2l cP 2 @0 2@001P,00' 8<,$C-p@ MPP  J00EPEUC\A@E=2 2 X b0 R0S 2 +13/PP"?o2R03S FPA (0$`( ) 2 P500 Ѝ(0 $``VP ЍP00 Ѝ(0" $``V000`V "V00"?o`213/pP ӛ Ѝ@-`@ MpPP  Û00U,0`V( 2S * 2 P13/PPF `P 0 p 2 P00 Ѝ 㕛 Ѝ0P0P2!C-RP Mp-:b V %*AY GcpY  0  P Ѝ 0  P`V: ЍMP 21`W 2< 2 ЍO--Xr M9* 0:`Q̡@cp@ W ZJ̱ PEMPP( ̱10PEUP 2< 2 Ѝ0 PE*Pp P Y Ѝ0 b P Ѝ"1C-S` M2:rBW R"*T$* RU  R00U00SR v0 4 PpX U"B Ѝ 2< 2 Ѝ!MP"! ЍG-r"W RbM"*R* 0 @\0 U@D0  PpY  U 2< 2Ѝ"ЍЍG-`഑p 0@M PP IP!X%( 0!0x! 0CSa%Xà @N 8#8S0C!  0S001P@10CS㣐.* 8#8 0 BR ("(R B("(  0S81#810T!2 B0C!2_pl0l l0 T T0T 0b808 80 pP~$̵0@- M@]0P  pPP   Ѝ0Pp@-`P@0S  ՙ00T T @00p0Q 2S@3:A@P p(0 2S $A@P$00C$0 2@:0 2pC-@P4M0`S  㘙00 Vv 2+ R3 13/p* 0 00@0" "00  0$03 p`0 9/0P 9/0P ~d0  ^ 4Ѝs$  0qp 0 aP 2: 24Ѝ?(0p0`,0 09/0P  0@S5 \A R0 xdP  0 0(!S%$! $! 1Q0 cdP 0 㼐ᲀ@p 0 p 0 S @10@Rx ἐ@d'xP $1 0 !$1( 0 O- @1T@0 p0CS0 M@DP`!P A @P' 0 0 ]P 8#8R0  Ѝ0 0S0cP 0 0PI000@- M@ Pp10 Ѝ0O-@M` 0p0 `DHPph ^ PT0S !1  0 Z0 0 @@  0 `VN0 @ `FV 02*0 @`0@000S  `0C8`#8VpḐ01*0`00p5P ZЍ 0YcP 0  0 0 00 `X X0X T0 }0 hf|}T0ІPG-`"2 0(M0$00w?0 @Rp2SF:0JSC P P崀2Sp1!pp BRY:0CS㣠H* 8#8X8:1ሀpC1x'010'8@ͥ” 20 „ 2Fp!1 0 $0 30W(Ѝ PL ZP崀 Z ( 8#80C 00C0 0 b 8#8X*p0 rpP202 p    0  ` 0n sppx p8G J<A-p@ MPP`  Ќ00 2   Q a:1Q=0" B_!2!00 VJ XGFZCBH@0PU; "R!* 2 13/pX "\* 2<00@PI\0 : 2 J0 EP VP V$P 2: 2 0~ ЍR 0 Ѝ0PU "R:(0 $P0PUP`" ==P   Ѝ>P 21 mx?@--M @0 00 0AWhh 0 ST000S 3/ )WXC@ 8 80 $0Q/$$0S/< dȀ<<0 0R/( 0S/ t ltA-@T 0S^p`/nXP0P@QD D0@DP0 A/PTU('O-P$M`eJ@t娄D UCp4D$4aSX 0! 0 0VpLH BP b0@S<S9꼊88̊܊8888888888 , <04404 4000$4040(404,4T2E048 4uD$Ѝ $40$0($0,$0$0 R2p0X" P "2QfDPP; `000SdSPXR0 `0 00CS0z S p RF($R [Y $R8 [ Q R  D&@) 0@ j;000`006@?U0`00 9S 4S !HC6@ 4S $P^p [ [ ,$R ^B^p I>^p$R [M4^p -0^p   ^&^p [@?0v]jq+.'$'['('x''QtO-pMPtd@?3#` @i?#3pM RPGPP2 ] H@ Pꄐ,,,x,,,,`XP! d@QQ0, ,,,,,,,,,@0!C!-\\ R0C0p20pW WT Z( Y Ho```X`r`T! e PP  ጴ`Pg 0+0Z!Yq``pZVp @P @% B Rꤑ(PPxxZ U X \d 0S X  R! 7/ P  R ": $Y>  $O> tYaPZ0S @5@qlm&r+.$'\tO-ppD@6@f@4F]P$60`V^0S0 9} `QP 9^4P080540H`^P0%.(0@^P8}P0d `5`%H`QP8P H0@ 08,%43/00000P84 |^0 P 0!^P (1^P 0000/0 y`$0 `P0; S @,0(D 2#!H8 01/tē0 CS /1#S]P0 0( ,S* B"!!0 o^8PU H003/p0STgH0803/p8_P` G0 d P`0 0 S0* X 0 $03//? 0-S3  V hf6;_0 0 -1/0 $V6P0 0 0 0 `0d 0 `0d P0+ ,!^ 0, ^R0 00P  0 0h0l 0 h0l 0 0  00 R0^0 0013/o SB] S;G]XP\`0K ( (0, PU`00 XP\`: 7741xGZ@P5 ThMds0S\cT2S H  ;00/ P$CĠ@T 0p/S[/ P  0 S:  `p Y 4P`q3:($'8A-`@MPDY3 0Н nLP  K dLP  K ZLP  K PLP  uKL常H30D3PPP P$P( 30^P+( XP3( RP7( LP;( FP?P(  P>P( 8P ԳP8$@Ѝ(P (*P?0"(0S (P(0S (P(0S (P(0S (P^JxP h!p X3`PPa D1R`*PU 0E /R /Pp(CPU  00,0/00/j00CSԼ{P0$0~00S t[u0s00rꉍ((('C%P<(lVK%x v&k%%;(X:(%A-@PXV3p` b6p 00S VԉP uLP PP k``pP $ 0@V5ql$''x'[O-FM⨖P`Xp3` ` $6p p6 HX.0S ЍfP WP! PP p `RP dP fvP iP00p `rPxPpp0p0 p$p qX 1S oVDdeddPU J$0P S<500S5.