08g<  gd&Sut utg@@<@T 08g<  gd&Sut utg@@<@TU gutPP`AgggAgggA.gggAgggAgggAgggAgggAggg=Aggg>AgggHCgggIAgggJAgggP$h gggmD9#ggg (08@HPX`hpx$|gggL$Iggg (08@HPX`M$ggghpxE$vgggeK!ggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg aggg aggg aggg aggg agggagggagggaggg aggg aggg aggg aggg agggaggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg!ggg4!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg B!ggg B!ggg!ggg"!ggg"!ggg"agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg aggg aggg aggg aggg agggagggagggaggg aggg aggg aggg aggg agggaggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg!ggg !ggg!ggg!ggg!ggg?\!ggg>\!ggg=\!ggg<\!ggg;\!ggg:\!ggg9\!ggg8\!ggg?\!ggg>\!ggg=\!ggg<\!ggg;\!ggg:\!ggg9\!ggg8\!ggg:\!ggg7\!ggg6\!ggg5\!ggg4\!ggg3\!ggg2\!ggg1\!ggg0\!ggg7\!ggg6\!ggg5\!ggg4\!ggg3\!ggg2\!ggg1\!ggg0\!ggg2\!ggg/\!ggg.\!ggg-\!ggg,\!ggg+\!ggg*\!ggg)\!ggg(\!ggg/\!ggg.\!ggg-\!ggg,\!ggg+\!ggg*\!ggg)\!ggg(\!ggg*\!ggg'\!ggg&\!ggg%\!ggg$\!ggg#\!ggg"\!ggg!\!ggg \!ggg'\!ggg&\!ggg%\!ggg$\!ggg#\!ggg"\!ggg!\!ggg \!ggg"\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg \!ggg \!ggg \!ggg \!ggg \!ggg\!ggg\!ggg\!ggg \!ggg \!ggg \!ggg \!ggg \!ggg\!ggg \!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg!ggg !ggg!ggg!ggg$!ggg4!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!gggagggaggg!ggg!ggg!gggaggg agggaggg agggagggagggaggg?\aggg>\aggg=\aggg<\aggg;\aggg:\aggg9\aggg8\aggg?\aggg>\aggg=\aggg<\aggg;\aggg:\aggg9\aggg8\aggg:\aggg7\aggg6\aggg5\aggg4\aggg3\aggg2\aggg1\aggg0\aggg7\aggg6\aggg5\aggg4\aggg3\aggg2\aggg1\aggg0\aggg2\aggg/\aggg.\aggg-\aggg,\aggg+\aggg*\aggg)\aggg(\aggg/\aggg.\aggg-\aggg,\aggg+\aggg*\aggg)\aggg(\aggg*\aggg'\aggg&\aggg%\aggg$\aggg#\aggg"\aggg!\aggg \aggg'\aggg&\aggg%\aggg$\aggg#\aggg"\aggg!\aggg \aggg"\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg \aggg \aggg \aggg \aggg \aggg\aggg\aggg\aggg \aggg \aggg \aggg \aggg \aggg\aggg \aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\ !gggi!ggg!ggg!ggg agggagggagggagggagggagggagggagggagggagggaggg aggg aggg aggg aggg agggagggagggaggg aggg aggg aggg aggg agggaggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg!ggg!gggagggaggg!ggg!ggg!ggg B!ggg B!ggg!gggagggagggagggagggagggagggagggaggg!ggg!gggaggg agggaggg agggagggaggggggbpf!ggg $ggg$>ggg$ggg$sggg$ggg$gggAgggmggg ($ggg08 $ggg@AgggKAgggLAgggMAgggNAgggOAgggQAgggRAgggSAgggTAgggU7;"1j8%ɆhcoXlo!Mo qV jcFQ+tOOgRuaFJ/T#D]ikJ4\ks% 1Crwil+exLFZǢ`ԝh]-:L="2Ir'Ԧ'ǵUd'`tR?@U'Od\ggM!G{;+c=EM0PT"Kh3[7?1c]yM%wf|.,y+5DѬYqkM%=EY@MI{Q_hRZ:Bkd(JRMZ{ AvbNȕ&}oB3ut . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4H7#4 (!"!"T~"T~'T~' YLLT~"T~'T~'Ptd!#QtdNetBSD@ ;PaX NetBSDearmv7hfH-MQ `10 _V`W@@PP R     0R/S SP жTP( `p`pV*0/V:dྶ\`\p`pV*0/V: -~̣&(&D&3'T&&|& &{&x&h^p@-8@@4PPUp(P`0/9Ꜣ&t&0H- @ P@P0/T0(L{&ȡ&A-@TpP$`/2P @,@P@Y"P PQ (@ @ @0ᨷ0 A/A- (@@ @ @ᖷ,` @` P@!@ pPPU: ᤃP ၷP ᙃP@H-O-M`Pt @  ds㘵E㨥(@Xp@(@(@@(@ b@Q  (@BP /@ 倜(@(@(@(@(@np2H(@`(@P  P A Tp. (@Q(@QQ(@Q(@Q P(@  (@p@ضЍQKI@O-M⼕@ (@ @]n `娅.(P@@(@ @pV  V!P P% @`P p}(p@@`W }(p@` j @㯛(@@p`VЍO-M@ (@(@ @pnU `娵 WpP@(@V !P P TpP,J Up%   P/`w`2`p V Spp`ڼ(@O PV Sp Sj @N@(@`VS@ρЍ  @O-MⰅm@ P(@(`@PpBpp U P  W Z P  (@P(@P W( X@ ޵@ W W* (@P8W@*P P(@P`pP @P` >XX^= P(@Pmt'X@ @㯵@ P(@P^`pP @P` XX$Q POX$p I`pP @P` !XXM X^pu `pP @P` X P XI^XI Pp W^XMpY `pP @P` XX-X-ԵpG P(@ `P@`pPu P XXP&Xᶵp!(`pP @P` XX^X^㣵p `UA`@?Qp Qp Q X  X X⋵@ (@j @(@ `@ЍI@K-M (@VUPR u㔅(p@(@Q& R`P@ YRp=@`V nR`P@v ʼ(@j @ۙ(@Ѝ`V SP ` V ԉP@OQ (@`V V`I@rO-M`@t @$܃v  @'p@/@P 0JPPQP f@Q Q QKPLP PP= HP&"0 @RP XP"H(@0Aq -R  PP0pH(@V PU P pRp P#p[ pPp Xa@@RUPP!@Rp;@ @@` @ SPL@P-`P PS Op@ P2<<<<<<V! pPb{  @`S% P 4 $ `h  @A`T  X38/P `Y j @㝘` "@[H-\  (@U@0kO-OM@Pt @ d(@ܩ (@y (@ (@`@(@(p@(@ ePH@ Q,$$$t$$$ (@ (@ (@oP fP6 iP9 lPF (@pP/ rP2 vP< (@aP. (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@pH(@@DT)(@( @ RQ' )(@( @ QR Q (@Q(@Q @@(@Q(@QP(@P(@PpDg '`@Q$L PG@ _PQ/U P  A A Q Q/R @ (@PaQjQpQP'T{ (@P  (@P! (@(@ AQp  P) T^p/U$Y@  j @ 3Qp j @  P (@(@p `V @ PWP:@ /R @ @R: A` @/R `V  q (@/O-M` PpSPz @2Pm  '@P @p@Pbᆚ  o@\} ZX 0` @@ P \ @M}pP-LPPZ, P/,@P, @&P 0,/QV/Q/P@ E0A P:@V ᣖ  P Pp/Q  PP (@P XPHPpP2 X 0`P!0#0`(%0#P @|Xp  P  Z  U+ : S  @P|X Z 0ZE0P0%V UW`x (@PF uD9(0@`9(0@P5` PSM Sg:j(0@(`@ Rpc P  P) PS )@v|  [L (@P  P P LP  PPPpU  P(@P( U @ "P (@P LP*( @AQ<P(@P XN I@$|pvOPpaP zЍ j @A "@<u&6@ @0@62yD u&6@ @0@?$y@- M@0 `@ *` @*@P @K ЍO-M-MP (@P  '@@O NPF j  Mp<} Xp(@P (@P `(@P (@`V`Yk  '@+Mp8y , (p P@ p4` x 0<7p  PN$` A (@8P  '@(@`p@0GT# 1MP`P  0 A `$ @ 4 00@p  펯@T`j  @㥔 (@P  M'@(@@ @wP@sr (@PP  '@@_N+Mp8p '@j @pt`xL 4<(@(LZP8 A Z y@(@`0(P@'@(p@8 LZxpv P c0 A4  `00@ @  <(LP(p`,zVM`S (@9 P@*p P YP @'@V Mp H Q Mp  '@ <LP7 '@ @<- Y@0j @ړ`(,p MPZ j @̓(p`,I8P(@@P <P  '@@㸓<XLV TLPЍЍP EPUPP PY  8:LP  '@j @㐓PP  '@(PP(@P8@MP  '@j @sP` Q(@8LLPY@H-@P z=U00 6LP` '@LP `P  '@L@<`U L` '@LP  '@V@%` W" (@PpU K '@ Lp -PP  '@`@`U '@P`A-M@ `P#oKp Ug '`@ PLP @  @ KP + @͒ۍ (@P Xap@-g @Q'`@ PLP @PvKP 7@᧒p (@P p@;pp@-g @Q'`@ PqLP @P"KP B@ၒp (@P p@pH-<  (@l@0K̪O-M(`)@hJ)@V)@@) P@@PW =p_ PX `QV  0pPS S 2/`V #=@Q B B @x  @ Q6 # @@Q@ !- @@ )@Ѝp@ @@  @ @@2@SH-M  @ 0}(*) @*) @ЍH-M   @ 0i+) @ЍH-@cH-M   @ 0R+) @Ѝ H-M   @ 0= P'@Ѝ H-Mh )@    @ 0#*) @Ѝ)@$/H-@H-M   @ 0*) @ЍH-@H-Mh )@    @ 0(*) @Ѝ()@$/H--@H-M C  @ 0ў(*) @ЍH-M O  @ 0*) @ЍH- J)@)@@P! AP R0PPP(Z)P@aQ8 )@ (*) @/H-, j@ @H-, j@ @H-j,) @ @~H-j,) @ @vO- MP@tg `@1 *pH(@@9J)@@$P D  @ @8$(e@LD @8Ip($ ? )@Ȋ)@ '@P: @-(ZhJ)P@)@@$PD @(8I @$#D @8 !Hp(8 $0 !3/ p( $ j @( )@x(jP)`@@  BP K)@@p PRp3WP PhZ)P@#   Q 0p@(!S#hZ)P@1#1/@x)@@@I@@D@ )@@ @@g+ ' @P@ @ )@  @ 0R*[ Z 80 ($03/Pu p?!p 08op@@? 0 `)$ PI j @㉏g  8p!( p1/ $j @xp   0@`P0@ 0 p@8 0@@ 0 @ 0   B )@hZ)P@1/w( )@@ 0ihZ)P@ kY"@ሧH- )@@P @PC @PP-(Jh )@)@@  aR*F:! pZ)P@` .!`Vp `(P 81/pP 8(1/pP@C@O-M(P)@ pJx)@@)@pP Ph )@ m  80( @0004/ @p  PpP/ n P`8@< ( P)@!# 0@#   *"@ (ppJP)@)@@ '%'  )@Q  `$)@ @t  S pWPWQP p Rp0pRp k*( )@pJ)@@" " A*) @  p`  Ѝl!@ ЍO\F$ @$ }@$ @$ j @H-MP p@`)@ FF8 ((03/@P 9FPЍp@-(PUp@8 03/p`81/(`p:@p@-M@(8 2/P$8  P 0( 8D3/P ( 0 1/p[P  Ѝ$ j @;@-M@\PЍ@v} PЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-MJ)@@  @ }E  @ uE0Fx0)@(^^@@V,4 @,dDPp$8@HPp SE-2 }?N}SbAW(/ P,$PbGS"CS?0x@=b/!p@`@@   @   , @d !E   @   , @d㬦  E    `C@`,d @ᙦ D /0؃`Ge 0!@@, @d` Pz DЍN@-@KjFG-Mj)`@ 9 0pWE @[ hj'P@)@ @8 ($0 3/PP 7 Z$C!8 ($0 3/ R!:80 B($0  @T@pGW0p@(! pS#1#7/p Ѝ@$ j @B-M(J)@@ 0P`*(!s# p1#7/p#C P`80 ($03/PP`U: 8 0(0  H3/p Ѝp8 (  0H3/p U* !#P"`P $ j @pO-qMM`t @!(! 0@@,K([)@@)P@  G@'QaIIRRRRRIRIRRRRRRIRRRRRRRRRIIJRR J0JIJR8J@JPJ`J8 )@$ )@T )@ "< )@H )@P )@@ )@0 )@4 )@ D )@L )@tP?X )@P /@@T nQ QoPo@o@`)@,pPP ,PP~PX )@UP @@W ,q@pPPp4 )@P P )@P8 )@PH)@@ P8+)@)@) @ RP@xP H(@P\P)@w ATU F|j~P r jʄ A` @@@ uDp QvPqP \K,)@@'!P  x@T|D )@PQ !#@ p @jP \)@  0pDp$ )@)@Q X)@Q P L )@PDp>PGpȜ `&D )@P +P L )@P  , 뗹$lZ P  , pU $  `)@PE\)@p0 P)@P(@&  b 0!@+ 0 )@P\)@[ 0t T )@@Ȉ`$T Q  P`U7 $ ` `  a1;U0\0 ";@%+![ *ar A  a1;U0\0 "; P@ $@+! *`r*a @0 `@r*b A `r ` B p[4 U)@P)\)@Q' P :PL| PpU:0 4)@)@P4 U)@P`\)@`U (rqߍۍ|@4@@@@Y@@H-  (@%@xH-M@UP P|`P `PU FЍ`@0H-@X )@P Q P } P Q` )@` )@ 0O-MMT )@P  0P .R @ ĢR $_ 8L8 P)@p0`P&0R @ @Xh @3@LxP #@ O|0@ !!@Vl  X)@P )@Q , dK)@h)@@)@P P#  P4 @@Rp )@@  E P! '@@@ @;  B'0@ 3 @ @, '@@ A@ ()@Q  '@ @h )@p+) @@P; P'0@  B k 0'`@ R0 0S P` P@`&H `)@P |0@0@`00@G @  J@ )@P { @ @k@  0;p@u5(@ TpRH TP0( )@Pl d 4 )@`Vo8[Dp@`)@? 0 P JP 㠛)@`)@ ,O40)@0 0 p  @  @ )@   (@(@@"4{` Ԉ  (@(@@"{0H- _@)P@040)@0  @ @0@-,)@) @ 0'@Q4/) @@ PڀT)@ * @DTP+P) @  Q @ QQ  AQ S )@'iH-+) @P00S S P )@R9 !@H-L)@ )@?=@ @AQPP@PP{)p@P/P )@@  )@@ 1P p 0P@`)@P=j @^3@Y@M`m=p@-K)@@P +pڰ[`)P@`P >Iz`)@)@p )@@ ߇0 (@y#@ I@p0H-@ )@P [)P@P =zqH- (@)@ 5ipPP. ` )@)@ H@ Bd P  @-)@Q@)@ @0 0AQ00////O-M0_@)P@` V V`@ЍP Q1,_)P@()@` QLPA)@rP pP  0  0 oP2PJ`PUp@- @)@l@ )@\@ )@)`@@ )@)P@@uy@Pp )@p K-|\)p@)P@@P )@Ȍ)@l)@  twP Q`)@#A ׆  (@(@l "@P)@yO-MP0P)@P ,|L) @)p@)@@)@(@` Q0PR+ `)@PJQe  PJP  R R `PʌP  @?,P @) @p P@2,P) @] jPu p )@ R )@P#\L)P@)@@0 R0002@vPa ,P ) @)@P)@@P )@me , @) @p0)@PPt MP9J~`P0J  )@P,J0)@P, @) @pYU< p)@ @P @P PP8`PJz@'Ѝ P,` ׅ( @l "@)@P )@ @wH- )@)@0S )@ P0^A-P,) @)@,P) @0N^`pAT V@@pW@`V@@P@PA-@!P. @b. @㲜PP >`P9Jp!P8 X0 (@y#@ လ@`"yp )@P (@@ k )@`@ ] 30 (@y#@ [@nO-MP@mL/)@`) @ <)0@4)@pP )@p@@pP)،@)@)@P8 `T ` @P, P )@X- VpPW(J@ `TY [VԬL_)@)P@P" T@  P-)@*& !ԬL_@)@)P@(@t@ p)@ 000T0PW pT` Q`ЍAO-MLܜl)@@)@)`@)@P PP@:Pu U4`3pZ  Z  "3 tPJ <)0@ Q `)@`O PL)@  )@R R,P0p00tP )@`PP )@VY  ')  (@(@(l "@;P8)@71 @Z+   )@ )@L/) @ QR P  @ ƒ  (@(@@ЍnA-@P!P@<``P  ;P6Jp!Pl匃0 (@y#@ ᴚ@ p )@P (@@ ᡚHUPj0 (@y#@ ᒚ/@PO-Mp` )@P @W( W&4@)@cP) PWL)@P )@P P PJ@AP*`p P )@P  ЍH-|@P`)p@T Q Qf@DPp&  (@(@%H@8O- M0o)`@@pp PW.@P' )@<)@W)0@!  W  ,PJsPy @)@PP  )@ @p Ѝ@ ~ @@PJGZlGP)`@UI )@P PBpZ Z)@ psPo `pP  ` )@ )@:U5 @P. lJ)`@ @PJxPPZz@pF  (@(@ol "@@)@P )@Q} QpZ )@@Cl)`@)@ ZPrP QP% @+5   (@(@4l "@GPL#  (@(@"l "@5P:)@@ -O-M]@(P@)@)@)@pP 3p @:Tp`E`` R R,p000,rP; Qp)@J D`L)@@ V )@傁Z @㭘e@@`T0)@Ѝf( @㑘l "@@P )@ R O-M`@P w@}T(p@ ( '@[ `Q A` Ep Q? P@<Z X!@<` A` \P @^RQ*p #QpQXX\X\㸘`V |@ P |3@@0@`p Q0A`0QX❘8X X 3`p A`0Q&QX X X⇘`p QQ0A`0X X Xpu`p QQ0A`0X X Xpd@TPu`P@`XX X RЍO- MPPr@o SH x (@@)@P@(@`/p@)@ GoP p EP% SP )@`xP! sP& pP AP! -P)@P`` )@` @ 0 )@`@P <@}P@xu@q)@㾪`P%[ )@QP P $PP @;P@@P@;@3lq)`@P (/@) @Q j @}XPPJ )@P P3)@PJ+ P0JP )@pP$)p@PN )@PI@x;@P*P. P`z@`Pu u6 u( @W; PP)@P@I;@PP )@? @)0@ᑖs| @ᅖP) P)@? @)0@rpP !PD   )@=(/@) @UOH-M@)@0 h Dx5P JP$ #@"'@#% P( #@"'@#%ЍH-)@Q@)@0  H-)@Q@)@0  0H-P )@@P !P , @P /5P @@0A-$_ (o,O)P@)@)`@)@@PJ0)p@ 0 0 ;R,R ;Qp R R  QpO-M0O)@@(@ 00@ P  00@ R @p=0G=SG`猎ȐЎ(čď0PT$hԔ@č)@P; q@0 W$ !WZ$)@P PP%J` QpR nR lR   `$)@Q 0l0CS  QP`4)@PPJG@okPJVW`GW`PpQ nQ lQ`@`pQ nQ lQ`$)@QD`pQ nQ lQ`$)@Q.`pQ nQ lQ``pQ nQ lQ^` )p@kPPzJ`PpQ nQ lQ` )p@PPP_J`PpQ nQ lQ`/) @ R ,P) @ RA $/) @ R@ PP3 p`PpQ nQ lQ`$/) @ R@ mPP !P]@$)@Q`pQ nQ lQ`(_)P@Q  ` pR nR lRE   ` )@PPJ`PpQ nQ lQ9`()@P P` pR nR lR4   ` )@PPJ PpQ nQ lQ"  )@xPPJ(,)p@)@`P~J$)@P  XJ4)@P V X``PpQ nQ lQ` )@BPPQJ PpQ nQ lQ  )@'PP6J PpQ nQ lQ @ $)@P4()@)@kPP p`PpQ nQ lQ1`D@P)@)p@`0 A R* PixP "Px ` QoQ Q gQ`pQ rQ`` )@PPJ(o,)`@)@pPJ$)@P= XFJ4)@PA`pPpQ nQ lQ`$)@Q`pQ nQ lQ`$)@Q@p ,)@)@ VPPeJ1@P w$k '`@Pw"P@ H` @$/@= P6$4)@(/)@) @Q e @ϑD P#)@P()@uPP 4$)@)@b PeZ  ,)@)@ PPJ( )@` P )@)@`qW`P`Q`9 !@<)@Qn xP P)@P()@,)@PJ9P P)@P()@,)@PJ4 )@0RQ P)@PiA P P)@P[()@,)@P X  QuP Pg( P P`( P PY( )@,)@" PpQ nQ lQ P P:$ ('@)@4?)0@0SB`P P'VGGGoogPPQ" P )@q. P   /@ + )@' @0 Q S   P)@P  ((@/@) @ PPJP 0l0CS  P@P P)@P M)@@Q o(P)@p;PJ 4)@P)@,)@()@PpQ nQ lQ`P P M)@@Q  o(/P) @X0,/) @  @@WWPwJP)@@d@g@b9 !@X QY ^Q QKHOP)@@ -#, )@P^" "@7P P54)@IP8J 1P4JP7JP!P )@  P)@ R P@pPJ 0 '@)@@, '@P P)@P  P`@\[)P@ FP <hhhhhhhhhhhhhhhXhhhhhhhhh(4hh@LhhhhhhhhTth$h0X0<Hdp|hx)@p)@)@)@x)@ l)@ p)@|)@)@)@p)@)@|)@)@)@`)@)@)@@ph)@)@)@)@)@)@~)@ pJ )@qx)@|)@ ?)@)@`)@])@)@'x)@ |)@ p)@)@l)@)@p)@x)@ |)@ |)@)@x)@p)@)@l)@)@)@)@)@ )@ `)@)@)@)@)@x)@ )@ p)@|)@plH)@(@x!) @)@PP @P 4 '@P`)@!)@) @`q1 )@)0@V`)@)@`R!|0)@) @`S` Y` ``^`RQ X)@㕥)@/Y)@Q pP P P6@0pP P P,@&@#)@P P@@)@P @|)@@ $@)@@ @R)@pE)@Q @)@Q @|)@Q H@x+)@ @0@S!P) @ < '@ d)@ ЍH-  (@@{}yO-Mp)@@% @P `P P`)@P ЍO)@pPb(P\ oGdp@ @@)@@PK,$ d _G8LP \.Pt)@P* )@P)@P =@ { \ AGP >@z)@&J)@PX  pPh@d@bPЍ "@GC 5S \ S \ \  S / S !) @ RL R !) @ / S \ O-M-MQ P|)@)@`H)@PHP$ L@,Pd(p< @)@@8 PP$c\ Fa`X \.P t)@P)@Pa0 PHP XVDp<*` Qc3+S82Ypb0``P 0P4[`3 ^0 QV@ 8W< @ 4 *) R( R4(pSp"60, (pS ,   |)@"ʨ0DdP`p @)@l `)@P _p0) " @y#pP )@P S 0)  " @y ㆾP 4p$Y $ p W )@P n @+P `eOP p4pi i)@P `iJUDd`p @)@LL@TLP H地PP a)`@ϪQ  Q!) @ 0B?k@, @y<)@Q V%@U%EQ k@* @<8x@0) " @xQ k@ Q, @x)@Q V%@U%EQ$P vGk`(0 @@ x,0 x 00Sڴ0B@P)@1/|)@)@ Q TPUЍЍMH-PUm@(`@ p  ,`P@`XXpX yPUH-MPXp`)@P  C@x@@)@P. )@P p  t @SpH 9 @xx)@ 0B?. )@0CZ@Q@ tx@)@)@ c h)@P o@)@Q @Ѝ)@P  Q J@ᵨO-4MM@]!1) @)0@ RD PU9 3p2`(@ ) X)@P , C@x)@P1 x)@Q t' @   ; $㿔p 9 @ w)@ 0B? )@Cg0 `@PZ@w  `qh0b0 @ w)@P k8@w k(@w)@P  $@w   P(@ <0 &  P$r@w`p)@Q t @` Sp 49 @ w)@P 0)@P@P)@)@ m h)@P y)@P )@P  Q  PJLP J ! @0\j$\0 @v +lp @6w)@)@ "`0 @wh)@P  )@Cg`@4PZ@ wcj  @w`P@`XX X xPU4ЍۍJ@a@-M L R !|1) @)0@ 0  !) @ R tG  @@ @叓p @vЍЀ!) @G0!) @` S@@@B@?l 0Ѝ@vJ@H-M BeWPP@MP`p(@@V`Q A` p Q P X X pGwXw)@P P`U`Q A` p Q P X X `F vUXzw/p/O)@!` @0 p P \ P`U`Q A` p Q P X X `Fv*XOw`pP @P` XX X >wP``Q A` p Q P X X `VX'w`pP @P` XX X wЍ0H-@)@P \P !@XPP\S00H-@)@P tP !@pPP\k0)@Q \ J !@u\j @uH-q! Q d       P     (@`p Q0AQ`0NX X @GI (@`p Q0AQ`0@X X *6 (@`p Q0AQ`05X X =( (@`p Q0AQ`0*X X % (@`p Q0AQ`0X X |  (@`p Q0AQ`0X X /X@ X* X=X%X|X/avO- Mp)@Q,p)@Q )@Q 4p!)@) @ 4[ 'P@0`S ЍOLDK '@@q)p@Q NPv   @Q  ! "     Q ةP`өpV`Pp̩WEP(@ V*)@)@0P4 , XP@E`pP @P` XXX u@T@Z`P@`XX X uP ЍKZsO-M@)@Q,)@Q )@Q 4!)@) @ 4; '0@`PVЍONJp](P@W9 ` / [`P@`XX X ]u,)@P4   PJ`pP @P` XX`X @uYpW`P@`XX ЍX ЍO)uO-M@)@㰁)@P,`)@`P P 4`P)@}(p@P`UH 4 ,'@ = [2`pP @P` XXX,t`00@`0 0 QPpP XX P XX X tX t,P4   PU`P@`XX ЍX ЍOtp@-@)@`sP RFIP  V P @j @s6Op@G@ ܣO-CMPJ@OL@T4∠pD  0 [p `p V [P?P ?` $ P8(@W:PU:? Cߍp@- M@ ` ZPp TR BQP   (@X0 T [P ЍpO-M@`t @)\ P!@/@ P jmP |P pPNpPpH(@ATe !@=צ p!@ Tp UJ:]pEj @^X>`` < i` 3 [ p.p [ U:5p pP Jp  P[ /pppj @ X`@T{pH-ފ  (@@ropO-MMP@Ut @[h`@)@p)@ tihPfP hP)@ vP iP:  )@pp.H(@PEU(A)@@)@PEP  P `$X P !@kU=N pP Z/P / `pp/QP pp/PPP  Q:@ >` P`X@oH-3  (@(@0Bro)@/O-M-MP)@@PP Ps P 8+P 8`%PM j @8 @ ,Wg)@PPd *@X@  PMXL)@P P 8PP)@aT2`劵pX> t @!0@ V40 (@ @pq0@  P  kp$@ dp G r)@)p@XF LP P@V`` (@@ qm(`@P@p (@śpw W  AQ ᴛ Pp `YPD j @V$글FP $ P;p 㵋(@` P[`)@P  ღ0 A pማ Ѐ {0 A)@ @ 0 @  %q p$Px.$ >p@1V$80 `@*` @*@ P k@VTX P" P y@V@@Pj @VP `@U@U@$ 1@ P @U P -P @U ~P j @P `@`)@PU @ pЍЍ Y@0H-MP@1P=  6p  @@7< @@UP$R @@(<Ѝ0P7  p  @@@@P$R @@ )@0HP(@ @@@ \@48 "0@ j @^U^ $)@I\@@@ @M-@MH{ @'p@p )@㐏 )@'@ )@$R(b+)P@)`@) @Pmh"h"""$#T5 ! p5}) @0)9,T2 ! p;@T. ! pB) @0 97d '@,] )@'@,L )@'@p0)@Q" ,T )@'@,T )@'@) @08p0)@Q  P JH)@Q Np 8B)@@p  P  P%  PK,)@@ @L8 q,)@)0 @@8/ @ 8DPЧ`V d '@ )@)@p '@nQ?l&|%|%&|%V# )@PU S 0pp&P Чp `VE:VE@1*}:0@P 0!QP)@~\V0P% \ V  )@PU ?   ~\  0 \U [ V)@P~\ ~\)@Pd '@p '@P@ЍyH-M pP`@` p/ڝh p'@.P VpK } { V A bb`@: eb`@5 g e  0p ЍD@|S@wi@rK-MH{ 'p@p@Xo)@)`@()@- P*h)@P )@P @   )@ )@ )@ nO)@)@@ @On$R)P@P8B)@@t P   P,)@6  hK '@'@@P 4)@P P  P  P OE )@@@h)@  )@)@0P SPR"  )p@ Pl '@     h_O)P@)@@Q P @   )@* WnP )@L @kP -)@) @ p 0+0 0Q@mP` )@PЍO-MMO "P"'@@`R)@ )@ Zp00 (@㰠VXW P M`)@@x" @l@0 (~ @" @0l!p @7Uf)`@Q 㠐x" @ yl0F"n$! @pl  P @)@0` ^!~ @" @0Tl:!p @"08+}) @)p@@xb l; `@'0@   :l؝ )@ 2l p0 *(n @" @0 lHK! @ "`0lU "N< q )@"> @ lߍڍA-~M()@Pd[ 'P@P Hk @'`@~,p P~܍0H-M)@@()@PH[ 'P@0@eQJ 0Apʠ^* @5@Ѝ0H-()@P~@d5)@Q)@@0 )@ S5H-@P`p  Pp@DPTWH-@P`p Pp@DPTWp@-d[ 'P@@T9 ()@`H '@ @VT )@)@ 00T" @ )@T)@t@l '@@ @4l '@*0 @P5pO-Md '@@TH '@`pP  P@pPE`UW@T )@@)@()@R)P@@Q *tC P0@@4@sP4TP  0Q*J P0`PZ#P P P tʯP P@@EP@@T JT @)@PTZ@a4&T t)@Q yQ @l '@@ @G4 @jl '@+0 @4ЍG-M@)@P_d '@PZ  '@P@O)@P "0) @0(") @`V!*H 8)@'@Pp 0pQJUpV` oR` 0J U0QZP PI@ H '@ H< PJy@@3ЍO-MpPPPPCd '@PU>(P)@@P7:H @'@` 0PQJ8)@p 0tH `Qo'@``r`pP  0Pv0 S P  P, @3PPЍO-MMd '@`VJP()@P PyU@c3pV HK `'@@p~,-PpH '@Mᎎ@H/`H` pm/H` p~ ~, P} `@~,Ppd/H`H` pGW` ᙞtaQH/Hm pp p)@`@US  0U$4! UM @UHk '`@ 0q& P 0sl '@0P 9@o`p'! @``pq^- @|! @  - @! @! @3p`pߍۍ H p-0 @"0 @2O-MM )@Gpʫ- @2  :pʞ- @2@)@P)@P)@P Ѝۍo)`@P)@ @2,T )@'@PP L '@P ()@pWWWP @62l '@@b2눯:)@@\2a@Y2l2P6Jq:Pa`,C㍐㮰p@P@`@ @@@@.P& P  NP  P  12.2,2?2PZPZ@2d @'@nl+ <' @ @@W 2b@@W2 .'@ @ @Q1눏)@@1@1E@1m@11P9JOE_m,`@@@@P@p@)@.P) P QrPYP SP ?yPp7ʽ@sP3 1 11111PZd @'@@") @@1h)@B)@@P CM,"P)@) @ @@1#d @'@@@@-@ '@p'pH-)@fP )@)@T" @1H-p HF" @{1@-@p9" @0m1@p@-MP=@p)@PP NPP  P P `  p   P `@ЍpO-M@PsJo)`@H0/PlJ 0/PgJ@(M PUv (@)p@̄㸔X @Q @0`3/P= 0P*4P3J%f"P!P*JP%J/P PP  ` 0 (@@  0PP P (0/)@ + SЍ" @0O-M xK '@'@@P J \'@L B 0SPp\PfJȻ)@pL  PpWPH \PEJZ '@PN B@&0   `'@PJH  2/| p'p@*PJH  2/pPJZ '@P" B@/Vp pF  ƷAg@/ LA )@ )@T ЍO- Mȋ)@)@p`pPJ @P,O)@@$ )@2/P F R k80)`@ 3/P @ PG W '@PB @/ p@`p[ P P pW '@P @/ bp P@u/ Ѝ@R <)@1/P )@@Z/O-M`P=J)@H0/P6J 0/P1J6'P.JK@L)@PP  '@gP \# @/()@P $PJ@IP (0/)@ `K'Ѝfp)`@̄㸴@P  @Q @0`3/P 0@[PJ P   0@`P ,)@P P H<)@)@& P!<H)@)@QPP ` ` Rp RP~JPyJ # 00 @/P P@ Yd`)@)@& P!`)@Pd)@QP ` ` Rp Rj@)@P P)@ 0=h)@PP |)@Q  '@P P@@Q:P P   @P3 |@)@P @pJ @03/0|)@P@ 0@)@Ph)@PH )@P @ 9 7  0\t`"@)@Ph)@P )@P @ 2 .)@  0 @39" @ae0h)@S 0@PP  '@p Feh)@G-AMp)@@/P P`PP )@p )@Y/P $ @0p-PP/P PW$ @0-AލO-Mo@)`@PPeJUUZH0/P]J 0/PXJ<)@P "PPJ Y p#PIJX@)@)@h_)P@ !)@@ )@Hd;P4 (0/P`!P&JX)@hO)@@P )@E @9@P)@ @ 0@@,ЍV㸄)P@P  0pNP P P !PJY #PZO-Mp)@ Z P2J `P/J,0/P*J0H()@P Y"PJf)`@ P W 40/)@ `C$8)@P $ `Ѝ @_+0 @+ `Ѝ ۍ@-PL/)@) @ QR\/)@) @ R@)@P ,P)@ @P J8)@P P@C@@O-M4N)@@P ̶0)@M| ()@(@@)@'p@\)@)@Q P Q5`Pˀp PV P` qP V  `޴4P)@ `Ѝp@-P@P@$p `{+P Pᚿ@P/Q)@ f0@S  $)@ PPp @$.P) @Pp()@Q  4)@Q, )@ T)@Q$)@Q P/0)@Q 4 )@坹/H-8)@P )@pW3L(m(@P@@`@Q P UpWO-M-HM@,)@4)@Q PPJPP P( p00P\ `)@$0 P@,4P @ P\tttt88$  -PUZV `@TN4 ϊX"   @ QD0 +,pNd  0, @$~,  @0'8)@P" X` P8@0 Pp8 <0 @DP"P $, @gPX  P8 (& , #0 8)@P  `Р  C $ 0 0 , Ⲻ,(@ ᩺)@L @ヿPP()@HЍЍK-hMP@)@@P1 (``pTD QipۘtP @0Wp  @  T<PH@ 6P$0 ( @ThЍKA @Tt0 !@T<@Q* @PW @sT  hЍA-8MP@0400 qA0!4 @p`9P^=T-0@ @ @0P8Ѝp@-XM@` P0`8ED\0D @ 8XЍpp@-MP@PP Q `P0 կQЍpЍp@H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|*:H-A0\ Q: W \03#€A#2\ Q :A1^0Q:0AQ*H/@-Q0E\ 000SQR% PH* 00@C TB"/ A@CTB"@ a@CT1B"`   \& P"* 0@0T00C!\@? S 0! S@" P$: H-00C\ S: W \03!€C!\ S :C^S:0CS*@-D@)@Q@@@H-P8)@@ x/p@`Q`  )0@ P)@0)@ @ /@pʬ '@P* /@-QQK ,)@ )@Pt)@ '@p)@ '@0)@@@)@ '@PL)@P /@P h$)@P)@})@Py '@u)@t)@l,)@ e '@pC 0 H0#(@ ?X (@ )0@  R Q[q qR)@x '@L  !H)@/) @Pv -q_@`op@@ <  '0@\D /PT0BJPܡؤ \p إP@Xht$ȢȦ| '@ BP Lh\)@RF 0/@)@ '@0)@ @|<)@iv0)@`p )@`j0)@@d()@ `^ p?/@tO _ )0@)p@'@@'P@ lRmR oR pROaR eR/ ' @h, /@X p1c$ ,/@)@`k@)@i /@-) @ p*,gH)@f` x /@'@  @ L0BMP)@ ܟh)@D)@g /@p< @fP =t o'@pp@X)@b\)@a /@ peP)@d$)@`0 )@!@)@ /@) pbL)@e /@ `)@PP)@cd)@@|lx l/@Opq{`)@aj /@pojb,)@@`\8)@jVR[k P@t '@op@IrRB  P P (@)@X .0'@0'L Q P|)@a @`@)@p[ PK@T*@ @T  @8P" P1P P H.) @p H )@ p pGp@Tv Hpp)@n p@PP @ . @rN@P4 PP PA  P n)YW U p @ PWU Q)ep L)PP p  pʝWU 5)n @㩸P(@ xp)@ PQ   @PjH)@e '@'D" @ @Q Q -'@0 H0 -'@0 H B 0'@O". @0  #Qx '@)@LP$:@Q:P7H(@ PJ)@ 7p7Hg(`@ P7pt '@Hg(`@ P p@HOd @B /@@  @6J /@@& @, /@@ " (@@@`U !P@FML BM]!@ /@@ A @J @ @  @p[ KPY P% pP!ʔ@Tw  @㢷PYm p@P @㓷PPZ pptPn @ㄷP . @LPPf](P@P. a q @`@p@ hP  vP XpC@P y@T5EPZ/n @@P v pP}  @$P .pqt '@ ,B)@@PPP  @OPP @dЍ> @ :7K-f @!`@hPᕳpp f /!`@W SPဳp p:/ @0nD)@P  /H- (@e @I@- (@@   @0ᢨ @ 0ᜨ @ 0ᖨ @ 0ᐨIA-M `P〳 Pp0 WA L: RI 0lS bS kS(k5xP;mS wS(o1xP.`k4xP# (f:xP  0S xS *SP(P6 0R!0 PЍG-PQ @nWcP) DN)@)@@PP" ,`P=P p P 0 S00PV @ @ @3&G-P)@(@ @ @RKU & i@ @p5 oo EKVUP@ڰ  GKp@-MPPP P@P PPPN P PE` ± )@`P)@`ЍpK-MP@P @e`p\Q QY Qpp Pj  4P ` ;~ET @ 0 &<`\P P+ P``P" PP{bP6 P fQOQPQ SQ 0gQ sQ pQ*  GQPۊ % @ gۍQ)@ R )@  %# @}Ṋ %} @.) @A-PP @6p@PP `pp姳 0)@ )@PR `` @``H-)@pWF (m(@P@@`@ P *JpWH-.P) @Q# 4p@T 4o0)`@`V $?)0@0S Q Q Q )%PP0S + @P0SaP `P/`) @/Q @ @PP/H-.@) @p`W P 00 /P]P pW )@o 4)@)@oQ` p)@P aPCSUSK-P`>Q&?Q) [QS.QK  !R`!Bo  @`P? ]P# p-W pW]W Wpp#P @P *QSSP Q! QP R`*P P P  0P QP P $)@Q /PPG-MM@ '@PP `p.W.P{  @9PyW Q@@QP.QP.QP/Pf )@P U` PP^ P P2 P ` PL()@P| )@h @o @ @ @PP0J,㛗 ˧ g p @@@`@ |P  P! @ @E  PZ P/PE @ JPЍۍ.P P7 @pP Pn @g` p,WZPG @U P 2. ,: )@pW7 P/P`P ᅱ ؘ@p.W @PpW P /PP ` P _ Ი @ P.WP@P~O-MM@&p)@`P,㭭X  @'@P(P`'` [h 0{<Pa V3Q V* V3W V1: Vs P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  6Q \R\&R Z:Jp '@` V Bp, P ZX   @& Ѝۍ V*' Q pP P    '0@ V ` P' P  ',ެ' P  (@ '0@ G  (@@ Gp@-@P` 0PJQp  0pp0H-P@P/TN@N Tڙ @ 0@ U:UNAQ:0Q0N0A-@MP@-] (@)@10P<84000P<84000P<84000P<8400 @T/) @@0 )@0 0 b @D @,0ؤp)p@P  ͤPJ ǤpP  㾤PJ 㸤pP  㯤PJ 㩤pP  㠤PsJ 㚤pP  㑤PdJ ㉤P\J ヤpVڳPYJ '@P l!