*@X*/Q /P.QQ .QQ[(  Q00@  0P0S$0P`S0S@ ㅨpP ᶩPP0S ?t50C SWH0$S P w2 00 $ l2 ,0t0S $ ?RR00R0SV1 $0SX  噲P Ӫ0 0C0 ZIP 0S Q0S  -0S 5S 0S 0SIP 00 0 0NzX  ^PsHŲP k0S 0Sd 0?S` 0SỨ3S 1 P000: S RC S /o" R 0: S`HP 0S  P SH 0SxIoP ɿ0S ſ0?S 0S (X0q$'t0b00A-P@Va1`p m4p 00S AP@Pv3pPp =HP5-PW` /8P 0S 0S0PvHP-0qR$'tp@-PM  7 $ 0G&HP&H@+IUHTD0 00GP00mC0i3P SP 30S S! S 3 Hh3 ! l3 00T30S  R 4#6 R #!SR33 3 20S (2 20S 0S'002@T$ 0"P@B00CS00  0 D 0S60016 R0S 10S< 0PT<001 10SQ 10SM(x1d1POT10S P10S l1 `1 0S - 160S 8/ @$1 QH013떹(D   0S0F0S 00dq0S 0S 00lW@P`@To(qGw& (\((p((($(f|2Gx& x&G(v&(G1G-PM PU/b2r@@@0 S E GX" 2pD 0 L1 0"P8| GPh+dx GPP+L8 GP8+T< 0DS 00S8 0xL@BQa0D0@0 0Q)@0SZ L {PUbqa0@S񟗶<4@ꀁFP dJq@@L P P vP 0@0 00 %L(L(0@0 00 0 4PLu _D0S hx @GPT+M1q$'('```Bt @`ht@`t@`'a a+.t]gta@-xTvE31O-MpoTx.&lT@h$h`@@@ @0o0C?o2044Z/$4p4 X XT 0S@ Z`> [``: pRPGPP H@ PT`<HhP dP fPvP@` ``k0T 0090 S2 : 3P @ A0S #Sh2  ቤ`PdM 0\p#?. j0P0 8 I0pAp  FFp .p0S<0 0@0050C SU,,P,,,,,$ 0S x@Pq0SA 8p $O.p  1 R qX  Pp P    3/P00S  ) $&. t p[h0X00S K 0q(a+.Lx&$'at (PO-MMM`]8J^ f]50 0 5]5005 D]900 'P  " PY yPO PPPQ|loA@6P񟗳8p pp,pp|ppppppppppppppppppX`pptpp|ppppp0USxP a0pQT QH 0(<ȟS SS{ (o055050050505 iP  cP   pT0"S dn  p A0"S   p30"S P 0np0050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X o.U5SPP5`FV5S UUU0%0;JapPl%5S 8DP@0: S055PEUd0l@0V05xV հ4$04P0ˑ$Up@(?PP 4Cd$iB%%lh' @\D00 0$0( 00BlPP#2 (B>CB:COC嘰d0P` m0S #Pkmp@+dN0#S ({B'CO=O0E?o2? (hBX<0PP'f/۸?X  PPC`/~00CS0 ?P Pp PNU0 P00CS0?0 V 0S:00S:0!$1V511S(1S Pdh!iB?%%p&V|0P 8iP,0V0@ P,>m0`FV} wm P f/嘸0 HT  F%P(rs$fHs+.rfsssrrrs-slx&$'(sQC t8(x'sr ss'mdrUpP(PC-.'0 P !`p@X@P. PY*`00CS`0 0@T ЍX0 X @B*)x'O-P$udM`@$P(P,P0P4P P  -p4pK[lTT1Z03rTdT00 0IA0p-t$tlSPPP@SDDDDa0@SY*3P0 0dT5 RT ST# QT040  JlpT[ S0lT[0 0F*  $pH$ sBp8 dЍ $p$ eBp(l 8p8 XBp( 87 8pU  Hp[K z&@Pp`| v `[X\@T8 /BpD@0"0P(!   "0PqU!  P Q !k@0P 0k[`&Y@|-x-v(Gw08埧H8 p0 @0PU TS *\(` V8 ٸ 0P 0P@P0 P 7\ @$.)$'5)D+.a~DADN{D\i|D(x}DΉۉtAs yaratcid8('O-0XOX_-TaM22242222322p0 000 g,pr>`PpG nkPC 42"S 200002^S R2SW10 dbV%L0 ``qnp Lm%pP L0 ``dnppd2S P@PX0: S0d2232` 3`Sd2S|}0 t=]Pp00SP L t03PE/PF1@PC9P<4xH(@x A@9Pn*007000` ,b,000S0?# Rj0d204202020202 h[hk@ @8,Taߍ0220202;/`P000S )p, 00[ / `P000S  )p 00V /ЋP000S )p 0 08*0 j2000 0B BMvP 000S i3 S;3Ť)i00 0 5vP 000SX"\2RRX2Xi/ ቋP P ?PX0: S00y `P q&/tP   0PiᐥO>`P#V[>)?p X:{\104 [xt*)>d[ H#!14@(S8/>̲03%703 7ipm7037G P ʴ0 S 0R& 2S# 2St 0sd =pD;#P0 diP$5 f/ㅴH70L7 w?STP'\@<"820,"(2 P(PPO0 0  RZ$ j#$ P`Shd2S+ !?pX"=00RX!\1  \1X! 0 \(02T7,2P7p"%>pV%c=p` "o=`X%(P *U*)Ul~/J8()h#)[erdAedA@!)))")B >Ԟy& x'#)jF1 SR Q  RQ!R!RS !14!8!04P`CQښ. .a0C 2 0rdJ)+.$'edAL; th('J)kJ)y& qJ),h)>ۂٲJ)zd@`K).WO-`ؑ؁Q@p ~%p%W㰑 0S 0S p1`VA 0P h+0S P%H`V.Z ЍyPmPPP fP 4n0@ S0`tH00000000000000pAW 0 BP ^4PZ4P 8Xݵ+.8P)$'` O-$M5%pP 9P!!9D`дЄФK8000``` $p6Y00S 0S 0S lX``4pWQ* 0S00P ,㌯0S ㆯ 偯00W30S$ЍzPOPBP4 FPt XP@*PHPTp| 80000埪0P2 ᘪP20v00 0bX%j 00 倪 P00^ d w P00U H 0coXPN,I000E00B00? 0mXX1>0S  b00000'000#00 00000000000000 ` `0Ssn믞P` Bn0Y0S 0 \0P gPpG 0UnX0Xc7XX\b)XZ)+.])$'1`b)r8h CSP 0ӱ0pjaC Q dWSL4$  $ 4RD +^K L J ~O c{05xN 0Vt 3M pH n$0%c0!0 0  㶠$0S@. Xw`I 3V``R zS NkS CS BSHLS aSDcBl0CS>h          hb+b)Zim㮲PeH0SbI0S_O005S& L㞲P" T( ⰻp0 (0S 0C !P g@P!#@Op``Ẽp! |P|! uPd! 0S1H!|3/ 0\@ SPHf`P~3 (]P1!o  HR #B0 {pU PP 0 V  0+0 dp\p|&8e)}&\8x}&8e)|&8}&$'j3+.8`}&8|&0}&H}&88x/0891+96|E2oi69F9gui h9m@-ϱP _嗱@山'j)p@-D@DᆱPዱ@(僱 傱ᔱp@蚱j)&p@-D@DnPs@(k j|p@肱j) &@ A-|@|p `(PS,PV0`S8P@K@@4E0FXMA\k)&xdG-`Mv4P6WP0K5P0 ]p) P4\4@P L:5DŸD2D"0@@2@P 4\| @5 Hp HQ  5P  a@1  p0g0 @ p]0 @W S080<0@0D00 0000P0 0 80$@0P  8F3 HL@P@T@X@\@HP Hf3d3b3 0400,0( ,00@@0PapPPUPh0PP 0/`ЍG> G=FGoGyGGGG4&.h-<-|,,\k)O-`-||FMx6P(`0  p<6X0K (V0SFv@`@0V}P 0SЍuPfPFP RPh Qg@P<`00S0P0 D^0#S P00 $$00S  $$00S B`P ]0#S (pP $$0(0Sw P $$0(0Sk 0fP Pq q  `` @epKWwQ2@23@0 RH0cS pS: bSAJJK[0 0\Z9W W, 8 80,3/8 RfV A@2Xi Y2P˩ R00C?o20S`l tZ|WJ% `D]벩0 $0 000 00,0 $00S WZ 0 %ꙩ0S0:10S&1 0S  0~0 P 0 0 Q0s  `1000L,0 0n283PX& S R 0@0@0 #  R S 2P(00s  1p2X 1 072xI+.\3$'dk)tII8IKIbIIII'IJO-P'Mf M@p$PP p6 @DT T/ TX 唶W`PK'ݍ ЍAP? a@PP񟗡X!"" " """""""" "" " $!,!@!5P50S $PW M\e`pP%000P00` ៣P P ᚣP @ ᕣP~P P  儣 P jP(  \- qHPq/ \00 000#0 00$000 P@i(TPPLdH[(00;P(X@SW  p2 P  P( !P( (mW`@P T 0 0P`(Ȑ⨀ q+HP 00 00$00 0pZ@P V@P  V@PV@PV@P `P P P !g`LޢP X  P( (`m` pP( !qG@PP WD `Pa> 0pp+0S > +_ /`Pm``Ӛ 0V@ %}r0 0/pp` `$ W1P/0S` 00 000$00 0e( ?1p//ᗚ0Pa0SJ+S'- 29S!S 1aV`JN$'). Npk)+.N)>ۂNt NkNO&Oٲzd@edAp@-P@^>(p@-P@V>p@-P@N>t@-p@-P@D>p@-P@<>p@xp@-P@3>p@WO-nM M0잟@00p4`ߦ(PI 00 >R㸎0$0 0^>娮000(000 p@:x>P10?0S@>D$RP$r R  $t |00<4A @0<4x00 <$0/p0 IZP 娡Pp`FB@D4TFP****0**D**********$+p+*+***0******++*,P,,,L--***--...*$/*X//00@cPh< $wZPr tt 4< j$< $$r $b@<DP; $0 00 0 <L00(0 0,;0@= Y`; $500 0 0 (;(00!0 X 0 : 00(0 ( 0*:$00!0 0 :(00!0 0 X:,00(0 0 $:0:0S ( P0$0H: 000 0 L$!00 0 |:00!0 0 o:00!0 0 b(9400c 0 0 U(: 00!0 P 0 H88괸@0S 0 EPYE}`P0@4v YP@p 8(X MHPD40  EPD40D4Y  0P00O \@00 1 D1 48C?    P0 067000  * G: PozP/ jzP X0S 0T4000(0 <4 T!P\PFU ZU V♣  ᕣ0HVp0`R 4S<4Z0 H$L40Vu.p`'@?HL4@0S |$H?\H5HLX  $?N|5XHL0$4SH$L4R0& ,p`  VZ.p  4S@  DP = X  K`; PJ`Pd%dV5.p `1: SD : $R,@P  <P0P ,0  .P ,00S,0Z3$R  $H0$p!|$ L{ =p40P40 r04P  P$,03}pL{ 40S0X44SP04Sڀ2S, "20# *rP 0T40SPp'0ST4S h38#d`؞P P3 `s$2S 2H$L4P*pPW0 L4H/0#! 0(p<2 C  ?W(0) ;[vp̞lG   PL H$L4H1# 4S 0_X0 P0$$4RT SQ  X0  +p XS  !S0$Qh +S0$:$40 Q$ Qq8*mm)ihh+.q)$'jjir('i>l oWi oooo'}i/pippi0&Ru ii pi jkq)j)jYjjkjjm)kk7kJkfYkmkkyxfP8 2xkl#l7lQlll &-mJmrmMl}mAs iLmmHL$ Q,} Q+Q +*0$$0Q0$SV 4S$7P 44崀S04144 0S @4S 0  0@4,4S $4R#1ѣ1,4$00 00 00Vv  +t +0S 0+;Tp@ P! 0!d|yN]B;+ DuP6+-XQ.041$4+T4S) J,"d0|yV+***<+\4$P1H4P<$T1x00@ 0+a+peUc|LP;=0Z +P;=0=PN  Dp  TD > +-0$ !O--pDMؓcM0p 4, pP^3`4pGs04WY `⹠  ᵠXaO 4S<44S $$4R0#9*p  C `+p = 4S P,0S Hs$0w $tY0 0 $0k P0$ x1S  $$4P*`DBUZU CUkDPEU0>H=@AH=H==H=H=H=H=>>H=H=H=>H=H=?H=H=H=HA00vbPEUU@H=H=H=0@H=H=`@H=H=H=@@H=H=H=H=@H=H= A (\!8#80( R!0C RJ ("(T044s04>00 0 0 {0100(0 0,n0@# p00 0 X 0]z+.$'jjkkzz>l oWi opp&ikzk7kJk%r)vyYkmkk- axy r)@v)l#l7lQll00*0 +0$ 00*0 +000!0  0 00c 0 0 100!0 8 0,00\1 410(40S@Tt!;!GP!7T`j*p 4S (PP!$HL0P0!    (@P<2(0(p00S0 Z400 Tp$T"x$` =0P0 r04[P UP"0S3m`$`4S804S 1S !10 #4 0SDj3P T3P#X\cRc000  $Ĕ!<#%p3   S0 $ rrpԑ  +P ` 4 $$s(4S$ 0?W  I $tR $4&S 4%YX0; 4 44 W  0'0pcSpW=X0:S Q4S  0 V  (0Z00S ( $!AX0⫱ X0+O-GM MPh ;똔D嘤 Gp40PEPEUau@@5PG,F8GDG,F,FXG,F,FhG,F,FG,F,GG,F,F,FG0I,F,F,F,F,F,F,F,F,F,F,F,FGGG,FH4H,F@H\H,FxH,FHHH,F,FHI,FI|04000T庿(43 ?p00,p00000802"/2 (@2 !D~2 Hw2"p0L0mx2`" f`2D"_H2("X02 p00V2 WH1 p00X1!81 `1p00x p0V(pp`$  9qpp`0S  0[p` R0S0Shpl` 0A/sP"0 0 @xux@PQ Gލ Ѝ+.p$'" poƄ؄]1k $O- -M@L K@'UPPQ 'P&p &'p  A5pC`# pIC 0{0狟@{{SH{{S &P{{Z&P<;S&Phͻ QU $@<U< @ AG8 ({:ST(; 302HS<+10Y2E20SD C@4PQ$NLLLLXQLLPLLL0OPOPLQLLLLLLLLLLLLMLM0NL@NQLN\NLLNLNNODO\OxPPLPQ 09 0r P P0 P00R0S  Q_ 0;8;08;X 00d1IQP,1 P00S  ( ?+SP P P000S0? < - 0< 0: 0 P@0 00@; 0@0 00 008;0`RMb@A?{Gz?eA+.ɑЇ* 9U{$'ې/Mi**q**'Ȉ*'*3R**|*_*~*Б&&| @ }*p* Pl P000S0?` Y0P 00@ 00= 09: PP00PSp <> PD P00S0@S p0K 0!; 000 0! 0 000P1 P00S s  nY <01 ,d kP 0: 0 @>vP2!.8` [`22`VȌ0 V̌00 ň p+< 0] < Pt O 0@ 2@  0@TgPi 0C Sf0400000,00(00$00 0000000000 000000l 00\ 0`RD @@뤃夓VD [V:x8; 00 L0{%p 8; 00L0 m%p$ 8; 00L0 _%p` 8; 00<L0 Q%p| `D  |0 x;0y; D z+Ś0;0; ; '0cy;0z;(0x;+ @`⭚`L0 "%P@o;"0#10@00 0pKpQH E p   p0 $PJK0S ``K0 $P= 0  006 $P(0d "088v <@6``D0 $Ph6h&`l$tٚ`!2(1kkkk,a0a4aV0 0P````uV<;SV$>@ Rz蛟{  A 7:S$@ RVz{  A 7I:`"2RifT' { @l30S 0 ' @MHIN2 X0弅#pX00 A@+V0@V0 00D S@0`" 00S O `42 +$P$Gw42AQJo"$`7okfik@A{@⠋{'8NjGބ@8HINV X({*"PU8 v0S4 @<0T0x`T00`0p+t"pP a0S Ń#t;@000!R<  W0 0 |  d2"SS 0  -C6?8~A$@@@}*D*)'Ȉ**ƓЇ*DI('RБ&8*!G@ 1PS+ 2R`2 C8#<48#8Sh0!ddh|d&h!L0 0 d20 "  +  ``0l0hd?ph{3{7@{{{{{ {  M )*3`f 03  h⼘hnh2`0h2d20Wp |N 0H #$$@0(0"(00 2 0BS0 (S8; 2 |0;pV00#P2!(008C8S! 0 0H 8(#8"( 0 ,1币;    0; 0W|0H #$$@0(00"(0p I0Y 001 JK+P@0<0SW 0 0RZW|0H #$$@0(00"(0  0 H0D plph0Zp 8*Б&w͔Ȉ*'*'D ]0CS`abhdhdbbb chccccc dDd0 P Q<(aLaTa\adaaaaaaaaaaaaD ݋p`zlhd0\#!0D@<840,($ 0 NP@ 0 EP7 QDb`bhbpb  0 &P 0p#$$0(#"(! 0 P, 0 P 0 P Q Q rp0 P z0 P 0 Ph 0 PH 0 P( 0 P 0 P 0 P l `` #pyԕ %>Xnٖ/=b˗0LpzŘؘ \*0SL S<0( S W|:0H #$$@0(00"(0p  S<0KX0C W [B0C<0<00C <0= 0D0HD0X0 <0K+0C ;!< D0D0 <0 RKX0CWD0* +X  W)PWD0 <0 <0 ḋ2W p 0D0HD0X0 D0D00 W@ O-M`PX0@-S@P084 @ ($ t$  $p+4QP a`F0pP[NȳPQLpKG PL  bJʑP@\3 \C d@P Xixixixixixixixiixi`ixiliPixixixixiixiixiiL@0S @HGG 0É 0p7 4Y  `JZ'B`PKP`4b2 R n 0 S b ]U+ 0 s!00!0Xnٕ֕ӕЕ͕ ʕp84 p(0S 1zXC,z` np0S @]0 p   0I VpCz`d+k$'jB tbWBtqęڙKL; O-PAM M-@`눧WP |Pp700-S% P PLI @H p PZ `F00S @DDA@D `v a p ,0Stb@Q6 1 Ql 孈P -00 `@Z-00  D0B5S񟗌ollllllllHp 3S 7 0$0K4F`8A< <@7D2H- 0RVS0LSZYPQ#100gS @g;kp 00DX0  aR @L0Z? SpA ^F0-S @03Rklzzzzz8{{z{zzLz{zzzzyzzz4z@zzz{{h{,z{|zz{\z{{y{z{zzzzzzztzdzzzz"00: P@00 \:00 H:43043k0830<3@30@3``jjiihllkT40 j T 40 T 40 T 40 T 40$ J 00pT 40 = L00L0T 4% pT S SH0 SH0 (@00CSH|{{{{{{|{||{|{| H0D#8 D#<#  P Q0P0083 .00QG0G 0G@0G0G0040$  p640$ GP L嫌PH0S0'0 0-@PH0S' 0!40 GSW 43vSx0PG0僑`0`@~/`0aT cT gT0`7000P0H3@0P xH30娐@cD30) < 00R*SCP 0C00 40 0 @@TC B < 0004  T0dE 4`@T@D@@@ f0@<0S $3SW 0 8` R B    f<0 S@ $3S> 0 <` R B    f<0 S@ $3ST% 0 @` R B    gf<0 S@ $3S 0 H` R B    Nf<0 S@ $3S0  D` R B    5f<0 S@ $3S4<0@DSJ $3S0S   D0S4@ p`E07S @00 st  8o0S7 9 00S5 $0S2  Q. 8   e000`"VJ F8 30(#0<  J T`703S0S 00gS' @H0S#(hZ0`! PT 00S <[V[ 0S80 U4^8\<Z@XDVHTLRVTЍ +$'# ΅ ?l q4R̛&++x++++++M +p+8+jw*>a! !