@ p'@SP '@P p@  @ȦP@PA@@;PP PE/Q  `)@V`'  U |/@) @/@)@*@@P3"곲)  @@Ѝ; @~ꥲ)  @ 0)@P  qPf @vu@-@@)@h)@T  @@N)@P x|8)@P  SBH-< )@P 0/C%=Q5aQ^ PU )@P  /C#=1#aQI 0S )@ R> `0p PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V RA-P@`PV)p@P=P8 #V \V `#P` HP`HP P/C!=QhzpaV Q PP `P@ @ ~ > @ @v A-P@`PV)p@P=zP8 #V \V `#P` P`6P P/C!=QhNpaV Q PP `P@ @ ,  @a @$ H-P`@V @/apW PP`VpP0 F R :,VU .V,P (PA`VRP W`P @p bRCR MR mR cR5p @ TR(') p `Q G JpUP)@ R )@ ``/`) @`E @0 !f @ !p R @ 0   @ |  @v H-0@PS$ p(@ .SmWpj0S0`W ԬQp!@m0`p@ QH l(PP!@k@d TO P!@P@P!@ P!@!@1p0H-_@)P@P  P @ @0O-M)@Y: 0@P4 \1: РPq vM㐡`aV p !  !  pP` @P, `ZP$  @ `Ѝ ,ㆨ  AP Q # @y H-)@Q 0$0 R: RC qN vAMDI%bAT0 $ P "P%  `$p% "  @THK-鸟)@P y`AT PU@`V 0H-_@)P@P)G /P  )@@ _O`)P@A@z} p'@ 0 A @ "l, 0 @V @0O-MMO)@@Ql p PG% t娿 '@AT `P 崧 ! 8 tP7 ᧧P8 @T P ` 0啧QJ iP- 0)@p` a0P  @ #L @@깮,  @괮,  @  `@ 0T L @@㟮 Ѝۍ@-M @Q0@@B!S !Q 0@Q@?0 !`#!K0" ?^   @@@T: 0 Ѝ0H-_@)P@P GP! @* @0A-O`)@@P$ "@PqW P p jP+ pXP# `XP qPU @P `īPP GXP  @=; @ PH-`)p@P@P"_qW ᘫP p ᰦ0H-_@)P@P =P @ @0H-   PM-`)@@pW# /PC!=ahP Р+0* R P ` P@ @o O-M)@PU 0/>3C=a 3@0'sfp$0 "Q  U `p'`&p PS0 R^ @ PN PXZ PE  p  p P "B @ O/)@@) @ 0%=R />3C3&3ᓌc1S ` p'`&` 0 0   "  PP@  @ / @Ѝ 0@ .P 0 pp ``  0H-_@)P@P =Pe @@0G-MЏ)@P P=p aV  0 $@ P4(` Z ЍO-M)@`V8 @L@P@/8C<!=㐱hP ! # " # " (0@ P p JWP ( qP @$Ѝ @ЍOBG-)@^ /NCCD%C=Q%dAT $ `Ёp)P(PPЀP) p(P (PU@  (00 mk/G-Mp@)@PP/P` t`P' (RP pVP @)@0 @ `P Ip0 @  @ , @ ۍO-M_)P@@T, p㜟 㘯 o )@'@'@p'`@P$P ;  p p@P @TЍ )@ Q/H-)@0S ^Q ?)0@0SQ@- Q @P @ AP  '@ '@q 6 @J @ 0H-M@P V `00?(P2*2*`` 00 Q*  ;00?( P2*2*`` 00PR PT  @Ѝ0O-MP4 m_ a 㐟 @P@`@'@)@pῨ@PṨP P@Pw @ 0 m/ 1 @ @0@ @ 0ЍO- M@PS`PJp:( KAQ:/?) @)0@P /?) @)0@w d  l , t 0 |  p[ Pp$``  4P  KJQ1Q 2Q ,  KQ LQ ` /R5Q (,,(  `  ` b$   l b `/Q``@ Ѝp@-@ Q P`mpeRe #p@O-EMP`@Q ,eQ  @@)@Q@P@dT  @ p^ d Ģ@Q:P P/ @ @" @G @f @12 d 㚢0 |0 & `P)@@@!| @idPЀQ :1qpA~1QSpPQ: A0 cA ,\qlp Q :1QPA^1qSPpQ: A0 kAh 0\ytp Q :1QPA^1qSPpQ: A0 sAϢMIpJ: P Q :1ᒁA䅎1QSPQ: A0 AⲢ0s `  ?(P2*2*`` 0P eQPp pQ :1QPA^1qSPpQ: A0 A⁢0  @@Eߍ Ѐ |pQ :1qpA~1ᩑSpQ: A0 {AY   @h'@PJPJP P@ //0H- Q @P P @ᇡP 0 @ ~P)@P)@Q  @ 0H@O-MP@PJ㐄`(  lY!R ,X`/  KAQ:/?A) @)0@@5 /?) @)0@) d _ |  p P`p$p`  HJn)Hmpt 9p ,` (pl (Pm GJP1 @R 0 @ (  aK@Q:gPxP  " xP@ @  @     )@QD KP  bC   1 ,  I PQ p @ /O! (  B  /R     ! KP@ @ Y @ Ѝ O-MP@Q :P P@)@P " @! dP)@P  F`dQ0)@P&Q$d@ApQ /Q @C @TT }ὠT Y `/ P%  }㦠d 0@ Sa`23 75plh01pc @ 4 Hp `q `OIVDQ :1A@AN1qS@pQ:./O B0 [W&FQ@p hqQ :1A@AN1qS@pQ:./O B0 < 0R " @ @0|` f$  QS:1a`An1qSH6pp0  |0 PK d y)@@`| @Q :1a`An1AS`@Q: A0 {A- R " 0@ @p)@` pfL|Q :1a`An1qS`pQ: A0 {Aʟ  @@=rutF`)@P  0Ljd` {`Q :1A@AN1aS@`Q: A0 cA╟ R (0@ @i,lrl@ @pQ :1qpA~1ASp@Q: A0 kAt R 0@! @H0Lztp pQ :1A@AN1qS@pQ: A0 sAT R " 0@ @(P)@!@Aq:P@ @Q :1QPA^1ASP@Q: A0 A* R " 0@ @@ߍu|P0 |tg  `@UP ')X` 'j  `  ?(P2*2*`` 0+  ?(}P2*2*``P P 0@Q :1A@AN1QS@PQ: A0 A˞ R " 0@ @}@PJ CPJ_)P@P o)`@ P J @ +PJP P@xA-MMM `P@㐞oP@, U U )@ @)@)@ mMލڍ2 @ g0H-@\P P @ 0HH-MM A0 S0Q $( @@ 0P `.p*V ?V.`pp\pp0` Q0/P @|# 0 @ 6@P$JP# 0 @ 6PJ@# 0 @ 6P J@# 0 @ 6O@ЍڍK-M-PP . @7PP [  0@ T](P@ p`@ᝎP @ Q 0?k`P @ @(@U aaЍ0H- @PJ@@`PP*P@ . @`*@Q0Aa()@P  # @ @00Mp@-MP@)@]X@)@)@(P@ 0ho)`@P  0P)@  @7 7 Ѝp@Ѝ/ M@-M@*@@  P0  7坔Ѝ@ Ѝ/p@-@QP*@ R `AP @ @P@@pMH-MP@)@mX@)@)@P(`@0h)p@P X `)@  @6 c7Tm @6 ЍHЍ/H-M@PLt @*_a `@p -LP PPp?H(@P:.# @@P) @/P% @P @PYp l !@Sp  0"# 0"# <}@PfM(@@X@3I@ fH- N  (@ @63O-MP@Lt @p c *@*@`@*@pp ,eP qPrP vP xP8 VPPP RP fP iP)*@ pWP dP*@ *@p*@ *@ *@ p H(@`V*@PЍ@QѓpPW> P(*@@Q  /Q@ pPP/Q /㫰Pp.PP .PP PpW @,ppQpWP(*@2•$[*@w(*@PU gp p@ `@@、] P*@ Q PF *@P 5PI 1?PE -PA j @M;Q  2 Q * @ R'  * @ R Q  P   P  P *@PP*@P PU~J0 *0@P0 `*`@ `Xp JP @d@$(PP*P@PؔSjp @` @@ Q $$p$T$$*@Pn X Ph 3``*@Q X PU P Pf P 5$*@QPF pL & < P*@Q. cP,/*@P$P' P?P$ X $ &(P *P@ *@PP BP*@QP  W`ፔpPvh*@P,*@P ,*@ P ?P P "@cB0 @ cH-K  (@ @3z1,*@/A- M@*@P   (@@ 3M(@@⏑P@'P&$`*@P5 P P0 P+ P' # *@P! @`` (@]P P@]p P Y@ob Ѝ`?wp w> t @!0@ VR 0 (@ @p}3O-OMM`@Q  p  P#@ p PP Ѐ # "!Ѐ # "  PvopP 0w p␙ЀX` XzPp X PXP 0̘ eЀX` XzPp X PXxP 0㡘?ЀX` XzPp X [PzXNPr 0wjW WjX`  RPS  fpWPJWPPB 0G:РZ`nV`: Z `Pj PZz.pp`rP (p*@pj @y P(p*@pj @m OߍٍG-P@Ht @~"p@` (pP pH(@P2P+ jP @pp/3P PQ P np/"$ P |/H-I  (@ @1p/G-P2Pr  pRJ*@GB";`'pd,; (;0*@ aR*@P G H-@Q  0S0`J*`@P@' `qW 9P `pP R 0S JA' `0*@/p@-P@U  Qa*`@   P*@P PpH-Q0p*P@@`*p@Q `'VP*@P HH-@PQ  0S`J@' `0*@qW ᱛP pT `@-@P@噛K-a*`@K@]:0P*@ 1S ppW1 0'PR0P*@P />0@ %Tv pq @'p@ `^bQ A \`@T KY:d @.p@-0`P*`@@Q  R @RP'UpO-MP8pW5 v p P@'@ `=㦌P ;P @ ,^aQ A ʣ\ t  '@@ ]`pW`Ѝ0H-XC @@:BP aP@0Y@*P@P x @ A-M`*`@(@@^ P@ > p* @00SqQ Q, Qp&]Qa 0AS@ #8$%%%P$\$%t$$$$$$%$%%%%%%%%%%$%$%%<%00 @G S p* @   G 000 0@FG@*@@9P*P@ Np@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S      @H-M@P8`*`@PLTP  IRNP  GpP  ApE*@@*@@@*@PP8Ѝ  @ 0H-@ZP*P@ )RR0H-*@  @dA-P'@2 4 8 '@' @ip *`@ P Q @Q A W9T@Q@ A T QH9PtG @@ Q@9@8@x*@o@a @ 0P_\oK-0M@*@pЀ(,``TV F P :(( 0#@P0ЍI@PWV  F008@P`, @0z- 3]G-@Pܠ*@ %Rpo`&P`*@W@ 0W & @E@-@Qx@ *****@*** +D+T+`+l+x+@*+ Z # qY PM 0$^R R ^" #o ? `2 0PQS? @PS2 `QSQ!!R .," # 0֖{ @ @o @p@-Mx^*@*P@`#^@@ '@`P T0 TPN"@@ @P~PP vP R  @    RЍp @@"@|A-@pP*@`P,*@@$ 0A-MP@+܀`*@p BP0P `pR*@`o`P 0ЍK-(MP`@p!PW&WI We W*@ 0p'GP:$WB "W@*@@#PtW> W|UH ЀJVnU*@K`'@W*`@@P'WP,@ @+M*@ 0o᠂@*@{ 03Ѐ*@l 0(ЍK'FP]U*@ Ѐ*@`'V'VP, @+ E[ (ЍB @{4 @w] @sO-M8ܰ< P`p*@@#@*@   01@ DR0 0SR* @Z 0pD`PP PЍG-M@ B '@@@>peP P*@PU' `V/ *@pW 6P @Cp@^5` D D}1PB@w\PP @[-PPJ lF!@@P@.P.PP/P3 @ P# p` P^5PJ  P Y @Q Dp  `P @Ѝ  @#\P*@*@PPP @ @p@-`@*`@Pp*@Q # @2PQP 4pp@A-AP*@@pp +`P*@P W @ '@6QP V*@P( @X@ P@*@P zO-MPpU*p@Q)@*@@P 2Q*P@P*@P SP   @ Y# @ Y@1P4*@t8 i'@4 *`@'@@/Q PQ PP@\5@UP U/P@DpWI ,Sl P@!@ PQ /Q @AP P,  9P' P@&5@/P P@5@Y4 '@T1T   t/R@pW4 '@T p*p@# @@i];p*p@P@4@/P4@PA*@@*P@P f4 '@3  @Y# @ YP@*@P Ѝ*@P/ 0RS /S  00B /0H-M@P P/Pl!@p p  0"# 0"#oBލ00H-_AL @@P;pP *@P6LU_8P*P@P0P) pA '@@KV! !UQ A U 6V0q\ @&' @"; @p@-@ \2`pP 93"P P2`2*@p@'3TpkA @H-*@Q #  @H=Xg @HG-pq 'p@P`!V r@P  @Po`Vl P @T7 \T0@a DR0<>>?>>>>>>>>>>>>>>?>?>?@3\T1 0T `@ P0 BR6!Aqr@#\@` P, Q A ;U `V@ @ @ @ @ @ @`Q A U @`@X Q A  U HU @nH-*@P!* @iH-M*@P *@P*@  A*@P @ '@6P㝆Ѝ MH-MT*@  Q0  @-@*@00*@Q000%UMH-M  0 H-Tp*@M0H-MP@ 0- p@-`4 '@@ PPQG*@PpH*@ R@ H '@ @U*@Q H '@ @UV H '@ UTJH  '@!@UTJj H @'@UtA '@@Q A .T H '@p@hTQ P4 '@bTp@-@P`ǔ M@-M  @0 s@-@l M@-M@  壔 xЍ@ Ѝ/0H-@Pᗔ 0Hk MH-M   `ЍH Ѝ/ X@-0 @ r R P  R A5) *@@" @ JU@(*@ *@,*@0*@/A-P'@4 4 8 '@' @ip *`@ P Q @Q A 1T@Q@ A T Q1P8*@Q1@0@4*@8*@O-MP @0x*@ !W9$q 'p@P" @` P @'`@U ^PZ  P  *@P039PP! 0[8*@ZЍ$O-M@ P'@8^@U*@`h P p0 *@Q HDIXI|III0HdHHIIIJ8J8JTJ8J8J8J8J8J8J8J8J8J8JJK^`P ^`PPP# ^`PPP *@P P^`PPvP PUbPS0U`hP``f *@P PW 6 *@P P *@P Pc? *@P P5`!/ *@P qP$ *@P gP=  @S4 '@R *@P VP ``(o` / / *@P QPP 6 Ѝ1 `PmQG-MP*@ @ '@PP x*@l *@9GQ @QptA '@@W ` LpWQ @Q/R`fP *@PJP QX @Qt '@RP< P9 8*@2q*p@` *H P*@P  JP*@P P Qb @Qt '@QލwfK-@p~@ '@PP. x*@l *@FwQ @tQ`tQ 'P@V  mL`V- @eQW< @`QQ A ]Q QQW*P@'`Go"N(P W8*@OP'PW@P*@P >G)8*@P*@P (WPP x*@l *@8FP@ @Pt '@K R &PPP VEPJElVJ`pWQq'8 *@R*@P ЍVJ j @O-iMD  x*@P$ *@ *@@*@c,D@*@x^a *P@T  aopP e:P @T p_W _O`H:P  pW p!P ppp",tQ t 0t1 t@ 0'@6 *@R( PpPt(pt AtRu l *@DN|Qtq 'p@U1 =` @ Q A ʽN @@~P @ OQ A ʧN ``NP @UAT P Q A ʉN PN@ PT @T Pu sIP@ PTQ A hN Np0V_@Pa |ZL E `@@p ệP$Z=` Q pt1 \ @ Pp@`P -R -RQ! ` pV`pV$ U@PPp\ pW@ptt $pV_PPFtV $0 P V_@`@ '@`*@Q @QG*`4@P@PAP0 a*`@U$Tlx lYpA&PP Tl!$P! l8A*@@PI lPIh@d,T APP- LPx &P Kxx*@P x @*@P*@P dhCxx@Q*`@@ P Th%*@P ~Px @ KPCI`*@@ *@ a8| 0` HppH0p1ppq*p@t`0C0004 ZP*@P ETPbP``*`@PP\*P@P V\PA*@|PP`,Zx `A_ZT *@ 4V1 h DPQ EP*@P *@Qx? NtQ  -Ra -R R[QU QTP P@`^*@*P@4P px @P*@S@!* @4P x T@iaPp|*@ @P -P@T*@0l!#Tl!0$ @ P'@yzP lxP \ l'@ 0@p0lHq*p@,83`0*`@T@P "aLpQ P*@'P@ *@,,PS ,PRT*@SD *@$@Q `@P@P `*@4 $ BOl BpPVV|QO/@H7(0@@t! ** @@`1t!*@xA4!* @pt@3/,P 8*@PLt H '@'@4 '@M P R`4*@,V/P 8x:,p ,P,Q3P1 0*@*@P ` P DxP \ p'@0  0A(P ("@)Mc)iߍ @8*@J,@A *@@  RAP |P B@P5NPP@!* @tp ``1$ p*@P8/  @/ h DP QDXLR *@ *@ 4*@P`@P*@P ? @b*@P@*@8T!*@* @P 0H-MP. @ PP@Pggggggg,h8h  @TP   =6  Ѝ0@-MP @PP &5P D*@ 0Ѝp@-@PPP p P$PPP  Pp ``pH- MP @@ '@^P6U4 (q*p@p+  `!P*@P @Iܻ `P*@P n' Ѝ @@-MHP:X~XT@*@0 @ H-`@PŹpW pV S]%*@H*@+AO-MX+ pR%pPPP :PW *8@ '@@`Q%P4` '`@U@  lZ/P/Ѝ Q X!* @WQ:Q:Q @ЍO %O-M V P@p`@-b@Q'ttLtttLtLtLtLtLtLtLtLtLtLttttLtttp`@PW9 *0@` RW pW P  Y*P@AP PuuuuX [ Z V pWi '@piD *@0z PPPQ PT P PdH)* @pWAoT\ *@pPU Pvww wX[ Z V poPMP\*@|Y:pA '@@OGP  @FP PPЍK-\*@p @*@'p@ PP `Q QQ`PP|U:P*@P KK-M Rwx,y yyD *@pP @ u`$PEUY A @$H'Y,.Y, k @vFj @HA*@@S P`P*@P u @ZFXF{ @UF Y Y @OFb @LFj @G pA '@@P Q A `F *Q A SF Ѝ @H-`@Q  0SC\qa*p@!(@r !!ApQU P# pPV a*`@#P \ P*@P P*@p@-A*@*@@ 0 0P*@P @O-M/@`P0uP  D *@P`  @P `zP+ pP P P jpYP UP Q   '@p P p '@p @P@Yp P '@ 9PN X *@ p"Q  @l'P P R @a'P /P  W YB P p   PPj P ݅P مP Յp@ pY t `'@@@y0#@ @lF: p(@p㴐*@`W ppAo  pQ B0R0 @*@P W    ЍA㴀*@@`pPsp@op`Pᮁ4 '@@D!x!UP pP# @ H- P@@P `pQ%V ӂP Pp@H- P@@P `pQṂP Pp@0H- @P0@PP@P0H- \'@*@ 0Q R RP U 0|S(K-@D *@㞆 `pP@P P:Q :PPQPPQ %Qv&P`:QPp@@ '@@qVQ`UV Cq `A-\Q*@*P@`@T pP=Q@p@T`|V:P*@P Ap@-a@*`@pPP P Q Pp*@P p@p0H-MQ@*P@@0 '0@>0 0O P Ѝ0*@P Ѝ0HH-.P QPqO-MV P@`p@)oPP VP`ppP vP@cP  /o0"  Y*P@ 0S X |w @p@@ `@Y CZ @` Q|P9 PP? @Y ` ( @DX1 @B rP ? @B( @{DP pA '@@Q A B Y ` ( O @B @BP 0 `@ P: @ `pPȈ4H\/rP* [P7 ~@Y-Y/  @@Y# @zBY q @Y @Y ( @ D D *@@@P 2 @ZB@XC-Y @CD *@@ p  +`@DTY \ @Pt @U @C( @C|w @ `p@@@Ѝ @7 t'cP 0@ @ @x @tH- 4 '@HOA-P!* @00! p* @p!* @0"* @0x.* @@ ' @8 f '@4p IRaP'p@*@@*`@00yX PP@ C? @@Abp*`@` 5p*@ @p` W ppQp& *@ Q  @-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp  x! *@' @  4 A'@*@@P`~P  Sp F    *@ `P<UځE P%砏؏xq*p@ p U :U Ux*@=UPutPf pP pPp 4 '@ AApPPp PP~ kp#pP p@Pp=P *@pP} P|{*@P14 '@@Q)pQ&uP^ PUTP('PpPN p~PJ=U PpP @Yp ;p P5 P<; p( P gp P!PPp UPx*@xp*@pp Y P`pЍO- M*@@Pz xa *@'`@q*p@@` P_P @Q::P @P- T0@, PT5  U5*@T T` `@oP' #@ rP P `PoP PPU:#@ r@ UT PP ` U: PpW pWQ P   ЍG-PN Ra @*P@*`@*@*@ >RR4 *R[R?R pP || P | OPP |P P  R Pp@@T0H-P0R@*P@@@Q@0H-A*@@P Qa*P@*`@ppP P 1P*@O-M P4 '@*@A*@0 `☠Y'0@*P@@pW 9W ځGQ:W Q V W W /W Q A -@0 '0@pQ hЍQQ P RYB@BP2 GpW* `├ ぀@Z w P p P*p P PPppWhO-$M`.  @=P `n@o`   P*  OP2 p`  *@/ `Dp4 1'@*0@P0RC V< [H0 z *@ sB P `p Q @P*@4 '@*@@0 '0@0AS p*P@P p R OpPe R$Q PPQWV*@C*@P9 `FV00`/ PQdU*@ `p P *@P *@P PPU`F R 4 '@*@0PA`倰@ c! !@P *@P ` `@BQ;*Pj  0 2lU*@f ` @u P *@P *@P PPU?B Q0PؠؠĞĞĞĞ4pP *@P1*0@p!Wp P @*@ V*4` 1*0@4 '@0PA0 00 0Pq4 *p@i' @*`@ 00 @ p4 '@*@ A x R *@ 0S S@`VW   S S00SP$Ѝ  @lO-M<0 `'0@*@ `4p  !*@* @P'p@ @*@*@ @ E < `*@'@*@p[ E*@4`*@ @ *@@P@ʴPqJP*@P j 㬭p|P UPS p@X X@[PP[ A E@QPE P@hP@DTPʀPP @ P p P *p P@@PJcP P D*@P4 '@Eo*@PP*@P ЍO-$M4 *@'@6 *@ PHP@a`@Ax*@#`p'*@ AQ, @= @@ 0@S "R  @ $ЍH-r`*p@@PP Q Q _*@`P @PK-R*P@PJ *@ P#a*`@P q*p@*@@@P P 8P P`P  Qaq*`@*p@@Q@P P PG-Pq Q:PP Uᘞ PE`@ p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F t`P@V tPO- M< '@pR*@`IQ*@@*P@P V4 '@p p  =@p ЍVP0 7  @0@0 @ajH ('@@ ;O-M< *@'@PpB`W*(QI*@@P *@t!* @W4 '@`P P @,p̫\Ь Yp `P^V`ZpW:!pEW: `PGZ`@P wQ  0S Q:ppW*apEW]: ^P<GZP wQ  0S Q:pp`ET@* AP Z Q@!EY`* @D*P@0`CW P@Qi*P@*`@D@p@@ЍiO-:P:Q @ PPP3[Pq -Q PU ]U \UPY[44@ $ `8PJ $ 84PP]P9 R RX  @ X* RX > 0@00 0Q 4X* @ P  @Q: p  [`N[ `?<Ѝp@-M`P@P*P @*@P< U9 P5P2!P$ '@@P@)0@@ P%x@@ `xP=PPV *@V @ *@U PP @ЍpO-M`P RP@,P! @ R0*@ ĵиܵ$ '@@P+ ?P -P @@TV @ yP@'@*p@*@aP P   P@T*@Tx *@9 *0@'@`TA0p  0S0P o/oL Y"@@*P@*@だ  X) PR  P PP   t   P( W P :P PZP   I   P< [ P PP QP PPPv 8*@A*@@-Ѝ0@ PYw `QwP=PPV V *@V@ *@Q *@ @嘀``P yQ㔬 *p@*P@ぐ@PX X)  P PP      PBPQ P PP   s   PP_PTPN PFP|? *@PT1P5 Ia*@@*`@pU P :P P"pP      PP L Ya@@*P@*`@p P PpP      Pp@- M P0 Pg0`BfF TDaOa`C 00``BS:UP0pY-*P@ @P @ ʩT@P ЍpO-M@P ZRDڈ0BSP:RD [RF 0^S!S 0pCW,:[S ]SD S# 0:S:0ps`\V:V  ]R V 0S /SpV /V]V  00S/S  ps :R *R?R R /RP PR/R Pb [ P AR*Q@ Q: b*`@T T/Qb Dl!@mP> T/DZ`PFQ*V`*@P"uP p .P.V  7P Z Q/@E *@-6lZ/EЍ R *P@0pCW:S000S P 8PJ  !@P R0H-@eqPP*@ 0H-MQ)P`p pAQE@`Pprpp`@TP@`PpPЍH-MPp*@ 0a4P 'P@8 @*`@' @*@@I0 *@@ ~PJA @ЍG-@@v @c5p '@Q A 3pY p`PIpppPU @F5Q A ʿ3pY p`3Q A ʭ3`@T pH- @H- @@-LB*@@PpPP*@ @O-M P Lr'P@*p@ Q rPPP*@ crP 4 '@3H '@3TbP*`@*@ R / ᧤P+ @@ R R    D 0 S @  R (Q,pBsP P:s#P6 yQ/ rP)J @2 /VPJP@ '@P 2t '@%3PЍbA- '@*@p @`V PoP P P P$ '@  P*@L*@ T*@0 $T P*@P AL*@Q/ ' @ 0S  R0cqo//LP"*@* @0C/K- @ '@@q*p@` R l $T" * @L0P"*@* @@VPP@ 0`  P*@P KUH-Mq@*p@Pᔣp5`P  P 0k wPLDP+ 0xkK+P $P*@P Ѝ& @5jp @/dV @(]9 @!p@-a@*`@P  @B+ ?U/ P 'P@PC+@P T*@ L*@ '@ Qp*@P p@p ' @ R/0S0H- P L'P@*@0TP"@ *@* @'@@ @ 8 @    $0p@-aP*`@Q@P*@PunL*@T*@ '@@Qp*@P p@rpp@- P a'P@*`@@PJ*P *s P!PL*@ 00T`*@`P *@ '@ p*@P p@;p '@/p@- P @'P@QQ b*`@Q QQPp @G0H- @ R'@@*P@P00H-P 0 @ R'@@*P@P P0e*0H-\f@*`@P*@PTB (p 'p@p M* @0pW * @3*OP`*@uPWmU 9...^W *P@P 㪢pW "p(Kq! @ D`V *P@P 㐢p4 (P 'P@p# )---@PdP 1pPU @^0@ '@N q @ q @ p @ ( ' @0S/H-t @ *@HH-d*@QG @PE j @1P pY `pP@1`pVpQ 'P@Q A 0 1( '@p Q*P@_@P*@P 6 @!F @p` @.@-t@ @@O-Mt @xd*@PKyh *p@pY pA @P@'@@ B`P6 h5 *@rD F  1P ؐ 1АXQ A ʋ/ 0PPЍF @6 @O-M@Pg %P  P' zo @@^o P@g nl*@Q`h&* @p 0S 0S`b#0SS ApQKP4   Q) lo *@@P<Ph*@p`P PА?PP $P Wp&PE`UW%P -P +P,  '@@P Jl*@Ph *@'PpZ Ѝ螊 @, '@p h *@㎊  @ꎊ @p@-h&52 * @r?D, '@ @!0R00lF*@@@T P`V P@T@@Q Q Qpps $@T %0s &`V 0 p0 pH-@PG PE q*p@  Q `? Pu U PU ` Q`7poP=`V+Q 0`/PU PU0`@PP*@P H]h5 *@rDDv @yh5 *@rDD @l @fH-Y @P@kPP ZP@lP pP@@T  *@QP%.%@ '@6QP@@i*`@P pq 'p@P Pp '@-j @O-TMP(ؠZ Z P$ J? pQ` q@P @Q V V V e @R TЍO/0 PP@ TЍOZ @ p `V & @/h5 *@rD I, '@0+P s !!P - j+ 0 @.ijP 0 @s+  @.@Zj q P PQ4 S x+  @.RinFg@ /QQ 5 2j @ i@*+  @. J%j@, P@P@ -@p:, P p @Z@  W.J`Z @ZP@,pP@,|P@,X `3-P@ # TЍO-M X`P QP@ '@NPv/lV*P@P(hd*@@ `p*@P P T  Z  Pp`WЍ(@ '@@`WV `Sp m @j"O-MȬRP`p*@ @plPP TQlh*@*P@*@`VpЀP PD 0S8`  `pw$ Wp P pW \  \ Y`Pp ppWp P  Q: `[`p RPR PU: l*@`h*@ Q0*P@pQ$ P *@P @ '@6 RP QP`  R t '@P*@P Ѝ0H-Q@*P@P h@P0*@P 0H00\  L\ \0 R\ 0 Q/Q QP//Pp//O-$MY j@P@*`@P nP pP[@[  -P 1Pd*@P p *@pWpyl*@*p@Ph&* @0 `V ``@`0 P``P! P}`P PP `PPU pZ UP`Pl*@P Pj$h*@p R 0  R Rp AQWP X  Np` pWX  p ZX l *@P/Go" [ Q 0PQ Av' @0B pPX  ZZ[Q ,pp[  ,@ '@6P n)p$Ѝ @w @r @mA-J `@@PpiPP gPPjP pP`pPU* *@PQQP@W T h5 *@rDDPi @ V P  ! Q e @`+P[pq `Ѐ P@'p@N+Q A )` 00V V# @K @H-d*@P 5P`o @d*@Q l*@Q h&* @ A Q/0S /G-dFl*@@h*@*@PP P`P`FPVq*p@PP RA APQP `:\@P`cT  0P R :EP@ P 0P`0 @AVP%DQ*@P 5 \&* @@ '@P  6X PP*@P H-Pp`yK@P t  0 0 ib @A-P*@@p`S & &*@* @ &\*@@ W'@ VNPV5f'c'UP+!P(7 !@P & 7 @!@UPPP᎚V( '@p %%W6P %%%Td*@i @$A-`*@@PpPUU$ '@@V  X@p@ '@NP Vp pPp0H-tV@*P@@ '@`6 RN`P2`xv*p@`P..p@-@ᵙaP*`@P Q ( '@pp> Ph5 *@rDD, '@Q ` /P Q pTPTP RQ /PQ QYP% P*@P pZh0 @D%0@ ' @N RQ Q  P S@-pF*@@Qd*@Ql*@Qh&* @ 0S 0RS Q  @m'A-MP @x*@P R0XX !P@ @$$h $p|,8HXdp 9 @ @5 PU n !`@PU`V Z P@P `VP = @m  @y!@e @ @ @ @ P @ | @D @t  @ ~ @{& @uc !@+ @mj @g`V M{ [ @p@P@LZ H PS`V @, @H @ЍAA*[ P@_U P@ 6[ P@-[ P@0[ P@3[ P@0S `v' @(" P  0s @v' @( n @ Ѝ @ @ЍAO-Mtx*@*@ QE { @@"p@` P<UځE Z 0Y @$P 48P #U $U'U =UO \U U:F"UYP\P3` V PR @@ 000C S:I P? @@IP@P `}P`_ @ 0g @ Sy)P!@ " "P0QPC[P@0U@Q V 0PQ P0SP U  "`=P:P `Q"AЍp@-Ppn @P!`@T 6PB?-PUpO-M‶@P*@ P  *@*@ 0 S|8 p`P'@ @ 5Pp pPe QP/QiP@ PJ刦*@!0RITGX*@Q PPP:PU P PX*@4  '@p_{ p@ *@Pʒp%bP+  @ a@@P%tq 'p@Q A  % XЍUO-^p ` PU$ЍK Ѝ/ @eO-,M \ j pP@*`@@oPP dPpP rPp@ *@P) T UP  "# @PI%@l8 '@*@4 +'@ `?űT#@WpP\@op +P\UP' \@\PU U@ PP" #@ RP@@W, P' ZT *@P`Pe+ PPn+PU UZ )Z* @P@`PpF I@WN P #@^yP*p@ Q`4P 'P@ ")* @P@ʪ`4 Pp'@QAʜ`4P 'P@Fl8 '@` p+ P㒑Pd p PI*@@Pr`@p Q@ OP Ł`F#@ 8RPZ 4 '@p P@V OPQ # @"4 '@p@ }"P `F @@ t"Pk,Ѝ& @H-MqM "@@`}Pq*p@㱑@ᯑP*@P *@PU% (@$a `P  @yP*@P Vp  q @!R 0p`0VZ`0@ P0p!VW]_> r  w  @ x   rw x  rw  x  0 a @ pA '@@o @Ѝw @\_ @S @NO-M\ fP@@RPP HPSP aP,f `@pT  pP @# *@[ ZP  @Y@P5 @$]YP @0B P 0@L PS *0@B!PH0 @ R 0:Q@MPP0 AP:H%Z<  =t [ @!p@@W E @ @@ P % Q@ 0MA@ 0PZ  Z P5%pD [ @P@ PIp?P L>*@@P@ P% @ 0 A a @0pA '@@d @Ѝ# @Q^a @I^z @A6 @<R0 B0S// R/0R/@-M@0@ P Y RR @ R!Ѝ @0A Q/Q/A-Y@p P*P@'p@@ 1GAq `t*@`@ob6P V QP QP66i*`@PQN6QNFQP -PF R  P QP HA*@@P QP @ R00 0*@ 0R 0 S AlK-P@*@*@ RT z*p@0-S +S=P-P P7 PP(P8 -P`c@oQT poP 7PP TQ TPf RTT@ '@TP K( @ @0H-@P 'P@6NF*@@P0vP몎땎B収T+ P  @ @@ 0H0H-P``Q@P pPPPppY*P@@ p`A-@P PTJ T* @ZP @@Te  @B @P ~ O !@`'P@p@@@PE0  @`FvpA '@@Q A F)yqO  ` @p@@@Q E P `Fvh@p `'p@Q {ZP `V  @2 @VX P  1 PUR@# @@p N V @_ `'p@@@@P@ Q  R k`VpA '@@Q A  @ '@ 1pW`V PAPPU pR0H-@ '@1@T P @H @Q R APUP00H-@P0P PuP0HoH-P6 RI*@@Q/QA*P@P `pQ QpG`WQ P*@P m\ @m @P 0 @-A*@@ y *@QP*@P C@-0A Q  @)P *@ @H-MPP*@0 \ 0 0Ѝ @@O- M0PQ`V R 0S -QpW  `-V0-`S @T 0 B@p@@1?`Qpf R 0 :R  0 Rp:P R W t@ @ @:T  @ `Q8 p @ @ @@1H  '@@  @G!?`@0@pv'@ @ @  @,P` ` P Ѝ:T   @ `:`H  '@@PPkU@-*@0SQ*@ @T9 -Q60Q2 -Q@T+ P 'P% R@ R! @ :R  @ R :R R *@ 00P ** @ @? @;0H-$A X6'@@P P*0@PP P!P P@ $Q 'P@]@P0  @ H-X*@HO-M$ | '@@v @ Tm P @ T+ @,P) P  @p`QWP pP P @PV GA@T ЍO-M$ @'@T P   8%A2X Pdp`P@Q* P wpU n[ PPFP*pP PT"TV@TZ   8A1 VTЍnH->$ '@   p@-@`2P P`P `0$ '@pO-M$Q 'P@[B `@ @ P X*@   @   B/o"V`p  @ pQ  (   B[Ѝp@-@MP$ '@@ P`U P !  @  " @ @1 "!  @ "0 `zUTU J =" @ @1("  @0 JA-$ '@pP @P @'P@PT5@DP pd9P}P f@_`PZP%PhP` @W F! @H- $ '@0M @LO-M$q 'p@ ; @ P$PP@2,P\4\4\4\4\4\4\44\4\4\44;4;4(54;4;4;4;4454;4;64;L6 Q    Qo P BP<P7   P,P! P% }PuP `P p `PP`Pp pQ P,QF @P@ '@P Z> P 4P{ 08A P%0`lP     `tPRP P @UPcQa @     Rc   P3Q< Q0"P`p  &P#p QQ;p`0\  P @Q* P QA P8   0P Q,QF (1  '0@ 0  @P%"%`P Pi`Pi P$PPc@ @ T Z P  @ Ѝ @TP P$ P'@0`lp   `t PP p$ '@ @R*$q P'p@@   @zH-$Q 'P@$@B PU@Q* HYP$(`,P R R R @0 @BT:R R  r R"0`8p     F    P `L @@-@P .  @0/0S/00/H-P@-@ $ '@    @O- M Q  $ ^  p'@P@@`p P'0 @ V `W   @   p R =R    QV$@0`@Q 0XQ]POP 'P@40 pBW:R R$  r R2 000- PPP$@08 F0P0 Ѝ?/DP8A4  @9, @.  @0 0S/=S 00// 0AS:Q Q/q Q/H-R@`PP 6*0@*@0 P P-PP U$Q 'P@0`8p     F > @PO-MP 'P@@`pP|8 4 '@'@*@p$  '@\[ V P ` v\ VQ P P  Q P K VP F PpQ?  KT\V P@Tp` V g`p#P@EpZ P P@:p `E`pP  @ P  P@p4 '@@G@AЍO-M$ 40 P8 '0@'@'@p*@0 '@8 $ , @`Q0` @( #@Q ``P`@rQ IFHFHIGIlHPI [IIFlFPP2 @PPh X*@gPfPcPPTP&U)0@ETY*0Q0P@0Q"0P@,  @ P Q*@@@pT 0   "11  1pa(P^`P(VD@A" @T `0 "ap!0 a!@X- P p@\=  R Q *@@PpP9 6TPU ~@DP)P @PA 0"P  @QJ @P@PpP{P  @, 4 '@`@{U@@ @`#P#P}P1@GQ PP; T PQ m0T*@0. 000P !P  Cp '@#g)Pp! B! @) 80R8X*@pL*@PP"* @PSPH!R\P`P "P $P }PQ p*@@Pq w2 0'\ ER0p@8V\^\^\^\^VM@T\^TT\^\^\^\^\^\^\^V\^\^\^T\^TT U\^TM@` Tj~ 0bP@T H@@xPU 9@D @Y p*@@ @ T0  @'@QP@:'U @P @$9PT!  *@' U "U ` @  (@ [@y}T@P` `@ N @@)* @P@1`P@P 0E Q)* @P@`P,P0@ P3 H `*@@PP)* @P@`=[ #U%UT#UP}UP @4 ' @ QP @AIQ@@3Y $ p*@'@@$ '@T~"YQp1P QP A PAPA00 p#P @Pp*@o@:U@P @ xBP  @@PQ{ pAA\ @ QAQ A4AAp0*@P ! 1P! 00 A*@P *@U о@ '@D@'U UUp?`P P?@<P*?U \U4\PPm   p@P 0@ QR A@Q7P@a@Q)WP@pW% m@@T l  !"`@1` ` 1UP6 P P`PJp@%SU Up@ƕu P P\P 'P P pXP*@S:@Q,  @ P@p@?%P'%@%& Q Q@ƕ p B  SUC UApA: '@%P<%&@#%R R@ƕ%3A3 S SAp@0SU Up@@PuO%)@#%R R@ƕ%6A3 S SA%#@#0R R@pA Sr X *@  `@rU6J%,@#%R R@ƕ%9A3 S SA%&@#0RS RQ@J??@P  @P P PP@_`4 '@p@P<PT F ,@ ) PQp @ѼQ@PЍP P `P pp&* @*@ WpWp>U WpC"&P |P >P #&P >P <P@@ ` (-P(" p PQ$` @hQ@ @ @c} @]w @Wq0 @NP * @Ga @A @=  @9 @5 @1O-M$ '@P  X*@P G.  p LbPR'p@*`@*P@80P@@T:T D P@_d`d`_d`d``d```k PpTt 1\T^ P! R0 T T  ;;T# |T9|P&1p Q @ЍOt!#&P&P ;P  / + $Ѝp@-\Pp$A P Xf'@@'P@*`@ P 80R 8 \P p@ p@p@-$A '@@8QpY`*P@Q A ʶ`8  R8 pO-MM$ ('@*@P0 `,0Q,@4 '@p0!P7Fq*p@X0Q F@4 '@ 0AFP$0PP*@P =` 8 yV'@'@*p@t 4 X'@ P*@@ P  @m`[P \Pg`[P P $P1  P  ` &`P$-p!\P `P  0 0(  ""P` P\P\@PP`P@P 4 '@`EP )@PPPVP` V P*@   P'P*@|8@ ,'@@`PAP4 P'@@U  E*@@9@0P*@P b(0 $`1`S  @BQ A ʃTP@ @P u@PEUQ A iMߍ0% @0P 0( ,a@-Q@Թ@Q0H-$ '@t @Q XF*@@PU0U U X *@ *@ '@P0b @0K-MP@>8 '@ 4@4 '@TG`zP*p@U \ *@` E4Ѝ`uQ X\*@坷P `zb `@b `@O-[M*@`  @Wp@ '@֠$ *@P'@P DX@ @, A A;P @ '@֠$ '@P<*@*@PM PN t @FPP$ P*@'@@``@   @P@ '@ P R RC#  @V  dV0`! \X1hA4 '@ @֠T*@*@P[ߍ   u R/0S /l *@\/0S  R 0/A-pW dJP*@@`pQ@U p ={ᤸWp@-@P P/{{P({p\J`"{/  @p@-` @P@PpO- M@`P```@ l*`* @`U ܆*@*@p*@WWpP PC l *@P @T Q @P zp *@Q  R Zr P Ql h *@ Ph *@P zp @P=Z@p *@P Qgl *@P Q  R\  }zp@[I P? PPWh *@ lz@pʨIP IPE ]z@p> Vz @ p Q*@P Wd*@  PUL@@T\ p '@'@Qt '@ Ѝ <  @]IZI0  @p *@ R/0S /0H-hZ *P@@ ypQ  yp  yp   yp0  yp 0 @᯳0H-P h@*@P PP0 2/yP0@-0 '@ P@ T  DyPZT@yg fFP Q!h *@ K-MQ`*P@@ T@P 4tttttTsTsss pWJp *@P  R 0[ @ B`Vl *@P  R 0S T Wq!po PHi0[ @@ '@VP p7ypi `zp   P"@pp "yPeJ`W  %y !y pp ! y`PbJT  @ V'@ P y Vo"Wp%yP*@P xP P Ѝ*@P ЍKHPx  @ᚲj7T*@H~  @ኲG@xG@T*@Gj  @vR Q%xryp@-M@ syp`*DP P @ #P xp @Ox8888 8 yp@-Qlj*P@*`@@ ǵPp*@P p@pd *@P/p@-@l *@PUpT `V PJQ <Q  R v @:D@Q:P Pg @ rv @# R+ @pP@-p@-@p P*@P QU0pl *@P Q  R up `up O pU 'E Up!E  @᫯   @0H-P @GPP tZv'*P@ @ 0,aU P@0A-@Q P@D jdpP `@ p@  ?U U  P@%P@UO-M@P PP94 "@iBPP4Pj @aBPL n @[BPP&jqP*`@*p@*@@P вTQUPP @@T @*@@7U`S@,BP @&BPpPU`PE4 "@BP JAa @p '@a PPEZU @@U)Z jf `U @*`@@!P@ @p WWp@WPT c  T@Xp@@WoZ㠂 *@Pu@ZP `V Zs@*P@!p@P o C !@㼿P& P# @[!*Z' X P (  @{ @ P 2n @  `Vt  '@ @ KP `@Vn*@P ! P [  e*@P*@P `T  @Zp `e @*P@@!`@ @pP P T kM T@p@Wp@@WT  @{u c@p@!`@PP D&@@T@Ѝ-PPU.H-M@ *@PP U*@`Q U PTT TT@ '@NP *@P `P`UP TV T@ '@6`P`{T*p@`P PVЍ p4p Q@ '@NQ= T;'7 9V V V|@4p U`VPD ?Q @:B"1p  Vs@ '@6Q*@Q `6QP`H-AZ*@@*P@`pPP ǰ`p W: *@ Q*@P HK-P *@HzoA`R*p@*@@*@PP`P:FPP XK *@Q/*@ 0S00S/ <R:/0H-@7BP*@TQ *@*@Q- P+*@'Q% *@P *@Q PT *@@  *@' @6 R T*@P`AP0p@-k@*`@PP@Pp8 3Up *@*@PQ /PQ/O- MĻȜ*@{[*<8`*@*p@*P@* @*0@*@Q@P.QAT   PᎭЯ[<*`*P@*0@* @P  P [<**P@ `*0@* @@ Ѝ?*@ R3/1!@R/0H-\@*P@P0# @0H-*@ *@A--JM \*@*P@$P8*@*@Q*@Q$$,* @ R (@SP*@@V(@JP*@*@@Qj*`@@TP:(@*@1P*@@qn$`Vf@ "sP @ϊBr2F?Qϊ:@"1` uqsqsp '@0H-@Q PP@U Pt '@P00HGt '@p@-@Q,* @ 0 P /Q(aP*`@ AP Q*P@ Q*@P ٪@p@- Q @RPH Bpp Ӳt '@G-@'P/PPP  @Le`P1 P/ P@`'"* @c:PP@m"``EP@_`\'PpUWB 'W P@IpV P@<P@2P@(Z`P #P pP@`V P@'t '@PG=0H- @@dP'.P @ U0P0H-4 '@$H '@H A-RP`p@ pP P z?P  T@:pGWPH0H-A4Q *@@'P@ P  P0*@P 0H赩0MH-M  0 ЍHЍ/@-M@dP gfЍ/ @ MH-M p '@  ЍH Ѝ/Mp@-MP@, `,0 PP@X۶!@Ѝp@Ѝ/@-M@x.*@* @ @ 0B@dN' *@@ @ ЍH-M |@P@*p@` &P ppPWM *@@ @ P@3ЍA-P``Q=QRJ`X@' `*@A@pW P P @PppX@p@-p]@*P@``壬`  @@T,`T @@T @ p@K-BM@p`*@@PtP   p*PBߍ0H-P0SR00S @@00SS @0P0PSS@DR DH-M@ P=`P" pU `:p@^pPQ A =U `Ѝ  @xA-M@ `'@@ -ppTpPH PZ Sa*`@  Q ,<  1/`Q  Qca  Op! *@U *@U OP"*@P    #< 0 `ᨫ`ᣫ  Ѝ  @H- M! 0  PP -P - *@P0 *@PcH*@Pf@ '@6QiFQl*@QpPs   @  Ѝp@-aP*`@U @3PUPp*@P p@tp0H-P0@PPU0K-MP*@@N-PP5  <P p    ` 0R`` =Q6  =,P- , - A '@@ @ '@P]6 P& *@W  =Q,*@* @AA v  *@ `.* @0Q0*@P ܦЍ0H- @P P Q 1/P @0p@-@L*@ R 0`PU0=U=UV =z+Pp PP ` Q 1/P 0 R=R/="o/A-*@ 0S p00S0W 0R:tM*@@`pPU Q Q 1/P`PpW:H-]*P@`@T p   @ (@p@T`V:HH-pW  @@5P7Uj @x @Hm4W 7g P@`@'W W '*P @p [@W@p !@HNA-@`PQp8T  @=W  @7pA '@@=P Q A ʫ 00 =PX  @Q A ʑ 1/P PPO- MX*@\^`@*P@P0 w弝`*@`p Z T    V WgpX:: 0@ X$W` @ 0mpW ЍA-@Q,8 4 '@y'@*p@`= *P@=*@UPP@P@_`P=PP@R`A"2O- Mx` p@@PrUP pP nPVn@rU`iT`@ dT *@P\ V   0N Ѝ*@QG pWD `    P=XPP T  =X T=X P' T U R =X   pW>  @㛥] @ᲤH-rP @ᩤ @ᥤ0H-pP W @P@ MPP IP@NP xP@@Y*P@P 0s @}H-MP `6P7  @ R0 qR*p@ P  @   P*@P ЍA-`n*`@@T @P '@'P@W Q   ;3 彧Q   1/ 嬧 ᥧ@TH-PH P K @K-W p`P@YePfP vP xPP ePe@o8p` *@P /o@P"p PW APPP0H-P@"@6PPE @6P2U*DDHT\h00P 0(S !S p o00)S R p0 @t @p0H-MP@!PP |P*@ Q (P)P .P U U Uo!P,Pu  P jQ  @jQ oЍ0EQ 甴̴ܴ 8DP\h     @  @  @  @  @  @pt qP@j @jDH-M@P`P*@3 Q0@PضLط8dj@P jP@ 0p@`P#V `' P`0Q(Q !Qop)QQoi@P iP@ `0@V p P#S`'`@V@ni@Ph iPc 0"#\ 0"#T5P5@P J5OFE5@P@?@`&$oB3y@`u&$@@(n`pjV@d`p`P@Z`pVP@@ O`pKV@@$ލ&H-M0 -R Q Q Q @( @Q 7 @4* P @  p @@   @ @0Ѝ@/ 0Q@/p@-M@ 7 P`7P 6 "Rq*P (@ 00@RQЍpK @o: @jH-@PiP QC C `hVAhpPp`hP @QAޤO-M`t@ @LTpDP-P{kPP~ -P,Pq xsP< lP$PDZnZC(@d @P@DTM pI P\ @ ᣡ@PP(@ PP P-PTv @㳡app '@9pD"@3PP PXPZ J4 "@3PJZXP p@%P`P; fp  v"@@t!@I@UU-f)5  n0`P RP:95P tjY @@ A @7 @2@pZ~( @H-MHt *@'@  @ 0 ^h@-M @)0 R 1P ! PЍ @ ΠH- @t '@B0H-@MzX*@*@ /@@T P=$P "@Tev' @0 @@ @ ?# x @'@ 9I @@@ 2gT+ P  @ @@ '  @@, !B @ @Ѝ0@-Π*@P T*@L*@olJ *@@$1 *@'0@R pPt H \A '@'@'@@p 4! '@' @P 5 0H-㶖8@*@@]A\$ *@'@@@ '@0 0R @@Qs_Q*P@[S *@ *b(B;;@;;;;;;;;; ; ; ; ; ;@TP*@P 0H0H-MP @  P   nPЍ0H-P,a @P`@PK LLL\\DDDDDDD %  pW pW 0  |0PUPU PU p@-P. P`, @@Pi ``   @G 6 P  00S) ! / 00S pP/0H-P0@P PU0p@-MP `@P`PU``Ѝp0  0R  /P/P/Q /zP/wO-M-0MPp '@n@*`@ U %k"P EQ^*P@\ q%P%P  @"X*Pp @Xp.Y@*P@@ @X@Y WY/aIP8,,,X,,`pP v> tc  *@pPDYEIP :AY BYp@pWr qQ ('P"P Pp@TP  @J@p P @t*@E #2 (∅@( w t  6+S t #+S *@ 0*(XY 'ppW P 00S  0 ~*p@D*@(@@P `.\0*@S0 ^oQ Q ,dddddd4a!&QQ "Q 'Q\Q P  b tnvfreM  Q`Q@^-s p  n^*`@r*P@ }n^*`@q*P@} ~*p@d*@(`@P ۟.*@* @P џP*@P*@P \R Rf P*@P0]S 0S MS ^R/ -R P*@P^S% cSC . Q.* @PP0@`` 7TQd*@PP(`@ @.P* @P0>*0@w t  t   *@ `Z@*@T@ x y* s*@0p v  0*@ 0  *@vo   *@ Vp *@/*@d(`@P\P PE p@]P 0P" MP^P -P xp^P cP&   p/j@ ?P app 0`` 7S00CQpK*@ *@j @qn^*`@*P@ s 7 :VP \P' kpA '@@Q A ' 00 UP PMpA '@@Q A ʳ 9pA '@@/  @ ẛt' @p H  *@@ t '@0ЍЍH(@EG @゛%YNW 1 @BT  @A-P`p\@DV/V90FPF*@0PwP@P0@Aq `0Q Pi\F PnF P%@@@p@x@@ @T@@@@0@@(8@EV9 "VD 'V '@=EV@9@7 @5R @0@*@) @' @% @#(@@0pU``  A`GaGV/`6`3PV`3ABq P RT @*@P@"@`EQ Ro @*@P0H-M*@@T t/ PU @њPЍ0H-n@*`@pQ 'P@ p R R0B0 00p pRQ A ʆ @p@-M@*@PU 'P"P`VP  @ㄚ*@ ` / )@`!ЍpA-PS+@AT: @b@*@~`D*p@ j@@@-@P Q  @ ."P"㩪  @9 @5*@A-Mp] @` P@ @ 0 P剿`P D @ 0P`P7 pW3 P<U uU @ @>,P P P  PQ"pP ^U-P P?PPPHP,Ѝ @  @, @ MM @G,p@-M@  0v @` @Q Q `P@  Q_PZ  @Ѝp@O- M@:dP ` `p@t @PPz =PPw  @ 6kXcX- iX:j @+PW  @+P. @ $ElX oX"} @+PB  @+P @ (- @~+P$ @u+P( Q* PX j+P QQ @  P P Ѝ H-P @r @lp@-M`P 0@-Qo@,@@(x @FP ( R  4Q 1/Ѝp  @ @<*H-M$ 8d0 |ЍH-(Q @ $D0@H)K,58<@ 82D8<  < D,H-@ ,$"D0@ HK 5 8<@D @-@4X08 PMKD0,8C D/H-M$ 8d0 $Ѝ@-M@(`HP    _,ЍH-@ @ p}]PJ8, Pq]`]v3Y58W5<U5@S5HPDP5EpGwK5\I5`,@-@4X8⯮,( 8R <  <  8< ,/@-@4tX8⒮,@-@(P @$D @H0K%8<0@D8~@  @,@-@4LX0&] !@ӾH-8x& @H˾H-M H^pЍ  @,H-nBu^p) @ H-oBi^p3 @0H-- @@0  @P@!Pt . 80@ @P / D0@ @P T <0@ @P ,00A-P`Q @)P  @Qp@-Tp`Q P)P QP-T`O-MP@p`ޭV @/  @)`Y:  @!`T , @`U 9 @`V Խ P*@P ̽E *@@Y L U@"YT @Y Z U@Yb @@Y@3Y h @ !o U@ v @` &~ U@@ & U@ `& @ & @u @` & U @ & @`& @ & @ ! @PP  @ ! @uY  U@l@` & U@bu& @YY  @P  ! U@FY   @=Y  @4  @,Y! @#` &) U@ &0 U@!8 @PP 㚼@ Y@PG @YN @ !U U@`YV\ U@od UQ@k @PP \s Y@ z @ U@ U@ ! @Y  U@u`& @  & U@` & U@z & U @q! @gY*P `K  @@@pW T p`P@sd 0ɻF pWP ػ7P ϻ`[ `P@`0S* t p @p@Y P   ᝻<0  ᓻ` V OO` 0SV pO OЍp@-^@*P@`V %IP: @Ļj @  *@ @㷻` !@㲻p@-Q@ @@$0PNv'*@@ @I*@M0S^S@^0N*@@O-tM`@xt @㥤HD(@(@p[0 q @MP>%U#$  @㈲a@PpL\\\ Hp /@Yppʣp[pP a8@ p`.p @B D Zp @͠dhD Zp @ $ DZp @㸠GP:W W Pk(  0p'4P0Q  p`p(@@P%P =PpP   !P<!:TPWW0ppQ0P  p @!4P gH gZp @M᯸ j/@ @  04  @ɆH-  (@) @ᑸH-{XኸO-M`@qt @㞣Wu *@|Q *@p@'P@o@ o  0帮QPKPP HP %gP RP fP1LP PP* hP vP# /@    pH(@V QX Q`[` `[`Z[`A*@ PX*@*@P 3sYp0;@ O:pP .y5P p*@ppP #P *@p!@*@@ *@P4*@8*@ PL@ @|P'PY ៷j` @ @zp@@ P2U [M`Pbᾢ ᘅТ 嵢  P厅Lzp@*@ *@7/P P P vL "@_ @H-M*@*@6 kP (@@0@0 @ 她&@-@P#P OP k@*@p@-M@`&P #PP`t&P PЍp @ 0Ij @ LO-MM@P*@p*@e?*`@ *0@/* @ /*@* @p*@ @ P$ @P ` @ p@#P Q@  :n ( `@*@/@ ᬯA@6Q Hp$\PPPPPXP@PPPPPPPPPPPPPPPPP0PPTPPHPPPPP  $*@e 8ppg Wi@*@Xjgf %pp%"Px *@S8*@@PO*@D*@E,*@ p >A<*@&80*@2p @"#P) D @#P=" ppf%"P: *@4*@*@  S%"P *@ps [= [; p*@P: @  y @ 6 @  ` @ G @P @ $*@Q0Q=0Q%* @oH*`@ 0*p@`00V?*0@0S%?* @*0@ 0S%0* @ PA o0'@  '@4*@<*@P Hoa @0H*@(@pQp[PE pU|8*@QWWtaL/;* @Wp jL/ @* @4*@P  VP  P4*@G@PJ X@pt8U; ( @X-1@J @0@P0! @㘶p P@Pj @㈜@U$T*@*P@ P@*@PP*@LU. @bP> j @U m H\p @PP@(P&@ U P*@QQP *@@ U0*@ @PPS*P@f/PT @  P*@@P @@TPSL/*P@* @,*@ p@(@ WTPp ʹ##PSPJPUt jPJP =ToRUb . @㺶PX PP*@f.`V ZPo : @X>P@  P@ p P NP% PSN @せ PS(@X@L/*P@* @i,*@ P*@@Pd@̳j @cAU PShTTdTyTS @ZIP@@@t0!@ H4Sf@U@Ab"!@ @PPpᛞᒳ0H-@ Q@P@ P  PQ8@ ?U*0@ UPPP?*0@ ? *0@ /* @o$* @00HA-d@*`@*@ o*p@ PP .D> @TP0@T @l@K-M]pP@@ ` (@`@@  0ᠵ[p P@W@-M@" @P @90 @ 11@"pp30@" @(H@D"t圐@Ѝ0H-H@@ P "P<$0HS0H-@(*@P_*P@P P@P@ P P*@0H"eP#D* @\p0C@PP@wP 4*@P8*@P*@P៲eTP#QD* @4P P# * @-P0T@O- MP (@X@0@  R @@!<@( H@, O@0 V@ݴ8 ]@ش4 d@Ӵ40 P h`@k (tg@ @ `@ô4S t@ Ỵtg `@4S ~@ ᱴtg `@4S @ ᧴tg `@4S @ ᝴tg `@P0S @ ᓴtg `@T0S @ ቴPG xh@p@`@ P8  0a0p o0 j0S$ !S0  @!@1@ YP"B @ @H0 !@ BZ: Y ЍOO-M@(P- ,P- 0P- 4P< @PN @8P,08<Q4<P (Q  @  @ @) @ Ѝn @P (Q  @ @8*@ R* @8` a BR RpA @Q ``@p) @0kv0hS pRa`P R mv@Y<Qv@P< Qv@EP PU*v` R 0 0R *0 Q*b @(p pR:ppW:rO-,MMP(P *@  P p@\0 @ m@j P@KE@XM :qP(R ((@ 7E`"@V (P  @P> @Po  @9PP *@PP*@V "@ (k @`@P ᬛPm `@ V:0  MP q  @~pV. \E@@P( g`( ᇛP g @せP l @{P  @ m~(p [P*@XV @P T0  P  @D~pP*@\ @P(P*@@(dV`(d!@Px @Pv @P} 4@P B@P S@P @P c@P q@P ~@P @P @P @P @P @P a`@VP @  }0P:($ @ }P*@  @}P*@*@P*@P*@  }P0 HPKPH QDP*@(0 4P7P*@,0 &P)P*@80 PP*@00 P P*@<0 P (4@  ?}P*@40 PP*@0 PP*@{0 PP*@m0 PP*@_0 PP*@PQ0 PP*@TC*@V*V:  @ 0 @  (P*@"(*@Q 4  ((d*@V) @C(VP 0 @@`V K P P P @[: P w((@"#@&`(dP' @B(P0 $P q  @i|p@"T ::  @ `|i @]|@@@(t P  (  \  (( AtP P (s@$(* @Q P  (f($* @Q z (W@$(* @Q~ Pm  (J($* @Qr d@ (<( *@QpTpP*@ o,Ѝۍ"  @{pp@-MPcPW*`@VH@H>(*@Q.4o*`@P!fP#H* @7p P P&P m H#pڠ '@P@㯮P fP#H* @p)@'@Ѝp@ @jH-1 '0@0S H O@-@P*@Q Pf/*@n@d@-@PP P @P P@ j @@Ȕ:@@@O{ m'@$H* @O-MT$*P@; *R D*@*@R P@-{;`KS놔(@X @-pkE I ! *@fQf/Pt*@ @Q  GP} JP@H*@Q W%1V"HQ WVHPp*@Q: P D*@PY @ 0zQ&1E'EQK0EEPF @ 0z=D*@P 3@ 0z*@P7 n ^@ [@*@P @L/* @,*@ @? f/o*@ɯNP r@ؓߍO-M`p@DP*@P@Oz ,] P5U P:? QQQ Q Q8/PP@Z Y  QD*@P 6 @z@ߍD*@P @wD*@P @yH-PP*@$H-M~@P  xp -"Q@*@ЍH-M@P  xp "Q@*@ЍH-`@Pk0P*p@ RR$ PR0* R v *@*@ fQP*@MV@ H-/* @0,S P0H-MT*P@ R@4*@0v0PЍ0p@ @ ~@yH-MPRP@ p`xp""Q  "QOQ QQ$( @ @Ѝ0H-PP@P0@P @^?P@PG-M@PPQ" @  0/P @x*@Ѝ /PPc 0*`@p/8pP 0,`pP   p@-M@PPQ" @x`  0`^P q @x*@Ѝp ` Q 0P #:r/ Q 0P #:r/O-M-8MMP @z? 8 (p슟8(@@X$ P p AB@ `!@@ `PD @T)PF(@aTC:aP?(a @ RB`@š⠀ i( @l `@R@!P! p P) ?Pl i`@@" q` @ "P `"V @ث0S  3/@˫`@_$  @ A B*@    a @ p P( 9P8haV :aP8< |xP*  0q#Q @<Q:# @ ᄫ_$  @ A B*@      @ [pP P 0< A | r G$Q @ 0<`00V8$ @ J5 ( P , *@0z *@PP @b R q R @T: ,*@0 Y $@8ЍۍЍM0H-M@P 0Σ-( @CwP Q Q  &Q  Ѝ0HЍ/0H- AUO@P!@@@ ݪ PQ`\@0HӪp@-fMMr0+@Dup <4< S@㿪{@f  @P yP<<fߍۍpp@-M E*@@( @ @Q @ P nP yP@=ۍp0H-@ (@XPL/* @ ,*@ 0HO- MM@= L/(@* @X  8| _ `p@P@@P!Op P ?P @ᓓP @TCP :$@v  @@@: @ 0(pX P  ڙ  RMPۉ jp `@P@"@p@(p@ P  P Pۉ p `@P@"@p@( p$ P  P (Pۉ p `@P@"@p@, p P  P ٩,Qۉ *q `@P@"@p@0 p P  qP Ὡ0IQۉ kq `@P@"@p@8 p P  UP ᡩ8Qۉ p `@P@"@p@4 p P  9P ᅩ4Qۉ p `@P@"@p@< hp P  P i<Qۉ q `@P@"@p@$Lp| P  P MRۉ 8r `@P@"@p@$0p` P  P 1XRۉ |r `@P@"@p@$pD P  P Rۉ r `@P@"@p@P p( P  P PBۉ b Pp@@"@`@T P : P ިT Ѝۍp@-M@@  0P  tۍp,/ * @(@ X p@-ME*@@h+@ @Q2 @ PC@`P ====@;ۍp0H-MB@@ PP yPP @ 9% @@Q;ۍ0O- M@P +P>@eX `@p`6Pp@X P`P00@ 3H(P`H@TQ:mP(`@ `pP @P` XXX 7Xp ARM Z*P@`pP @P` XX @T A1M`P@`XX  Z塃 Ѝ@V"H-M@p $PP4 gh`PP_ bQJQ KA P[ ABABBBBB4BBkA P ABABBBBB4BBF `Q CQ GQ 6`P/gQ cQ/A 1 `. `a* `a a @  QpP*@`P8@0 &ăp 4# PU00p T&Ѝs@g@d@H-P0@@ R$ @@!7@ڧB0@ ԧN0@ Χ "@ 0MX [ @ 0DX f@ 0;X k@ 02 s( t@ᥧ, @ᠧ0 @ᛧ8 @ᖧ4 @ᑧ< @ጧ$@ᇧ$@Ⴇ$@}$@xP @sT @@nh @ 0l!R@p\`Xp"P@ UpW]!@ 0HO-MpW `S 8@T,PU@a @ 01@ !R @@!@ #@ QFpGFpGpGQ TTG*TTD  8@ @@ u< P @PP+8 Q @PP*@ 0Ѝ++** Ŧ H-@(` @P59@ 0P p 0pW:H@-W%@V"H0P f/  p@- (2/0Ͽ ? 0 b B b B P2/<Ͽ>3?( 8 2/8 < 2/< $/$$/$D 2/D $/$$/$$/$$/$P 2/P T 2/T X 02/\4\X ,013?1  Brpp 13?1  Br *@0`2/3?HVXO>_ XH0p0` 0P@5_4OP@@4O@JJJOJ ^:p@-@H*@P xf/&  W5V2HR2/R/q* @ R3G-MP-5P *0@  L!>Mp@@ P(@@ pa ᾤ`9`P@`XXX 㼥pGwЍA-  (@@e0@& @ 08(XS @`@ P@H0p`F vᐢK-M`@8@Xwp@P Q pe*@  *`@  ;Yp*P@  `2/ЍKB$@  j @K-MPM@P PG*  PG*  o`P@p "Rq:*w=ڟ  P5"P p4   *@`yLCp, @ЍM@ V@ P 5@ M@Gg@B @<@70*@ @7O- MMP@!@P_ @P !@PI*@@eCp    P  ` @w LVCp Y Ġ (DyP [(I*@@Q |P XZ 0p`P @Pp 0VH3E `y*@@ @p@ w*@ LCp Y   P `ґ 0-(Y Rf x*@BBp^*@ rp 0S *@@pIx*@@BB p] @X?  (@XP Kp @P*;$!  p  @0ע,Ae P! !@@ 6  @0o 0V`pX Ѝڍ$ *@ @ @@@  (@=*@ @ᜠ @@-MP@  P* {*@H 5BpЍ0*@ @@ p@-M t*@ DBpB U*P@  - @K E @ @AtGk @@ c `@ @ 5    @-   @%   @ @@ Ѝp *@@ }A-MP @*@zD Ap  P`I 0@ `CW @ЍB8*@@ Rp@-MP$`@ @ PP @ Po *@ wHApЍp0*@ @)O-$MH@z|P/@(@p@` ͘qP p ePjPd|*@L @ @@IAp Pа Q P*[{PJ @p  1Ap}*@@ Q) 1p?0@ F t*@8 @0@R0 @QP \`P@0p   A`@V: *@ @3 $Ѝ*@@ 2@-MP @*@ D@p*@   @ Ѝc0 @up@-MPLPPI `@< @$ P . @ P @ P !@ P/@` h ``@@`U @ P` u*@ H~@pЍp0*@ @$ O-M-PM p*@P$}Pˊ@`(D( @ ϊ @X@p' ˊUϊ@ @ U'( *@y#@㇠ P  =@p*@` 0Q ( @rPЍЍ-*@@ ?@ @-M@P P_@ P *@v H@pЍ0*@ @0H-*JTR0O-\MPPHm  @@`@/@p EcPQ@Q:aPl@Q _\eP`\e_\e_\eh`dP <p6H(@lW E R*W( rGdWo  @>p acWoW(PdWt lW 0 Q@PQWQ RWQ SW H@ ~ Ht?p@pW] rW P$ 0 C @ @  DY   P@@ EuP `PpU@P8@UD`@| (H 8?p@XH@ ~H %?p@ @ {H ?p@p{@{.P@ @e .@oe:@ Fc}$0 LbPsU}Y @McP@Qyf@"|Pw T~@@j @ zFT `CV y  `(@!P@rF   ? P( @p t P tiFP{ iÇ@P Xp @ U}zYs\Ѝ", -@ @'@ K. @ . @y@@  H-M  @ 0 (@ᖜO-$MHP A@PXE  L ,>p@ `tP: p  >p3 P5< X!@pP n !`@Y KZU @C}1T  0XyY$Ѝ@@0H-PI @PtsiFPtiFP rmFP# gtGP9SkyrFP loFP.  ! @@P0H01y}@j @0Hy6u a @00HPT@1UtP0ߛs @0O-cMP @*@8$ *@㸅( *@ , *@a 0 *@*@4 *@@< *@/@@ *@p4'`@0,( ῔RP0S@'P'jlrrrrrrrrrrrrllmrrtmlrlrr8prrrrrmhllmlmrr(l, *@0@Q-A@Qxkrrrkkrrl`*@\)A80@* @0PJ8PE\ `*@*@Q=Q`*@k nnnD *@@*@ <h<QFp|CL *@wH *@sy6  '@ R  Qd `$ *@/Px puT<*@N4 *@J[pFp*@@ *@P)X*@T98@* @*0@wP8PP *@ P%P *@ ( *@`/oP" @9<PH  P '@r0 *@  '@'@l*@| `*@P :x/@P Ĵ|*@ pP  p 0W> /(P< `9 ||'@J *p@!@0/P :PJ <p_ 4`Vhy*p@ V *q:POU P :8h*@*@a '`@`P  p: ,V /PP  p( ($@p`EP`@@@0 PEucߍK@[t@V| *@j @㒁:@JpxH(@pp *@P0 \P-@8 @2h@-| *@j @i| *@ @ | *@/ @| *@F @g 9ᶙ, *@P4 *@P8 *@P10 *@P( *@P($ *@P "$ (*@*@Q 0*@Q P@  '@oP@gEPa P'`@D *@P@:P H  PD*@D *@P9 D49*@*0@ 8*@0y*p@lY*P@0pP@o2R d9 p'@8 @c^ *P@  4㏿ p'@'ʚP?? @*@Hgcb? p pP @b? }p@Pp*@Q D*@QP:p/@_P!@@*@eT,QD * @:p@R@m ,'@* @{:p3d@ *@f/)H!L1  @pPf  + *@ R< 30@R[@B ?0|,0(p0 4,k* @*`@,p(P00?P4< ~*p@~*p@0q 'p@P~*p@D|*p@0@<*0@H*@[D<@*0@ RH<?*0@B@*@@R@*@l *@*@0 P  '@'@T!Bj8 p'@ l *@j @A '@@p8v '@P U otP*@@ x)* @uP% h *@P xYhI*@*P@*@@n/(ox)U * @PO @O @O @O @x+* @n +*@* @Pf *@PP)@<* @T *0@*@ D,X * @*@H*@@ *@ PD *@ P [*@@<H<*0@?D<*0@0@ 30@P&@ #*@ H *@@P* ]b/a? P5Jt A 4 !$ t_/^? P Jxp!B$ 4p|1p"8P`RPP  0@ &"[*! Y Q  t 4$!p]} @D *@PX @me\ *@P@D H*@*@x)* @`9!*0@\*@R  *@P(\ *@ x'*@\) P* @U3#UE3#C@0!//@!!!@!Q*`*@xi!*`@ 0SV*0qW WWPL!*@@1@`!p0 `0,Pf0 T (pQ$ QQ! PP!R!RQ !С0 Z P  W p:m@d @0 *@*@QP\ P( ( D*@@H*@*@P*@ *@P $ *@P '@ @ *@ 0 ,00(008@8 *@P '@4 *@P@*@Qm 8 *@P&h *@P xYhI*@*P@*@@n/aox)U * @ '@ P*@R@0 *@P4 *@P5 ( *@P x *@P]@=d *@P"|@5d @4+0 *@Po x*@*@  i@#+8@P x *@ *@ '@PU ( *@P @U X@×@@  ^*@m '@{J؀*P@(`@p@@P rA '@@&q5 ᡗ>@@㜗d cP8 o@*EQeQQ  {b@ *P[3 [J   > '@ r H@u@P a8q@?P`@p@ @0@ @@@  0@@ @@@ 0 @P@@ eP x)P* @QKJPU( @*@P @@P @'Q8apP@`@? p pppu @P x9*0@P! !Tx *@ *@ ? @0 pppo?$@@@PPX Pl*`@PUSPE>QQ1QFP `X ( \  *@0 P@q` P*@" `)0  VPo%@ @0%,0PT@wPL*@@P PnP$ @ Dx *@@DЍjj @O- M,p*@ @P*@Q3P@nP *@Q4#@ ЍO%P-@%xjP*@ `@PS 0PUP%P *@ Q m@P @:x *@ 0U  * 0 ЍOP@ S@_%P\*P@P8<㟸)`*@@p W   0*P Q@@W  0   0*@plWP" RJQQ>@%@ΑP Ѝ@ ЍO‘@-M '@, *@P*c@㵑*@*@@ *@*@0l@0襑D *@*@@@ H *@*@0@0蕑P *@@Ѝ@荑@㊑@$+* @*@.* @0  *@'@@@ pPp@$H *@*@@D*@0 @ *@@ P?@Z` \*@*@ @Ѝ@O M0H-M8@DM(@@P@P (@P P p P@ Y@oЍ0H Ѝ/H@~G-M@H *@Q4 Q1 pP`% *@P%& \ ' p \ og @@@v@]܍M-M⼁ q Di'@'p@*`@0 P0Q8 x)* @p- *@Ph hY*@*P@@LTڤ$p@P\*P@P% @ؠ$p 0@T@8v m HH0p @.v@)v0 P0Q Ѝm H00p @vp@-M@P C$R' P `0p a1P0FP| [*p@R(*@Q8Q t `MHQQQ @ Ѝ?@O-M,(0`Q4  *@ 0P~p@c~p@x q*@@pWpW@PpPWPPpp[p(*@Q\ P\*P@Pr {x*@@!R RR>Q QQ[P!*@p@$  PQa=t(A*@`Q V ! Q  0  R Qq\  @ |GFR 6QpQbPL*@@` ( *@P\ PfP$  B @ J\Z P\*P@P fP$ @ Eppt0\ " #\p Pf0AQ  B p RprQD `  *@0 @p A9p@CQ @P\= YdP9 U*   `+P p*@Q% QP ( *@P@v!Pp@p~p@Q$ @@~p@pЍ@@-PLP*@@ ! 2A b A 4$@O-MP@*@`, >P} Rؠ*@PU 0 p 40p0T0PRPP B $d?UU  E 4p` g*@ B`   D!!pD H*@*@ @` kV Pd `ᐺk Ja  ?(1`)?P,* @Ѝ@kO-M⬑ '@ pA '@pB1!?! gPo 0!p  R,ЍO'!t*@(P 0 !  tG*@P, 'PЍ @O-kMM⠲"2xw RB`-*@* @*0@ p@/@*P@*@@  ᵀcPd @RE0稺\\\\\\4\L\T\\\x\\PP1 TPyP :P p P *@@T% zP& @"*@   t'*@ @2  G *@  = pR*P@B*@@6N"0@PQ nR R oR*@StGP @@    "@SPp"* @H(@ V RA*P@`  ᤦ@P @/mP@ @& 7! @0@j ѴP ᘴP)  ㄦPt p @@P !@P @Pf  0 P`:FY gP@T. ;pT z D@0(P e.D)(pI &N=Pa@PC"PA*h@ATA&@@@! *@L2  @0@`kߍۍK @ᠸj @ᢸ@ ᓸ|@Ꮈ4@ቸ6@G@.ቸe@@.w>@!@nH-`@Pᗧpro p H-c  (@6@0@qA-`PV p@ᕧ7% ` @0x>``p@-@P: P @P !@P @P'*@`V PP `V*@P *@P *@`V PP `V@pO-MM*@0tW@ P@Q `P `V@@@P !@*@QqT k  N0+ ! @ @P= "@ RP4 V@p@`"P@ F[`P -P = qP p   @ qQpP @ @ 帒*@ a t( @ @V  @T Jp`E !@@P ֆW 㗆%p @P9 P |b zbV @ @glP mb kbЍڍ p P PQP@Hl/QP o  @ R @ P P= G?J@ 㿚 @pP!0@!@@d"@@   eP [  l l0SPP "@k @k @ =P%%#* @*@/*@/*@/ M@-M  (@@  c RG-p@뜓*@aVQ *@  @S*P@P Q*@ @ ~t@o @VP 㠅VP*@@G  @ͅڃ MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ៃO-uMM⠳*@N !@%pB@ ##p ppJ%P/JPJn*@@  P-  P voL -pP j  @p pP* $PZQ @-B @*8%<5" #*@!P P$p   P  @a @Q @{ @a uߍۍH-M sP )0*@ @㦄)  @*@㜄*@ЍH-(*@Q 1/ $0H-bG@@0 P",*@P~T@0@-P@jspF@O-CMM@ 0(0*@00p $40 8(@*@㰀0 ,P  ˮ`P 4/P 8gP P0P @ ᄄ4PY   0(` 6/PT $P , P ,W WPYPYw C/ ; Ĩp z8DP $`"v ᐰ (@H * @  8*@`V P  hPP `㴣` Ꮳ80@X0*@*P@  00 0`` PU  ,P P㐣P kh ePPG@ m@  @P;4PJ pW20P8*@`V J`U @@!P@ƃ pW p ゃ`V@8*@P*@U@PUPUP ,`(P $Q V`@PUj8 @CiCߍۍ @@O,,` CǗp  4@C8*@pW P p O ᮗp U `U4Q  '  0@PX UUPP PP 0  @@Ѓ PZ 0*@P` ` ^^^D8 *0@PQ @  T% @*@@(T* @A'  `PP$8*@@T@ Q Q(OP $Qc V (E@P $QX `X`@` *pi` Y, 0H*@@P% tq- `P @" @: d@0@YPU zJ @ p@@@0P  DPU H-M `@p0 p4/DXP*P@ Q = 0p4/P QPЍO-M { P`p@/@HP(*@* @ ymPn0@ So@PLH(*@*@* @d\x\\\\\\tTHL(*@* @PPfP pQ[ H*@P P*@P  @{NH(@@`V< P d@L*@P d@V$AP [  0Gp`p^ , @gpWH@PXPЍH-o  (@X@MH-BM@L*@ !$1P T*@Q^T\ @Wp> 1sTHP*@*@@ 'P@ @F  @㿁o:NKmP@@(`@᳁XP@pop W  AQ _ P  mWNW YWyWnW Y@BߍHЍ/G-MLPH*@*@Th*`@ Q  @ho @p P  @P J@ P  P txxPP\  @@RAm\0/`h\p P: P  0`] 0p \`R PU:P @>`PwP @1`Pi `bP @ U`UD! @P  @0` D @ ㅀ PЍP3`xp0|P"%  @'up @V ( P @P ` > @` `# @ 0B`Q 6\ p @O- M` D- P pW P9 @p|pYPP @xp pW!URQ k @gQ @[]lH@TN pPJP L A@@ $!1X(,YP @2|YP @)pDQD% [[[XY `@ P@ !`z @ @p Ѝ @e($X* +HU,0s80004p 00 J  PBR"rBa!DAAFPPP @  !@pPY R"0a!D 0U:JA130p 00 A  pP80P<@5 @ @ @ X $P, ,  RT@|@@DPFQW* * *JL>,@10p04y 40   aPA A O ųP& 4c@D 뗮 `@0 R : `eVC@Q ZZ "L P\*p @ 0Ph0dl Q* /L PUPBPP=PUP8pP4[7@H-MpP`@X@P @ p00 00 " P0<0@p10q 00  P PZ @ IZЍ,@O-$M` 0lp@P PR2TP Z P PP: LP p0p@@@@@ Z0@0*@@y =@QPLCLpqD Q@>P PLp% P @P Lq @QP@LpPPPP@P PPPP @PLpPQP?:P P p 0    o@ 0  e@P 0  Y@P R * 0  K@PPPU:dY ]Y$ЍG-M@XpPMSP  d 0!  XX Q @ *YT@ Ѝ0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:L;=0@ t @ 012@o l@GP P@/ p; 3@3/1LE#@@/O-MPpP:B `p@@ P 2R B p:C q : p4 q5*;  rE @ @ 1u@.  !@nC p:S6 s;=0@4:E0L0@#@0.R9 rE*;- @G@ @P'I@+rs#*B; @@R@L rE #@ @  1SA s:*;M@@<20@z@ @P H" @@ P P<=E L @#@  I@ P  P'f@P )E@L@@#@@@0 @P B @@ @ xBP P@@ Pp`VE:Ѝ@-R:P P *2@T@PO-MPP:`"Q2 sS p @PQ`:Q*r@pTSPP`VP:LPpP@ RMZ:Z*0 b `V Q Z :AZ0:   z/Jb q:Z z*;- @Z :Z *@ 0W @ @ " @E L @#@   0EPpW:< @ 0  04`9P@ P UPZ *  V pZpGV:PQ *"0S 0@@Q@@PLPP@ЍK-@9p@P Y:P 0S *r` VP 2S l@`hP Y:P` Q*`Q `O- M`PX@ PP Ul L q " Q&#T @a H0Lp/uPWPwPP  < VPQG:/L0S s2Slpplp00rP'tppppp%r020'2Slpplp02#402Slpplp02St0pPPQ *RUlpplpp202#20P0Q: P @X !P 0!  P P s@@ Y:@CV@V@ ЍO-MPpP@P<:`@Q  Q P`V:(  @ 0b@P@bP PQ *"0S0Q@0P. <`ql Q+@q PQ*lPP " @' " @@V !@.P PP:"R PV6@Ѝ@: !@`Pl`<@A-P W@BO`\*@V` O@`*@T@ *@P  D@Uh@+KOP) d*@KD8Q:PQ*" P:R$ R 0S, r:y@@d*@PUNU@4@@a@8P d(2* @ pp p p@-X(* @@T *@0@00Td@*@@Q (* @0S @0S0S\Xh*P@*@@@T`h*`@T@@pG-`d*@0XHXp*@@*P@P 0   p O-eM@ Pd0 Y:P0Y*h0 L4D$P008 H<@D\`T0PdP 0I `!8@ q 0\X! *P@(`,p  Py YrXp1PP\` d( Q Q d PT(` VhpOd \@@P( d \x*p@TP@(`0(JH 8H< Pw UP{ Xp P *  P: l@}PXpd ((dP\(e`hpP P P@@\ 0Q$P L 4RD`X \DK   P  | Q@ P @Qt@Qt ; @ Q. 0  p R0 Ph FJ QDP @ @`@*@0 L0 oS0 4D\D`4L@8 dD0T4     08H< 0 LXpXP@  Zq0@ pq0`Q L 4RD L DLXp`H XpLq\   X  *@@ ,Xp`0@dLhXl# hPOT 4   D 0 8H< PP KT 4Xp Q\*@TP@PL\T_  D*@ @PP$ Q]* *@h0@ APpW\M pE@P?pT pEP0U: T @>:U<* *@0 APpW@T- pE P?pR pEP0U:R @:U* 0SpW 0pP?0W0  Q: $\p P` EQ* \p q@\ p4[D pDP`@PP  @@WDp DLpLp\Xp*@Z@PP; P0 P , @ ;PR h{@dHPP*<  Q 4 <RUE h pb@ uF:<G A@@hS!@;P' hH@@lPHM PLpH!<P@APXpJdP P3P@?h$@ic@d`@Pl@6P \XpHLp@#P] YXpPAT:HPT*<  +T TE H PTA*<dT@*h!0@l@XpP( $ A$$@P h@=@@PP: P`6 LXp`P@P*DHd Q:h& @J@XpP HPAdQ*0pG-p@됝*@aVQ *@  @ r]*P@P Q *@ @q jtQ[ @qVP qVP *@@X  @qo MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    oO-uMM┽*@N !@!pB@ #p ppJP/JPJn*@@  P-  P ᇝoL >pP j  @p pP* PZQ @-B @*8%<5" # *@2P Pp   P  @a @Q @{ @a uߍۍH-M _P )0*@ @p)  @*@p*@ЍH-*@Q 1/ 0H-s@@0 P *@Pe@0@-a@{W@O-MMP`pl`@PJ   P)  P/]P rQd)0@ @pVp☙P{p `ȼ P `pWkW~h Upl~P `p -@`PTVJ4PQJ  !o qPBJ040 #ၚP9JP5J[Nz) @ 0o @P#J~PH  pNʿPz) @0o dP@PZ` P KV TJd@ߍڍ   P ` Pl)_ @0oϫ@^`{F~PdZ)@`oZ 0P ^/Dp P KX BO-LMP8@H  08@C E$S4<CE(SH89柅ⲏ9D, !2/!A4q["X32/\c3?s6o7"X3\csJE0 > ??h 6 p / p (, p !$ 0p (0X$2/X$\ 13?1 Br4 0Ѐ1 ŕ$5<Ͽ(u3?,e7 6o ń$5(u,e@ 8p < Hp D`H%L52/Pu3?7H%L5PuT0TX0X\0\LЍ0H-@P˻ ƻ!!Ἳ0A-P ᧻$`6o P<Ͽ2/3?> ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `Pm!h"c"D`6oD`[#@`6o@`S#H`6oH`KL`XLL02/3?6o8<\1L` X`\p `` @p8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x ĺU @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUO ۍK-MT|,(@p@QpPp  RP` VLB Dl# 5_ P\ P PO'a` 0 p ЍG-P@ p`CF P =FP  !  @Tc@@'FP !FP  !  PF@pA-@Pp9[`K ` @0`AO- MMHQP(80*@ 0Bpop @o?BT *@4  P p P*@P1 C*@@ R000 @Y#* @?*@P`6o`@`To`@p@p pW v`ov Q p p Rm0tPe $* @@T p` Vk# h@*@1/p@ *@P*@P*@P#* @ R000 |@@0#* @@@ 3b*@*`@  *)*@EC*@P =  Pppp Ѝۍh @A2O- M@*@ 倓*@`4  R000 -@p00P*@5Q  P 0PU 4*0@`0 S< 0/?sP8PU  PP  @P `D p @R000 ?$0* @*@00` R  W M  MP0Pr `P@0*@ٟQU USVP  PI00P*@`ß pF0 PY6  @DPC*@@ R000 ?$0* @ R q*@ 0$* @00 P000 U  *@ ЍH-M 0ЍH-AM`(p @@P1 j 0P@CU :(*@P:q @'>P *@Q p%o  @ P @  !@1 @1AލG-Mp@PK *@Q p`V*@Z *@P*@P` 0oP] ( PEUP ("* @ #" '@ Q p%o  @ @ P @B1pF @ cjB*@@P*@Q u j @1P 1@P @=P *@Q P wp*@Ѝ@ @ ЍG P wppЍG2 O-|MMBNpX `*@PQ po@ @ Z @0 *@P *@P`< H@' @]=PR  #C(b*`@ `Pm#* @`Ph@Q $*@'P@0 d$ Qp S 2/l$Q t 1@ l$ Qt pB(b*`@/ @v0*@P @=PZ  '@ 0S 0 L P "* @*@ R5 =@14@$ $3* @*0@0 S R AqR AqA`*@P i  0r *@Q p  PjmBP(*@ @`  0ϸ t` @P:㠄f V @  0㾸! D@0  f V(R#*P@X 0Pi  4B@ ZA\,S P@  ` p ( *@P (*@m3*0@*@ 0Sd Ri qe1 @/O @1<P&  '@ 0@q ! ' @ P@; @a/Z @ @Y/@*@@|Ѝۍ{ @N/ @ 0`PP @$h AB A @6R qk(R*P@A    @ 0/p  @0@h*@P gO-$MPHp): @P`#:*@` 4  ? 0{Bt *p@'@ PP   '@@0*@#* @ 5_ ARq0?1<1 0  '@# @* @0*@ R A  Pt*@@Q p@tR Ᏼ@(@Q 4O*@〓 *@04 SPpppp <Q x` h 'h A'A0*@p R0 w0?C *@@a P'`@04PW00 b+ B'B pP4 0 S:t*p@@  R PUpPP _`@P 0? Vp `@P @P 0+  됋{ ` @@P }@P y@PP*@P _ l@Ph@$3* @*0@0 S R qR q $ЍO-MMZ:(`*@P 0Z0*0V0: V* Hp @~P8`P @H @ @( @H@LH*@p*@<@@X@pW 0X t 0u X t 0$* @`_ 0S; X W [ F0p CWP@W J F0@ 2T? F0p &W  F0@ T@ q HR=G 0 ?  *@@*@4 X pP  P8  #* @ P0 @S10 0cSc1dQ v X (Ѝۍ8=C *@@ (0*@p, P$p0+ q*@PpxQ- Ẳ(  0@屲ல$P ᨲॲ堲 @81(,*@Q 1@0  (*` @@+ P@*@ 0R p 0sph 2/0h <Ͽh h4*@P@PpP0 0 g0*@P5"' 0Ww#Q pSpP 8%0-p L0 0 C *@@pP000 9PPPlJ *@0 ,09PPPYJ p|*@0P q0?q *@'p@ 00 Q `+ @'@0@0 0Q: *@P0@PQ4 @P c:P @S30SQ0X8-L  *@0Sl9P*@PPa  *@P$ pp*@00#* @S @(`0P@ * P$@ ᖱP "8@*@P 0qqpq$* @ 0`R ~P{h 2/B1$@P $R ,Ph B,08 L=*@y gG+ @'@@a+*@P W@*@7P  <*@$@40 > H\Ip@-XM@P`P 08l   AH A A( A@*@h0*@H  PQ`p D@S  2/L Q t 1L  Qt P  XЍp@-d@ ὘QЀ*@ Q 2/ #* @ R M= ЀO-MdP@tQ pp*@ P p0@S1/0 B?0r 0/3? BR"p0ܣ0*@t0 S =D @ W Q*@QQ@ЍO- M0*@p0 #$* @[ 1 /r  3@*0@`0 0@S(D*@@`@0@Q@%*R# GP Q) pW(,PP^`S pP/P pW` `PH `*@P  @Qc Ѝ`*@P *@PJP PPp[ Ͽ| L@P 0 L @@p@W0 PQ` ``*@P *@PZO-MMMp8 0(@(PS p000*@0p*@W`V0  /r  : Sx * R#* @ (%0P?n2*0@0S <PfRW h[ WC C,@ W0PVP 0 p( d*`@ $ #* @ 0 0B?Rp( PX p  *@@*@(08#0*@ @TR ?*@8% -L`T ? ad0 Q*`@SQ(0T    R (0 P Q 0H $pR00HP/U, /@ *@ :c@(@5P p*@#* @ 0R  Q ߮1/ YxQ Ю  [@<*@*@ (0*@p*@ @X8 R (00pOaP!C_pXX   $* @ R (0 P *@Q 0$  0 PHPV / *@ i:c@i(@5P [3 *@pt?#"(0`V $*@P "$*@* @ Q@@R ?P<P[@#*@* @ MߍۍO-MPP@h:(*@Pb:0#*@* @ᄣ*@  U :x`U?:k0 됷?#"1T9A'(\%R !p0Ž¯'*@ r!V`x``p g 0W 0QS0R0000 5*@0x` ᾰU0"* @ 0㴰*@0Q0Ѝ3 @0['*@ / O-4MMPH`P@:/; @ ^Q3s@*p@@0 25Y,0 t1I $P(``*/*PA`0+S\1 U4KYc*5KV왢"p5#0 { !+ A a`0 T$P1 Q0kS q!(`#?$ P 08 $* @0 X1S(* *@P (,0P(@pP/,0p@T (,0P!2/!(Q*@ .5PL $@@ pPK(*@tQD(,4q*@P    / :! @_9P *@P ,,*@,  p*@tZ*@4$@ p(,0PXI*@P    $* @ R  P *@Q 0 Z&  0#HP#! 3@*@  }8c@}&@)3 pP$@,0  1/,0$@ p[(`P4Ѝۍ.$*@* @ QppR K PH P[@,0*@#* @ O- MRPP@p*@ P P GPc*`@8Q*@P A A0  0 Q *@Q  @09_`? 6\%TAR 000U<6R pp 0p0 0S0T*@PN 6cR*`@ p p0 0@ @^\5)S A0  @#6 0S0!*@P 6cR*`@ p p0  @0^@ 0^ ЍO-M`@*@H"@* @ p$%R:P82*@*0@Р@ V *@:`*@0X*@k@@  @Pᐇ/ !T)A'\P 0 ``?" ``  p\p*@@dl*@*@T`p`P*@dPx`h"T*@* @ 0j ` Z032Q  pBS  0e*@*@@03u U rQS 0v3 *@82*0@*@P @pQ 4 Xsp*@@`*@YPQ p P hp˪ ƪoPp7PEuPp7巪PEu@lT@*@*@(EQ<@X5p*@أ`P*@*@P q QQ 1P1PP`U TJ P  r T:pB*@*@@0 c382*0@*@,Q ЍS @0#A-`*@0Pp@ 3I0H"*@* @P@*@`P*@`X*@p*@P8H *@ pPh*@WP5`Fd,W l*@`2`\*@*0@d"* @T@p P` GP v @0#@#@-pB*@@P 8O-M@*@P*@U Rp ϩp*@0 0B? P``0V82Pe *@ ?᢬ V*@,` `#V*o $(p p(0 U 0?0`V  [:@X 0U p`pop0S`Sc*P@*`@Qs.*p@}6Q  d *@Ѝ@"0H-P*@@ ?5*@P !# " 0 @0"p@-C*@@PpS*@*P@Q`@8V* 88pA-MP@`pW*@Q po% @ P @t !@#Cb*`@P! z@a@H*@  R0Q  pL `P0` px6*@P *@, @y/PPP*@ )95 *@  *@ЍH-P@ 0@[Ud:(*@P8q@@[T*@c*P@*`@P  PpR 01P  @  PpR 1"@[Q p@p[*@P "  @[0PpS  T 0@[P(Q 0##@Hx[H-@$* @P8 0U 3?`@0&0 0t0 D H-@@P`V D|P *@P 1Q(*@ 1R:P 6oV(*@P:pPa0H-8 B@$|0@P@00H-M@ $0P- @ @! ZH4 AR: Q Q Ѝ0<@b!O-MP*@` @*4Q P@(t*p@ U *4`P P@%$ *@0 p s'!#* @ U R/: Q ``W`14P p  ! ΫP* F00 RsP*p@ B6a3`*@1\%T9AR !0 00s *p@  ?/*@ *@*@Q P QP  *@ U @ P PP 2 *@0 p! Q.\ *@0*@ L#@ 4t 0S4 B  $*H*@d1*@P 9+0s  X*p@  X  X*@82 *@p s1W $pp* @ R  z溯*@QN 0P(t z溯JS@ n} @ nd 0 XⰠb?$* @X j #* @p  0`T @ br; RpSQX  O J0  4P(& 㰠d)?*@ P 1# * @ ?T b;r RSqQP  0p h@*@s *@*p@ p0W  ,ЍO-tMs0*p@P 弐ܨ@#* @`1\%T9AR !0 0 0S  ?*P@- :*@*@Q P QP U @PPX@X Ϳ @$ ~CP*@@$* @P pR 1dPdt0h 0dPdth `P *@,P*@ ޿P*@ @ P1`PQ d h0PpppP P2@*@  R0V ? 0 =p!Ur p@Q\.0B *@@4L#t0  4   $*㔩*@/*@P '*P P0C*@@0 PtЍ@`TO- MP*@*@@P0 SUs2# 0cQcUaQ T /r 30*0@@YT  @Y@ Z@#* @ 00l ?PR v Y2  R4 PŤ00 PV`0 U@  p㑊PU`J+PU p Px*@Y  R  pᜤQ( 0 ^ 7,RQT 0 O (,  0^*@P  0Rq*@@P ap@  0?$* @ qR 7@  0/*@P`0 +JZ0*@0@@ Ѝ@O-DM*@p*@`W VP *@P@WP`0 p V ` p   hV 0,P@ `T><4 @dSD>FQ 0t0"8PrPV p*@#* @,080 $4,0_R 0PV $<* @ R ǣ,!T 0T2pS` $0P@㕨`Vp8+P 0V P 0 @P-*0pP040 $PpW@̐N  `ᑣY Wx  ኣ @r$PQT@E 0PE QA 4O?*@Q 0,( `*@0*@ *@0S R [ 0V R P 9 0 0  $h*@ T !8P `*@#* @,80 00?R00 $<* @@ R 40$ !   *,`@(  0*@P  0$* @ R   0ҿ$* @ R 0 #0* @ 000 *4`V[p>8aPE p*@*@800 /Q0  ,*@<P  ᷢ 0ᖿ倁, *@P 8 0ᆿ 4`(V& 0v`F4`P@`}pDЍ@*@Q 04 $Tl@ @00H-S@*P@88-  0 *@0{@0O-M@P| *@@*P R*@p|*@a*@ p*@㥲p*@`@p/@*@ LTP"a@Q)\HD`lx*@EP FP PP x*@UP XP BPp @QP| D @KPu*@| E*@pb"@ 0 *@@U |*@@p (PY  @"PW c@ 0*@P*@@!x*@0|*@pq m @0  '@ R *@T`p*@Y*@*@P*@pI*@*@@*@p:*@*@/p} RY` *@P  `P /@ `H(@pPUa *@Px*@P @*@P @@U6@*@QLlPPN@ X 0  J1pp8I`}T@ @T@, @9/JZ@ *@P@Ѝ@uH-l  (@8@TRp@-M@P` 9Q QЍp^@ 0RO-MMb@*`@P@*@PP u@@p PP @$C* @P*@@ @#P @@*@P P @l*@P @d*@pPN@iT Pl@bP@[P@T*@P P@H9@*@ 8*@ 8@ov' 0p  @/*@@dDt!!/00b  0 0dP@0!!  0#@  @0SS*@㘳*P@*@Ps (*@@d*@ *`@Q 0B*@@  D@SPW *@@`, ?P4?@R%ۇ88p*@O!4# @1!@0@?d p*`@0@p0Y`0 0  X@RS*P@P m@R`V D@@ R`V RP @R`V D@@ R`V yR*@AS*@*P@P Z8b *`@@04*ˣ*@)*@P ^$ c*`@P*@( C*@@,P pQ &. ,pW:.*@  Q P @1 *@R@*P@P, Pp @!P @P  (!@FP( (  $0@!@!@$@P P@1@ЍۍO-M--MM *@*@*@P,P=  T Az/:&\%R0 ?Z 00 0 0Z p`Ppop`PWPOPNGp@`W*@,Z:4@⪆HL$0P_`^@PPA@ UPQ*@pX㑸8*@c*`@@*@L @t,P pP4P8L xDPȣ*@Ћ(< *@(@*@@0 qTyAT@4!\5S 0p0 00C *@@  ?Pp & Ꮈ*@*@Q P QP 0 *@*@ QDR Tdp`,pͻ0@ 0pQ *@P  *@PP> U @P\ 4U @P T@U @P X X0 P XA0TX@ 0pX@0gp` T劁 X` *A&P p$@宷`@(ppp\u:  hpP )l*@pQd #* @@TQ@  `` *@*@T 04%!TX\ p*@` p pdPd*@ PXZV00!  Q  :0QQ : ^dVa:d*@P  @ 0MPG @ 0lP@#P  \*@hpQ6 ,*@5\*@h<(0 pĄdP PX*@ X⻄PXb  @ 0@#P  *@Q< ,*@;*@8P *@+ `@6@*@8pP7Ȁ @wpQN @@[#PG ,zP*@*@@*@ 4R Q# ᓜ0!P *@l`@hpPpY:pȀhPQ t0? ? 4`O,H`*@X@0 B?Eqk8 ` * R`@ PmH0*@Xp Pd*@Pa(P J S:*@Q <S* 3P*0@!0n S!So V: FPt,L@/jb F`Af0+S[1kP4[Xs#5[W2"F  K '+&A ``0 T,L@1R0;Wb"!!["d* @X0 RH @ dN;s:hP (*@LP 1d *@3*0@0"00@$P+H@*@P  0X @@N ~P( *@Ph pfP *@Pha ` v*@ V&ʆ( pP (1_0l X V Vt@ pP? J pP U*@!X0 PA_@p3 Q L!X`PHpLP/ @4$*0@* @ R l@ \pP^$PJ #LP* @HpX`@ O 2*0@0S P' *@ P   0@"* @ R P  *@P @ 0[@@@'N*@XP 1@N*@@l@!LPPHpX`@ D  Rlp  0HLP*@lp8p*@!P7*@Q2 *@Q pP PpP l0*@P/Q ?s0 q3?p01 p0 t*@%* @P%* @$* @ pR P1t0Xd0PtXdp,py*@P *@P *@P;4$\* @` h@R 1Q ($Q  ,@ 0@ P @*@\ Q Ol M*@PW \*@Q 0PN  *@L0 @⼷LP@PU *@ 8$\* @ R 0#* @ 85 =`L0`T  0b0 RWQ!d`  $* @ R 40t p2/L@@\*@ 4ap %*@P`P $* @`@ hpR  h*@Q 0`@hp 0! 1 , C@ 0 P*@P l@@ PJ 5 *@PQ $* @ R P*@Q 0h,P  0  &ph}*@H0@XpLd*@( P 2/5@@@SL*@ u*p@*@P@0 pXp6:p*0+0 `1 T@ȃ*@40P0003`PPS`Pa, \`&% VB*(%PA \pT@Q`*$HpcT@*`@Lȣ@*@*@,Tr:' *@Ѝ؍Ѝ @`0@I @0$%@ @4!O- M؁PH `XRP:  @?P . @*@ p R R@p pW8S`*P@P   `PR .*@1  H`00) z, @^e*`@ 0 P >!!PS Q *@ Q ` 0`& 0#0 Q8"*@`0``000  *@ # " `pW%u @*@P `@^`l@`P*@B@*@@PPl@`P  ЍP!IO-lM@Xܱ#* @㈣*@ *@ L @X,Qb L(@*@@P Q d> p, ky L@0*@QKQ6 pT+:UP& `*@*@ P@pR P1\t0P\t`#P  @PpW:,X:lЍO- M `V:ESЀp*@@*P@  PpQ   " z, @F Z ZP Q `Vpp ЍO-cMMz#AP ,(<`@O @P, @P $3* @*0@0 S: R?  <@Q @{P*@!@O @nP  0  @S*@l@TPGR   CN*@P #c C*`@*@@L3 0@ 㚠S^Xᒰd @4xP($NC/@(LX*@Ѐp(@P `*@*@pK@Qdb~ @ 0pJL*@p(P% P%`C) @k0*@PᙴE @Pj#`* @*@ (Rh Qn l0*@Am ` 0 "0#*@* @ R QW @@  QW @@ B*@@P 1@T0(*@P@AZE( @|P#* @*@ (R Q 㺕*@Q 㰕 Q 㫕     C㷯*@*@PU Z (C.@㊕0 Z. (C.@〕,C 0(, Q 1P  0`P0`0 , Q): 0@`30`$ Br0C ( 0, R 1Q00 `Q`, R: 01  Br$ aU B Z $U1|0$U|CS/@QL*@([:*@Qu *@@(Tm*CS^(`pp(Pa C*@*@[ Z (C@  Z (C@ C(, 0R 0 00 ,0Q:C(, 0R 0 !, Q:[ `$ @CZ 1|[ t1|[ t(@T:*@p(W]*, @ 0(0S `0@&P#P0s(pW:B `  @ @ 0 @P(  @@   1 *@0P @} @ 0 ~@*@*@p*@PAP` pPQPW:*@pW*P    " pP=cߍۍ @ 00@/O-IMM@@P8*@*@P%*@P Q 2/R ($p* @7  W *Q 0P (*@ P*O   @@T l!@&PQ Q 0C*@@,Ql!@- HHH) @ R  `p  Q P2 @ " @- @*P` @Q/ @pp)P 4O  C ) @ @ P7Q 02 @P4  ᰗ+@p ᨗP  ᛗ  A *@*@PP@p.`Q 0s*p@,Q, @  (( 6 P  P  /r P0 A q0 P0 AP= *@@0 BS qϬPU , @P1 Kzp@ ppP P< g @ @7X @7PH Pd"* @ RZ p @V*@P 5_ PPP 3* @ @ Pt *@pX @*@P PY"* @ RO p @K *@Q L) @e @P*@*@Q ` @p x ⰐpP  0 xA@ O Rr P.Q`VP* @ .P* @PPI 0 Q 0(4*0@`V *:0@00P @ZP6*@P- Q 0PP Q 0P PQ 2/P@0Q @(PЊP@5*@PP @ Q 2/0  P; P*@Q 0% Q /* R   * R   Q 2/p`GP*PvW @*@P*@P IߍۍGP:WR WxPW0 S 2/80@PQ 0p0 P2   P 2/00 +@ @0 *@P e @B @xPP Pǡ*@PQ@UC0 S 2/:;p0@00 @OP*@p I @7 *@Q/0/O-M*@PL  #*@* @@ @ (@P P*@`K@d{x@ 0`DP`(  @R@p00R 2*0@0S4*0@0S!@W, Ht*p@P(P%J@P`  PT@3*0@0S R @ p g:jHt*p@T/ڡ @ @P\ PX  `*@ p*@`\x@PpW P1dt0 "P%,Pdth @ P # @" ((O*@ K*@@[(*ߍO-lM@Xᯩ눓 *@@,Q LTȳ(@*P@*@ Q d @,`G @ 0`0CQ `PT:0P*@ *@0RpS 1\Rt1`Xdp7\Rt`XdpppXp0pAWi(<pW *P! *@P=  @%R0$ v@/*@P+  0p0#p'0 Q P# *@P B @ 0"Bj@ 0 p#* @@ @`PUo:NꈓLT*@*P@,XB:lЍ~  @0bO-,M∣*@@`p(P? ᑫ#* @P1\%T9AR !0 00 *@  ? x` *@*@Q P QP XU @P( P(  @|(` Y$`H` "`Pl *@!D`] *@P P  "0* V Q$P㈣U*@  ?U @0P`?.18d(0*`@H PR L 4@P0A_!  $P(0 8 QU $4$ L# d0 4  `@pY #* @눣 `*@`$PVB*@@*:*@V*@P +P P0C*@@ P,Ѝ(@ 8P$Ls 3 03p?`Pဪ e2! US Q0vO-M-)MM␃S*@*P@p@@♧*@*@dPpXP2$P,B*@@P @tpP @ pP #$* @@@*㻑*@*@P Np @XP$E0TT~T|*@@` PP0$0`pU"0.p0_~P  @"p0$EVB*@@P "  @p`$͇J 0_P.1!`P@Ve_naA  @p0P1 P@PL`刓*@@P #* @@@@*4*@P*@P %p @0*@Z `La P D!!H!`La忦p؋$5_S!P!!T!R`@*P@PU B  X!!0Y4 \!_>!T!U @PBZ` %.8D|0< t00 @p ?.x0H wo*@ PP0 XPUHP%~0  *@ B| B Bx 80 B oPR0c /0`P`OPN`q~``@@f`pPp,P TPT4lLd刓*`@T\hXPXB (@pd*@L@Pp dx,P᧩td 0@P尀?p1T9A'!\%R !0 00S *P@  ?d*`@ *@Q P QP 0 *@u*@P U @P U @P  @P 0C*@@V *@P @P @P*@*@! p$#\TAP  0`dP*@hp p pe?2w5 pU7Q% SFv qTyA4!\5S P`00Sh *P@  ?c*`@P  @#@ h 冏*@P |8 )A@\Q@TA\*@P5P*@P' L@P! p`&#\TAP  0`dP*@hp p pe?2w5 pU7Q% SPl/)|p ORQ@*@p@Xp hXlp  B%QJG,A\QJ NrP r@_Pd$P8 PP`p(@ R  ! S0!T@!X!1 A xPhU @ QD及rU @PLhX PJLpU @P2 PAP" U2 0@@QL!pPU:W:PP0UB @@/SqL!0AV 8*@P@ 0p_^pAP~0Cp70UB @@S0PpwQpq8 RPQ Qt1` U2 0@RP  01 2  *@XPV  PD dmU" @QD! !U" @QHPEPETd  ާPp>Wa P  Ч3$P\@`8!818`V[$*@P(`P% \0X` p Q $UQQPQP`U`Qp00V:Q $%Q! ! p / a t/Q x/ALs  %/  pP5 *@P · A('@ 0@<b@sP * `*@ H2*@N*@P # *@*@P 尀 눓Ld*@*`@0C*@@w p,pW: 가` jpPU @U"PD @Q\T WpP$ X@P ` ތU @U"P\T @QD  ͌0C*@@6 *@P*@㈓ *@Po P4 `U2 0@QLpU @Q\P @ U @P\  !@1P @T`VTP4:`U @U2P` 0@QpPP @ U @P\  !@P @T`VU @LdPL*`@U" @Q \oP*@* P@fP$ U @U"P\ @QL   P8JLQ qU @AT` A&H@%^ [oPR *@P D$@p0<p@ 00H0`000`@`0 04` p:b@P! *@0  *㯋*@*@P B  *@)ލ؍ЍDF  @06 @Q @K-Q )CP`"@p@D:`@?:@T :P V:O-Ms*p@!z bRタ@*`@*P@@1(# P&  '@ :*CC9*@U*@P * jS@@a P P*@@P, @ %, %**@*@P   P@UT ЍЍO@! P P*@%* @*@/*@/*@/ M@-M  (@@  : )7G-p@*@aVQ *@  @h9U*P@P Q*@ @Z9 !2t" @M9VP 9VP*@@Q  @:9G7 MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M     7O-uMM*@N !@}pB@ #p ppJnP/JPJn*@@  P-  P doL VpP j  @p x^pP* ?PZQ @-B @*8%<5" #*@]P Pp   P  @a @Q @{ @a uߍۍH-M 'P )0 *@ @8)  @ *@ 8 *@ЍH-| *@Q 1/ 0H-ϥ@@0 PX *@P@0@-齥@זݖ볥@O-MPC*@`*@@`|*@(pgڄ*@P 0  P ? @l@ PL `;p*@Sڤ*@PY *@P @ @7*@(b*@*`@*@  *@   !@ !`*@` !p !P*@T WV(#@ 4 ! @-! @7ߍp*@*@@7ᷢ P*@ R`p *@LR> pA*@@*@@Pd 눳P*@T @\%R p. P!' *@*@QYPw@ %, %*h*@*@P Y *@P @7Y *@QKYI `*@Pf*@@  @R@Yꐂ`*@PS*@PPL=*@ N@ pu@P fs@PW @@ qkPO @ & @q""* @ @,0p*@0  @_?`PO@XATl ءZ *@`4P [ Q 0p8S8Ė< \$ P!*@T)A@$P `#@ P 0@ PE *X30m*@ *@P ^*@ @ RQi O @@ P+ 5  %*@*@\ *@P 1 P:@@j P  **@9 *@P  <dQ:@@G P < **@ *@P  *@P:Lq1 QQ+@|B*@@  Q @P@ P**@ *@P S *@P 0 Hq, R@FB*@@ 0RaH @P @P*剆*@ *@P z 4 Lq, u@B*@@ 4RaL @nP @P*W*@s *@P H *@Pg@t㙹 @F~@ \4S+ R( PQQ PUQ P @  I R  :  XIQrP*@*@*@*p@% B*@@P @P @5P**@ *@P } *@Q,QS 0"!, 0@iB*@@0Q4e @P @P*孅*@ *@P @ *@ (R xQ2<Q0 @1B*@*@@x 0Q<S( @P @P*p*@ *@P a H8%<5"#. @B*@@ HR?8<5 @OP @P*8*@T *@P ) @L@%D5"#D @R*P@ LR?@D5 @P @JP+**@ *@P @ @ @ pʨ*@P D@8@H 0 A*@#* @@QzPx,%Rsʨ*@P> 4@d?Lq QQ /@UB*@@ Q  @P@P*噄*@ *@P , u@T@P *@   ,84e00 < (%* @i*@ *@P Z*@  QWPULpQ*@P p@@PP *@ h0 c L0Pp- C0pO$e>qV1 `@U_a\``@ LPp00   * *@' *@P  P *@P**@ *@P  h ۃ *@p @PL  }QW0P AH4Qd P8LdL×*@  pP@ 0b432 R"1Q SP X@:l@P *@P  8Hdd L*@P` 0b632 R"1Q S*@P  p0P Q*@/!`@  P*@= , P*@> (C*@  TK*@ 0P @5@1*@*@@ *@o P*@Ph URc*@*P@*`@PI@@@`*@`8,"@@ P*@ #* @ Q P f` K:fQX*@*@ 0@PP p`L0ADP *@P @` @ P ` 0``@` 1Q 2 @Rb*`@P l@P@P  p Pg@/b*`@P @P@P  "@ b*`@P @jP @P ` 0```n `pi@Pl@%j@~PJ R@p XLuPuїS*P@ *8*@P   pr*p@@PP @ jeP*@ @C @j @`PYp 0PRp @1Q/Q `V"*Q:Q@sr*p@P @P@P   Q @Kb*`@P l@P@Pj  c@0p @ p 0P @@@y`D   ٚ F? @H@`P T P1$ T9A  R 0  Y SP T @@ @0 zg@@ @0@0^-@*@*@R*@*P@0$* @QBP@  @/!*@`*@*@*@+0 p0pWPC *@@3p*0@R  p0!@/`A P*@P U*@P@ *@-O- M*@P*@*@U *o  0@Ppmp)@*@ @@?P` 0PpKP  X!@[*@P *@P *@P *@P Pu@@P:@*@P @P JC*@@*FP >80!9AT)A\Q\%*@Ao*@h Y@2@ Ѝ̃*@d 04C'"r*p@p#%c ?ၘW& SC*P@*@@i*@P*@P * *@P *@  o,qTyA @1!\5S A 0S*P@ ?>@P*@P ᶾCs*@@*p@ h *@P 奾8 )A\QTA\?fP ㈓*@*@P @@h Q pa@P0 R DI.P@pU:#@m*@Px@*@@E7@^V@^#*@* @ 8A 1\%T9AR0 49AR1 8C\5"* @ R \%R  CR/ATA\/#* @ RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R60H-P@ ` @XX<<@@\ \2 p 2~?τu/~ `*`*@ @h 0HbH-P@ ` @XX<<@@\ \2 p 2v~?τu/n~\ `P *`*@ @a~$$h V~ ŕdp@@SD `PHPS0He @h ńdp0HeHa\%Q TARTAR(  C TAR T@R 8AR AR /ER CR $*@QAo TAR/*@PP$* @$* @ *@*@/P/@-@*@P   @,`@@r@-*@ Q /**B R*R&:@3 "@* @ R Q p @,H-@*@P @Fl@㨗P =,U *@PY*@pTڥ*@PU *@P $ @[,N @U,m(`@X⏊P@P (@WPup W  AQ V P  mWNW YWyWnW + pyQ*@ @,O- M@*@*@@0`*@@ Pj P0*@ @A P] X*@ *@ `@P(@ӓp oWbo[ X::PV/ |,DP*@@@*@ZP P p 0`(fp W [o*@bo@*@@*@ Ѝ. @H-MR*P@@T *@d n 0^<Q>0S`p'`&p @T@T  @  0000 P@@ЍJ @A-M*@*@pPdpp ` @P`2q`SpT,tQ! *@ @,* @*@000 0@n@`ЍO-MP P` `@V *@ p_t'Va  @@@ 0 p 0p p*@T<*@ R60@*@`*@pL3 BR@Q  v8d H4LĐ@P 0b532 R"1Q S P  \p0@ `RЍO-$M̃`*@0p !?Hp$ @P 0"P^   0@u @*WKP*@ @   *@ R0 [Q  P_  0@%0 @ /) ?_?  ?̃0 5 *@ @@0K**@  `Z * $ЍO- MPJ̳p*@`0@Pᐢ!( oP*@ Ѝ @0PC @*T PT P ^ 0@) P`U ЍO)O-MP *@PЍ*@*@P&J*@ ㈃*@*@P*@PH B*@@P @P*@P *@ ?f 0*@ @'P( P PJ*@ ^ ? *z*@*@P Ᾱ`*@  eXS*P@`40S*P@Y-븲p*@@T TPB*@*@@#* @PL HR*P@P # @,cp*`@.PpU U@ @P& P%  @P$T$X$*@bz*@~*@P S  @P@ @TS*@*P@P ' @G@*@6z*@R*@P '  @*@P @&  *z*@1*@P   *@P *@*@@dP]0 @ (1*@ЍO@ @@-\%T90@R"-RH?>ˀ c C*l "BLŐ % E|0 %,@ 0P%0@P%,0@yp@-`*@@PP =( @ 09l@Ppy&O-MPH0*@p8^*@ R/P 4 *@*@N`PC YJ@.!2 @pS @000 R@0 TPpUpP\\%1T9AR  !0_ 0C *@@  ?0S*P@ **@*@Q P QP 効U @ P PyP[\ `Y!ϊ0P @ *@~ 0a"!on P P `"@Tq !C `*@@P88p*@ ? W 0Lcp R "pGp`@0p00GQ$ CP$Ls A$ R?0 B B0*@@d*p*@*`@x*@P ᠷBP P PЍ  @)p@-Sc*P@*`@ @ 凎*@Pp p@H-XM pP`X@&P` @IXЍO-\M"`pP&@! o,* @Q@P*  X%$H A!@ !@ \ЍOS& P* , @`D@ ! @x@`@D  ᾐ@K xD/P T `*@*@ P*@& ?eH+w\Ѝ0H-@(*@ P:0*@P bv*@ Ea1S0 '@0  @00H- Q(P@4F,FF,F@HPᄻj @U*@P f @㳹o @P 0w @L*@/O-M@\PT@P P~JUQ PVPv V.yw*@P r @|*@P9 L*@ pqqR ` ] X` SZ LpWQ @ p<W 5 2 ?>p(aCnHg0*/1 Ga]☠ȟLu C4 ʿw0*Fj0`\ 5 N P ߍ @>H-P*@@paV Q PR qP P A@` @3 *0@00!R  R//G--`PP:@Pp'PI*@!% #^1 F7KR 9 # "7 ! oQ.*@Q) l0*`@<P  R   \*P@{)Q( `p @ P *@ w ap A @-#* @0!% ^! F'K^ 9.$P% "  / #"o  O-8PU/0|$p@ q灰@p> XA@a pWQ\ 5_P5_pPQpH8Ph@`WXH-`0SLLLM 0 B @@o @@ H-`0S`MMpMM  B o @@ H-`0SM$NN@N0010B0B @@ pH-`0SNNNN0010B0B @@ HO-M$uW Őlp|hh79ON`SQ0vvq|$p pWp!@4OW:0p[ P` N0AVU P 0f PPX@``U0@B D  Ep_T pa R  p NpG`P  W0D R| !  !P! B!Y @2/P 2/ ! !Y2/ B2/! |Y 0@0ЍO-M@R PATP@ Tꨠ D P pP e D `pf (0 c0< C0 $ D8(%-@Pp w`P @@ E F @ @@ @ hP pY? z D p8e D p4 1p) 0( PU!*`KIU  0 꺐P  @0 *@@ C lߍ6@ SK-8MM8 P;pP|G`p @0 P9pIW ` 2!8ЍۍO-MMP`pl~@PJ   P)  P/{P rQd)0@ @pt"KP{p `ȼ P `pWkW~h Upl~2P `p -@`PTVJRPQJ  !o rPBJ040 #LP9JP5J[Nz) @ 0" @P#J~PH  pNݏPz) @0! P@PZȏ` P V TJ@ߍڍ   P ` Pl)_ @0!]@^`{F~PdZG@`oZ N:P ^/Dp P X BA-M@)`Pp*@P  0s*p@0P  R Ѝ3 *0@0@ 0BS*@@cP P*r*@P ӱu PO-MPp*@ `@lhT Unሓ *@2*@QTР CnP @$* @ 0 ?  0 Р *@Q  n p 0 Z,*P?p  ppp` TPod0*`@P 0XDP`@ 2V mm0@P 0 0RP, @% *@8@VApERp^1 F7KW0Su #3@J,p*@#38@: *@# @ -p*@P z@㊳@P; W *@ *@@ *@P =@h @P 4*@ `᷾ 0,*@0Z,pP0*@$* @Q ppPRp l!$ ? o@P *@p TP (p @1嫊 `媊J`$WJ$F`Z:(p$ QZ :!p171(pQ p(pW*@0, `P`Ghp(0(@@ @PX( (,p 0@P((P( Py@$*@[0@`Pb: J!  *@ 0L @G*@P @㥲 @PK (@$P@ S*P@00? 0P0`Q((,`*@0`0` B (t*p@P0TPpW k, p@V @ @ Z8@@( ([*@,*@4Ѝ0pSR z / r P{  @*@#3{@O-M*@@ 0P k@Pw *@0 Tpp  0s 0RpPY?Y0@`p   6/  H `*@ЀZ  Yk%$ @  Ok$ %`P@QPQZ 9k@P` @  PPP@Q@*ЍO-M*@Pp0@o 0m&"0W$!#* @ `pS W/p  3R` 0m똼/*@>` ! (@Q` R5JX*@P 0*@3?R' 1 @ *@R @ *@P @' @]P pPTЍp*@pO-M`HMs@@V*p@1/ #*@* @*@V   SP 0j0PP k!@@V@gXЍ`T0p @Z ppPx `pW 0@P X ZSop`@X"  0@  09*@P `@㗰@P  Pp W*@O-LMP*@ppXP 10P 0@ C@ (XP `vp8РW,$@ i@P %0$ !,i ! U pW`@+* , @ P #"A p`, p @P` i,i p 0 ( 3%@ 0*@P @  @@P  *@P i $pi$p , LЍ*@0H-S@*P@!8 ^! F'KQ#@@\@*@P$l@@3@X@# # *@P@l@@P 0@;@*@PjO-M(`@,P 0lV` 0pkP @h`0P " Z hP`pUЍA-M`p@ ,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8Pr"2@ @0@-!1@ @0@$!1@ @0@|@-@,P*@ @ڬ,Q,#8P0@F>"'2@ @0@@-@,PTP 4@1?!Q1@ @0@0H-0@PP 8 R B8 Q   04PU8P0!'2@ @0@!2@ @0@O-M,P/ `p@0 QU   0"P  %PPU@@4[Ѝj!R1@ @0@$vO-MpQQ `P 0Р `@`Z`Q @AT*:`[ 0P `QS [QP(PEР[ 0P:` `Q S[QP p`PpVQ  0 Ѝ"2@ @0@3H-,P @NQ CP\ @`P'`&P @TQ}!R1@ @0@>}!1@ @0@?G-M,P+ `(pJ,W @P P # "  0@PP pG@ `WЍ!R1@ @0@O!1@ @0@QK-0<S 0 @ pT@pppW@`LQIWPQP@ @ pQp^0 "2@ @0@fjA-MP *@$C p`*@@ !@ 0 0`ЍA-MP *@$C p`*@@ R@ 0 0` ЍH-\*@*P@P @iP @ql@PPQlC*`@p@@  T P pW@-L*@@P,Q H-M *@P,^Ѝ Ѝ0H-P@X0*@$* @ Qd0R 0 *@`QaQ 0! 0pC-M*@P P *@S@*P@!s `b*`@Q a AR *7.@Ѐ2@;:@l@P @ d# %a, %*4h*@P*@P % @!2  *@ 0OP% V@l@PPZ @0 %d3, %*g*@*@P @ d AR *a#BP0:RQ- :@Q' @ll@P" x@sB*@@ d#a#*g*@*@P ᶦB*@@V @ЍpO-M@8r@ `0DH@`Pp@\XTPLHD@ H kPlP tP bPP   p X 0 p$ '@wPЍHg(`@P80@ JP0 0P$X P\0HL P p X(\$,PT`@pDP P0 S *@ z@P[p ` pK8 @JP @ `S 8p@   wJP PpW:PW@}8@ dJP }pk (P$ $$0me,   0 ;P@Y 0, +PJ 0 a ( I `  P`V 8$ UpD 0 a  B`  R0[" 8 $ 9pp) dPv'00 @  j @0P@E@O-MsP8P`Lp@H@@DH@D<40< Z aPLP bP iP cP+ l   E pp AP8H(@P@`  P 3 P@zD Ẵp DP < '@-<@@ߍ< '@!@ `0$`4 HL0QP @4HpLP<@DhP 0`,PP P @- X $pT p( /P]@,@ J %e!@ @0§p4ڔAT3 $F4P `@PJf?p)  n (fp n/㦲 P$Ỳ+@`"!@tr@`4!@ !@n?!@ᑲ`VY !k{80?(`"R10@``4P? p oo'@84P-`V* Z V. Y 8$ m0 3P#8P , !$  0 !( 4P , !$   pW @.@+ ``@F$0p" $ 0p p =@ .@ X  @K- @PPpW ` 0`W0 0 0KgO-Mu`Pp@@ pPpOPp AP5PP fP/Hp(@WppP"P`d P [P [ P  0@pP TpL Y@ @HT '@@B@ 0@N +  0@^P, @zU  01  0 @ ipa@u$@ :@p@O@z@ЍG-\q `P@ p@  fP p rP@H(@P  p  `P  U@ l '@GoP@ <`W $ y  p VP$ y p Z `P$ y p@@@Q/H- @r0Q0#1"$#O-QH p`V pQ^; ࠠ@P>k6 V  ``?k7 VPQpW#* `  @T pW*@`!C @@ X*`!F @!CC@`@T: G-0pW 7O0@`pWT ?p@T s5T P@0S6 @T@&@T@ @@T@p@T1W1Z:@ PUpP*U p p@0p0@S VS(BxK-Mp($D` P fP$ 0w!   PfЍK-MP$Dd' 0w !`   ᦯P`ЍO-MpP`P  @FP +`  Q 4 0@ @rpQ'"$  p R+ $H@   {a@0 QrP  [% `@0pp[0'1 #pP @ 0P P} )@ 0uX PtQ %& p @@@  q%`   0@ `PR X`  P`C XAP`X= @T +8@ wEP-  p T0 PUj$$P @ 0p$ P@$  TP pP@@@T:`ЍQ M@ 0 LM@-M@P 0   @N  FЍ@Ѝ/M-MPpM`P/ @HL< 800d`@,$ 4(4;T$Ħ4p 8p @  P)$tTWР|p b "@@+v@@p x@ЍpWL Р V  0y`pP@@ 0P \@ 0` Ppl 0; p p 0pyp  0p_p P1 V0=ꨤ ᬴0 y \}D ᐯp pW@+D ჯp Р  pt@@ P P $ R}*0pvn*@iM0H-MP@ 0} 0Ѝ0HЍ/MH-M  00 ЍHЍ/O-MP`pP$ @U P#? "R R$# P PP@ 0@P @ 0`P 2@ 0PY@ 0 0 @P_ 1SS@[ơʁO@ 0}P !k@ _1S SSH L0@  0 ip) 0 wP @ @ 0>`A 0 @]Pj`ЍP/@-M@BBQ  D`p @@ ݬЍ@/K-@`P p&   (@P @   &  (@  @ (@p T 3@ K K@-@WP QP  KGQP <@@@K- @$ @PT0U p`v0PU#&d  PUX 0ps`PUp&q#4' ^p Yql@V@ `$$ @-SN"@R0^\ T /$ T! /$  T! /O-Mp @P T= P (@`@0 9@T-&w@ xt7h 0@P (@P`@ `@ 0T:tp@D @  0@` @TЍH-(4$$,0wPO-$MP@iPdP @P $Ѝ 0e- $tX` H0!p *cwga 0 Q0 ` Pp`PZ; X0 00SPR @@ 0  P QPU`a  0Pp $uPW p 0` pPK pZ0 WE0 P0IBRE#8\    8pu $$Hp2`r"pTp`` H QQP p`vpZ P`pV:LP PQ"@J<@[a@C 0&p<  0 0  0 0P  4$$  s $@ `@O-Mp@Q W#gR P@oSBP@$P PP`  0P @ @ @ PЍp@-M h /`@@PR@?p  0r @ @xЍp0H-hRLR aR bR,%iR sR tR#P8@ @@P /@P@08 R@I ( Bp @@<@0p@-MP@Q h/`@ PQ @Ѝp0H-P@Q 0 /@#Q0}@0A-M@`Pp, /@  P # 0RS sS bS SS pW bS S BS R  ?PJ $$2!PЍO-M` o r 0R(Q0Q{ @pPt Pp MPk P P`P] (QQY R 0#"P R " 0#F$p@ T +0P p8$ m00 p6vP/8@ ?P   ?P"@ @ 9/$ p)    T 9/$ p 40  @A@PUpЍ@ r8@ d?PwpA-`p@_PP  7/$|p  7/$ qp 4 @PH- sR iR aR Y p$@A-M@ P $dPp0 "t a@ 0`M@, (p0P t `@ 0PЍW 0ZPO-M /@@"@P" xΊPp@"@@`XuP `V    PP ЍH-xZ@`p@P@ 0 `VO-Mtp @P `Bp밨Һ@@ @   P[` W`@TЍO- M`Q 0@4p P @A ЍeP P0S*@ 0 D  T +8@ D>P$   fp  $ 0 T0 У0  0 Sp B@ &@ H-`8P@ >@P  x/p@qP b@@p@-MPt'`  @  @ &p Տ @0D P  @=   Ѝpp@-MPH(@P:($ ,4@$ @( $$0(@,r @0B@WP$ ` p @ " @#@v' P80 @@P%@  '@Ѝp@,W@*@ЍpO-DMPP@~` @ p@(@ @4 A@8 fP lP4 r8 1PW n /@@ sP . @U PA  dP) # 0@&Z *3  WePp%0S" H(@P.  @}@@ * (@Z 2@  '@DЍ 8$ +O-$M [ LH P p@`Z` [ @ $Ѝ `  pWp tL@P ` "0# pH L0 %! PP\+ \U& 0\@0@ @ !U@@1@P@\ \T H 0Lq@nTX $@(W`P] @HTPLPX $$ . P 00R 00 P `p`8  'p00' @@T` P`&(PP! H0Z P L@*k !Hr`are B`Q H@@P/@-@$P *@'O-,MX TP\0R, `Pp q @ P 0qTPTP 0@p ` p 0@pV  0 0 $X(F P=@T9(P5$P (PR`pV  0VW0 `P p  VV VX,ЍRpV0 000PvO- MS9J4pw60P@9  0sV @ P0jV@TP p`T +X@ PR (pP+ V 0pp0X@ @P ЍX P @VX0 P0 X@@ @ ` 0@P(  0 p@T P 0 %$#@PK*h[!Hrare H4@0T ` \@@PPT @0\ 0 @0T` 0`0P@T@*h  `Hrre5 Q Hv$R/0S  //QQ/K-P $ ` p@ PRPQ   TXp@-(M@(P`+P +` @ P `P[P @ (ЍpO-MP4 `@pP` UPE @@$BA x0@@,/p@`(  lPm@ P<D\dL[8 :8Po[ʰHP TPO@@٤p $004hpꀠr p '  ,(ppBA @@rpP, r <,<P PprP @ i5pZH(@UU R!UN $r A'p@   Q pP d @pQ  pPP4  t@!@0PJ@  -Q & P` 4 0 ,00(00`:`P 0 3/p @V @ЍN@b@ 5p@- @@oP !(@P1 @@0@  @ 0adiHP`@"@@PEuO-,M;r`P(p@(@ pPp(ePp AP"fP sPH(@P(@P`;P p A@ '@f,Ѝ  $0@p  p yp@`` $RƱPʑ1Q PL"*@@@ @@[@ 0[!RR'C 8 H0 @(P P  `VR R R  Q @ R  1 @ 0,p p{ $P 0O @O @O @O @ pi@]t@XO-M `0P W8VHQQ @ %@Ѝ(庨Z @ 0S 00S000S@P R@P@ 0뺨$$0plZ  P0#S:\"*P@@ @l@Q@ 0B<0 3/p 8 H0( (唠$Dm 倀PT 0 R0  pW:@-@RR R R @ R R@@@@Wp@-0@P R CP0plpSp#S:l"*`@ @@Y pp pppl@a"@ 0 pK-M0. @P @pH(@P  P`P ]@@ '@ЍKqm ie$R 0 "0# "   @ Q  @o/o"R P 0 t@ЍP U0Zp  Q P  0P  0p Qp 0p(  0p*P# phU  0 0 p7p @G:@O@a@7M-M`@Q V*ogR p@P@g oSp@P@ؠ  `RP p @ 0 A@ S@n@ ЍO-M`PpH V V9o#g  @B @ g" oB @@ @$$  h` p H  L` 0$@p 0@ A@ @ ЍA-8MP@ P @ u` @4p@ A @0 Kp  p H(@PD,  @0 '@B8Ѝ8@ a @/O-LMiuP`Dp@@8<@8,40@0(, bP p qP   0>p% (H(@P8<PP 8< 0S0S @p"`!p P '@PLЍ,0@ D004,p pPp @@D,`8P pF8 @$'5P $$ 0p-j P pP pWs@&@ Y " # # T 0 0 j 0  0 0t@!$ + !(P@P$1p{  M+pr  @PiO-TM(uH`PLp@sH@ /sP  0_pLp qP,H(@P%HPL  0 P_@p4 Tp D0$$iP` P   @ D 0  '@PH L0@ 64 8 P  F@ &PTЍ$ (  P%  ` ` $,0   QP| @D,!0! P @Z@  %`  哒!@<Y*`@8 @ 3P @0 S  R`0@0<倐Y:D @\0Q\80P QZ,0`P  t    P4    P  ` `V PQ@2 @|80Dt`P0 @ppT  0  T00 `P  4$$  f   @ @.T @>+ @;  @ V0  `R\- $@0 `P@ p (P(( Pq4Q$  ᰀ p@u@O-$Mw @`Pp@   aP bP iPTP   TI TC  !p=p NP9 lP3"@82PLP  0S0S `p"`!p P 0T H(@P  0   @< '@P$ЍO-eMM X@p`P@ ,a@ Q  pIp uPEH(@P7 P @6P P  0S@T `0"p!0 P@T P `P `V @ `T '@`eߍۍH . @@! @ %' @; @ P pP(@h `@t@  0n`pP @P` XX X m`pP @P` XX X ]Q @H z`P@`XX @4 @@d`P@`~XX tX - Ej$ @ 0vg `@ 09hP "@ Rc&@Q@0 ~@@$4`##t @ pj @$4## @`P@`XX X 8@$m0 >@@# 6 @PU.X H . @@! @ %' @; @ҏ `P ]Jp@(P@ @@    `pP @P` XXX `pP @P` XXX qQ ]@Y`pP @P` XXX Y`pP @P` XXX J m`P@`XX X 6pW @ P0$$ @0$$ @j$EO @0v'` @0+gP E"@ Cb E@@ v'0 @@8@$m0 ]@ @# @6 @`0A-MPP1`@p, LXl+ @2 2 @v @0 PA@@$ 7 0@S @< @K @ @ЍA 2 @6@Z @h @ЍAz @w#() @'J@kPP( @1 t'@ @S  !@ЍAV P8$ m0 v' P0 @v' @ P0H @=ЍH-M0P@4p b #t' @  p  @0P  @ ЍG-HM@8@P*` P ᭪ @8` @4@p A @*H0 !TP p lR* T"  pT$ hpT 88@ v/P H(@Pd%80 @ ht '@p"@PpHЍ a @/G- Mz@`Pp@  aP bP iPT   T MT  Up '@ ЍlP"@op PP  0S0S `p"`!p P0T H(@P0  yO-LM4p sP㴐`8  000<0尔,`dDEF$o<@`@ P .P  Z48 t`p+lPo<@p`@P .P p W48 \`pFGI0H + @Jp4800 p,pK`$` LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  002 @@ p`s9 P 0 QQ1"2(pop`@@dP p W d I(. 0rp 0O-lMP# ,p@@P0  @ ` @ @` ``&  :/p WlЍH-Z@`p@P@ 0b` Vp@-@ A@@P` `P PP@TRp0 p@A-MPP # @np `p @ _p0 P0 W3:pW@n 0 pD@}*04 $< ( p 00s` P0p P`^@x@Y@0h8ЍA-8MP@ P @ u` @4p@ A @0 p T pT H(@P-  @0UPP -  @0 '@8Ѝ@-@R(*@Y( *@ ` @@-@R8*@K8 *@ `8 @O-AMn m xP@@`@/p@ oPpH(@P;`P $$r@@P kPX  p"@ @@PM(88088(P 1P ǾP jPp@p`@PPk PS  PK ! @㧽PD !B@㠽P= !M@㙽P6 !Z@㒽P/ !"@㋽P( !i@ㄽP! !r@}P !}@vP  @nP  r @fP  @^P s @VP WspP P @@T Wp @`P"@ @ŻP 6@ " P| @*P v'80 @O @νP P r@ļP %@ ᚻP+P RP $P` @EP Y  @P'P `v' @0"@ ᒽP @v' @0@ ჽPx   !@0VPp  a!@0NPh   @0FP` @ $m0P   @[PP PK H@$ T: @"P; @- @ P`"@G pWP@ pZn @'bP'  @P* P (@XU r! '@AߍO: @T @`1 @`- (@X~` @ 'uAߍX  /=@ @0@ /5>@ @0@ .>@ @0@ O-AMn 6_ Hp`@P@/@@ iPp FPH(@P$$0(,"`PP`@p oP  :@ '@AߍO _o WP  ]@n @waPP@ PE @@P $$0P= %@ p$tP9 40,IP3 p@ "@P( X@ P8 @ U*P  P !@P aH !@P  P0 TPH8 LP ,pP,4$P,  0[pp 0$4P  ,匓0$S0Z8##[!  8P $$8,p $RZ6@TP  "@NP ,!v\ @CP P P ,s <%(vP@ @  @P ,  @㌹P  B@ㄹP M-@}P  Z@uP `"@ lPy  i@dPq rq/@]Pj  }@UPb  @SPZ r/@LPS P @ @;PB s/@4P; /P.,0U*  0Z! + $$,宒$P$$5P @P^ 8 0( $D`c[| "@㛺P |~P| @㏺P |$rP  !@P  a !@P   @߸P | @nP |$ , @㣸P !R$, @g[P$D0 gZ!  4$,  /P$8 @!1#PZ!  $,  P$,@ Zh `8\ <$0( 0(4P,REEIB DPT4H 8 0 BL PEX\A0$$Z! h $$,ԑ$Pa,@40 <``8\$4#S#Y! H $$,屑$PAp@ pAߍ @ @ 7 @ @|E @ p,w @W @p @| @  @ @0 @ @ '@O-$MMP @P ^Y ܂#p`*@d^P QQ4*@o     oP t @$fY @p P`fVY 9Z$0P 0oQ a` p(P  p @`܂*@ 4   nP t @$'Y @v` PpgWY  pY $@1` 4   nP t @$X @ P"  @  @V   \YY㍉$Ѝۍ " @ @", @"G--MPHpϊ @0`x: @Pt H!h" @pd @H. `@Ll@ D  <4,$H@p8`0@(@ P,Y  ϊϊϊϊ1ލp@-M `@PY y  ` @@p ' Lp ЍpF R# @ @"` @"O-M@`pp PVP pHX DXe!@P P4 @PP *P @P " @P   @ᵵP PhQ @ ႑puh  @ᡵP ohZ 0 S 1X pv P P P @![  $ Q 1  [sU  ,0(S 1X0P Y  4Q 1  Y  @!HQ 40L S 1XPZ @ hP ^1P l 6P 0 S 1|X@ `p$@ `p p R 2/p 8 Xp ЍF @ @ @p#  @!\ d j @!\  @! @ u!K-HP! P P p|P `^@ EP PIli8K-M P@ @dP ``p  p @P@TЍ W  L tp ! @0 `㷶H-M @ĶPЍ@-M@p  @ᴶQЍH-@PP pP^?^` ` WDSWH-@PlP pP *` WD=W]]?`H-M @㘴P ]Ѝp@-8M@  @PᆴPI [ @4P t `+ @+ `L H `+ @+P[ @ `mV q 0p@0 P P[ @ @MD8Ѝp X$ q? @ @!0@S0H-M[ @@P PP ` '`H @+p Ѝ0 U$ e4 @ @0@V. @* @-HM *@@'@PM*@@@@A-(MMA.P0 C Lp P(Ѝۍ@$ 7`C @P T P@YY@P$@$  @CP U P@iBY@P@-M @@᪳P  Hxp$ @Ѝ , q? @ @!0@Ჸ@-MZ @@ታP H Wp^ @Ѝ U, q? @ @!0@ᑸp@-M@`n P@ dP uPP PP  @P Ѝp i, q? @ @!0@a @]x @ @i,  @S@-@ @P  @w@ + s<@ @!0@;0H-M @Pp   @P  @V@Ѝ0 + @ @ @ + s<@ @!0@ p@-M @@P `AV*EP P @ 0p  H`PP.[Ѝp @ @ @4 @H-Mmxi `LPp` @pPy @@ pp @QQjTp P@`W p`W "O-4Mx @ `*@@ T @@`P0◃p, @g*@Xpe @Z `0`V{ \ '@o@堲 PpW`VhQ pWQ   @ 0"0 PP1/PQ 1/P *@P p p `0  ! P<W90`VP0/FeDL`I KCPpp@pp @pp`W P `i0ds Pʏ: ;CPP @`W@`RL#@p@-M`P@P  ^pA @ C0H-Pe@!@.t@P lqPJP 0 + s<@ @!0@ჶ @0H-M @P$p  @P 0  @@@Ѝ0 + @ @] + s<@ @!0@Sp@- M* @@P `P P* @ 0_p  ``HP`p t@Z` Ѝp @# @' @p@-(M@ @PP. Pp$ $ p0  `q ``Q 0$` ZP `@ @ @PD(Ѝp )+ q? @ @!0@fֵ0H-M @@᭰P Y PH|p qڸ !0p@0 fpЍ0 , q? @ @!0@Cᤵ0H-M @P{P  @kp j @@Y@Ѝ0p@-M`PgP  @'pA @ tb////< 0'@0 /D 0'@0 /L 0'@0 /T 0'@0 /\ '@0 0/0H-@d '@HPP BYP00D PaD"P# *dY 'P@U?Q:2Y ADPP*@0H-p*@P0@ Q:a@QW@ A@Q=@H- YH/O-M(`  `^R\ '@P PX-* @p@0PPU 8@ T wp`_0 0` p$P( C AP '@; p @$ '@1 p @ '@ & p  @< '@`V @t 'p@ `V*@X*@d *@f p '@'@Ho`@P@  :pVP BWCW NWI*@PaG QsGP(4l566$6l5l56*@PGAW"  74l56l5l5l55l5l5l56*@PwWW /@!  K"* @Q p lW*@P`WFCWY LWM vWFmWH sWp $ '@Z '@ '@Z*@P*@P+*@Py /@*@P!  yK"* @Q *@P*@PY*@PUaW lWQ '@NwW zWJp '@Z '@Cꤥ '@@ጥ @'@;p '@6H*@(@P   2*0@0S0>2*0@0S92*0@0S2*0@0S0"* @ R"* @ R$ $P  2*0@0 $0H$ 0(0 P P/ @3,! @hb ;/@"@ U$ (`@ pJ @Q$PP PP PPW @Ey`p` pF @P @\ '@P V s 3,@! @ R 3,6 @! @0@*2/^K-MPZP/ - @ @di @'`@m pE @Ѝ0 2, s<@ @!0@y0H- M@ @@P P9 P@ ` u*` H @*@ p Ѝ0 &+ 3; @ @0@iTU @PH- @|H- MP 0 A A0H p Ѝ' @4H-M H PЍ4 @"H-d '@jEPO-MMQ l@jTPQ q( @ @\`*~Pn`ܢ*@Y[  ^<0884@0H,P(X$` hpx p(@P`XL P[  SPJpU SP@  @ ီP9 P*@pP1 *@P)*@P" *@PpO LpK p P `P Q PCpYH`p \ \`'@Q P QD\`D pX NP p(  @H  @   pT!XL Ꮗp Q & @ @mT   Lg xpQ 1 @ u p L@P 0 GY :P@ !ͩ @P p kQpP< : Y XP@P pyRQpPL '@pW  2/pTP pf@  Lx P @R ` L  p P, X L䤍p% 2 @) p*@P anNL > $&p R @@@ @ \姪 @*@*@ DP 0\ 3/ܢ*@^o :*@L PXX pP@ 8t @!@ ` \ "@ $ *@  "e @ @4  " @ @  "o @ @  z 0@0!@ ` @"  *@  "e @ @k,  " @ @[(  " @ @K D '@`VD 1/`\ \P'@ܢ`*@V 0 3/`VH`@PP Ⴚ\债`}ߍۍ, @F @z @9 @) @~ @y @t *@@ P @RhH- MP@ @@`P 1 `*` D*Dv p L    `*` D*D@@ @ sP+E Ѝ0H-MP @tW  P@P| (  @@`  Ѝ0" X t@ @P@P! @ @Ѝ00H-M P@zLL poAoЍ0p@-M@!@PB @|P { @vP7 @pP *@2*@*0@ P 0``?L7L `{ p Ѝp @p@-M@Pj @B 8P  @8IP V ` !P@->F "@@P Q  @ЍpK-M@nP PP(p pP` @$ AJ8(L Ḅp? Pb bP @ᩄp  @ !@Q  @ !@) PJ A `@ @ 0SR2 R "@3 PKL pm @TT A P@ @O @ QRR TG PK @< @ư7! t!@ @ FmP& p P@@p@P`! RQ&e c $`V UP: Ѝw @F @ f@ @ @/  @@-mjPB*@@@2@L @ H(@0c  @,A@-M@ @aP*@? ?@ ЍK q? @ @!0@mp@-(MP`MP2  @@P *@P  @$ A8 (Lp]QP @ ̧P *@(Ѝp @ + @/ @ @( @#H-@!@P! b@*`@pPP P@pO!  @ K 2@ @!0@0H-M@P6 @0Pp@-M@oB @kP" @PP b@*`@ P*@Pu"  @ЍpK (! 2@ @!0@᫬p@-M@9{ @5P @tPfVP b@*`@ P*@PϾu "  @PЍpA-@ 7 @P @*@pBP4$P P@=p `ᠾK 4! 2@ @!0@2K# @VH-`P RP@Pp 0p @AH-M`P p@ P 0P P  0p ` P PP ЍH- P Q   Q 1/pK-M`(P ( pyJP@p:O"Q P OЍ UPO"ҸP , 0 qp ` O O-MAT$' Q *P Q #PPH @gPPHpHUpPW Wf Wh W OPЍW W@P "@ լ"@PPQ /]P( P $0 @0( DP,paP `P$P( [ sP (QJ VH( ( 0a`P$Q? +O9`_P`HQp0 :R Ru a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0@xP:iNPP `V  ; Q QPP:N"P UW U3>P 0@ P3Q0 !P-P* P(  R$ %PP !` CRp P`VPP@``¶P pP 4H$@P ``᭼V  0pP PP `P P@ᐼT  vP.U P  ! @ @0`2x @ @!  @(A-PU `@pJP:-NoP  0p ` N O-M- MPPU͊J @pP%  0`X6/P' P)P ɴ`半U aP D  ͊ XP  0}pPPU[ [ MWM P P DM ЍЍp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V @pQ P 0P -PKP  KP `VZMWMЍ @(@Q ɼQQ Q R-0aaaaaa 1ᗶP P0 0  0p 4 M  @p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pP 4-  @p`$@ H-`P@pᬸP < p@PB @0H-@PP  R$ Q  0H/00Q /  Q /K-p@P`P QpU 㮴P `PUP QpA-p@(`IP PD @ @p {PA-MpP,`*P @$ ( L- $ @ 0 PpY@ЍO- M0Y$ P 8HP J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP*U( `@p HL 0[*  0@  4/PFPYU@A  K@ 40 B| |LB! 0 [#*U! @Ap  0`6/P@ LD 0[ *PU, D,L 400 ЍK-R P@`V`V p6/8y P@T p@-@`PP ׹ꔹP V  `P PT   3K PpG-FM @@㧺 P@ᢺU`P ! ' @@` ϩK@(P R" pF`eD Ppp DppPƘ DJH @pf @Fߍ1 @ 0H-B *@@'@Y_C@*@@@U Sh*P@@Qc0HiK-NMMP@*@`pF)e(aDKL XW `p/ ) + P*(p) 4`Y 14`JO Y) 0P ,*0* 0Q,U1 v @, @Nߍۍ 7(@0  @:H-I H4p @X p@-Z @'P@c*`@P p T p "{T@ R|p@@pO-Mp@(Q0 0X $( @ xQxAo@X; `xPW b9P6Z (@   % V1* $( @  W B V)*@0 H(@W@0@@`X ` @@p PFP@ECP @ @㓨@Ѝp@-P@QU 0P (@xQ (@ 000  @UP  #   @@UQ p@ @Upqk `@PUpp@- M `P 0 BP B P$P `@P`@Q@JV:Q `B  R@⟱P P`  CcIP ЍpH-p@Pp `$P   H{J @0  @+ H-M pP`@B @ЍO-MMMPi Ppg `K5qpe @FxB AN -p,@#p@XpYI @FP= P9 pp B L $+{p! !@ !P  *@ 0/o004"  3 TWP3P 3 @H7  @@Y,9rMߍۍ @F @( @#  @ H-M`@>p pPB f pp EB L zp AH@+P p "@r H@1P ~H/PtЍW @H-"* @ Rg @HA-Q P`p@FP PP`V@- M  @p  @ P 9 Hq @ ,H Ѝ # @ @ @- M  @mp+   @ᰠP   @P  @ϞP 9 Hq @ G ЍF # @ @ 0H-C8 *@@'@[a C8*@@@W(S*P@@Se0Hk@-M@ p QP # P @ @@ 2Ѝ #(@0  @97H-P`@PM @sP   @pX@P(@U @m :L Ep@-M@H  @qP  HpЍ @T @ ( q? @ @!0@NJ@-M !@@P  lpЍL @5 @ C( q? @ @!0@M+@-M~  @@P IMpЍq @ @ g( q? @ @!0@A @-(MP@  0 A  Bd !@p L p(Ѝ @  ' @ @ 0H- M @@ṝP Y PHp  p Ѝ0 @ @ ( q? @ @!0@qṢ @ K-MS @<pp v` `Hp\PX P k@Hf#EiP@  @ MPXp(@ :Q0@\v@"p@0 :P3 @` TP  @_  0@$P AAqX\PH 8H q0 @@ QFݍ ( @ @*  0@-0MA  @0@Gp ]P  Hp0ЍY @  $( @ @/  @p@-0C *@@'@Ph '@@C*@@@HS(*P@@yPc,*`@@w~p@O-M-MXP@Pϊ$ P8(LxP{p` h` dp@ⰰ ϊ 4P  PPLϊ ϊ NPPyp !R*6 @+yVpL+  Dp P = @*@P G @ .p P P @*@P Z @  p ) Qe @*@P m @I p ) Qs @*@P | @P4 y A8pL  J IpP y Lp^ @PS  @Q @PJ` ᐋ(f@px ĀXQ@ppP4(0@0   :R P   @LP @kph P`@U ,)KqZPEoP) @O @PL mp( , Lfp! @p @  _P  @+Q @% Q @ލЍ` @^  @x 0/ (@0  @4H-M P0 CHpЍY @^H-8MP  A( A8Hp8Ѝ0 @FO-UMM8 L@p+ ] " |Evp&P [PJ+tPJnP PiP +tPZ @Lty @F, @A P?n A0Lapڴ(Z:@ p!0(  P .PP`@pG'W8 /5  4% @0@cd !@ @0i5  v `@@0@  p@(Q(Z:Q 㓖 n⬁@P@@(@!0!     30AS9Q 9Qg)  00  0d#A, ,L",@Q  0ppS0Q X*@p@ X0*@EPPP0IPPXPcP*@PCPPPP= P SP@P@BP0PA P  0 p (@ "i r4` `Z@*p@. 4,!)PPaT̍P 0 @ph  @@01Pe*P8 0P>j @@@P  @ @`D@ pT  P@!@ sPEp@UaF଑@@FPU%  `@/ @P P /"@P,&  @%  @&  @A"! @ !@Zs`F@@VK@[: @J>r*p@2Pm P@T:@Pj @@4P  @-N @' D pP sbE V `@@@!P@,9 Kp[@,II@P V , `P@@㬑@$  @P !@P "@P,&  @%  @A"! @ !@s`F@@V,K$@Q' u Pn @@@j @tf 㻕 T @`@@ _ P@ 0  @T"@>v㬑@Q f P@`@5P } @7P   @0  @` J@@TPUUP  @0 @ @{@TP><P ` i @P  @iQ PB@QND(4@LXdp| @T:@PP2 P j @@0P 6  @(|Py   @s@Qi  @眑 @bP^ PY% @[㬑@{P*j @@PQ [ @`tW@ P@ 0p"" 0  p@T>rP `*p@㬑@, @% @" @ @ @ @ @ @ @  @  @ @+ @  @ JZ f4`0J`'ZP*3Q  , f6/O3s2"0r R 00 , C,L%"^#Aq, !ɠW%#Q:A, A,L"KUߍ؍ @ @@- M P@ 0 C@@@!H @Asp @@ ЍO-MY ppS   A^Q0S  {9` V..@ЍO< @ l9`W JP:PJq@` @   `V*E@UPH-`j@ @P<`<pfoWpfU W `Eq[ P@oV `FpWP->H ` PA!@/x @/ @+@` PA!@/ @/@-M  @@ᥖP  WЍ@ ' q? @ @!0@@-MQ  @@ፖP  ?Ѝ@ ' q? @ @!0@0H- MY PH@p   @mP  q @! Ѝ0 @@ ' q? @ @!0@֛O-dM3qpʘ @< !@pʰ @ @`qP !p P < u+p <Q @ @qP '@@ @  a p@ P @ 0P@ p`R @ 0``H( @ B4 00,( (@ $P`n p<@P P @<`0 02p0p.p X `T\T0\``'p T?Qx*@ '@Q 1/dЍ @f fqp @pPL @@+qC. @< , jP @A !@@0@  Fq CqA-hM:Px*@(P 0P @ D@(@ 0'p( 7 @ @@P(  @T@_0 [0 p5 @Pd } ʋ P'p@o@ ~*p PP8 P5(~o>Q%P Q Q% ( (0 $0i @ P*P( 0 0 @hЍ @PQ P PX@d`\Xo @J @@Ppp P@PX Aoi @@  @ PAD!@@E @ip/zp Mp@-M,Q, @P`A o``` `/QЍp@ Ѝ/H-|*@ R00@-@ @-4/>p '@// Mp@-M@Q P`A?Q:=P"1QЍp@ Ѝ/ MH-M   йЍH Ѝ/@-Mx@*@P 0%p @ @Ѝ@-@n @knenp p @om @o MH-M    哹냹ЍH Ѝ/ MH-M    價s.ЍH Ѝ/O-Mph ;] @`@P@/@ fPl@ Q! LС`P xFP RPR? Ph ` gPf#Q  ㌵P P&  #Q  vP P  fP 9  WP Z @*pH[(@6 *@P\ sjD*p@) P @@@@U*@`P |:PIq Dq ? P `XP PpGPG U*m@mQ @pP cP bP  XUp*^ GP*U8p<    Py<P! UZ*@*@[*@*@X :P X Pp ZpP P  ! @'  6/ R Y@ @PhmW  0mmp3<PdPa (nP `( `W H`L !(   nV  0fm Q P  mlp4ڸ qr lp @Ѝ G @ . !@ q @ (@u @ @j @  @j @0H-@ (@P  @D @ 0+ @ H-M 0 '@ #P 宣 *@R  0 '@t#P *@Ѝ @Nf@I@-P@@O tP ^  60S = 0@ = 0@< 0@0H-M  @0 '@PЍ8P 4Qqs0#4 S = @0@ Q 01 = 0@0/H-P P&@ #Q \: = @0@\01P Qq0 0 S:< 0@@ ^1? 0@ Q 01 = 0@0H-P0S\ = @0@\0 = 0@0P S \ :<  0@@\1  @/@-P@O0$S@q Q :  @  @ @P   #Q\ : = @0@\01 = 0@0/P   #Q\ : = @0@\01 = 0@0/O-qMMpQ   @`P@/@ 0@ cPd@P紭ddddddddd$dddH*@&AP 0 aP# 0@@*@@@ 0P BZ  0pzH(@GPY Pj PoY dP r ؑ PᏧ`p@!@@`(7P  7P  z7P P j !@P lP4 @c7PP(N   P+ 0  000 000P` P `Z @"P  @Z'PAU  `P`P `P`P p @ 7P !@7P @7Pp @6P U =P(8P( pP ` U +`P(%`P( ȀpP  P@ 6P p P`  iP   A   ~(vP @PPl( P(P@T`gipp$8P}'P+1/FPP15P q Qr'P}ipp, Sz*P@D jP e(D j|iPy 5PaP:a@P !PT @QeiPP U@ 4 0 0`qߍۍ @e3j @f 8 @ @] a @N6@ Q ! @0H-MP0@U 5 @ ღ?Ѝ0H-M8  \ (@@0FG-P@pnQoQ Pp"@4P @"@nQ`oQ ``ԳP @P@K-MPuPp`DȜ5P 5P p`VЍO-AMM  p@2P $ ,(IQ $uT @TJ $f @PPP/P@ 0 PC `P) @P9 `ȼR P@p \0ȀZ V0PY  M0PW @TP p  @㧯3$!@$  @7Pp _$@   $@ $!@ ( $!@a `@ZN pᨠ@mP  @ /P $L @P "  @>) @B 0T @$L fs@( TB45 "@` HuP. ゾ@p@P"@@EWA`PP -P =A2&@T pA L@Pppp P`4匣*@`爃*@o 0S0P  @=w V`E `p!@@2pV [ (Ghp @ήpJ @P $ P Ϥͤ[P- , 8i\g '^[`F( Pc 5gP(`FP ,gPVP(  gP[ (@Xn "p P PQdVN @}$ P 傤@s`Aߍۍ/QP#`[P p ^`*@P   @ 0 @p* @P   @ϔP Zj @ X`Php } @  @P2  0@,0 0  @ FP ,P , g$P,  @y!@Z,Ѝۍ @@Zj @,ЍۍO0H-Q  Q @P2P Q`*@ `*@0p@-@P5 nQoQ2 P# P ,R RP @P,$PP ``,$PP  @f @@p`*@ 0H-P@(0H-BM @  P0 $t(@0fp  0@y @ @' | @b5ZO-Mp`tP-/@ G  H(@@@/@@  iP jP oP rP9eP gP  0P pH(@FQ(`,`pЍ @H-  (@5 @0H-@PW P /P0o @㴒 @0H诒Z @0H0H-P@h0H-M @ P0 )  !@0Fep 3P P  l = @@Q, @3嗯 ( 0@O-MP,pH((@ h /@@@/@`@ AoP 0iP ]pH(@EQ A O @gH-f  (@5 @v0H-@P P /P0o @ @0HZ @0H{0H-P@0H-M P 0AN (  !@0dp 73P P  l = @@, @#3  A>@O-MP,pH((@ j /@@@/@`@ ᤼oP 0P pH(@EQ A O @H-  (@5 @Z0H-@P P /P0o @w @0HrZ @0HުH-0H-M@A 0P" @0dp  @$O-M,( l @pP@/@`@ -oP 0UP IpH(@DQ @A +5+ЍO @MH- 3(@0  @!0H-@P P /P0o @ @0HZ @0H`0H-P@0H-MA>@ P +$@0cp  0@@ @/  @ ,<\! @@wO-MPp @0K+xyo `@/@ ႻLPg@Q!T0t9P GP9||||MP( UPw| |||  @0rPc f||}] ppH(@QB0Z S  S Z `PY`[ ecp( [<pY@tZ(Z PPu=$||Ѝ  @  @ H-  (@ @)0H-MP @p RQ pЍ0- @ 0@-@–Pk@@@-@wP!@@@-M @DQ QpЍ? @ 0H-@P( P /P0o @ㅏ @0H耏Z @0H0H-P@90G-JMM4P 00@ 0 H @0bpe4@Pp*@ `@0KPVP S QP0 P U0 0ap 2@G Pʎ"  @^8P  p< 0 04p>P B @<0  @`p @D L0 T T @Xp\`t@T$@p `Jލڍ  0@)p@-@ P PP p@ZhT*P@`)`p @ O- Mp`H@0l) '@H )뾳 @*@*@ ᤹@P@A@7PpPPPPPPPdPPPPP<HPP\PPPPPPPPlPPPPP PP 0XPd2PJ 3PQPe D/@h@  I/@^( R/@P '@ '@} a/@;8 s*@mi e g/@#P:4P Y@UQ  /@X 0@!P P *@   @B P  P  @  '@    @      @s$* @   !@i $  @^     @S $  @H <   @= 8   @2 @   @' ,  @0n r/@X$ t/@J,  w/@= u x/@30kP bpH(@GQQ0`+ '4D  Ѝ @3H-% @"0H-M@ PᏦQPЍ0A @ 0 H-M  5 @3 0@  (@@P 5 | @@0@ ᚾ0H-@PZP /P0o @㷌 @0H貌Z @0HH- RRa @A-M`PPJ^ _pPJ@@ RR0 _ ^P 0pЍa @H-M` Pp0@ 0@S^Q 0ЍK-M`p@PHp? 0 4pP< $0*@0p4O76oB048 AB<0<" A @`@I @~p P 1Q 2/R ~  @@̿O-HЍ @H-BM@o^% 02/ 14 10>p p0@ 00 P (- @ @㜿-H<Ͽ BߍA-MP@` p$- UP *@2/R1QP5_U @4O,@,0  @@ fЍ2P(0/O-Mp  렆P `@@ p{P`DH @0@3/pB,P=p@WP ` p@y+  @0 3/ qZ㋐r ʤP P jYR*  @@0,<ЍO-MP@`*@[ =%@P @::Pt @0 PPP0 A,p C @ 0>P >  @壶` PB`t@ $T`P@pp P/   p8 % ~(p P p! 0x% D 0tp PQ 1 U*@P,` P+Q p @㤊P/*@Tt *@Qyqp@ *@UD *@000  PߍO-M-MpPP$ A`0@/@ K @ F/@ 0@00@ H'Ӛ( @ @ /g@Qop D @ 0;P /@ @ $P  @ $P hpn  @ \" 0SPk@ e @ N" 0SPf@ ]I Z  pH(@EQ$A+#@   ]p9 0<S p@ p(00Qp0 ЍЍ'  @ @  @ @e @ @  @  @ BH-  (@F @㽽>0H-8MMNA. 0P$ ( @0\p4 @-  @P@  @  @ (RP + @(( @0,jP I @,(9 @00W @8Ѝۍ0  @Q0H-P@0H--M  @0@Z"P     Ѝ @(0H-MP @ጢ RQ pЍ0- @ 0@-@ޏPk@@@-@ᓑP!@@@-M @`Q QpЍ? @ 0H-@PDP /P0o @㡈 @0H蜈Z @0HO-LMP8@H  08@C E$S4<CE(SH89柅ⲏ9D, !2/!A4q"X32/\c3?s6o7"X3\cs0  ??h  p  p , p $ 0p (0X$2/X$\ 13?1 Br4 0Ѐ1 ŕ$5<Ͽ(u3?,e7 6o ń$5(u,e@ 8p {< Hp tD`H%L52/Pu3?7H%L5PuT0TX0X\0\LЍ0H-@PY T!O!J0A-P 5$`6o P<Ͽ2/3?> ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `P!""D`6oD`#@`6o@`#H`6oH`L`XLL02/3?6o8<\1L` X`\p `` @p,"8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x RU @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,o 0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+F!PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUO ۍK-MT|,(@p@QpPp  P#`  VLB Dl# 5_ P] uP PO'a` 0 p Ѝ Q 0P #:r/ Q 0P #:r/O-MMȵp[/*@@xE @8̅P*@ PP D @$PpGPPm Il @Q`@`840,( pB@4Q 0   0             $       4,\   t@ D   t /@ @@0$P D @*$P  /@@Pe m !/@  '@0p*@ H/@@ 嶞8P  !/@  @0U*@g /@@P?  %'@* @0P  h !/@  M@03*@E (/@ *@0#*@5 /@*@/4 > (/@  !@0 *@ c /@  ,@0( '@  /@!@@#P k@#PB*@ *@ q l /@@P ᄋP  !/@   @0*@ !/@   @00 '@ >(@0  @@&*@@  /@T@!@6#P*@@  @0$ '@ 0  /@  v@0k H/@@(0n @,[*@@ | !/@   @0F*@X :/@@*@@kPf/fPaP *@W /@!y0 0 @ 1%* @ A(@o P, 4R!@"P. ["@"P*@'*@" @0, '@ *@(@f P( *@  @pI$ H(@'@@P#*@P  @  @  @ @ @i @-c@*pPt[oQ봥*@B AG@P' T@P# Lt0- R= !@ @0@PR@ J@  xE [?@Up0  @@zp* PU*P@P T0E*@*@@ p R!T pn; @@ p( t @㛶ᨴz iP"z? @ E p*@@$ z VpXpxP!*@@*@z _P%* @;PJpzVpd @%* @e*@*`@ ?@P@[ot"  pz UpbN @v%* @ ?@P*@@t @ P  P * ) @0sY$p<4P$pJEU*@@*P@ $RQ! *@P`*@, zPp}yP+pP*(p*@R x  P&v @P$S*@ ?!#$p*@l @ $@p  @XZ*@$P*@ Sp$#ʛ @BLP P @ pl%*@* @ b7 'P  @ 0Pt$@V U   }S`Vp V p\+ Q*@Pe*`@P  R @+ぁP  QM*@we*`@PP*@[oQ( '@PʬU*P@P  @@ @0Q*@Q$/ ' @0 R01, ( 80F@w W ESy ASPU B!KP @p4E @ T 0B @dㆴS#S!SS !@S*@*@)* @ p @ BtxE [?@Sp9"² B @d0 W@pfs@ȀB_<` p1 PZ P P  p% P<PP ٝB/0@pPdP @ @* B/@X @@@ PT)`[Y p OK@PrG@ePz  `Pu `F[Vy pPPp̅ȵ㴥[o*@*@*@E*@@ ?R *@  kp @%* @m*@9 Q*0@RQ @Y @PPs  @ @F@ uP *@ 0Q*@Qf[os@ PK  %_=@* @0@ %@* @ 0[oP[o4  %=@* @0@A-U*P@@TM (@@m6@0@9@@@ 0p'`@P @P` pPWၱO-$M p ` ` ~ @Pp0S$ P PaSKC P 0        x  kC P0        x  \PBSP GSbSP gS @0(P`\ ` h  0Xx 4 hpScQ7VQSVQ"R. ! *@PW *@P- @ p` (HL Q %* @ R! @ p`$Ѝ 0@9s@ 02@p` p@`  0 O-M-]MM1$R*@*@P? *@P:*@*@T *`AP@` 0P P`{p p 0P P`pp RRD 0^pp Wp  JjP*`@| @; ?P*@q 1  *@5$ '@*@*0@P 0P o %x ,< (%(,, 0 '@'@Q @ *@Pe @P @*@P[ @U*P@*@ B0 4 @*@P1 @4A =@*@P' @4*@ Qi@*@P @0 Q *@ձ*@P @0Q (@ȱ*@P @04 Q@㻱*@P *@@TU3UE3CD @ @ P*0\PB\C0\@*@PXPmU*@ XQ(@ぱX80PP$0 4`@BRFPfLP_ȟpbHpP@0pS0PVT0QTR@P`@80pS0 P`1@@;*@P  *@4`a  0Pp8p*@ϊ`V @ T@ y㰁*@Ѐ pdY4 TQ?Q8T'QQY!Q$ '@TYAd@Q3R:@*@PA  *@*@48$`<4 0pT @1<0\@'D00LPx |`!$ 0X 0p!( '᧑x 1\Uta F? ^ 0A0E HP? RE_( P|`@F $   y9!@P R!1R@J*@@@{*@P *@P x`8@P8<@P"*@xpT` 8q0 0a2!# 0Q0#Q0Sr<8 # @P0Pao 0A@ԁP 0 0PP*!0PP0Aaq.W:`AtP@0 $Q!1Q 0o.0!^ `Ñ!~1AQ1`  0R\b>B boQ"\#Q 0O.@0!.` ` 00 pP0pU0p0 AB0QAPaqQ!ȁ!!! 0`i PQY# W1I 0Q!0B@0JW` p0KPD\@@ !?>1``PTf_nQQ 1 0 `1 S@1 AR>  0@ \` 1aT܁/ !R!!܁P!!@0*@P *@p @8<$x`I`p!善e0P18 X? $Um?H$U,0To`P`$? p`'0@`0L S|尐4? @ 0@ @jZ*`@p*P@ 4*@p*@*@*@:*0@PpH$:4`*0@L  :( *0@pp'@@u<VPD QTD!h A? ABXD@HE =`0 ,p B<4q 841 S!` 0PY2 `ɯQPYSQ@J8@p@DU D0QP@SppD? Æ $O0܁PSSP0S4qP DTD4$ 0t'@Q H( p0 T*@ȥ@*@P ^  FK P1A Q dZ0 pa `Q 9wqSvQ@ ! P `0+SZ*P@@ 8   !  +S,p9 @`0*@  P0(:R*0@\%,:*0@R| @P 0*@@ @P0p*@,j*`@( *@P  0@ @P0p*@ ,*@*@P{E*@@ r s 0@㟭*@P 0 *@0R%* @  `H@pJPE@T`VA *@P !*@1L*@ B+0*@,`, *@|>*@@ Q*@ &L+0; P L*@ +00 @*@V.PX*@P @ PJ0 *@ P) @H@P#aTiA, 0A/r"\uW A0 0d/ 0`13 0P#QSS* @㒬](P@z/PhDL%* @0 QPPPSppGRpSq,@,@W0T*@ `X p@8<$唦Ϡ\ P0QPPT AX !  @Vaȑ j*`@4 `@a TAX !/@ j*`@QJ*@@L EUR P@ P$aQq`0p$ '@P tx R !x  PJ,@P TX\`$%R?0*@Q@h$l` R/dP @D?*@P  *@  Pq W jP*`@U @ P`$P 0l$ '@QBdhU" @QTT! !U" @QPeXPeVd ! ! !@p=ta!q! J*@@0j*`@8P Z:aUR P@ q0R\  /0 A  *@8@% @4  4   F*@8pV*@ 0Q"`P1 !`$$j*`@8pj*`@Pf`7 P`h$P 0l$ '@Q?dQTT! !QPEXPETd ! ! !+`PVa!UR P@! j*`@~J*@@8pPQ AT0@*@44W* P`!p$W$:T0@*@$Q+pQ( &p0P `  R $ER A@A @PTp@p`pUJ*@@:jR*`@ $5R 101: **0@* @ a AQ.*@Q $Z4 *P@s  @=J*@*@@Px p$Z*P@z4 *p@d0** @4)0P   UZm*@P  G0x S00# !T P`\uWl`P\ @T*@ a/6'\%1T9AR !0p`(*d* @P0 p` 5w pPSQN ܡ*@P\PV`x 82PN`, *@0p @a0,J*@F*@@ `lP`P a*@AT@AATIA&6#\Q @ 0`08d  h `X9"HFQ?ܡ V 0SapVE*@@P0*@*@ȑa\ȑ0P*@*@a*@PS YJ.=IYBtg!Y `@\uƒ2# !@aTiAW P`p0pd ? p`2w0 pP7QWS! @I PaP, *@PF `,Vu:Y *@PK $ *@'@ R P  0 0AP; `I ;AHRH$ '@ RAD 4 '@'@ G@!P4Q@`PLP `@D5Lp0? d?H`AH | `_p`l  A4 '@GE  @*@E @UP!4@'!  *@@5DuL`0pdP04k4qa`0 0e03 0UQS4 <  0p 09SY` pp@ h ,HGP*@0 ,AE*@@ 00aqp`X  `p !@TP` jX 0X4 0 XPX#,Qp `pTI 0@@*@`*@\%R+!?0OQ? 9d\Tt0` X P tPLf @DuL / G:GL d9!1+ Qo` A;*A0 AtC!4 @ @DuL +4 wGpGld @ b4 RQS <a O 0CAc`p@#P *@PP$*@4$ 0'@Q?.; b*c "A4 *@@A*P`V.VDV>*@P P*@P8A\ *@` PJ *@ ? 0J*@*@@P 4 5J0*@@dpHd g4 L6 WQSr 0*@P*@P 4 0z*p@4 dV, *@F4F(KЍ* @ @%:&%( '@5@0ԤѤΤˤȤŤ¤ῤἤṤ ᶤp@-M@*@P"`*@P *@*@  P*@Ā" *@$! ˔PЍpҏm @ 0p$}M-MM@*@PZTX 4 *@pW (:*@*0@0 42'p *@P+*@ P= *@T P*0/ @ q`V 7Q  QW_`R0 `F*@p 0KMi*0`KH-M@*@`P *@P!  'p*@$% *@ T! 3P d:G @ 0إ"*@*@ !Ѝ`0S TI I I I 0/ (@@ ?0B0B/01//p@-`*@KPPBz $ '@PC/DBpO-MZ*P@J*@@0d` p f7 VQSc*@P vU @ QRQU QM -*@ 0P( @ S` `` o b @R9rUqŏQUtQRK K K K `@1 4G``@Q,`aQ%Q !@㢥 *@*@8 _Y0 @f @ @;8P Ѝ S`*@R L L L M  0@l G 0G !0J*@@`$P0l a>Gp `@** @  @P@  ?  0 $ '@PLd ` 0P9QS?7 QTT! B! QPuXPuW&d 0P  ` 9QS?먠 <b 0? *@  !? A0 P; 4p8@0 H  8 A ? $ $8A4  4 *@`8P `?@>p T`@`A0o~ B0"  ** @`8 P*@P   *@`dp g 00o `WQSHO- M*@J*@@`0dP p e7 UQSЕ*@P UrP p@ Q @7*@P Ao"R \ A !. 0P 0dP p e7 UQS@** @ P@,Z :  @0~*@P @؋ 0 )y?`#"1T9A)%\%R !`Ž?#p2!P`x 0 d`@ 0d `T036QSp 0k0j0s*`@ [0QS :JT)*@@ @\Q(x 0p*@SQG `(!1pG2/ w( X `1qA3? qX0/x 0*@TQ% @p`p!p`X`p@!p@W    l , J `*@@P 00 ЍO"֠ Ӡp@-$o P'`@@P  *@P 0PppO-M@R PP@ ꨠ D eP pP e D 0 ,hNSo*@@P 6`3 '0@0`@(pW 0,. @$`@HEP@ $D 0 (RT ` 0*@A`0`rd`\pL (00*<; @<T 噊<Ph@@ *@PU &P*x L0[\`< *@qP,m 0@PZ hNp`*@@ [ d0 V:VhN*@@ 0 0Q RS 1c!QRShN*@@\ , , , PL,V, PEV,  @,`p V! Lp0D (*@hN*@@ pP <X:*@*0@{T`8:*0@0 0Q6! c&=@8᫛ 0(z@!* ᡛ  D *@@0 P *@UP lH *@PX *@ rLR*@ 0d P`@pG!Q!pW DJ*@@P@.P h**@ @  ](P@4 PhD:DH*@*@#P0P S@QSH   hn[*`@9 X@*@@P$$,PVLPd +庵  *@h*@orE6hh*@*@&h*@,hn"*`@(L 0*@ +%$ * @0 @%Bt (@ P  +" @R*1p71 A  *PP:Pp p PW:P U:, 0( 8(p V E[  P,  0 m(P P$P pᗐ$1$pdW:, 0&(PU:D *@P1,P[@p LPdQ P(H *@Pg PU_.EUPPW[3:[` P, Q R) !b P Q RO@,P? U  !@t @ @!PP*D *@P"  H *@P[:[ P Q R !b P Q R 㸙P0[U 㯙H *@PLP \ O9P (9 q" W!pq  d0 P808pl! CH0 C(0 CppXqP\ Fv^oP$ 0@XoP VGU $z<U*0 UQ*  6$ Sd( ,p':Pw U Q:QP YX h PYXRH* @ hn*`@Q 0PR*A5, 0v <G(P0U0*!!U:`"@ @m0 @us 3Q 5B0V@%P %P@0@},AU1P\  0p'U*$A t$P  0t  0ALP `  '@ '@`pV@ `8 V `#P p l h d%8&ẗ|)P V0p :,pPFh*@P PUhN㠤 *@@*@& 07吘 '@V㴰 :,pF `PV1y   0  㴰X pⴰfH` 0F0]LpP`M88h '@@PPdPplh7G|똄 P*@ 4 &*0@@` 0圔 *@Eo@+bUo&,"iL *@ 0%C07iߍh '@* @,@" @|@@@rr@ l@ f @%@ ;[@ 8TF@ N@ H$@ @0@$@ @08@0@+@&@!@@@F@@@*@m@@-h*@L(ƞP d Q:Q0 @S RT 0Ad!SRT\  H-MPH *@PL p*@`d*@%G!  ᦅPЍ{$@ @G-M@H *@PU TST +P@pWhn*`@ppL*@P`X *@V8h<*@*@P P+0+@ q`V 7Q  QW@5  D*@0ۍG+0~ۍH-MPL *@p``*@%G!  *PЍ!@ @AG-h*@d *`@p W @ d p*`@P @  PUB@D`Rq@  K-h*@`,FQR vWO:ClPK P 0@  T 0 Q0pW S Q @pa0 pWr`! ,F'6&0r, A, @ `y, @" @O-Mh@*@VpkP{ W@%:( @,Qt   0`&p,6&0 0,A@(`WM*@W P0p&!& $&T,f?" 0  h0"x X pSQ $&?\ @'@ᒐ(L%P  P ((||||||j& d 0A ЍOcq@W@ @9 A@ $ @O-M@R PP@ ꨠ D XP pP e D 15pf (0 c0< C0 $ D8(%-@\rPp w`P @@ E FY @Y @Y@ Y@ YhP ipY? z D 4p8e D 4p4 4p) 0( PU!*`U  0 P  @z0 *@@ o =ߍ6@ XK-8MM8 P;pPM`p @0 P9p3W ` 2!8ЍۍO-MMAn@Ph<X@@  ԋ@@5Q=砎 X , @ X X d X X X X X X  X X X H X X X X X X X X X X X X X | X X  X Џ X X 0 X Ď 2/@@3 4:/@0@/ 3/@0@ yD4 :/@0@/l p/@p3p ` 9/@0@ T@~ 9/@0@ JHt M9/@0@ @Wj \9/@0@ 6pXp] /@X /@@ O /@h-(I 9/@0@/? /@L: 09/@0@/0 >/@0@/& >/@0@/ k9/@0@/ 8/@0@ p,p /@0 /@8 <9/@0@ pVp ? /@0@ ` p`'&`pP | ^`|P3 P0pP+`p%H(@Q*Q/@P  @@|)7 @0@ᐫ@P A.xЍۍ|@ H-MPp ^@`P?V=JP5 Q6G@ Qg@ P0瀔 ̔ ̔ ̔ ̔ ̔ ̔ ̔ 瀔 ̔ ̔ ̔ ̔ ̔ ̔ ̔ $aO $kE $fJkDЍ@ 0D@H-@`pPV P  V@ 0)H-3  (@@@B @ 00u[`p@P@!p01`FvᯐO-M@R PP@ ꨠ D UP pP e D :2pf (0 c0< C0 $ D8(%-@eoPp w`P @@ E FV @V @V@ V@ VhP fpY? z D 1p8e D 1p4  1p) 0( PU!*`%U  0 P  @w0 *@@ x Fߍ6@ aK-8MM8 P;pPV`p @0 P9p#0W ` 2!8ЍۍO-M-MM`P0FpxQlp'q#$dP{`(@t{ppdp1#upo`oo4PrQbpb`oo@bpP``oobp00U53sU5E3sC00E`#10@d#2`0qq@p#<0$0⃀pqppQtpp\0o`04r0pJppH0p}|0ppG003pp0p80 100tpXp00\p ph00< 02R  1 p夀U PT  P*P $aYi/AK]/p !1^@ -/P 0AQ $aD/p J @0PYA0AP P@ 7P Q耍[ rPXv@ @P``DoPN PI pPUXv@p耝$a0  @oX    0+$WPU Df@`@P D@T"LHD804X`P)0L PX 4 R$ H(R`D QPQ`88S<@,0P $A/  P@0S  (@000D B0SR @D@T`QU HPDP @LaQ:`PPV?p耍P @☠蠝$?  gp t04w8@  /p@ p/ KᘠUY: Y P?*H?W?p#PWHp2 DPX7 XDC*pV耝@  0`DP p P P  P *1%?SP0:W QT` P`@V !P  @ P` V`V_ T\0㘠saP:a !PȰ P pP pPpPp吐 !PȰkpP ipPB P wX @PP@PP@P P?*Q@:QD ` P   1P Q P *P@P PX@PPP[B /P @ MW. @ 0῎W@PT B-p J`.P0,@  P  q@0 7'!0T T  aQX@ P p `,\pq(`吐<P PTP嘠 QN Z꘰ P a[ W@UTB@L`W Epᙵ!/ TQ 3f:XTPPq<b @ `-P(@W  !/TP U<D: @Q P P P`` Q` T X T V@X T V TZ@ Z:  P) ^!~@  [P  P X TPq<ZPX  Zh: R"[ P X @`W' p@T @pT TWP @"! @   $ U:pW:YP*$ ࠐ0 Y ! U : +` a耍q E@?0!!P "Q p@P0 0qPU UX U@PY p 0!@ b@@GY㐱+T @=`P`Zk:U?? U0Vi*Y p@PLQ夀 PHP @Y @$Y @G @ @j @: @ @3 @ s6 @,`,@) @%\  @ 0Yj @r5 @,@ 8x@ @/@o @R@gY @|P0$xplP4pVU U @@c @ @ @ #@ @ @8 t0@ @ VPP`P``R`0@P `T$0 QP #S!  @ 8  P3Z8 W p RT; R6TP4 @ A @ @T@ @4* @ @- @* @( @ @@XߍۍЍ @0) @ S & @㌌ 0 @ 兌XQ , @TPQ 4 @x< @tT E @nHMD @ 0hU c @bT|Al8 @X} @UI R "@@oP@QK @HQ@TPA LQd +X \y \X``\ 0z @$paPt  @< `Q 1 W`S0 !000@` aQ0q @Y 0W00T@VAQ `$pFo,r P c /oL0"d 4 &$`8 ,x ( t p ,l ( d `% %%| , (  D H   X    \z@PA\  (@ +@Pd A4 @$! 0@ +@ @pP  @Z3@Z <T3P  Q ( )p PTP   7XZ@ $P /P Z$#"!|DH   $ PP` @321x/t.p-8,(l'd&`%0p$p)Ph`gfF P`@h !l'0(@ PU `0P P`%`PP@ B rMP0, @l0pW p@pQ`TPP\p 0S 00P@T U WA Z:Z* JQL ZP  (@0S 0 0 0p#p00KA q0 (0 00?O$(@ 1@ Z P 4ZU @rAFRaDnLPi: *a/!`%>r#h"""B{"Bp@{"B""p@{p{*c!`r#h"2"B;"Bp@0@;"B""0@;0;*b!`r#h"""B+"B0@  @+"B""  @+  +*a`ph  " "  @ @ " @@Q A  'p P  Z+$ @j$ey$ @j,^X, @ )   +@/O-M-MpD`C ) p+@ ( p+@ʜ @ܹ'p @o(/(p @̹UA 8 @@/@ vC@4Q(   4 4 4 4 4 4 Ⱦ 4 4 4 4 T 4 4 4 4 4 4 4 4 4 4 4 4 ܾ 4 4 4 h  p 4 4 4 4 x Ľ 4 ,  +@<I <+@ P9@ 4 +@/@  $  @+ @ X</P@ n<PzڼZ  +@ +@mH(@@8 } +@ X</P@ n<QPڴ +@> X</P@HI <+@ P@  ` U +@{@  /@+@ X</P@ S<P X 9: X</P@ _n<Qp +@ ' +@K +@F +@A +@< +@7 +@2 +@@0+ +@/@ + $  @+ @0 X</P@ n<QPPC  +@ +@ l @ᇸpSD  +@@+@ @ Pm a  P &Pp a Z&PrȔ +@P&Po Q߽@P½0 AP ` x,@@ ,@ `  PP D +@@P @T +@ Q8! QJHG(@PG   @'  @# @"  @  @+S1 @`RMb@A  @ N @{Gz?eA  @ @m @" @Q @GQd  5 t+`@ @+0@ 0PPZP  f+@ @ +@@!z 8+@[Z``Z` P +@P  @v +@@+p@`\$ P+@ @ ᪷@  V)( +@D``Z!D +@@0S (@X^ [ @ V( =r+@0 J,@-f D0wB@kKv"P"\P D (& +@@d p, @+`@ D0 X&p @lT +P@ D0 G&p @l D0 8&p @{l D0 )&p @ll XF +@,@@0 ,@   0 '  $ + @0  0 (  'c( \V +@,P@@(0 <,@D0p p%p @$ + @D +@@   +@CPp )0U"  p   0 p  0 %pʃ @ʶ(@ 00 * 00SQ# !Q!H@ 8 400 (,00 0`,Pb 0 `PbB0< @ 4$P +@Q(& @+ @D `0aS0`P` +@ @ U ( qK+@D` @@`PU 㿅    +@HH0 M%p @UU  +@C0 ;%p= @C d +@+`@ 0 &%p^ @. +@Ӌ  +@ 0 @+@㯅I P'@@ 0P %p P @ 9 '0@ $  @<P` ,@HP!" @`L @p ,@ @@$ P P\H@s#yP F ,@@$~PU A-Pp G!P@Q`P T  +@ [PP [P QTP A/@J0 @ ᒵ @ ጵH-閝  (@ @㦅'H- ,@Q ,@Q  @  ,@+@ R1H-p ,@ #pA @` O-M- M   ,@,@$蠦 ( (F 㰴 ,@0%"p+@,@@+@=tA T <+P@< @ _`0 `+0; "8r 0"( # $p]& + @<  0p"p  @Ij0 p#pEڐ ,@#  <  hD @ -b A0DQA#1H  @ @(0P4 @ @(0P* @ @(0uP  @ @-p 4? @$] @  @#X ,@I /10 @ \ @j @ @  p @,@@pp Y:Q Q Q$W6 @pQ Q@PIT** P pI@WT@T"* p W,ن H 0  p p; @㭀mW*D@f0[ @A `D,@V ,@ 5PZ  ,@ ` ,@f 0[,`@ @&1 @  @|jIp T6:@`P@`XXX v U@DI T ]KI T* p p`P@`XXX T 3@DI TIYK f [,`@ " @2DH W `P@` XX "봄 㠦 +@,@X %Xⴄ 㠦 +@,@N ,@V ,P@pPqP +@  j@M ` R P`ŵ(' 1 A, @  B* 0 hP ,@) ' @H ,@f ,`@+ p+!xb X ,@ C'@CM ,@ `Ͷ @/0 RU X/  , @,@ \ ,@Ww ,@Ņ H 0  p \ ,@ BP (P\ ,@PX +@ \ ,@4 @I\ ,@P E +@ 7 @r9 @L @E @B @?p @=& @6: @3R @0k @- @* @' @$ @! @ @ @\ ,@_ @7PUp  '@@ODqPU$ + @  p Dqp0 @ +@KU S'@S@Q +@P,! H 0  p p +@p QX +@S ( +@+@` G@D~PC (& WP+ @ PDPPWPZ, H 0  p  (& +@+ @`0ED  @~ f +@pP +@,`@U @~C@~ P+@f ,`@ p| @ @A-@v ,p@m(`@Q&  , @,@P0P.P`p P0@P`0X X PX.qQ q&  , @,@P0PPC`p P0@P`0X X PXPpT F ,@@P `P@`XX X 6 ,@X^\ ,@ ` ,@ @@-@D ,@P@| K--@@`pu바 +@)P @ 0(P}X n @}t @}@  | h @0+S}  X (@KwJ@@A--0M@<T  @+@}F ,@@ @}V ,P@ @}Xo ,`@Q  @}P P @} @ `  @ 0+S} V}Qr t "+p@ @k   H ,@* R +`P ,@+`;Kq+t++ '@ R; ,@ `;c3+SK ;d @b; Y}; ( ,@H  8' , @P` 2 B* 1 A졛0Ȇ ,@  `/ , @P`  B* 1 A졋0@U @@ +`` 0+S}0ЍY@@@eA-C6?H-M0P0 p ,@ @i @|ЍH-@ +@, & ,@, @ 0#Jf 0,`@   ,@Rல  B* 1 A pa  a  ,@P@dtH<eA?333333?G-鰔 `+@P@p @( Q#<Q( ,@Q W,@Z @ @G p/ @, @|H-D `+@@p P\U U U 0/* 1 @ Q   /r @H[|/pr l @0/K 1 @HE|0H-M@ +@ QP PO+p @,@0{Ѝ0Cj$0p @,@Ѝ0H{O-M@  @ Qᾐ`pH` * @ 0|៖ @ { @ 0{ @{  @{V: pPW *qKa @@{V`FW:ЍO- M`pG@-Q@ @P ,@  @P ,@] P@@ rl@Q  $ D P  \ dP ,@P pH(@P- qW%Q`` P`=`PQW Pk*p W@ PZ T?{`PPP`,g `@ ,@P @ d @%dj @ራ  @ቫ ,@P  @ d @ @ ydXy, @ vdudtW p@#`@ P@ d 0dY p; @@ pLPdY_ p @T U p1P ^ @ H @t @F  @F`@p @Pc 0!@  @ 0c@- ,@tG"@ @@Q@  (@ @0z|xO-MMP?` @pP @P@@ ,@ @U-P : XCP İ p@/@ @@,P@,@  hq MP!bBP4d  < L 0Sn DR MRzP/ P,@ ,@NR@ RR  ,@ A_ , @QP '@ ,@ ,@ ,@ '@A _) ' @QP ,@ ,@} ,@ynOP gOP @ P @`bAP P- lFOP -iQ Z-@rP @ש  @  @֩ @E9H(@@ ,@QtP ,@ @ PP @pFPM(@@r ,@ @pxcW p'@)qPOrPe tP xP O̠ ܸ@,@ @+T)P %` '@P ]& 0!pWC  ,@P _ R @j @O  @I @DZ TRP[ iP  EQ@arq ,@ ,@RIP GX0 @ ( @} L ,@P bX0 @   @0l!@ DCc (X@ P@++(  0PpWO(O @@r% 5 ?P {X0 @ s4 ,@P X0 @ d  @0l!@p( @ Z   ,@P ,@P X0 @ E @0l!@Q( @p5v0H-阐@ (@P @x& @ x| @ x @ x/ @ xvO-MMN @ @   @ ` @ \ @  !@♵h `(@p @,@`h ,@ыJ^P@ P LL" @,@@ l ,@ P ,P H ,@@ Q/R;D`e x P @,`@,p@  @(x   C  Q J^P@Be@P Q Q @ԌQ: h %`,@ @ pJ ؀ >@! @w @@ 0ᛕp2,J>P @wu u u3"@ @  pᙵ @`, 뙅 p @`" @$ @5 @ 08 J^P  ,@ g P Lka@QDh ,@   H   x  t @0 !@,P+'P %@J ,@ '@P 0$ @  0 뙵 @h ?P,@c DPPl  @PP ,P@P r @r@' "@P& *PJ. @&w@q !@PlPz @ wP[ @PV = ,@P ,@@@C  @P>> @# g @.3$ @ @( @ 0@, @0 @4 @8$ @<J @f @ @ @  @ @ @ @ @vO@ @aP] P[ P ,@P H ,@ @1K ,@PPD JN P P @ `P KP J^ `P @ %>@ h@hv) ! @0uP Plf o `\P` ,@P H ,@ @1 ,@PP Pl!@P , @P PP\0  P  @ v +  `Ph P@O  @PJPL (@u@< @6@4^  @P/ wP'v @P"P ,P@P) ; @ 0K@`@g  @rP T@Y !@fPr  uE8 @ 0(>M @J4e6 @, . @ 0$ؐ }`@ PP"  t @ 0sP` 뙕h V @,@c l@8 0@hV`T0 L XPPH@0P ` S` ^ P0T 0003S@ PH 10Y :/oHL2/oP`PT"X@P ,P@ "0$ 0S|@ QL LL4 Q0 Q  '  AlP 0@xQQT@t@p.PPx`xdpPm 㘶  ,@Q x @t d PQ A  QC PA   FPQ A  Q. P,   |P#* PtP*t@AP @PѸ ڰPt@TpPXtt @[噵h @P,@ @P:@D i@sO`@0` (ЍۍK-P P& ` p H ,`@,p@,@@QQ Q  0B01z P p p,@0 0 p0H-P @P  ,@Q H% , @0 A!2  ,@QP @ P0G-l!@`PP  @ P /P.. pPR* c Q 0/S/Q Q P/R@P7 ,I@ @ P  B0QS/SrpD0.S `FQ AP@@ET@EPP/Q@@c@ QA cPp #(@0 @pH- ,@iPl ,@P @*#Pph ,@҆A-@ R R hfE(@P `@ @!R"R'Rp?oQQ2 QQop2S !sR R R  \RpQ  " 0A-P@   pW  $,@( @`?0V`p`p 0`pW@ ,@ Q H ,@ @1 _ P* ^ R                P /= #  (@ @r @%A-MpH ,@B`) ' @P 0 ,@@(@P / @Q @XX @ 0porUPЍK-pM '@B@H ,@` 0! &P ,@iP ,@PF 㐐'@P ' @d`P`qY  0 1 ,@P,  (@ @X ,r$Z P p P  0" P  0 PYT@pЍ@-H  B,@9 '0@@0 1 P  R  T@O-MP ,P@(@P X0 @ [ Lu P,p@# @P *X0 @ JH P,@`A 1 0"   V@P ,@P8: 〜 X`<@P,@,@ @ P$ pL ,@E 0P V qP  $ppWP@U:ЍO- MH ,@PBa @T6P `PH @ pVPpp z `P PP P`PV W aJ  ,@P   (@`X @"qJP@0  P P PU8 ! t `   @ ! !       ;  (@,@ E @0pW  QG @@P * `V  "(@ @ pZu B  ,@pQ  ,@Pi L |,@@I Dppp @ p @@ (@X ,@pQ L |,@@I DPPP| NDFD@ @ P@ (@ XWD z  0d @ZN ,@pQ IP5 0 (@ @ >ppxy  ,@b @Z 04 @ZLI @pp\Zp ,@PP @ 0  @,@pQ> ?f  ,@(@ X @. C ,@ 0`$ @ 0 @ ,@pQ 6 (@ ,@X  @0o Ѝ0H-PL |,@@I D | NEAE@ | NDFD@  @ @0  @ @0O-M ,@P (@ X0} @ P ,@P4: 㰰 㗈(@X`@P,@ @PQP@U:H  E,@ 1 pW P P  EoqZ p ,@PU&  ` 㗈㵘(@X@,`@ @ @ pW PP  sP  oH1 p$PUЍH- ,@P   (@X0 @\ ,P@@T `p P $p$ `@TV ,@@TX P@/$@TO-M ,@,@RQ P  "(@X0  @MP  (@X0*  @B ,@ t P ,@,@P` Rf* ?,@O @ (@@ @P` U *pP  0=X  n %0&  pP  @% @  1>f @ 0Vn~ ,@P  ,@ R:ЍO-M ,@P  (@X0  @ ,@Y`P ,@PPkpM@`GP \pP P:P (@,P@0  P  *`mZ:gS*P* P Yq R0  RMHg `@ T *P}  O @m@ T$(P:P[ v Q@` p P`@   p P t*ЍG-MM` ]P,`@(P@ @P X0 @  +2@TP X0 @  P ,@P':P sP `pV  \@T@ `PU:ЍۍA- ,@P  (@X0  @P ,@P8j@P `@3P p RFP @pWP@U:H-P`ptP! @o"@/o"PPoR 1  @0|RPP F @ (@ @ lPO-cM@ ,@P  (@X0_  @*X p ,@,p@~*0 @ '@k` ,`@ rP '@@lY 0*'P@ @k§p @㾕먜 P,@ T( *0 @ '@k rP '@@ylM 0*'@@ @xkᗧp @㓕 P,@ p  ,p@ @P @$/   PJ⸬ (8,@ ,@ E`P` @@/0G  ,@,@0aS0+ $ C  4<D  娜 ,@p]ύJ`8 @h帬 (A,@,QX8HkPU" @ @ @D  ,@0P ,@ [eP TP:徫 ,@  @ P H  P 巕P"+ P,@ |T  (@! @k ,@P P '@SPcߍ2  @cߍOC '@ '@ @ @ @) ' @c @- ' @\O-CM@ ,@PP' UP`p㰐Y A ,@P y rZ px@T:cUa   㴀 (@X`,@,@ pP 0 ,@PP P `[:P-P  @ 0 P  @ 0 0SP  @jP  7 Z:P CߍH-, , @0S \P '@,A-@l 㼌 ,`@p \ ,@ P,P@ ڨ ,@ 0a9P  ppRp '@H-M @OP  ,@>  @ @ (@ 0@j h@- '@@.p ` ?P p@`6Ѐ@-@ ,@@   PO- MM`@P/0ㆹ ,@qW !  p0 01/ Ѝۍ0 01/P ) ! @ 0Vi 봬 ,@P _@P(@ l!@P Q @ jw@T , @P y @ jf@` 0T @ఐ`0 P @ i $ҿ 00 x 9`@ 0@T`p@-M@P` 0u@P `Fv <(@ @ i ?^e`V +HЍpO-MP ` 㰀 (@㰠,@Q +1P/Q!!R 0KS p@T !@P$ P ,@T:P  @ dipP  @Yi pP  @ 0pЍO- MM@XD/Q  !@3Pp@PC ӽ0 㴜 צ `PbA/,0@,@!@ !R`P/ # "  GaPoP pU P apP  PS3P @0 /P,0@p ЍۍH-P /0`@  ,@qW !  p@G@ @-@@CO-Mp ,@M(@@P  X0 @& 8` ,`@ rP X ,@, @0* '@ @g '@#PE  @I[ 0 @) .'@ @h묜 P,@ `0 P` h@@( p(@@  xPU T TCxP=P@@0T 4@  g@ $sxPiPZV P@N $  ,@PFZ  ,@P9p lP .h .x0ST Yn- @ @ 0 h 8 $0 @   { { ,@P h0t g !@t 0` wg@o  @'@L  (@0  @RTBǑЍP@ @g- @' @g[ ) @ 0ЍO3  @'@L%  @  @'@L  @ P 0  @ 0K-MMP@`/0p㲶 ,@P # "  @0P&p!p*ڴL ,@@ r@PT `,@ Tp{ p& P p0 KT  (@@ @ :g/P @0gЍۍ ,@ @ P (@@ gO @ ,@ @ P (@@ gO @gdp@-/0@P`& ,@P # " `Vp@-x '@#P M '@@0T '@#PI '@@0T@p@-`@ P P,@V*d ,@ ?` ,@P # " $@pp@-P` P ,@U: @0Kd ,@ ?᾵` ,@0P  " , $P 0@0#@$0$0 $  p1 @0p@G-M@P ,@PP/:d ,@P ?ᇵ` ,@qW!   $p P@`@`TV/VPW P pV pWPۍO-MP5 P,0@` Ѐd0 h@ ,@,0@,@@ `@p/@DX:? <P " $ U dh P,@ TK @ЍO-Mht (,p@@PT ,@@;`Pb @@@(@V($@@Q`(@A$P $ A BZP `/n  ` @( D  P  @Z 7( 'P ,@P%:d ,@ ?` ,@P " $ PP @2 @ @('@ QЍA-/@/}P PpPP `P  @PPO-MPF @ l q,@`P ,@b:@PP @  BT0aPU@ ЍOTH-`@p P ,@V:+ @0d ,@ ?-`  ,@,@`1Q$0A$@T ER P@! 8$@Tp@-@P  @+P P  @! P  @` " PP @ U U PUP` R & @Pl ,@ h$ P, @0@$0p R /R  R/T @@-@l ,@ @p@-@P`P5 @V  ` @/x`Pl ,@P `o pO-tM@ ,@PP  (@X0k @ ,@PtЍ@P>dP L  (@ @d @P ,@@`P @`8P p 0@ p@WP ,@P`[*P; H `  P* p |||| 0 Qd QH` \  Qh$Ql(@pWP ,@`P V *P`d ,@0 P`p D@`,p@0  0QD`VP ,@0`PX p ,@,p@ ,@@@ 0p0 `P8p@ _5L  (@ @^c @  tЍOVK-MP ,@(@P X0 @ ˿Ua  `p 4 L @5c" @_p #KD @$cN @x0p@<@Pp @ ᠐PJ0 p K @c @P ,@RQ0 rQE , @ `!P `@ Pw0 @vP  ,@0d ,@;` P,@ @ l!@0Ѝ` ,`@  X ,@,@ Q,@ O @Z Pe ,`@  (A d ,@0`p C,p@RqWqqq R( R*0pS`1pp100qSq1p10 0S11 0$0S11$0( 0 @ _0H-NPu  @@ @KP P@0H- @ ,@,@p6 Q,0@  M`e },`@(p@:prP Pt ,@@P)_n @P .@ @8 2/ 0`3?A6o5_7<ϿL " h0p P4آ2/3?70<` 06o؄ 89<`##,8|Ѐ0<i1xS6o7 5_02/ |i3?xS 8`0 @3\ @ @ @ 0@[q( @ 0V  0Q| ' ( Q P]`P0 @,0@TU B @ [* @ 0,/|&  @, @[Q U' 6 @ 㥏P9 ( P |v ,p@!K`@t ,@P | ,@ | ,@  p'@X|&  @, @i[x 0 ,@,0@P8 X. , @,Ѝۍ0 xV ,0@,P@@@ p ,@,@(P(@+ 44 S>Xu (,p@ `"p!p` ,`@@ p'`$p1 $0I@ @[X ,@'I @[ ,@P  X,@ Y @[h0 @ ヷ0 ,0@ @Z0 @ ,@,@@ ,@` V 0,@ X @Z(P- ,@P ,@Ps& @w o(P  PP(@xPEUH ,@b$ ,@QV  ,@-n`Z$ V ,@pG V@Q  t7@ 0@T0 @ ZTPG(@APEUʩ ,@P`P(@3PEUʛ '@P/At ,@Q $p@-n P ,`@,P@P QP  @ @Y@P% @I, @ @@P P@p ,@mO- M pF ,@,@@p|j ,`@Q 00ؠ x ,@(@P,@XQ0 U0SD W,@@ut ,@P   '@ Q [Xڦ R[  ,@Q 0l  @ n[Q[ Qz  pGW{P (@p  @0N ,@P P P  @ ,@ @P Y ,@ @ Y  @ 0+ ,@P @t Pu  t ,@P  P Z] '@? 8pR [+ ,@P 05  @ P1 P,@P ppF ,@@Q=. ,@Q 5 @UY+p& , @+ * ,@, @0 Ѝ %  @ ,@+թ%A @&YVO-M ,@4@0p $,PLPP(`P<8H`@0P@ @(p 0, 0D/pP  @  P`@ ~ ܀ ~ d ,@P  ^(@ @X X ,@Pg P,@P  Z?4p  Z @  @ @   0 @t ,@P  (@ @X X ,@P* ,@P zpn  Z P@  @ @   0@ Pd (@ @ 0\ '@P P   @  ,@P  $(@ @X MX ,@P E ,@P- p,@ ڼ 㠳 ,@,@PP@  ,@1/S ,P@ `& p% Ox# @ @ @ @|Z 0 ,@P [   ,@2/P p W(@X@ P@`0 WpW `,@PS @,P@P 8 ,@P @!@0  @C ,@@,@ .0  @ @ @P[ @,@P  ,@ `PU ^k8[k  Z 0| ,@P p-#@ 0 ,@P  (@ @X qW @ `c ,@P  $(@ @X \W ЍO `,@PL  5(@ @X JWD@@0 (@w @0 @ P j8j ,@PO  !@"@ Up@A?0 (@ @?0 (@ @ W @ l`Ѝ @ WU j8j ,@P p @@ 0ok ,@ @ 4p@-Md @,`@  ,@ P *P  ,@1+P ,@UP @ ,@P P,@P  (@P :L @ 0@ PVЍpO-,MMHA  ,@@A"A `Phpb @/TAP  @'n ,`@P A" PA 0"  p(@XP`P Q  '@ QHQ A (2/pA P '@P&Q A (2/pA q A"@9/pA"@9/pA  pAAA P0 pA OPPPA 0"p `PV |.Q A (2/pA"9/p@Q  ,@Q   @UQ Q f ERPNPA PP9 ,@P  ,@,@0)P @UP ,@P]  @,~ ,p@Py P P`+QH ,@ ,@hP ,ЍۍH-M# 0, @ Pʔ ,@ЍH.E ,@P  (@0? @,0@8URH- d @ ,`@,@PpW  @p  ,@åpH- E,@ @P  (@URO-EMⴰ ,@@P P (@ X @ TT  8(@A `Xp@@P PPz 0 TP  '@0`!' @TX X) X 0B  B   05<( @& 0B  B   0\( @ 0B  B   0K( @p ,@P m @TP } @ 㒈P  @ ㋈P P  @ 0 Yw:bX X& Xf ( @$X( X1 XV w( @/  *( @   @( @pP   ( @   %( @p ,@P t( @Y @  @TP  (@X  EߍU/p@-MP ,@@P  ,@ 0 ,@3/ ,@P ,@ cp Ѝp ,@@P`< (@ @ 0`SGQp@-M@ ,@P   ,@0 ,@3/ ,@P  ,@ 0Yp Ѝp ,@@P`i< (@ @ 0`SQH-HQ ` B ,P@,`@p @@PP p MH-M  (@  .TЍH Ѝ/a( ,@m}ۍ00H-@ (@P  @Rs @Rl @RP c @R P Z @RP Q @~R$P H. @uR}U*@Q @G  @jR W @eR( ,@j @0H p@-MP@P`P ``PPP @(D .>,@@  @ 0@`YQЍp0H-MP ,@@P pڴ ,@P  (@ @X 0Ѝ0HR: (@ @ 0 RЍ0@-@P : @O P Q @H @ ,@PLp ڴ ,@P q(@ @X @QԾ:0 (@ @ @Q@-@P  @ @ ,@Pp ڴ ,@P (@ @X @Qꢾx:0 (@ @ @QH-M`@PR ,@Pfpʅ[: (@ @.V ,@Phpڴ p,@P 6?  @ @V  (@ @X0PdQ @ U+: (@ @ 0RQpЍ MH-M  (@  R ,@P#@P ЍH Ѝ/ @PርN0H-P ,@P 0@p ڴ @,@P  l(@ @X Q 90 (@D @ Q0@-@P  @D @ ,@Pp ڴ ,@P (@ @X @Pн90 (@ @ @Pp@-Pe @,`@PU *PQP@ p0H-PP@:PQPU@u: @P0p@-P(H |,@@ID``` ׹0 @ `@  ̹@ @ @ P @ @ ᴹ| EE ᩹| EDP@ ឹ` @ @p0H-@PPP  (@ @ 7P0H  @,@0P 1A-@ N`u (@P@,p@ P̭Q A  Lzp` V Q A  =z P   nV yVG-MP4Ѐ 0@`p.P,@P/P 0 @ ^ @ 0Fp`@OYF 0 @ LtG @@0F @ "@@?  @ OF"@@  @ OF"@@  @ OF"@@  @ OF"@@  @ OF"@@  @ O @Ѝ @_A-M1g(l P,`@ p @㎭4 ,@P 8 ,@ !@@URP $8 P,@ gP| P@@P0 Q $0( @  qpW`Jpp_Q-QY0Q0x" @( ,@ J,l P,`@G*U;J *,@ Q% r  0p pp @  P@  0pPJP 0p p@ 0p 0pPЍ @XL @~P @~k @~H-0 @~A-BM`P@" @0M0 ,@ BߍH-P, ,@@p` $pWHS@-0L ,@@PP  @ @ H- MP"0@ @M@ PP ,| `,p@ EP`U ЍA- M`@" @0sM,\ ,P@p圷  _ !@ ЍAA-BM`@PYE@Q*RV  @ @@FQ0 ,@ APBލ@_PP Q@ @;@-XM@"0 @PM @ HXЍQC/Ap@-BM@""0 @M* @ 4BߍpA-MQ,| `P,p@@ tP Q `F@V @D @@ЍH-P  @Ze  (@3l3 @ 0@M#KO-LMPlc\ d| @P `@,@,p@ ,DcPRPSP TPn@Q紬     (   8 T ,@LP"P ,@fP dPH ,@X ,@h ,@` ,@l ,@L ,@pmH(@`~p t ,@,@h ,@P 7 !@  " $ 0)pw!@@2pFPE@TP Y@ QXd < < d < < d < < x L ,@P   S<% %$%(%`,%@0%p4%t X,@8  RZ VT WP+k @|L ,@P   pLЍ)P /P  P T ,@,@l< ,0@ 0   p ,@00 gP n눬 U,@tg `@p ` P``E@-P5 x ,@  \P @PX @,@P ,!@ @ @"@PX @,@P ,!@ @ @`F@PO0@3S `pBI瀳 \ ij ܳ \ p p  @ X p | \ Դ  \  \ \ \ \ H T ` l x pRG 0A@ S3 ȵ ܵ   ,@< 0 p@I @< 0Ip@` 0 Ip@ Q Q  ,@o|ypR < 0 pR  0pR  0|, , @LpR  0 pR  0   '@ 6 '@ 0 ,@ ,@ +pR  0  `,@f'pR  Z '@ ", , @G `8  ,@ @ ,@0 ,@8   ,@  ,@(  ,@@L  \ ,@@`,P@,@P0``` \ S,P@`   Py!`Wxtg `@ ``x ,@% aQ% ,@| ,@PQ! Qo/op0" 0Wp,@`$p pPP@廷P aT gTb cT/ x , @,@P (,@P  PI ,@ / (@AP @R px ,@ `Q  PQU1AаU0u QU  x ,@Px$ `x@@Ppp l ,@P ` p,@P @x ,@Pp  @P @@ ۚl ,@P ` ,@P @x ,@Pt\ ,P@( @P @@ ẚl t\ ,@,P@P ` ,@P( @x ,@ , @P @@ ᚚl ,@P ` ,@P, @x ,@ 4 @P @@ |l ,@P ` ,@P4 @{x ,@  0 @P @@ ^l ,@P ` ,@P0 @]` l ,@,@ `KQ` Px ,@P -( @`P@`XX X J H p,@@P  pp7P lP `7P PG @P`-h  @ :` @T @*2J  @M3P ,@P nCp@P ,@P p@P <P RfgPD X ,@P?%PN)* @! @P 0  !@HP >  @HX3$ ,@P TU 7U UG @$N @qH 5H : @T @1  @bH $$$($,$0$4 $8 $ `p@#p "@x @x @x& @x 0H-Q @'P@P Q 'P@TPP0 O-4Mt p,@ㄬ `P,@@P,Pu,0!  `00 P BP $P兝p0P P P00 sp0l ,@P  @P 5  @G0pPz U^*` P, R  PyPH ,@P `V:@x  p(7P 2QHX ,@ PP QT ,@ /  @G0T ,@ @P     @tG !@$#P 7P PG @: @T @0J  @p4Ѝh  @ @wf@w @w"O-\MM@l ,@P Q ,@ 0 x @  @  @\ЍۍOG  @G  @G@Pl l l l l @ l @ @ @ @ @ @ @ @ L @ @ @ 8 8 8 0  @F\P$ @Tk (@X`(  @F(s p@ Bk1  @F  5k x@  @F3! 0@\P/i<% @P @0P k (@X  !  @FQ3 Q5  @0 t' @ @F\P$ @j (@X\Ѝۍ  @~FdAP  L `   @'  @jFa @fF] @bF  @ $  @ ?  @ @UF 1  @PF Q0 @\ЍۍO8tj@Q:g@P3;89 :0?@ABDPE @Xv  @$P(p4FjP8   @F \ЍۍOEL  @E D  @E O-DMMQ `  @PE@% @PMj}(p@X`P@`XX  Fp5 0W 0W a z0BR000`p Wh T\ `u A,@,P@!p@ aVC [X Z Z/C^hX~jtT\  p@,P@Ĭ4K `u 0 .!p@A~hXbT\ `u  !p@,P@㨬  .0j$0 . @E eE [M(@@`P@`XX X aFX⎣DЍۍO-M@ ,@p` V'@` `x ,@  GQ  W W` `* @`@P; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P  "Pp p P@ P:2WW``/ G* Y /ちP3 W1` ,@P p"`W ,@0`Up @`Ѝp 0  zЍOA/`P W ,@P ᯅpiP YFP  ᘕ J`P9`W  >K  @*Z @ tp@-@`P ,@ Rx ,@!PU e0 Eoph @tZ @ tH-x P,@0000 P<P<OP<P<3?