ه G-`XMP&P y I  p 90`FVJ2 :CDP$ b0@SS܅<<<<< <<,< <8<<<D<P<\0 60$60(60,6006046060860<60@60D60H6$&R <&4  <&,&R 8&R 4&R <&R 0t't7QpqQP P@@7=CP ,WP0S g P 0000NP&T60 9M#;P.P061 (VU@pd0+S L`X.4_a` @ PԉDl5 000] b<00/P 0T& t5 0 000:XP00F0000 C000C2#S0d000 C000C2#d v>C 0C0 0B 0 B "00P00 C0 2#10C0 0 0C0P00C1# 0 0 0C0P00C1#00 0 C000C2#0Vb4qp 0P 0PQT+AꋁJZ2V c`'os`F P$ 0SU030#:U %5PXSP H1 4'P&T6K/r09  3PvTS0 0R3# G@%rRPE X!EK/r0" Pr"E0<6S"46S|" 02Q|" 42t01 q\ 6S L P W0`W 0 ~P0 g q,6S m/PP (qا<6S46S;QL10@6D&Sl1 0 00R\! H& RL! $&DR@! 8&R4! 0&@R$! Q!   @/ 냍 @}@%t0P0|h++.$'iRH_+Q+x+B'x'(Wdb*7]Q!R^G-PHM`pI p10PEU& v HP h0@ S S꜏DDD؏DDDD̏HHII塭00pa< tP ` 1 !  )daEPP @؀ L`$@@`(` `C" JP P֌0S PxW CP XY@0 0000 ^&+.$'L; +t ayt hCt q|G-0HM`p0# C S fp 2B1 `FS 1S 0$  !RS@$ P+PTPQ@xP`PAP MP2 a0@S꼒48̒ܒ888888888$48888D 00 04044041! 00101@30@3101101101101ДY 000 0HЍP uPPp  ?0S  a0 `PPV q V `FV R $Sa (08 ]V Zk++.$'y&vw+t'C-Mp`ᮋdž@PV p-6TpF`F5 VE@T XᯆP H᪆P 0F,V mp6PU 5 `V V 50S aP tP0S 500@V 0S qpG |P`VV \\X LtP9@PA0@3S`̕̕x̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕̕ȗ̕ܗ̕̕$0<T̕h|zP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0 B0SZ<0SU00SPՅP0$0-:FU 0SA 0S 0S;`V UU5ễP xᶅP ᱅P& UH U U6PEU2h($(((LU( Q xP! +> U4 @U U0000    U Qa 9PJ 00000  P  j $0S [ F 7p qpk*M\@T a 0"600"$0$P @)P $P`j~+$'W+.('+. t . Tm 3G-MbrM@P p10S AġP` R ލЍRP fP749)P` p=X@0JERP1 JuP/0: S2  S)J  P0 JN@~p 0`4S00pZ몉0S Pp FJ PJ @PJ(`e+$'thC-GM M`\<,00M (=P<8 =8X@8DX=`{X`XdXhXpXtXXXXXXXXHhLhPhThXh\hxxxP0D80l8"=C0 8qPP   AP:?T 0<\$L 8 \P ,<, <V@P PN; T(X@0Pb+TX8 @;P  0S;+,|Kh8S <PU GhX )P@ xOoBl;p E{+T;8(p <{P Z`T`hiOPdhJ0㊎pP 0pP:T Px: h(PT: T(X( ᬃP : h(40FDSNtT``<0p|ģ|Ltؤ$0 808<)&p`H0 aH9  B 01W0، ܜl  d8\0>0X `X冖0P S00 ts0X8T80 P:$B?   081<S|w+> P*Nl0:[P 0XP:@P xNp N~LT@PDN< N0@`(r[PP0@P`Ax@+>00@0@8004`<0U00P<P8m[,8U0C?o20SP ,R `0 ,0S Z,8S=u 9j,8S q8+& \7 TjpIl x'' +. $'+.ȣ&0Q('EXNd l+.fAs .'O8#/D8J'}T8_@ ,  ( , nG-P`8EFh宅ȀP03fep2S l PQ9Uh xPH 嬄p 9PB/PE0@' s jpl40pEWQU P4 000`xP, L ,=PE0S#44$ 3 \PfP 8vP303 `px pRl{Pd34lXj4S HSiP  48L] P 4SqS|iPl l  PnRAx,`p1<01 1> 11bG01/΅01$1|h;97<㐄0"02Q$6p`h Pe Q18C8S h^q`0hVl00C?o20S tiP  \h=S` 0 0000l >i18C8S 3S P P=?o20 P Pl "i18C8S 0 P `P?o20S 0Pgjx,(0$'',Q '&W&&,(,( t'[qC-@`DP]P1  刑q儁 p0h1QALH1PD p41?8>P (9P1 nSbS9S0S00C0c0C S 갳ȳVS _ 0 00000T TTO 6op0S1, (&$',+k(' A-` fP@ CPA dh庫pPB rP p(0<,0 P80: S0S00Hm`P pqrP 00SpWjW  >`P 3 |3| C?@00XXXTs=W000,2", 2pP1QW ;k hv<1 Ѝ0pn40TP 0t<0S0n<0S0h 0U04 0!00L1QX C0008sH$H( p2P0 0P- 9P(/@P$ @( Z Q$W N !1VP 40E4Ctt 00Pd m1-HQ +.$'t=Q SQ ^Q }Q Q Q ('ht@Q R Q Q Q Q (%R R  G}͉ PR}0S \0 0/X0 $ P}0S 㩉 $ȠPp0  Q   S  R#4pt}0S0㇉ | UGTP@Pp` tO-0MPP00`Cx@P =x@PXߍ*.