>0 0ASR   7S86S80 S :S40 S44 ? O00H-P@U U I  @F  @C0  @ C (@X0HݡO-dM p4"0<0(8P, $$0pp<P 9P <0$ p<@ @Tn@ p@Q^WyQZY W y'@Q  '@{k> @ w @ 0@ U @BC xp2 0`CS`0``p01 P@pP% H0 ``bD 0`\n @ @ C-( @`P@`XX X D@ T: @7dЍ @esas= @\sH-Mw @ k> @ U @ 0@  BЍP P Q  @} @ @=@B @B0H-P@Q  _0t @ 0HBj @0HB @ 0HBp@-M@ ,@PQo ,`@ [P  .,@EP  ,@,ͨP `V VO* ,@@,㻨Ѝp@q.,@ @,@0 B,@Ѝp@-M@T T Ѝ@Uq.,@ @,@0A,@ЍH-(M0 @ 000S  Q: @&B(Ѝp@-MP  P @P.ўP  `,@9P@TH@*O @@P,P@,GЍp@-Q R  RR@~E@E R@0.,@@ @Ap@-,@Q @>  A 0@.@R$B@@@@@P`@ BU:,@p0H-M@Q P5_5Uo P`P4O T PQ U ʝ.P$<,@ @$* @,,@ܧUPT.$<,@ @TT$<Uʿ.!,@ @t %.,@ @A,@Ѝ0H-M00ЍH-M  0ЍO-M`P!,O@ @@Pp-Q#P P PZPP@GQ *O @@P(PP@Ѝp@@-M@ 0 0 0?=  0@ Ѝ@nO- MP@XPXo㤒㴲r㼂 `@,@,@,p@,@ "8b@Q! P @ P 0 P | P P P P P ` P p P P P P ( P P /@,@DP*,@,@,@,@,@,@,@* @ qp H(@P2,0@,@0 SQR2 ,0@ 2,0@0S 2,0@0S  @ SQ ,@"@ = @R @ B !&  @)PB&, @000&, @@T' n @カPP {,@` #pGW:PV `@` k`@T ,@,@ ,@w @_ P[ +P=(@ `v>A,p@@0,@.0 @@=iFP,@@CP, @ ,@PLHPH pMD @(=t@(p@PpQJ :PᩩP@PP  @0 >-Pᓩ@ Pz4 l  l l l l  Qk@R@>n#@ )vS @?=b,`@@s(@PF  PP Q UP:P@Q ,@<d TO !@@!@ !@!@g.&, @ r v,p@Pq @oH-W  (@9 @?/=pC-FP,@@ЀKx2ЀP Po@H `@ @ @X`@T @ 0㫨P IᗝEUPKpP劝`0H-g@ @@iZ P@ᆝოဝ}m/P0Ht" @@,@_-  ]!@ R,P@ᐨ 0HG-MM`,@Pv,p@Q W@ 0 @ 0@@>@YP @,@ t0 pp @ @  @ ?YV,@- @>%V0 @ 0@':<V v<&8 0@ @0*> W <! @^ @ 0[,@ R ,@0Q,@:RPP @grjZ@brٜЍۍp@-XMbR,`@,P@P ! @P,@Q - @$ @# @P ~,@ @0,@z'㡜 @:,@P @2,@P  @m/"PJ @@. @ @/x @PQ !P @ @ A,@ @ @@@ Q @ Cj#,@ @Q @,@Q @,@Q @,@Qr@,@QS@ ", @ R g @  P @ &P @#H-,@Pg @q;H-,@oQH-% @ )O-DMc x㘳 㜣 @P `@/p@'@'@ o4h@ Q p HPXH(@EQHQ@ RP PX& 7,P@! @0@ <9p3  P@ $#, G{p&yB phP* C HpX  qPP@ Dj @ 7m @2m$ @-m/ @(m @#mH-$U  (@D @4=:O-DMP@Sf$y ( `@,@,@,p@,@,@ 3`P a@P 8 ( H AP( MP,,@% ,@",@ '@ @ )/@, @,@pH(@PP~ ,@,@pQt ),@9, @,0@ ` E XVp,@pP  (@'@X0 ,@, ,@+PQ PW " 0@q>V) . @<P@ 4), @0@%P 4ip,`@P   0pPSf X X ap@ pGW8 ,@@T@DЍ  @l j,@ @ lH-(MT m @Z$/P3 @d 0@ @ @ (@3 @ 0@  <9O-TMM (Zp2 PP/ ,,@,@e  ,@P`& @<,@:Z ,@PT T @,@:U`V 8 <(0 T < ,@,@6/>PKQ:   x  ( 8`  8@,@T P 4@1P `p@0   p   P@`pP<T, @,@, @V:KP  !@0 t } @@D:# @<:, @ g @n @s @z @ @*:@ @%: 〿P,@@p@pLt,@@ @,㋐ @,㆐v @"p@ppP \,P@,z @,uv @"p@< \,P@,i @,dv@"p@  \,P@,Y @,Tv@@"p@  \,P@,G @,B v@@"p@  \,P@,5 @,0 v@@"p@  \,P@,# @,v@@"p@  \,P@, @, v@@"p@  \,P@,A @, v@@"p@  \,P@, @, v@@"p@  \,P@,ۏ @,֏v@@"p@ \,P@,ɏS!@,ďv@@"p@T @PS' @ 08L,@@,ᰏ,㬏, @, @ -9HQ  @'9( @#9 8X(@ 8E>@@@塎py <@ ,@ 0L8`@@(p E>PP PP匎pP P4<,@  Pm8P@ (E>@@@xpP <@ ,@ 0#@P8(G E>   dp< P$< ,@0I(@ 8E>@@@Sp+ <@ ,@ 0@a0 @8PYW_ 8 ` 1 PP_P @E> (pY: R'@<) @, @91@@J@T) :&4\924,,@pPp i,`@8( !   QQ 0"  4p`@W:0,TЍۍ ,,@,@  ,@PA @@0$  ^.8p<P A pW:<(Q P 40 40P $  F40 $<X 0 S-c!< ,@ @6O-MMp, `,@=㰔P @TT?QD@ @ㄎP '@.QQ^ `0iS ,`@'P@P  '@ < c$ ,@$P X 0Ἂp. $ T` p,@P (@ 00@R   00 S ,@P% V+$ 0XLPI   ,@PATPj =D@ 㨝PK@=PPE=P ,@@P X``7(pPP\T @ A A,\XTTTT$P@PJ P` = P  @tQP W ,ۓP @@ @@P p@  !@7PM R @1P`  "@+Pc % @%P @ !@P  @PTt hBQ0  8 T T T T T @ H T h T T P T X ` aRp ppUTY8 `P% P")PP~PQ`y @T9L @㿡P] #@㹡PY  @㳡PW @㭡PU  @㧡PQ  @㡡PM T aQ PP7 R2T`ӣ PP P@ãPUT\PP ` ZQV`qr@ UPX@ =PPR=P ,@@P (PP <9 At,0@ @ AXcX p X`Xɜ Xp0 `\0X0X ``p    ,@,@jX@P^, @!\0X  X07 @ Pm =PPh =P =` bP  ,@PP =X(@PP  A <9 Bc,0@ B    ᎈp  X`XY 0 AXXP\4`0 `p `Pw< @,@( P& pW X0$ FT,@  7/ @ЍۍO I ,@@XP0PPЍۍFP $P p PTTT噢P &PX`p\ "P\ y#@/P P?  @$P. d @+o @,@X$ 0Z $`属@PXU-P+  @bUK!  @O @0Po  @ =Q Q Q ]TPdR:"X PV pXX0 0"p <X4,@ ! 0l @ < Z,@ @G  ,@,@?y< #@,@h48,'  @ < @,@`40 ,@,Y @QW V 6 @VQ `@ @+p Zp y P.@@XѯP sP< P; c  <9 ( ,0@ q %Y P QKOu?( X Ĕ<,@UPQ`0 `]p   ,@,@g@P, @! @J@  @qR/ @!@ 0 @P    X`(pQ'@  X`(pQ'@ QQ / Q @@ C @DT QTQTQ4T1Qz @ @ AP   X l ` PP P a @ X=Јp P/ P P P1 0 ᲁp)  ,@P '@  !@, `V  t]p@ @ P@2 p, ` p @V: +Ѝt @b\0H-(MP8@ 0mp P,$ (,@,@  0 ,@P  @+  : @@ 1+S*A;B++ ++(Ѝ0 @ \O-$MM ,@@PP? T9 CP `@r"@P+ PV@p"P@ tpl Wo QlPp*`!pPP`@H 0ހp V ,@P?($y,@,p@L V00 *9o(@ 0V  V   *0 @0  $Ѝٍ苘"PW @P @ _[j- @ @a[A- My@,p@`PPV #  @ P \  R PMP  @ YP^(``8 0`6p V ,@PC$Y(y,P@V,p@Q<Q  0oM+1  "-  @ 0V PP  0n!!-  @ 0 ЍH-(@  0 @000@0@0^S @CSG-M`Pp@ @@`0 T  0P Lp @`VTt @ZB@P Ѝ @- @wZ @O-dM`@PP ِT5 q㴄p @(@ |_. J @0)0  )  00 .[< P 㩐pT P d @dЍO)0H-P @P8PU04P 4`P8U:WXP0P4PQ8P:NXP00 ,@Q8 ,@/  <)'@, @ @O-MMP`A@ @㧔Ps؝  @M p@,@,@@/@ TP0U@%Px; = = = = = = = = = = = L< = ; d< = < ; $< = = ; ; |< < = < ; = = < = = = = = 4< PAP DPcPP@Pw PoPi ,@P` PZPT ,@,@[,@~ ,@z,@P9l !@Pn ,@j ,@fP'`p"pW H(@ FP P:  ,@W`,@V ,@P ,@P 2X WW@ƓP  @P l !@㺓PWGPAh> x? A ? A A A ? ,@PtOWڀWS  Wb  WH pU!@@ P@RPy `ᏓP ናP  @V( WD @W -,@, @0 00  FWp  A,@ pf A FP1j @ X ,@P-OQ ,@ -,@, @0 00  ]=  p @ %P)& ra @)  @'*>w@ @'T 0 & P$  @' %K-d} @P`@,p@/@ tPPHaPp-H(@E Q% Q"mP@A,`@eP( P@:%Q@T @㼒P  @㶒P?@ (@P' @(D @ (%0H-?@ (@PR @' @ ' @ ' @ ' @ ' @ '  @ ', @ 'S @ 'I%H-MM@P  EP/  P*J Z @\  @Um},`@,p@PP 9P `,@P   `pj @ `Ѝۍ%0H-M@  DP P,@P   ,@ pj @ Pۍ0O-mMM @ @0@@YPw @0@ KP  !@BP P`堐 ;Kp |L  Wp @ $PM P*iP @x| L >ppe D 5PoPl @P$V&7a" @0@P&X ,@P $u p@_P Pu p@>p G&@T:>P2 @hP& p7! @0@%P ,@$uP p@ > &$аX:PuP p@ pP N !@PPP mߍۍO-MMPP#` (@jƈ p P@ @!@ @ CPS pDPY J PE pPY  ps @~P  ,@} @qP ` ,@P @ːP ,WP p@ =,p8  P @or3 ( O`P =[ P Y +`5! @ 0@ %P  @W @Qt/5! @ 0@P$p ,@`V @qo @io j@ @/ Y @`= V  @ 0"%+`= V P @ %  @0%j@ @[ p @  @0%j@ @P /P @ @$PP ""@?U@-@ ,@P< @P   p 4= @ $ @_ O-M-XMp`4 @lP$P,pTP4 p  ^p2U   @ @V 4PV V ʏT@ @t @㷷ԏT@ @ޏT @@4P P 㦍Tt@ @P4@oT ` R%Y P@ `"VB^@D`1T `  @ @@0|P @ 'P@  @ @P+$4P Y $p ,pŋ0 @( WP0@R 80P<F tw;O p@$0@P@ @@p $;Jp0@p H0E@$;p@px O@04 @#> J @  ` #<( 804P0@,p6T ?k@0  @#pT@_ 0Z0 H 0@,p4PN  0 @ ` # <( 80IBYn@0 P) $;p$Pb tgJ@ P `@`P@0@p $;O`P@$@p UJO @]# Y@$PR SP POt; @ @p$?p J;$ ?p  G@Ep;$?p J@0 @ pZT@_ 0Ὄ` 0ᵌ g @0pᤫTP9 tO`@ @ 0 @?p $;J @?pu  G$;E?pf ~O @J E0W@TbL=@VegGT`@ 0b  0\P 0T 0  @*DTPpſ 0A 09 01J@0  @z  ` ( @s" '@XЍЍJ@Rf@R @R Y@O-MM i@Pp `@,@ vfPpp RPwH(@Pp !Rh P`p @Pb  @C hP AP  bP@j 6  P  P P@@ GP' <=) @!tP @MpoP G  @Q;pj @ R#  @  Ѝۍj @4RH-5:  (@R @E"O-M,@`@PT ,@ ~,p@JP,@ @pPȬ `~AU U ` B⻌P  ⴌP H pGX @'pЍP`,@@ pP,@@ ~B.,p@8?Pj . @, @Qp@-P P P' (-@+ @- @! 5t . f1iF @P! @!0@-`@!@@!0*  @Ss @_ -@pp@0H-@t f @P!@LP PQ -@ @ ! -@ RPq  @'f  @'P0 -@ F -@ -@0H-[ @-P@T@T e-@-`@pt  @T QJ @ 7QT X -@P f X, @- @&q  @&Pp@P y  @H-(5 -@P f!@H-5 -@P  @tH-5 -@H-P -@4, @- @!4 -@H-P -@, @- @!4 -@H-P -@+ @- @ 4 -@H-AM@P = hFPU P -@3 -0@# 0DP?o- @ |2 p@`\  @ pTR 0 8  aV @0pU0R0z&$T T +  @BP P +  @AP PP o4 -@AލO-tMⴴ@R(@1 Q+ p` S@ Q T@:R @ @R `t(p@ A` R @S+ # - @0S Q: 0Q c @-`@S 0pW Q P CPQP* @\A P  @ A 0S9 c P,-`@P$P \P P ,1Q:pS `P`P0S1 AQ0SPUPQ0pS`P' ,- @ `iZQ]\Qr [Q|$PPp 0P 1@P,P ]Pj  $P Pp+Q\QP$Q 0 0P 1@PP PQpU pWڅ,Q]Q? Qw P FPyPU PQmP$QP000 0P, R7  QTQ  FQJQH  FPD upE \P P3 ]PpPp1@P P!pR pW"  R  QP!PR PU -@ @P +㱄 tЍO-M-HMMP@D P,D @G@Px  -@@@ @;,@32P@k  -@Pg @@ CP: 8{㔣 |U @`-p@-@-P@ @ @PP -@@= -@P8 @]P2  0-@   -@  0V-@o00Q Q$ -@P -@P @`/P` -@@ 'C`PI2 -@DP8-@P PxeC @P-`@-@@Pl  Š 0Ꮚ@ϊ ;PP c -`@PP Q RK  -@P> @P9  0 |-@3 -0@op0Q00 W| @ p@# -@P -@P @|%- @PP -@|-@PQP=xe-`@Q -@PL @ PF @ -@ 0   C @3 -0@ |-@p0Ro0W|0  p@ @# -@P! -@P @|%- @[Pxe -`@-@P|-@@ "  @7T=DPQ5 u: -@HЍۍЍH-Y: -@P -@ P @,@0A-鰄 -@Q-@Q |uLS-p@-P@@`P@`O- MMP|-@@Pn L-@Pi*v-@`Q p@8p` @ 0"z 0(@+~AP J⬤(@?P  @ 08 @ 0z  (@+0]APZ $-@@0@I @$oPaP nP@pP qP @-@@g @L@-@@Y @ |%- @| @j Ѝۍp# - @  ><X# 0@ @0 G-KMp@P7`0BPO  P -@-@# - @Q0 DP/oS0B 0 @W[ -@ P3 W7pEpHT T + @=P P + @=P PP =0 -@@8 /-@ 0A  @x@.PZB r, @ R @*Qp# - @ VTq  @ 0"*p @-@@@>KލQ @,@p# - @  ><% 0@ @0 HO-MMP P v, @\=P p# D - @-@@  @うP -@ P  @8P,@4/Plz-p@ P@P 8k\ -`@-P@pPPqPn BP#  dPc  -@P0 -@  -@  P ፺P Q @ -@ @ }=p# - @|%pc - @-`@ pZp/o 0"  @ >< 0@ 0q  @d) -@zQ-p@`\ -P@P |-@ P|-@ ?P,8/ -@Ѝۍ /-@ 0A  @wK-AMP2@. @/P- `P!@ рp +-@0Ѐ``j? >| p@@pPJP  0`<+0T?pD .  -@ @ -@Aލ)&y @@P/H-P -@,< @ @ 0@. -@p@-P@P Po`y@cP ) @]P .pUpP )y1-@ @0@0 @ pH-P#<- @ 0@ -@H-P -@P -@  @H^. -@H- *4=- @ 0@ -@H-P P( )F-@ @@/oQ" y@@'`yA@@PP )v p@P {BP4ڀ  -@ -@ .% -@ -@@Yd-P@ @ $C -@@P z-@ @  @㸾P -@  -@  -@C @H-%=- @ 0@= -@H-$*=- @ 0@3 -@@-E=-@@ 0@ (# - @Q -@H-|%=- @ 0@ -@H-MP PyeP-p@-`@ oP* )F @@/-I@Py@iP )F @@bP=Pt-@C,@@,^@@T P yA@@ -@t%+>- @p 0@W 0 @ } 6-@ 0  @u -@ЍH-x%2>- @ 0@ -@H-%;>- @ 0@ -@p@-P PiP-`@P@y@P ) @P yA0p  -@W @5- o200)S- @P SP-@)y! @ @0 q @QÜ -@pH-MP2 P0P. @ i:P'  @P -@}Q-@P -@ @㉽ @iP -@ | -@  -@, -@Ѝ0H-S -P@P  P, -@G>P0@Hp n= -@0 -@P , @- @ 0H, @$ @ u0HH-MP PP+ @ 9P  @P| -@b, -@ЍO- MPZ Pv, @9PQ d -`@P @PS5,@+PP =P4 O|p @@-@-@P! P P P| -@PP pPpP <pP 5P+ -@ ЍH-MP) P%/ @ i9P P// @ _9P P7 @rP? @kP | -@P + -@ЍG-Mp`pJoR@ @gP We y @_3P @@ -@PC WR t @WCn @;p`pZ @T2PPPQP@@=<|` K} V =`P,  @=P& 50@  y%V ЍGG-@ @0, ЍGsW`pD+ -@Ѝ -@O-$MP Pv,  @8P P+  @8Px @@n @́P|Po @@밄 -@PP @4@,@y*P @P@ 8O3UXc-@ @@@P@ `@p @[0P- 0 ! Sp0p [0$P-@Q |%- @`P|-@`Xc -@ `@P 3P * -@$Ѝ?<P  @mPA-MMP @3PreP `P@M*P3v @t* -@ЍۍPAPUr3 @KwATP!P@/PቑP+,| -@P i-`@P @   T ` b"-@0 @#d d @\ -@p@-MP  P/  @7 @P: * -@Ѝp @`P  P @G>PPP@$P @@NT|T P @->PPP P  @s@6<|`T @oP  @  @]!'|8 -@8 -@ @g0H-C -@@P P -@-P@PP<P I-@ @- @00H)#-@ @0% 0Hr0H-C -@@P\ -P@PD:P _-@, @- @00He)-@ @0$ 0HqH-MP+ P)Pt  @ 6P  @P -@}Q-@P -@ @ @P| -@)) -@ЍH-MP+ P)Pt  @ 6P  @P -@}Q-@P -@ @㶹 @P| -@( -@ЍH-M P P  @ ]6P t @( -@ЍK-M@P +zUҎ pE` !@ +jV +j`Uj  @KP| -@ۍH-M P P  @ 6P  @( -@ЍH-MP P# @ 5P P+ @ 5P P @P ^( -@Ѝ0H-P E -@@PP - @ I( -@08 @P00H- @R:9( -@0E -@@PP F @P @P00H-P E -@@PP ] @ ( -@0b @P0@-PQ ( -@8K-@@P  &P H-PQ ' -@8 -@Pj @wH7H-i@-M P  PP@ ' -@o @ <@P@  @R}zЍH-h-@0 -@Pl&8  -@-@Pb&,@'K-MP P! @5P +-P p  -@x @1r'0 -@ @)p P ,@&P |  @k0@(& 8-@P P -@ @&U0 -@ @ -@ЍHS-P@@zP `|@ cP xP@ 2/ -@P% 0H-# 1- @ 0@b -@H- *1- @ 0@X -@0H-P PPU C -@-@@ @㥷 -@0& -@0 3 -@@ -0@  -@ x U-@0 0Hx0H-MPH P C -@-@@ @p -@<P3" @ ,4P. P+ʜ `S -@-P@# - @ n@ -@P  P  @n@+ -@\x P  -@+TxP x& -@Ѝ0p@-P P%)V-@5 P@-0@/oQ" y@ P@/`yA@@!P )V P@P l !@P F&"-@)V-@ P@ -@@-@P-@ -@ @ 0:-@ -@pH-%?2- @ 0@ R0%- @i -@-@H-%Q2- @ 0@ R0%- @V -@-@A-鐅P-@?2% 0@- @P@0@s -p@Q2%-@` 0@Q`0- @/-@`H-# c2- @ 0@$ -@H-# p2- @ 0@ -@O-MPPR@Pڲ%Ѝ`p !@tP !@nP  "@hP`U 9PJ`U 9P..u-p@ U-@-@`T P  -@-@0-@y! @) @S  @r U-@-@`T P  -@-@0-@y! @) @S  @PE. B.H- o -@H-P#  @P -@}Q -@P -@ @ε' @P -@ | -@  -@% -@p@-MP P@ -@ Q pS iP-P@-`@! QJ R  , @$ -@ЍpA -@ @0/ Ѝp@fm@0  e @ Ѝp@J @Ѝp@r0H-P E-@@P @LP0$ -@0G-MP< <Pp 0@q  @pP/" -@Ѝ0H-P&P@ @P !@P  @PPPP7p 0P   -@ @" -@0 -@0-@ 0-@0 @A-M✃ -@  RP '@0S twYE` p@-P@ @@ Q0`SЍA~" ЍH-@`p'P PP 20-@0PT  -@ @ Hm  -@ @ Hep@-c @-`@P'P PP ~  -@7 @Kpp@0"  -@ @p@>0H-P -@P E-@@Pu @P0" -@0H-@ @0, 0Hj0H- @R:" -@0, - @ R E -@@PP  @ z-@ @0, 0Hj @P00H- R, - @ R E0-@@ PP  @h! -@0-@ @0, 0HTj  @SP0O-$MMPQ !*P#  @/P < -@`VT p-P@@ XsP pPVpW -@  @  -@$ЍٍH-@)Fs -@tP(p@ AY I @HC-@@p$Q \Q Q@  00iRUH-@ A)sv@ P 0 0@  AQ`H#- @ B)rrv@& -@&P @p  -@x @ -@ @ P 8 -@P -@ @㝱 -@ Yy-@P iH-`@-@剱P @   Z ` r-@`H-@ 2/P-@PPH-@)|r0& H-@-@ -@ @P  P ! [ PUO- MP@4 -@P 8 -@P ~P8 @n) @j)P 8 -@Pp c Ѝ㠅:,@-@`-@P hP `PpW n @vP|P PP X`p@-MP @ @/P  @ (P  @TP ` @ P U PP 0PЍpD @&PPЍp@=  @ P F @0;G- M p` @ qp'0 u P/P:P# 1p P P  ЍPP C p`-@@@cP)`PXtp pJ0 Yq !@ a "@ Nq /p塆P p/ P :㕆P p`// PPp{ -@@cPP  @ PO-M-^M@p|xppptppppTpppp$,@p|pxxplphpwdpp0pp pp렵P-@ p (p  (|p |(xp x (P: 7<xp 0D @  p xR/|dN/hJ/Px(UlpP'PQTPQUi UQ 0/ PI Rtp t叨PP 1/PP x* d( ; 9 P P P P ^ލЍ @EP  @O/㡅P..PPP6Ih 0-@؀0p# 0-@pP- @`P\0X0 ^Pp# - @P| u)-@ @ . @ 6P" 5rP@hs -p@ \XpS -P@ 5  poqYڐ-@P Y -P@ @ p -@   @  @㴮 -@ P `L@QpQ P  @&x @&J-@@Q+ u,@,p@Q P ,@.%-@|@- @p |&|$P@P&  ,@6PA v wpeV6 v"P5 W3J@ Q;Q @ qQ Qn@1tP&W) p@eP-`@P j n ,@R ?,@0  R (` U/? (`-@(-@` R 0 u,p@  S 썢Ρ0 A5P ` P 0( 0 pWp  ᨦp v#PP   ᜦX` P-@ -@P -@㰕-@-@P ,P P P'@f,P  -@ 堵-@R 0ES 2 H0ppT0(5,0@@0P} `#p @P  P  p  R `@4 #p0 P0% - @P @ @@BnPPR@@$  ᅧj/5u0SeG/ rP@DW  qj/e5 FuSPP U*p @4P  Pᠵ`-@`@ u-@,p@P  ,@5P n@rPV P`P @6  @  @(Vx,P@,m -@PPeQP\ P^D @Y @Q  @9렵-@n @rP |P  %@k"PN 8@p -@  0 %0&   P 0 '0*h# - @`0 P& #   P -@P  -@ 0  @VdY|  @N @"| )-@ @Q PP'Pn/0 pP Ep-@Px|` C0uTpp55505w?PL@T Ptc(e @xPD"P R +`pn"@P  vn_"p@:$P!  ᄂP j 堵-@Q Q(P pZ:$ AY{P6 PPxpkWܥZ^ Abbj_ @-@!`@ v   00 0p@ គP  l lPP z-@ @ 0 p0 Po2 1p tm[.k? @y%p ᳤  @ Z 0a  @ `* `P U堵L@-@U p#mP UU pmP P tatp;0 @#Z-P@|Q<#t> @v2T4#P<}#-@-@P  @ PP -@PF x0 , @ @u; x| @  @1x @1 @1 -@P \` `@ p1Ppc -`@   @ 0 @t1 E @;   @d1d -@P l=- 0@ @QR1 l @ `@PfP  @E1,< @ @ 0@<1똀z p@PYp`Q`U -@P  @  @ 1 PV @ P-@P  @ P @ 1PU-@P @on@0x1p `"{ `P'p@g* @j?pPH@@@ P9 P B  @"u aP pn qQ% $( @ @p  0 P 0 y (@XsA0  Pi)Hp n?@.pP1 0P  `N-@P P Q)P Q)< -@PUd C^-`@ P@poP `pWGP% @ PQ] @P[l @Pjv @P y @Ph  @ @P @P  @P '@n? <P b h# Q- @J 04P 0P ` }@P} *Q. p P00Hj 0ϊ Êc+Pp Pkj\Xf(0  0`c @Pm Rj ^`QFJpP-Q@j O 0QJ0PpP @/P/ *R` j 10`QfJPp -@ 0` 4HpPP Pw(00`4   '@@ <Pn? P 0p P `   0P\ 0 (0)' *h# - @ X @@P @PV QPT P p -@P  @x-P x`%_P   @v @ j>0 @  po PPPH  @:j_8K@Pq m 4pP @WP8 @  @+  @(hp ,@ " F @<  @H-@ @)i -@H-@u. L @t5 !  @C  @꠵-@ pS -@-P@P< -@P7 P 3%- @ P  @P  P #P @  P8Q Qp -@   00 .P c  @`X:\0@ R  ! jO`ҡnύX \0L1/`pX@)p @ pP ph 0-@ S  @ 0R=,@Q c @W  00P8 -@1R>P 4 -@ @ 4px0 L-8aV P  !@mP& h G  00/DP" D` @  #9P 4 -@ @R4px!  00PE @: @`  004P6p  00_ 0p Z P P 00I 0D 0pD4 @ 0 @0  04PD`p@@ P0 HV U ` ᠵ PW-@ W W%x | @ p  04PD`KPP W *: @ @ 0@^O-LMM@P @ 0P(P,PPPRPuP  %@P]P 9-0@ , %P:]P %PD (0 @Pp ,P P PP+ @UP( LЍۍ`P@VB P@P= /d| PQ' P/ P(PQ ;R|P P @P.  @P5 $ @P3 Y @ 4P !@ f `PQ  @x-@P! P P``U P y @WPTP y @ W`P``y `8k-p@-`@@@P @8+ f P8@<( @DE-@@p8!pP P,0 c"P X `X8qA"! @P  @O>8V`U0 [.'N | 8p"@@-@ `P /\P``{ P P +:f@  @pU t !@ Mj  @HP~| -@0{ 0-p@P j-`@QX],P@Q \},p@P J{ -p@$p $ `-@P  -@R |  @>@Q *4/u-p@ `P4000S\-0, @0 phP P ` @vPY#`-P@4 4R0B0 p"p W w9SZ!  Q @P  P `U -@ 0!0@+0 @P  P  0P @  P w P  pq nZ$ ` V  @P  P> #P @  d ` F4@  @0 `@ d P  @,P ,41/40!0$#"2 @ @ 0@+tA-Mq|` p@ P#bP p   -@ , @ @Q  -@pW   -@-@ pPpQpK -@@P F @PB 8 -@PB P X @,@PP,@ P< ` P,@ P, @(Lq,@@@ @ajP-`@ Q PQP  Z-P@Pg \ g -@ @㰛 -@ @㩛  -@8 @ps -p@   0 @xP9t!@ qP2T   0 @`Pt!@ YPLH`,@@ |  u -@ @ 0`G f AP@ o^ P P; oQ `Q-P@P -@ " P p @P -@@P. , P -@ cЍt!@ P t!@ PP P `-@@-hMh-@@)H,@@| -@  -@@rP sP; @2 @@d [c @d L -@P` ,@ A @%O-M-KM℥8x-@pN圵,p@P,@@-@ g @pI-@ 0 Pp8-@-@P= -@P8 㐕-@T-@ P@pPW`Wp VP  (-@% @- @P@  -@P @ P -@ @Q @-V -@FT P@'Q  P"F @ )P  @ )P'  @ )PP -@dP @ P* @-@P 08x,p@$P-@`Po g Dp  KpQ 0 p p -@ 0 T Tϊ p T p @=P PW-@PC -@P> d 4`3 B  S rpP, e-@-`@S `30PP @uUP Z8 -@P (-@% @- @8 -@PZ Z -@P  0`A- @PPI8 -@P? Xp``PP -@K @OP# @@@@' @ @@P0 @` @DU $ @-@@@KލЍP> -@P? @ P< -@ @ -@P @ P -@ @PdX l0 X 8 p`PF.\0,@ @_3 P@`P\PXP -@b @dl  00X  A0,@ @pp>3Pl$!(p4,@td,d(hPxt$ 0 P3?( SB -@ @㞘s -@ @FS d000mX ,@ @3x @QST QU QV Q -@%@X@T -@S @(,@ `0 C p^,P@0p-@P<l$!p4Ptd,dh(xt$(,@0 3?( PO-LM✅-@-@Q LЍO @<pH P 5pA (Pb (-@@m, PP<@b`A(, M 00S( 0B 0@SCC?7 /Fp B`P >`#P D @_P e @@LЍ8 ,@ <Pp@< p`P `#P   ܐp PԐ PƐp =P0 ב @@ @O-LMpp`Pt娥ǿ@[ǿS-@0PW 0ȑ_@P~@   pppʾ_P _#P  apPJW PP  /@pʛ_P _#Pf @PJpGPWppP  #-@ R 5P  0QPr" @P  P P ء ?$ R# P#-@W@w <0 08 (P0S4$pEP/pp r^@P@@A p,_PP(  P $!P9-0@  @P  P  #P @   9-0@O^PowLЍ#~9-0@O-AM`-@h -@/@P-@;$ @M| -@ %-@- @@Pq @q\o-@,Q P(PZ -@PPj -@ Q P` ,@PP@Z Z-P@P @P -@p ep-`@p  ~E-@@PJAEU-@@P-P@P 1/P mp[-P !-@ @YX -@ @ P Aߍ @=\ @9[ /pZڌ -@P P n @[P|P{ -p@P -@Q   -@0 pPu Q Ph` ,@eP_ ` ,@_EP-@@ , @  -@PQ 2# - @0P0K H/kp]P ] P0W @W !@/ l& ! @P!@㭏pڌs -p@P ] PÎp?P ] Pm {% @pC -@@P XP j @ 0 @Pt!@ P. @Py [  P( @47 @n @[P |P P @ P -@-@8@ @_B-@-@ (@X P@[pH  PZ-P@Qd,@Q hn,`@P ?  0-@P %- @-@ R @@Q,*P u `-p@ P Rh., @0 pP UP-P@`=\ P T @`@3UP-P@`.P@y -p@#` R0B0  P] P p]} (MY#  -@@T @P  P `>M  -@ 0-E-@@  P0U  E  PP UP @8 @P  PѲ U u U   R0B00R p R 00%- @w-@-@Yx  -@@T  @P  P #P @ [ W0 p P000Tq<  @U`-P@W 0 QP,JPP p ` R0B0  P pP`pP`W  0$p|  @ @n 1U-P@`@ [ P T @@@   @ P 1/P I -@@i @~ @ V R P -@P @PP}0 !0 < 8 @`pB,`(p0P僌p A-@P8:0 @ >#'H#: @ @ 0@3G-/P/pEiP @ !@T`p l!@!@U `v.dA-@@+S.  V(dA1dp1P-@@pW! u `P9QP0PPJu0QZ.QJP % @@ -@I @{0H-hM@h-@ P @d S -@PE` ,@ H-MY @-P@PF oP  0lP  @ @ HK -@ $s PP-p@ uʒ @`-@PT P+PPPP ۍp @`-@P -@ۍH`@-NZh@-@7 H,@AZ@G-H$@,@P @P5  -@T Qnw,`@-p@PQ g~-`@,p@㜜 8;-@-0@P@Q@  ,RA_(JeP,@8PE_ `,@EO*a EA_*EY -P@$!jd@ ) - @j@P(Q[ -P@,$A@ -@JA00 -@,AC 4-@@4 -@(188 -@0 << -@@@ -@DDRRR RC YQ-@@ R |R C -@l!-@@ l+pR+lRG W-@@+fRW+bR  P G/@-h-@@s -@P -@ P @ H(-@, @@`-@@P,@p@-M@PT 0S00U 0S 0100 `EP TU T@Ѝp@-P Q -@ @Ր -@I -@@ PJPd. @; -@@ -@ @㳐O-4MM0,tg@ `@,ql-@!@h-@@p-@!@tU-P@ @@LP-@々@-@@ @x-@|-@U-@-P@-@@-@-@@-@@-@-@@-@@-@-@@-@-@@-@@-@-@@-@-@@-@@-@@-@@ @iLP @-@+OQ P*-@ @XLP@ -@ @NLP. @ @)P !@#P  @P l !@P  @ -@-@-@1 @UP ` @UP-@-@  @LP-@ R`Q P'  @˶0 !@KP i @UP@@m_(`@PcKX -@ -@ PWKP T-@ P-@0n-@ @0`0,P ~4p@DW] @ 0@8 HC 9 HC HC HC hA HC HC HC HC A HC 9 HC HC HC HC HC HC 9 HC HC HC HC HC 8 HC 8 HC 9 HC : HC 9 HC HC HC HC HC HC HC HC HC HC : : HC 9 6 D9 T8 HC l; HC HC HC HC : : L; d8 |; P9 ; h9 9 HC ; -@x-@ x/p@( P-@( 0P  x/p@-@+/P P 0: l/@-@-@ )-@- @0 -@ /@ 0 a |%/@- @0 U-@-@  @ߵ-@-@p /@wp p @ @O p/@ep$$"@cPm Qt pWd -@M x/p@( D P'@ ( 0P E /@4-@n @{TP 0 (@-@/-@-@'|-@# x/p@( P-@( 0P  -@ x/p@P-@-@ 0 p $  @9  (@" @04Ѝۍp @-@p 0(  *-@- @@ -@U@H(@00pA0$,$-@0,  P-@ (:-0@ A0@pphP0Z,zB-P@-p@@@@JPQ P @P]@P P PQ y v -@PQ @م-@+N Y-@ @+> P:?P  @᭴Q !@L P  @@N @ >  @IPP; @ PDx p@ItP @  DNx p@IP  :Yx p@IP  0ex p@IP  &  @IP@  @  @zIP @  @  @oIPn  @   @eIP v @ pL @@yvB @@qn0 @j0P}[,:DP ,jPs 4 -@P8 @P @L,@PD@P `P/@?  @/@?Q  " @04+  @`pP+M,8t-@pzTZ-p@ P@ DV @-@@0V P R P  <-@-@@ FP [c0,Up=4 -@L8 @ @G  @  @  @ U @ ?@0 @  @?0 @  PT0 ,@h-@P PF fn0 @ qO- MIHDkH_ -@-@@(@-@-`@-@P@P !P  u%E )0 p P PgH-@P -@p pP  @=  @x @ P 8 -@P @L# P- @ L-@H-@ _ P@2/P-@PP  @P  @P  P 8 @ @ ЍP P @   pp@-@[-P@P '@P O` @@P P @F*DK @P-@@ pp@-@P j P'`@P lP @pp@-D_-P@P '@P nH` @@UP P @sFt'HO @P-@@ pp@-X X-@-@TH-@-@Y\ -@-P@Hc-`@@TpH-P+ <$ ' @PU& 0`p@S`P`V p`V V`Ap Vp `PUWO-M@p `@PV2 PPV. V/BZ@-P@ 0 -@+@ @S ] @<$ ' @P  `Q R [ +`Pl ЍOЍOV0{-@ p@`P p @ 0U 0  @HX ` K `2/Ѝp@-TX -@-@ \ -@0$S!S0S S  " '@'@!Rp`3 -0@ 00 0 S S S080S S0`3 -0@ 00P@` P\V "V `V "V ` P`V$ ` P `!VV V VU  @pS  Sp `# - @ p 0H-P  @'@P PP PP @  0 @@-$K '@@p -@P@o O-M-RMpC  p-@@-@-@Z -P@ e J  1$qS(apPPVpPp -@-@ `0T -@* kPp J `0P P EP-@@PX zP Z.` P4`0`8` ` EP. A`0`C PP.` @ @ 4`C4`08` ` EP cP xC -@@0S j$ @  h p-@`PV9 1 A ᠋!0 A.h @  _ dUdP0z`d -@Q-@AP M@DTE) @ . @Pt @2?D hX `@ PY@p:0 6@ uP[p!E:R :Wp '. @h @ P@/P -@(A 1$q@DS D -T=IBuPJ-p@@ 1 Aᡋ0 P @ڀ0 A 0 Q3z*P p@ :0 %Pk@!% :S0:z p@` &ed a"% `4.1 @! 0eh P-@ R4@X)@& R #:PV.e @ Y@p -@ R`p0 A@1kG@ p JT `I.e @PZ e @P -@ P RߍЍc PaI* p. e! @|FP pc. @?erFQ%.Ba(/O@b"(r0r 27"cAh. @qd[P` @-0 @pO -@P 4 -@ .AH- M  ` A] ЍH-0M0P  B ,iAPC0Ѝ@-O@O@O-M-JM-@P-@P/ F`ʁ Q-@1Sq@E  -T=IBJ 1 A-@㡋0@T@`p 0 A 0 Q`pX p$╨ | t'@-@ @ v. @ 0 P@ [..L @F K @ Pt @1!He0딹kP IP?㓰dP:c.e @P.O @` pp7ecDpy V 0&U@  `U'p*S0`p:R : 0@!?#{ 0.0 @@d0'5;A0h' @E`[  -@ pZ@ h -@ Y p# - @ P@PPP  f @" [ -@P|JߍЍ .AP.@P )0 A 1KEI > p * P᠟P#g.f @@ U:c.d @ 0@.O @` pp7dcGp q-@Q `W  0Pp Qp0S.f @`@-N@-@ R -@P -@ P @ vN@O-kMP-@pPi .-@ @`@( P-@C Qp.ӫ=tP @ -@ @ eP2 PP\ P p0SP  P @P] ^ ^ ^ EP p P , -@KP , -@ʬP  @KP P>PJ?P p P, -@RP&PJ?P p P, -@:-@Q<{-p@Q A    Q  Q Q q R t -p@P PQ  p (@@ U P, -@^ -@  -@ <{P-p@ PP P  -@ Z{Q A    Q qb -@-@ Q  pP q Q  4 -0@ 0Z 0ZS P  Q?JP @ -@PPMP  @-@8p  p -@ @㰄 pkߍ -@ @ -@ @ @㥫S @ @㟫! @㜫 -@ @A-(Z @-P@`  P,PQ A  P @Q:p ("P&,j @-`@Q A  \P p"P IQ  p< F@Ddt0,J `-@@|Q A  [P \PQ  Q P ,P p D`Fdv  @@DF@@, -@P} ,J @P* -@@@IP PP @k@iH-`, -@PP .q;@P pP `G,z -p@ :SPoB@p@-MP4 8[-P@Q .-@ @ -@&P!! @ wQel-`@t5 -@@-0@R0P0R -@P R Y @ -@ЍpP P-@P v-@ @ -@ f`-@!@ `D -@ @` -@ ` -@D0 -@ @`4 -@ vDT -@!@` -@ mD  -@"@`X -@ dDx -@-@ Q  Ѝp@@K-MHsP-p@`G@-@ T!* @ ~` `0 @ (@p H#-@- @ R `Ѝ @G c1 @ 0@T>O-dMPp@Q`PP PP `W P -@P V ]  @U U; @|  0ppW%0P-@-@(@ `0S H @ W @ P 0epPOpP -@P >GP;GP pC @ 3 3P p @[`P> Q @@P@ GD  @C P@G DT!Q @@P@FCP<  @"P@FC`@T-QP  @ P! @-@ -@P'8 -@d< -@pWOT Cn-P@ `@HP7 PpWBt @ @ cn0 @ 0@S -@@P t PU FC P f PU FCP XdЍH-@ @)B -@H-@S\ -P@$P -@ -@A- U-@-P@`P @P\u V-p@-@ @ @(D P:.P B @0@ @ PP X @ PP  -@, -@- @Q V)  -@ @ P! @b -@, -@ -@- @Qy  -@ @ jBV (+ @- @L -@@ Bu-p@ @u @P  1s0b Br`0H-@Q (@@Q @"\ P-P@  @ oPP  @P "@ P  @P0 0@-I -@@P =8 -@ -@D  -@-@@ < -0@R -@-@ %- @P G -@Q<-@H-h-@ -@P -@ P @y4 -@aA-HP8ky -`@-p@P P PyE-@@PJyyP P Py -@npXHP. @  H-P aP @ w @w H-P`p @KP D@ R. T D46t 0@ p@Rpp`FPm(`@ AQ  PpTV @`T@-@yP @ , @-L -@@?"PO-MMP -@`x-@Q8-@Q P ^ -P@P #@@P @-@ R J -@@ͦP  A7P @-@@ -@Q`@T`` p-@+@P/P  !@+0p @+0%paڡx% - @-@0T00 05-0@U -@ o~ R 5op0@ `@ X3 0@R -@@dP:T -@ U-@ oX -@P-@.-@ @y RqT @ @@ @㚿'@Ѝۍ0H-0MPx-@P 0P A @ A @P "  @ 0Ѝ0HP @ 0Ѝ0A-MiP-`@吅L -@P-@@pP ) @P# -@`6@PB   R6 4(0@0 @ @2@U. (-@ 0 @6%P -@}Pp@U PY -P@-@~P @  @ jpЍO-,MyP-p@吅㜣 l P-@-@-`@@PK Z @RPQu -p@`5P.5PCP`b @  Pif-`@ @2 @ ` P A A BBPC @P<  !0  / @;U6 (-@ 01 @5-P}PpU# P Y -P@-@~P @    -@ -@ @ G,ЍH-"0 @-@2LP -@ @ H-`P @@" @ pP < @ pPV @ pA- -@e-@ -`@Q  p-@# @P@ P-@@ -@!5PQpP"QQ 0-@C"Q "R  Q S0:  -@@H-MM@P$~> l`!@XCPP P /PAp` Y>PP /@ooPl @㳽PЍۍO-M@T `PpAPPpWPPd -@`BU@D` }BVS:PIp-@@  P@ * aV |Q"*AP*` @P  P `V: Q* XP @   000S Ѝ@-M E@-@ 0Sh0D9wQPpd P-@D@ЍH- P-@ R&-@ R5-0@0  Q %- @ -@ R 5-0@0R B Q %- @ QA @@-M$( @@ "   R Q R$( @ fQgQ mQ kQ Q bQO OЍp@-M@ -@PZ-P@ 0[vpB QQ  -@PZ-P@ 0@vp, QQ Z`-P@ 0`)vp @kZ-P@ 0`vp @]Ѝp @ @O-pW% Q" S AP\〒@` @GT ^ *p\W ^p2P`pW ^U1:O- M⨤ 8KpAP`-@-@@A%Y Y V* `PbY.IP :%Y MYg nY mYb cYP QtP @-@cY.Y0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^4BQ1 娤 8K-@V-@@*.Y.0TV* 0R07 2R1|*`.g n% -@ @QPP} V  mY.Pv Rc `Pnꨤ 8K-@-@@GVU*% a -@Pn @PX V  RA `PLV8*% RB:2V-*/   R)*<0 Q0 R937 2R1*+0R*00 R*`>Q V  R `Q   Ѝ/O-\MMp`@Z    7 4WQP AR!P@7$; ;( -@P P R PUP tp=  tsp-  PmspK <-@8HP t  Ysp4  Msq @@ @@7 0⢺wyB0 @   4PP A!@$0;eB@m @ㇺ\ @T[B$P,8pP! EtH@b0`@@S 0B0@mb`ASCc?; / 㲀rp3BP /B#P !X(BAQ!P<` PT0 sp ThVz ` B`  @7 )\Ѝۍr0H-@Pl0Hsp@-`P@@?P "@?P P  @@@pH-"P- @@-@6pV @ MO-DM@h h l0 QgQc 0s0-@@B ӝ4 `p@@bA04P s(80 S0 0B0@SCS?8 /pAP ~A#P "P wA qP$ plAP hA#P  Q  A<@XA@冯RA  DЍOЍ/ @/(/H-M$Q 0 sЍ0H-@qP JP0P @Pq0p@-MP`0`P @$`P q0+r@ЍpP @-@q,*(@/O-  @,q P -@pX( @-@܍p@ '@< G-MMHT @@P: MPP op.4( @op* PPX nA -@@+n`npPP Pv V" V+ $(@ @ @N @ܵ|n zn@Ե (@0 @1- (@$ @Ѝۍ rR Q  '@LQKn@Hn n DnBn A!@Ub"0 @RoO-$MMT @-@# P9   㤚 -@-@2@@ m L -@-@ m  y  #P-@` m#P P' `@- @  -@D  @J.pQP#@ `Q? m# Q#RP0\ P+X X  X  O'@#P `u @g# '@@X# mmP  @bP##P@P # [mP  @b O'@P   P0y @y' @- @  L -@-@ :m-nm$Ѝۍ0H-M_ @-@P P ۍ0O -@@-@%@Q: @ۍ0HAbP!4mp 0g' @P @s' @( @ۍ0H@- R RR00C PR R RS@@R `S RH-* -@ -@K-MH{ P@'p@a? X8VbP! @Dtj @ PTk rHp'`@ @@QWYXF0Qs0 W p_  @ЍKa0H-M @,Y PBmP  @aލ0p@P' > @,C PlU l lL  @D @, '@< e ,PPPWml2 @raB0H-M@ '@/LQIPb" @0Ѝ0 -@,@-(@` R0B`0p0R P X 0X0X @-@P P -@{. @P M '@@L[P  @-@@T -@@fO-M -@ 2P@ k -@ @v,' - @  L -@-@ kM Tg U'@@-`@ P PpP[Q  k,B,Vj Pp-`@P@ SPyzw ZsPzZ s Z Z P z Z' M '@@sP # P PK P p  M '@@ |p M '@@OP u @0[Tw j  Z -p@-`@-P@P T  Ok -@ Q P?qP  @A`5 X sP 2 QP Pp*P㥲P `v+OP y @ U0sp @W L -@-@ j' - @ЍO! O-MTg @-`@ @{ 똝 ['@P, Z -P@ jP ؏ p @-@H  [  U  jPЍA-M @-@P ` P ۍO -@@-@@P:4  @ۍA_Q.` @ P  [?'@'P0Q @ @ @  @ q @ۍAHH-4  @* -@H-BM(@` R0B`0p0R8 P6 X 0X0 @, PQ 2-@@ 2j**' - @@k  L -@-@ =jip`P3 㺱p@P@P PXL  @0_P O'@P 㡱 P 0 @+ L -@-@ i' - @2 **BߍT -@jt*q*@ @H-BM(@` R0B`0p0R8 P6 X 0X0 @,PQ 2-@@ iD*A*' - @@  L -@-@ ip`P3 6p@PP PXL  @^P O'@P  P 0 @ L -@-@ ni' - @ ))BߍTG -@@aj^j;))@ @6C0H-MY  @k^))p @P P`T_  @U^))Ѝ0 (@0n  @(6 @u)) /'@LAFP Z (@0n  @'* @VH-M q -@"@ hm G'`@w -p@P@P P4 h @ h -@ hnPЍA @ЍH@-PMS @ @P P  -@P  '@\AipY @a  @]PЍ@-@ -@hT m @d  @]\0H- '@|ATPT -@PJ4 h )A-M{  @,@PN - ] 'P@  -@ @ chb GQV)fyA `@@@ cP  {-@  P@&܍0H-0MTW @-P@+y@05G P-@@  H D0Ѝ0p@-0MTg P-`@@*y@ 5 P((  +0Ѝp0H-TW zD-P@@B if( 0Hi@-@Tig@0H-@PP PP 00O-$MPPP @-@@ d -@*8< -@ @'0@p  h~/`@ -@Qb pOP0@ Q0* 0@*8<  @'0@ӽ hp/`@a@Q80 $ @ $ \ l $ t $ $ $ $ 0 $ $ ؼ , d -@EP FP3? @ |/P  @ u/P < @[4P ;PP`"@N4Pn  @H4Pm < @B4@ P-@ % -@PD -@PK -@P -@P`/%P0 `=Po    )0 0P] A @X -@L -@P -@Lp2P*F !@ [8@ -@3~H(@U LW Q-P@}QAg!@3P D -@@ LW -@-P@ -@P -@dO  @@'''' E 0+-@@ @  pK PN  (@@X7P  @< @P p -@oB@ '@ < -@AlPP XP#$PPNP$Ѝ@2u @x @s @n @i  @c$ @^ @Y @T @O @JH- @(@0  @$H-  (@0=  @$O-4M P @o&`o P-@; L u T `@`-@-p@-@`P/ P  P -@Pep Q fQ ej @34@P`@$&P@4Ѝi(P  -@P  @B g&H- -@ -@cG-M @-@ -@P @zT @(@P  @(P /Qh .'@ @Lh '@ ˕P6J\f @P `@"@ P僘`Q@ -@P @V ?-P@@ Gp |[ -P@!@ =p [ -P@P0JJ @: gP)Pk P-`@P /P:@afP4x 0-@@d -@L -@@ -@ -@0R| -@P -@Q d{ P-p@ RP D -@P t @: !Lg P-`@+ - @QQ P 1ox -@: @ "@PM '@@J"@: P @l: P @ : Pn!@ : ޔP5 !@: ֔P @,: ΔP!@<: ƔP!@<: 徔P !@: 嶔P!@: 宔Pt @: 妔Pf@: 垔P: P -@5@㔔P  -@Qt '@ -@Q '@ -@Q !@ -@Q  @ -@Q *"@ -@Q q !@K ~-@@ @ %p3 @K -@@ p "@K -@@ p P -@@@T ,"PP -@@ЍM @e @  @u u u  @ڑ @ @ӑG-MP@Id( -@d, -@?d0 -@Ke4 -@@0PS8 -@P -@PKX -@c&' - @ -@  O@  -@ed -@bd -@_d4  @#8 / -@ @ # @Rj @0 p-@a PdUTG -@@ `cPJ Ycp   @%P @mo`; '0@ R 0 `-@p@r R VQ  `RpPwP" T -@ Pw P:P  -@p ^ -@P @ ?  P Pj @-@y1/ЍH- (@Q  (@.p  -@Q  P:P  -@ ^ -@P @ ?   -@/@- : -0@0S R  -@0@^@@@C`pȰ/P _ !@@Чa @ Q0S S /H-PU* ) <0 - @ 0@\^^O` pW p`WU@PPPPPU `BlV U@`P -@ -@O-MI @` '@P> 0 㘝 -@J N R` p'@-@@^P @ `@ WP)l P:P @P?P  W P:P @P? W* 0P  QЍ@- LK -@-@@ _ -@ @_G-BMg -`@ _ Xp@P _ Q UP:M j '@@G0-`@ S P  XX @P yn -@ T_Bߍ '@o /O-MMP4N  @@ T -@-@L M 㔚 p `-@'@@-@P!  B_P$!  -@ 4_PBP SP WP -@ _ -@ _o aM T -@+_PP>` -@P   Q: ^GP0S* P* U%P @q_Q:|P  R0B00R P 00P U:u .P r  zH- G'@P -@P ቾK-M☍ '@P @PT !P @P\1 @ @ . @P! @  ᗌP E` !V1Q q/R@Q"P㐽.@B  1  @ @RP B;T4 "@p`-P+PP}=P p +"IP P(;@DT``i=PRP >P .@ @ M P-@@P S @PPc @ @$ P-@@P  @( -@P  @[(@YpV"PPPO(3(@_pG`WP >(P5z!P!=P -@P .@P -@P  @?6NJPM.@@Ph n '@@!P# (P $  @?& PW! DoCKMPM 0 0-@q  .@'P%! P}=@-@ @[H-饏Pk  @k?) Q Q/@-0SR PaQ:{Q:A@AT 2[S@ @2@S@P@Q0S@-p@ -@@@@ -@@D -@Z -@P -@P Te>nMG-0MT -@ P X 㘋-@Z.@ P -@Q` -@ bKPPP.PC KPC PSN` -@c P P 4 P4  @P>9JPP4 2P50PKP# P, 'P P&! P K P KP nP K P      @/@} `-p@0`} -p@ 0= -0@   "   ./O S 0Ѝ0H-Mh DT] P-P@ @H @"P NP  @P !@P] T-P@ @Ѝ0@P xNPP@@@P@-@P @bN-@P@1@-MM @-@@P@  , 8 D P \ h t N @(Q -@Q @T @ W @ Z @] @` @c @ Ѝf  @P0H-@PcP0-@Q 00H1G-MM0 !@A-@@P "@0Pi @PF? @-@l @-@o @ؑ-@ "@a-`@f!@-@~ @b!- @P!- @!- @.@!- @!- @!- @!- @"- @ -@O !@P-@B/@PA@~tG @@P-@ @s- . @-@P 2r-0@R-p@ Qr P @\ "@W"- @Q-@t @Pt-@ @  @=P-@Pt @P -@' "@* -@R PPP @-@3 @ P-@P]!@P -@ @$P-@,b0r-`@-p@Q(t-@ @ u  @!@0@4"82"@"@- @-0@^]<"@2!P@*!@- @-0@D"H2k  @- @-0@ @PL-@ @PRP-P@ !@PPQ "@e @PU`PQ  h0bhx*  @/T-@!@PU`PQ  h-@ A0=hr p@ X-@P @YP\-@ @P`' !@KV@Pt'Q @@`-@@P -@Ѝۍ@-@P 0PP-@Q@"/0H- M .@-@@P-@" @. .@P-@" @. .@P PP <;PU\"-@ @.d-@0@-dB-@@P .@P "-@ @ -@l. .@P "-@ @-@^.T"-@ @T.` -@-@" @K.X"-@ @D.\"-@ @=./H- $-@/" @H0.L-@Q/ "-@ @$. .@P L-@Q/ "-@ @.:  -@-@" @."-@ @.@-\.@X"-@- @Q " @-h-@@T R-@"-@- @Q " @-@-@2-@-0@"Q @0@-p@-@ '@ P@ 4"-@ @-Q`` <"-@ @-P D"-@ @- ,"-@ @-h-@Pp@-hB-@@ 0"-@ @- H"-@ @- @"-@ @x- 8"-@ @n-@- @'@h" 0- @0 pP@ " ' @  1 `! `@o/  '@`/P"-@ @2-H-M@| @5PP0 P @ OaO@ ##lb-`@PU NP P Pv p!@ PpЍG-P@Q P -@pr @-p@ , `,V@PP -@@@p-@  /H- Pp@`!P P^ !@tP @K-`Rp@c; r P T @P Pp PpEUT  @ @T @ @K9 @8/p pPp PWpG8/p @PTPi K$O-Mt-@Z (, R A0!p 004pS*(?00R @`ET !0# " 3 @@(p T  ! / Ѝ.@P '@  PJ Q 㑉P @ $0  $@@@ @  04S* @  0 0  ` @ @ 0 0v` ! 0   W'&   0 !  td '@q  P  *bq7p Pp  @P8h @P -@P  '@PJU M$U?8x-@p`Q. P=j @J9P .@P -@F!NP, - @$ ! ,- @ !  -@3 P .@P- PP  00 @ B   @ @ 0P:(,5?  @[8Ѝ0H-_ p'P@@p   @K8@00H-O '@@P0H|-@ Rt"- @ 84<$ r* @8[.P@p  6M -@0O-Mt-@4t`/)0S0%< П &ၹv@ @'@P`Q !0# "  V7` L@P TЍO-Mt@-@pW# `PVJ r P@$ɀᦶ$ 0* ) ( E0Ѝ? "0 S  !  0 U Z{.p@tp Q0H-tR@-P@P  _ 8</ r 0H[.P@Pp  @0H-@P t-@Q  Aa0`TpS !@($,40D@t-@ R x2-0@0S/8</ @/t-@P/,$(0&)/0H-tR@-P@P p ?0$R ($,4 ($ 0,4@0$0@-t-@P 0Q A0@`(0 Q  QP?20Q @p@$p'p 㰀$PJ&R '@/0H-MtB-@@P+ P8TTJT: T:T#T#;* -@ @0$' -@ @ (T-@C T ZO `"-@  $3CP@A@@@-@@-@ -@ 0-@T3 R R R R P/0H-P@P0P PU:` q U Q P@ RP0H-P@@P:3 4 $4 L4 4 ,?% ?? 0? ?  ?P? ?0  ???P0"- @ RQ L R  000!30 00?!R 000!6+ R 000!9q 000!< x 00!?00 00!<30 00!930 00!630 00!330 00/H-@P`-@P QpWN`QU4 U1U uP ;Uu```H- P:  @0SA ! R*0 Q!R @- ! @0SB / A@T*0RQH- P:  @0SA ! R*0 Q!R \ @1S10S/ R/H-P@`PP'@Q pP pQ` '@Q pP  pQUS @3@P@0H- -@R4 -@0@0PB U*AP U0@B .R bR cR"000T   D LP*0 R R-@P0(Ls a00 x @h @2q+-@- @ -@ -@ -@ -@d'@/ -@ -@ -@d'@/O-M@#PP3 Ыp -@-@-@ `@pT*1P P!PP  PЍp@-MC-@@@PP ` uPPЍp+P- @-@/p@-@Pp`PV P `@ ``p@-K-@@P-@O-MP-@P {-p@P Q;-@-0@ P R q -@QPh ` `-@P d `-@P -@`J{-p@PP V(B-@'@@0oP"Z@PrA A ,B DB \B B B C $C XC C D ? ? > t@ > > dD pD [l-P@{ L-`@-p@P-@@Y[W [U [ P P  ЍP -@U d'@pw#-@- @pAp@̃-@ [@@Tv ` TP@tG @@V@+K-@@P e[ -@bk-`@P  P  Q  p P-@Y+  PYPk-`@U P-@P wI Ac$'@QLP PKk-`@Wkh -@ -@=PZ: -@ЍO7 -@N -@H[-P@c-@-`@P P QP P4 P/ [-P@-@P Ph m -@ -@ -@ -@Q -@ K-@@-@P I[-P@c-`@-@PP PPP P PP P[-P@-@ P P P  -@ f P 8E$"%'@' @c -`@ PU P*   P X PP P` V:`Tk-`@QR [[l-P@-`@[-P@ -@l[-`@ [ -@A!@ -@ RQQ FP7P; -@P%P'@P  @]  P!@ -@'P p@-cP-`@@&'Q:p+- @P:00@T0Q:d '@ ?pp@-M@-@ `P0B Q -@ 0P0`B!P c0B Q:.Q ,Ѝp-@/ -@P /G-MPX PzEPSJ  PO. @ㅦ@ᕁTF  rP> P @ pP6 rP0 `㬐p `@ @PQ Q Q  RP   LP "P U(R'P@PR'P@ qP"ލ0H-M(P'@'@6 wP3 P@&@6T* P UP4EPJ  PD(] P@ @  @('@  @P'@Ѝ0p@-P @@E P >P Pd RP` RpP P@ᾥ` RpK-M@{-p@Q4 [m  -P@-`@  j 0Q - QQ P ` MQ-QVPЍp@-Mk-`@Q2   /[ -P@-@@ PAPP   |-P @ P Qn-PЍpH-Mp`@P 0@ @kЍO-M̛C-@-@@pWDP `p 0P GR pPWk-@-`@ 0Q} -p@-@AQPI̛-@-@@k.k -`@p ARpP@ЍP` 0 I  A ZYA-M P`Rp  @W  U I@W P UXЍP#- @wPU PG-M{-@-p@K-@@Q̓ `-@ PT0 EPP@  AP -@-@ЍG-M⠭ {ԋ-@-p@-@̓ -@BQ  @P`Q   0B `VQ @P P Q  @-@@NЍp@-[C-P@-@@`V F Rd'@ 6-@ @oopp@--@P @-@@V  -@@d'@  -@H- -@PGHp@-MP @PP ` @PPPPPЍpp@-M @ PPPB@ P@PP!   `@J @! @0ᛢn @@P 7 !@P Ѝp@Ѝp -@PP/H-Mt  '@ @,Ѝp@-\-P@P P (.P  -@P P P @ -@P `@`Y~op@,:g@p@-@^ 0-@@ ,- @0K-@b P@U8 l-`@-@pUCUp*O-4M$ -@`*  d -@ @ @L ㈛\P -@e.@-P@-@ l(L p |0-@-`@-p@-@@wP 6D -@PPMo,8,- @I)P _P K -@P .@P mP : -@P PP) @*X/P05P @*UP:**B\-P@P@ peTpePeXBl-`@P$\0L.P-P@-@@P PPO \P-P@ !$\(LP-P@-@@ P P.W 0G P: dP@ -@~P\-P@pCP XL-@@P y- !@9 HcPQb c c ,^ `^ ^ g ^ ^ g h \c xc _ c d @d ph d e g @e Xe g h `_ e pi i j e e $f [ [ _ Dj Lf Tf j j f f j g `` g g Dg Lg 0O-M@pS  +P p[@ @@ P p `Y V P@ P0- @RQ %X P P*P  P ᢂP `%P  JGpZ PW:@ Uq P@T AЍH-\ h-@'@q/0p @#` ,-@'@ $p @ # @  @ @  @ @ HH- \ -@p @H"O- MPRE @ `sP= @@VP/Pp PP `j P.c `@ P PPPZppPZ : ЍH- ` -@p @H" \ -@H-P; A@0T"*Pp`VVW, PV @TPgU P@EPU uPU P@PT:P @0S gS 0@dS fSd0d00 ` -@@-M@d -@ PVPQ h  -@QЍO-MP -@@QK2`7ptWBJ`p9@:rP3  0p'  67$ &$PMP+P PQP@P\ -@ @p  @@!It6@ЍAtGP@PEQPnQPdPd hl-@-`@U\`0`-@-@ @uQcQ eQ P s p @ vQ Ps p ! P  p @z!xQ@0H-M@PP +PT HPP =p  @PY!sЍ0G-Mp -@`PX -@PЍ `-@P `@`-@PQ /p pP  @R d 3  BP`d`3`dV P IV)dppU PA*PEP`O-M@S`pPPPU+%G'@PWP* P Z P@T:$'@P PP @Ѝ0H-@Q PT R0(B R P#0Q 0 S*A qR Q 0rS Q /P H- -@HO-M P-@@P .P $ `V Tp  Pz -@`U V  @U ` Pp p`@P;n @.P* m @(P)   @"P& P j @& rZ j r/r rV }@gp @-@@@V -@`t -@Px -@0 -@H -@PPaM -@@ -@PQ +6P0| -p@ ,- @ -@P @r} -p@`PP !%`  @V 0.@Pj @㘐 "r@Ѝ4p @.@PFP!P  @㘐; YP 4a PW@p@-M\ -P@P% !p tl-`@@T x -@ q -@ -@ЍpO-ML `-@@PP BpW P**p@P W$* * `V   P*`@P V *wPUP qU gP i_ЍOu@@P Ѝ -@  -@  -@ A-鈋@P`.@TpUCP W PE`  -@ 0H-@PP PLP0H"0@-L -@@PKP/Ep@-`P >P@P U  PpT  Pp0@-L -@@P @@@H-p -@P -@n @H @M H-p Hp@-M@#QT@23OPP JC3 -@P @@Pd `@`UnU aU dU 0AU DU, OUoU qU) P 3_ 'P@ 0 q  3il  '@pP @@cpЍpA-@k$'@QPP+ %"P' @0PQ!@Pe @}cP`@`XpPP PW P@PH-e @\P@O-Me @Q냓P@ ,@T: %b$R '`@'P@p `TF T[  P p%bp'`@Q@Z  @X* p0t$@ @p@pP `pP  & pV`PЍ0H-\@-P@P @ @QtP0A-MPB@P@`PЍpp8mP  + !@!" @0hP@1p1@doboG- P@-@-@`p#Q%QWWP P #Q%QP hg`Q `pK`@#Q%QTTP P #Q%QP Eጃ@`Q @p@-` -@PP+P{$ @0@MP`mPnPnnpG-BMPP3  0hp+ `,R1Pp`MP`p.@@ QQ PpP:  yQ* PWBߍO-MG -@PB@e @P@n @RPn  @P@PPT P@됼`-@P @ @Q@`p}`$'@%'@$ @0S ZnQ @P @PU t@ p@l yPUcG @ ~yp4nW HPᯮP (n@#n@ nЍH-M` @[P@P. @ЍHIP P*`'`pb+@!! @0m. @*@mЍG-@ddP EHP  `@ mPpP@pҼpw W G-M.@pPm  -@PhN @P_ @`T|P`F-PDpn @P2 pDMP @p B@ @ 0PjSpnmW V @ T@/Pn p@pn@խpWp@fέpT :P@m @@JpЍ@-%B@P sQ%:@CA-MP -@P Ѝ@R ៭ @^P `P @ЍA2p/p, 0pP@lT ЍAsp@-M @0P`lAuoáЍp0H-M{]@.P@P 0p#PP"  P *P.'@ P P'@kPlЍ0@-M@0PJx| 0Ѝb@/@-@Pp/Q@p@-x@-@P pp `u@P!$ %$oB@H-x@-@Pp pXP`!% ~&%@JP@3 -@Q/O-M☜@(-@0p`,PP  -@X P @.@QnJQlPj T`WpW`PIP` ! %P ! @PP, P`Z -@-@o % & .@PP .@P p -@ TT .@P -@@PP` Y Z4 P2 .@P, +꜍.@Q P !  w! HP"  P bj-@ЍO -@PY @oU RG- -@$P `Q  -@Q .@p ʜ .@P -@@p P -@ PYp Z@i`pPX ^W @ZT W  .@P .@P GWG-M`exP-@P P(!  p@!' $' RP % !0" 0@ЍV -@@P! P y P@p 0p@J !0" .@ЍP G GA-MP`p@p  0@$ЍV  .@ЍP AA -@Q/ .@p/ .@P/ -@@/P/@-@, - @P0'@0Q0S0\ 00  Q 0R0C0-@  B 9j@6j0P'@ R/0P'@ R/0%P' @0SQP/ -@/H-0uP'p@`@T P @T&0U@P0"@ P 0$00 0 0 0@  Q   -@P// a @/ ` A/// // / /O- M.㈻@. @.@() P *!.@ x-@-@P ?  3P pp P Zp ] | Z  @P 0s@PP ` K[@T PT p @ D DooP T Tt P P0CP@ f@|T.@Q-@QX @ .@P-@P^P@s .P. @R@3Z PpG .@.@P 9 0  P00 P * .@PU  0 P P p F ЍO  ЍO-M\}㈫@.@-P@`.p@.@t P / .@ 0`Y R "@Y`9PP P U U  P P p} yp PPP Ph `@H g@P p `pW .@Qp` Z  P 0TP W*Q&-. @ R!/㈫- @.@ RP P .@㈫.@P!-@PP@@TPEUʷ㈫.@}\}P.@-P@`.p@Q .@@ Ѝ.@P  0P *H-@p PP @P6 P P p `'@x@@P)P  '@@@Pp@-MP & @Ѝp@@ @Pm 0-`@s  B @!  ЍpЍp@H-M@Pb `p p+P uP b  @P@Ѝ .@P  .@ ЍH\-. @ WA @ЍHH-M CJЍA-P@p @i;z`p!&  0PP0P-0`Vp. @S A @Ap@-@P`Pp Pxh`P .@P ( p@O- M`@ PJ@@T 000P  @ ЍOptP !d0v .@P}  ЍOP  pq V  P᜝ -@@XL`@!&A V YXP)+ Y`@!& PXPp -@ 0  @ -@ H -@0 -@00@ <`@ .@P J p-@p 0@ Ѝ 0q@- @P-@Pk @ @P-@KP @ G-@ A-@ -@@P3/-@.-@- @-@-@-@-@-@.@-@P/O-M̍.@Q .. @ n~-@R-@-`@-p@" 0 p'@o '`@p0@`@ZPPP@Z@p0S3`pWnp-`@p~-p@0  R$@ PUP09 @ pp`@.- @ p-@`P . P- @@0 PQ@  Ѝ-@O-MN-@-@@Ğ-@p AQ GPP J W`@-@@ .@ QQ -@Q P!Q# sP$p Y @-@ _p*P{P P@-@ mo᠂ -@@ P@ppP ppĞ-@ @`T`з P-@ P U p P`T-@ !-@- @-@ 0-@ T-@ -@-@ -@0-@ P -@ -@0-@p-@ T!q- @2-p@ -0@p-@0 P@PT U-@^ `   -@`-@ p -@ Z P P  JPPP N-@@ P ZpN-@@Z-@ 0G`-@p  ` PPPPpS-@ @ ЍNĞ-@@-@Q/H--@PH/0H-@PP-@P-@@P@0O-M^@-P@P `-@ Q`t` V .@P' r-p@-@PK ؾ-@Q? P1.- @@ R b-@Pr N-@@-@ rPmn-`@P -@.- @ Q @@-@9-@PU -@@) 0@P-@-@ P- >- @-0@ 0/S .>- @-0@ `0`AQUЍP P 6-@ -@PO- MP p.@P N-@-@@ R~-p@0SANp-@@〢-@Pn^-`@-P@ Q8.- @P `_W3 `_p`p/P -@-@<P. -@`_W `p-@000S0P P `_P` W' .@P'*`%>' @-0@ p> -0@-@-@0QR@0DQ B1Q0BR @PWCZ pD Ad'@@fD  P@!- @-@ q-@@= -p@P-0@PpP0PpU<N P!@@  P1PEUʡ_p-@P``wP .@P PP w 0 P .@P  pPp ЍDP `-@PQ r@'p@  @AQ-@q-P@1-p@P- -0@@p- @@0@ @pTP; @  dPP/꼞-@    P0SR   R0 @ ` PP A -@p``A-P-@P n@p-`@ 0^PpW@@-N-@@P-@O-MNP-@@`P-@-@P PU-@ 8-@-@P@ؽ.@Ď弮-@-@P-@m-@mP v `0 @ p@`B`G`@A0Cs `@ -@-@Q-@P U-@P R P RV  0 0000Ѝ 0 p` 0`0-@-@@/.- @ R -. @ R P @ P  .>- @-0@ 0 ~ /-@-@/G- p`r+ tP'+p$ k|㼮@P.`@-p@-@@UP@P@t T`pYXP`PpO-MP Pp` @P7P:㼞-@-@@@ P" `.@v* TpP 0@Q: 0Q0BQ* @B@D`` P`pUZЍ`pG-Mp@P-@pm `'@  1`A2- - @-@!q- @1-p@ -0@`p`0`` VP `  P@~PP ЍH-`-@pVPh *@P@cPPVv9@@PV4PQn~-`@@P@-p@QPPP!- @1-0@-@ -@0@@@@P! P PP!- @-@r 1-p@-0@@p@0@@@O-M@8-@QV -@0 p0CpS@-@ЍY -@P P @ @ QPAO-MⰬ-@pP|\@x\T`V V ^PT ^ -@$-@  ^^P-@P`@Ѝ-@ cR:c-@00.@ P!(. @((. @ @/O-.@pW .@@`T@`@ `P`P%`&`V pW@P.@`.@V pp`pp.@`VPP ` 0 p ؠ P TP PUV RP0A `pVp0 `0 R A 0O-MP .@P@%$Uh.`@P h.`@ pRpPp` !Ѐ 8(. @WpU0R`0W04`Pn<Р.@ЀZkp.`@  0G*!Q TZ  0"X U  R @ `(P6<Р.@Ѐ U kp.`@  0*! X U   0-. @P -@ @  Ѝ@- ЍO-M @`PDpot[J -@ Q@ `p!&o T@P` pz P`&0 p'pЍO- M`-P`" "@p n  @k Ig- @p @p5 @PPP*Pj@L@q=\@Y 2 F @/   -@@ ЍOaP P 8@ 5 @w+! @ 0 \@TG-MPi`p  p ! @p@ .U T  ! @ 0 0ЍK-pP``P W @B @r@P: @$ " "@ @`q p p  Y `Pp pPwP w P  ppҀ @pw W p pPwPw P  pᲀpכ @HP -@P@.@ 0 #@ p /H-o@-@-P.@$P 'PNN?.P ^P 8M-@.@@  P & @(8M.@@ -@"a @R:A @R' @Ap @E= , -0@- @8M0 .@@  C0 @@p0H-MaP@U:A@Q'P@ @  @(-@. @ d @Ѝ0 @Ѝ0HP@-M2 @ p @$-@.@ d BЍp@-zP! @, .@N>P- @4d 0sm0.`@$`44d`pQ Pp p@{p0H-S@P , - @ Q u @P@0H-@O.@0$RŃŃ@-M@ -@Q  @Ѝ@P P P -@@ '@PJ @ '@p  -@  @Ѝ @ @L -@mЍ@ - 0- @0@- MP P PW.P,j "@ h%' @Q+  @&h'@ r/f @ @@eP DP0@0S @l @j "@ Q 0 @PJ -@ DP@ .@D @Oh '@ .@ Ѝh'@P/A -@ DP@.@/@- MP P PW.P,T @ l%' @Q+  @&l'@ r/f @ @dP DP0@0S @ @T @ GQ  @PJ -@ DP@ .@ @l '@ .@ Ѝl'@P/A -@ DP@.@/@-MP @P   @@Ѝp@-P PP .@p -@P  @p@0@@P p@Pp ` .@ p@H-MP P Ph '@ ?h'@h  '@ @gЍP/H-T  .@  .@PH / !@0H-M@P P P5h; E P 7 P.-@&& -@$n @t P PH -@x|!  p~ P -@PP@ -@  P - - @ RpP B0P -@6X P Y  ]O P=P`!%pWr P0m  hP~@ Qy@Ps -@SP/  _  r' Pu p !- P- @  B?iM -@ -@ 0 R :V p P6A!@ `P } 0 R :? p0   A!@A!@p`WPM -@O }~ Sy!@w@0t @S RSC $Ѝ0H-@b AR0TPQ0P iRjR tR mR BR bR  .@0 0>S:SQ\SS/.SQ?S/( '@H- .@p .@Poo 1-@- -0@,MW- @<R'@@0.@ ABAH -@ !-@- @= -0@0 0'@CAH-@H{P.p@H`.@  RP  map@-@r0P Cs/o"TJm -`@@T @` !0  /o"Rpp@P .@\ .@/G-@ -@P hT.@Y(-@P -@P@,`Pp p$`@@UO- M '@q E  ("'@- @ R9 -@P 뜍 -@P,@P`p ! &@  V  0!   R̾m@TP ЍO谾 Ѝ ЍOZH-P .@ ZP a @H4P h .@oHY0H-@P PLUp .@x .@00H-8M'@@P PLUp .@x .@00H-PM'@@P PlLUp .@x .@00H-@P0P'@Q 0# " 0G-$@^``n.`@`Vo '`@@p)P&p  'p@PpPpp"P#p* PVP'8}'p@`V! ЁpP pp"P#P PЀPXP`V^.@P h Z.@o @- .@P PK.@@P K@ .@.@H-Xh .@.@ QHkK- MQ`@P P{.p@ oP2P  .@P[J^.P@P pph .@p(PC 2P\  @P; P .@ P4J.@Ph .@P%  #^.P@P@h[P.P@Pp3P T !0  `+]( @a @@Z .@P P  `   .@ J`JX 0c 0! < !0  `V ) @ ] `-P@V' !0 ` 0 00 phP @.@PT Ѝ-. @ @.@P H-M`PpQ  GPZ9P J@U@ C_`PPP`p W@PP:pT@p .@.@pPT .@ЍO-㱵Ǹ @-@P } -@-p@P`QP L -@l -@.@Pc@-lM'@@P 0 G .@ .@ .@0H-h '@ @Pt@P&  @mP  @gP  @aP n @[P ` P Jr @@@@@0O-MM@P `pP T 딫.@V[h '@ @(@ @7P  .@P P @ Qe Pp R 0(@ p @ 0pRo Rk Pp`0@p@p W P0`@P@  pW 0`0@ 00RE @`` R> @ 0(@ 0S0 0p0@0S( 0 0@ BQ QQ P 0l= '0@ 0   6Pg (@X ፆP .@ .@h '@.` @jPEU 딛.@` u6Pp p!P  fP  d6P^ P PQ `Q Q Q@׳P  P% $^Q 0Q Q 0 \Q 04Q Q  q$P$@o0 0?(l= '0@ 0 FPO .@l '@.@BpC @PPP; `FpV7>pt @nW`piR# @0`p}PW 4E. @m-EXul'@P  .@ .@ppGP @Ѝۍ p(@X ጅO- M⌛P.@P   ЍO` .@ @P Ѝp@ 0!*`pQp`P2 .@P  0W@ P  NPP P P ㌛.@ @.@P @P+. @  @'@-Pl.@0 '@.@S @T0000@0 BR@-Pl.@0 '@.@S @T00C00@0 BR .@/ .@/ .@P/NH-P p`a@p[XPUa bMXH- @PC.@/0H-M[@.P@ p p PQЍ0SO-M-NMM .@  .@Z.@ Pk.@.`@P (@ @ @;PP#P     @P   1(@ZM `R 0pp@E  R``PU (@|'P @@ {0S 0 SpV R  R 0 @  " PU R|0TAKOB\BOL MLXLBLE J,R @Q @w `P Q (@@ QQ @ k.`@P5 (@+P (@k0.`@PQ pp@;P }PJ\PPO $? # P @#P#P\@T`Zc  먵P\p.@ $ȍPM \P U P P"bU 0 @ R*$p$00 @Sr  0SQ:P 5\P&P$p$$P  $@@PPAP @K$rPP$  @ B P  ℰ P @0B \PP  $ FP`= @K >P㨠; PQ (@@Q $M0zNp @K 0nNp P8(@PG `(@ Ab PP (08Pk.`@P7 (@ 00@n P* pℰQjP$h E.@@  PtP\(@MP@ TQ   MpM*@( MpE*T`V H !0q1 A) $`("(;P }PJp$ $ $ A  `㄰ [P R  P(@ @ R PP1 A R*P@*@K 0@""P tڄ@P@ℰhQ HQIQ gQPiQ pQ1 Q Q;Q#k .`@P #| (@P<  00@ P2;P0P,wQ (@ R 0 @ JA PR RQJ P@ x} .@Q !_p \P ` $0S6 p` p@\S- RV @-  k.`@Q  @X @^.@Q k.`@Qe @o @ k.`@Q @b @;PQ @@,@P: P: P 2PR2uP  `PM `@  \R R  0S S  `P5 D P@ZP  P'YP.@ aV PP `1#. @  P !p5&k.`@+(P .@``N㨣.@ @@.@QU pP 0h0?WP`V<.@P @.@d.@h.@NߍۍЍ  .@0 @  .@0 @f  .@.0 @@\  .@0 @  .@=0 @  .@O0 @`C  .@0 @  .@0 @P2U %  .@0 @  .@|0 @ .@0Y @  .@0 @  .@!0 @  .@0 @  .@0j @  .@0 @  .@0 @~  .@v0 @w  .@0 @p  .@0 @i  .@0 @b  .@<0 @[  .@0 @j @   .@0 @G  .@N0 @@j$ @ᬓO-MPE <P@.@qP{P tP rP 3aP bP/`V P p 2pR p.@X P)P  >@TЍ.@ .@0o @`IA-MM@0 A R * -PЍۍ.Q$Q +Q&/Q \Q `MP P IQPR IAo`AP 3.@ @ \.@ @0 .@ p@-@(@0PP@ R RQ .@ .@~  @.P: `៳pO-M[` [k \[n p[]` \0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" PP]UW0C0 U \U nU 0p0]Q pRp00Ѝ !.@ @0 .@ _ .@ @ .@ @O-M .@`p @\P \Q Q: . AR [Y+ P[R[& \0S! Y IP ]Q [QY[[Y][Y   P R   P R p P` KPd.@ R5Ѝ.@@.@PmC @ 0ܑH-M@P`pmPn@ P2Z[[[,[[4[[<[[D[ aP dP fP       P pЍK-@pP`?V ?PV @p`?P VPD`P00@?6SC @]@]@]@]@]@]@]@]8]8]D]D]D]D]D]D]D]]]]]]]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D]D](](](](](](]?Q7@?QW@Q?0|/O- M`Pwt @I ~.@㬍 (@ X p@.@/@ WHPa@Q&8^```^_^` _``<_`h_```h^``x_ .@EP GP_ IP.@!.@F2@P?  (x-' @@ .@tP @.@ 0P  @E .@ 0P  @E @x-' @@vp)H(@.@APU x-' @@PPU |0'@p 00p"|m@'`@p pP PU .@ fP .@]I@@H-Ax  (@ @0P`]O-MȍP.@}ԭ̽@`.@.p@.@.@P P< +Pu.-Pz  Q Q. @5`P .@ 0"  @/_P:" .B.@.@P:@P  .@#QnP .@Vc.@ p0 W8 W @@P.@@@p70@p0pp` CRp  -P- Q#Q) T  P" TP P -. @ p @T ЍnQ-. @ݻj @bO-MM ~.p@nMP.`@.@@.@(@.@.@ RPH . @. @XI @  ^.P@ XP; Qp P P/ <P 6"P P.@P `PP P.@ P^n.P@.`@.@P .@.@P Qk P! `P ++Ѵ PP++ ᛑ  =t/.@ @ 0] P*PP .@@ ^P k 48( P  P .@.@P .@^n.P@(@.`@I.@. @. @^P4j @C .@ ** N .@@.@VPP u  E PEP   0.@Ѝۍ j @$\ <F? @ @ 0@ G@* @ * @DC.@P3 @;C.@[ @@- N.@@ Q >p 奴 .@P .@QoH-@.@pW .` `@]P PP p чpWpŇ@@-@2P !@ ᝍ@-@P 7P!@ Ꮝ@0H-@P6P0#!@ 0H-MvP.p@@P 8 0*X` 0"XЍO-M M.@.@@P  (@DX<68f@.@.@.0@.`@.@ .@Y Q P# p RPU PY P l6.0@P p R Q Q Q PAnP$ P( Pl l6.0@mQU_ P2 l6.0@3@D8f<6.@.@.`@.0@PK?AoR@D8f<6.@.@.`@.0@PPQv@D8f<6.@.@.`@.0@PkIl.@P5 h6.0@0  Q<68fD@P.0@.`@.@.@ PPQYQPPSPPOl.@P  h6.0@0  XQ<68fD