({?X1?/0201 2211("T122{p͐tpƐmpo㾐&k p d10. 0>(p40H 0> H0R`1Z8`1ޜh>(0pQ H1!1lү0 (Z@Pv0` @n H0R 0>00(.+(S`18`10SpVPMP 6PU ?PL 4PԭpN@P񟗬P$0pfP j@PP񟗘\4=0X1h=lh~f`zpwd1f3d1kq0000k0dAC0ed 剖`꘬p]0 (PP 0P 0%Pe(lD n0 HR(C0 (⿬@P 0 (P T8d&`(00`1(p ϛ(1S(P  qo(}kq m(&( :0P ZdA@ @0 Tp  p 嘛( 0 R 0 0  P819:0  0  @ÛZ/0X* P p0@ rnP*( %`11`V nPP[9 )[90) 0)0+(Rd1 (⿕nP{P D@ ({(0 0x9Әp0`  W! (Q0S` 4 PsWWB  (c╙P9( `!d10d180D8"/0  U`!0 2s8"/0 G2s "/ =p+ `1弚 (JP垚`!d1 0d1(007 pt}hz(007 㣖p {0S $|寚`aa0pGWz0SPz0S z0 S `1d!8 0d!'zpz0S &|党pz0S &Hx( P q(  njvgGm`1 H 0 S<pP O,p5 P 8d1$A>d1 0T1(00T 6 0p*lA&$0 T1(00T5 p(0mp ,p P d10d1Fxw崗Id0(@00 `P @ 0 \40 (pd `!d1$$ $$ 44l(ⴝp (qS-p(004 Õp@ԙ!R`14`11(tPx4~ 0t000!0R0S"Rd1@(⚎`1!紜0P!  R!礙000 Q01pW< (⸜(⤚`1p (j1PU5`1d!( = V @> ;0(M(⮩1R@T? 0S 0 @~@ 0S  p 0S ᦌP`P P ( RV R   (001Q@0 S   0~PUQF|d1@00f倗mhd1@ 0n n :n %T r r r & n n DU $'qs [l sl +.Il cl r s IT u 1j @As 6s Cs a-x uPT l Rs hs s u s s X s s s t t %t 3t Ct Xt ~t t t ";j t t t t n 3n n t u |(u Eu -u pu u u Hu o^y0S 姘  Q/0@-0t h P ^0eP1@ 0 0$0108R Q0@-MdPP@T Ѝ0L0 0 0 @ ue 0@nekКĚ0ƒ S&* 0@- "@ R P@ 0\ R^H00"@<0 0 0^$00"@0/Pkjjjp@-`dAdd1M@0`` H1H!0  00 0  0 i/ QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp- DԲX dX- \, H,, @-M @ЍPh  Q/X-M  0 p 0 S 0 0 Ѝ0 /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/:*/)7*/=4*/1*/.*/"+*/(*/%*/"*/*/////^*/*/*/< */ */*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/& */*/ */*/*/*/K}*/Wz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /J*/G*/1/ B*/?*/I<*/9*/6*/3*/0*/-*/**/'*Q/"*/!*/*/6*/*///*//7 */>*/4T*/@-@v@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress-mEP5 s<;v |!dH8\\8F8*- :d@8 K8 L t  '$'f8 D'd'l'''''- `;- EOJWgdglltP  ԛ& (Q \+\1\|@8@=BPO6 It %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory C^h,JXSP) @@OSD@@Y_0t  fl@@IxD*@@runblock and -DNO_CONV?<l@4`@$oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... |? ? ?????A??A0??@E"@Z6@K@e@{@#@ @_@^@F@<@>@?@@PATH= " tK fIdIIshOcIImIIlIIr s nEpIyDnIIv Ib    EOF reading here (<<) document>؇NNNNNNNNNNLsNNNO OOOO$O)O0O4O8O?OFONNN8GNNB% FdGSVG }-+?= )- @*- QQ%Q+Q1Q7Q>QHQ@\G^GGG GQQabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'|(0uS(1}S(1S,(8Sh(0ST(0S@(0S(0S(0S Tc)^ d  RA^H_ M 5 R CU w9 /HTlKTr w!)^}$ 7^vw\                  x kUs |iSFpU$^vUtHlK {UFrx(~U(^UUUU0U07 ZpZUdP7 plFHER!UİSkoUU sU8tUXSU̗U\w G o^t Uh/Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20240503090059Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed] ] &]*] o^/]5]t 9]67 5 !]  __]:"2 *^,^+r+^**^+E_T+%^+]<, D-^X*C D-]d,,^-!- -3^4+'^*,],/D-^^^^^#^3^#^3^2^3^3^#`___ _@@_ ```^^_____N_ ]_@d_V_k_wq_^x__ G^C$F^CL^C$K^C_S^^^]^f^^^l^_^^^@t^@_ |^ ^^_!_@)_1_ 9_9^8^A^@^_____ _@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.vvv@mu@v@v@v@v@v@v@v@v@u @v@v@v@v@yvvvvvw wwEvww$w+w5w=wDwKwQw]w@dw@iwnwxw~wwwwfvwwwwwwww{vwwwwwuuwsttPtatuttttttuuuR?u7xxxxxxxxyqx y y uxz6y_ynw xxx#x2x9x?x7FxKx"Sx֫Xxaxlx qxuxyx6xxxxzxxxxxeumuwsuxuuuuuuuuuuuuuuuuuuuuv vvv&v1v:vEvJvQvVv]vfvkvsvyvv7xxxxxxxxyqx y y uxz6y_ynw xxx#x2x9x?x7FxKx"Sx֫Xxaxlx qxuxyx6xxxxzxxxxx7xxxxxxxxyqx y y uxz6y_ynw xxx#x2x9x?x7FxKx"Sx֫Xxaxlx qxuxyx6xxxxzxxxxxchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] v)Usage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'*=Stբ / N y  ǣޣt%_äۤ !#$#&12+345G68R9X9_:x;<=ȥ@ץAB'CSDzEFGHJLئMNOPQ"R7SQTZUbVzW\acçde f4gGhGiGpNqstudvwjx~ը%7Xx̩9Kb~êߪ8X`yxQmūЫګ4GTfͬͬͬ$<Qnۭ)IdO ,FYͯ"R/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]. P8 Z3 - P8 w xxx#x2x9x?x7FxKx"Sx֫Xxaxlx qxuxyx6xxxxzxxxxxreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-v-7y f0       % Lz&{&hz&z&z&z&z&z&z&{&0{&H{& |&`{&{&{&{&{&@w xxx#x2x9x?x7FxKx"Sx֫Xxaxlx qxuxyx6xxxxzxxxxx*=Stբ / N y  ǣޣt%_äۤ !#$#&12+345G68R9X9_:x;<=ȥ@ץAB'CSDzEFGHJLئMNOPQ"R7SQTZUbVzW\acçde f4gGhGiGpNqstudvwjx~ը%7Xx̩9Kb~êߪ8X`yxQmūЫګ4GTfͬͬͬ$<Qnۭ)IdO ,FYͯ"RSFH0eC쬭ЫSFU0eC쬳yxHah!IdontNeedEFI(s*K>;; |nQn- q+|nQn- q+|nQn- q+ |nQn- q+#.|nQn- q+<x=rGy=iG}@K;Mt?VamWC 3KOOlwyD<#*=(3Dh&ǖ\ M}-@Mjy֬-чHqx-чHz ZIчHP8 $IчHZ3 7IчH\B2IчH]S'@ )Ѹip*1@ )Ѹx1x )Ѹbackupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps111setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcapsU8zi}&yiUUU}&00̀&9nUU}& & x&(0&+9|&1H&X:T}&7&a:h}&k:&r:&j:p}&q:p}&::::: :::@::;; ;0 ;@);2;7;} <; G;M; S;@l init_current_mediasetmediamodesetmediaoptsetmediasetmediainst!=G,=!=Z7= 7,= != `>=F=@>=F=,= Z7=media_statusmedia_constructor==^<X&<=^<X&^=^=&==== &==<^<&=&paddr_matchlL$X|settunnelH>}&N>Ђ&print_link_addressessetvlansetvlanif %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAۂ+. hOy ^. (STM _OO M6O= LM@/S6S;SDSNSRSWS^S bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node getmntoptsegG:jM:m:o:rU:%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsunknown %s id: %sinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.SS)>ۂ+. hOy ^. (STM _OO M6O)- @*- = UvnLM@J. @tOqOusage: %s [-o options] special node specified device does not match mounted devicemount table fullincorrect super block%s on %s: %sreloadSS)>ۂ+. hOy ^. (STM _OO M6OBO KO)- @*- = UtOJ. @vnWl LM@WO]softdepSS)>ۂ+. hOy ^. (STM _OO M6OLM@usage: mount_kernfs [-o options] /kern mount_point kernfs on %sSS)>ۂ+. hOy ^. (STM _OO M6O)- @*- = LM@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s SS)>ۂ+. hOy ^. (STM _OO M6Ovn= LM@{Uqavaa a a@aaaaa a .@Q ;`A`aJ`T`^` i`@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvConflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cwsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s= SS)>ۂ+. hOy ^. (STM _OO M6OLM@tOqOusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o mmm4nlnnno,o_o|oooo p pAphppppq 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @*B;CJFVIoLyNO4SaÅbӅcޅefhKiWkcmqnorsu†@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp `` Ōʌ@ ό $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()۹\\\߹\\\\\\usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY$<eCu=UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print4  &6; HVhu{``/7/K/[/myy(;B[q 4FKY`qllbitmask_scan2l %07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlnsendrequestrecvrequestq***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16K) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz  " $#!%Z^\`[_]api ti : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataqCULESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-in u $ w-~  *z- q(- ql-  -m!  -  -  L|- / ){-< & -E q -N q -X qr-a i ,x-v -} - qІ- P8 T- n +y- x- ,- (|-  L~-  K- ! J- ! +! K}->! & I-G! qg-P! qf-Z!  t-f!  s-w! qr-! ! t-! & q-! q-! q-collect# [+ # + & 7 U+ w xxx#x2x9x?x7FxKx"Sx֫Xxaxlx qxuxyx6xxxxzxxxxxNAME=- Z3 P. mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsw xxx#x2x9x?x7FxKx"Sx֫Xxaxlx qxuxyx6xxxxzxxxxx edit_fs_type_extK s `z 4 |4 4 H I ;; |nQn- q+|nQn- q+|nQn- q+ |nQn- q+#.|nQn- q+<x=rGy=iG}@K;Mt?VamWC 3KOOlwyD<#*=(3Dh&ǖ\ M}-@Mjy֬-чHqx-чHz ZIчHP8 $IчHZ3 7IчH\B2IчH]S'@ )Ѹip*1@ )Ѹx1x )ѸQ .O AO YO XwhO lxAxO |O O O O O mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newМ, ,L< xܼ4\D `TL̽Ľpmbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_free/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.10 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.10 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.10 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.10 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.10 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.10xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32gamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************qusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2Ykdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionm bcd@mew fd} g}x hx iY`jn kp} l mz} nj]o} pȉqr} s} Rty uv} ws x} zWy} A} B} Cv D} E} F} G} Hy I00J} K} L\M} N~ O~ P~ QS T#~ U-~ V7~ WA~ XK~ Zj 1Z~ 4c~ 6.l~ ]} |~}~ }~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ y A. r{ ~  2 V{     ) 3 D B K I Q ^  d j r w  }  f}  default_configread_configrt_compare_protort_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init8 2s  A0x G script_buftoenvD } zK make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osA* 0 4 9 = D if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leaseread_leaselog_dhcpߏ  dhcp_bind a  "   *  2 dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sSTOPPED%s: removing interfacepid %d failed to exitNOCARRIERPREINITDUID %sdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.6--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.6 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.6 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ' X `  X h ʢ muТ ֢  ܢ   u@ l!h!d!ʢ ԦmuТ \֢  ܢ ( l u8 | /etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist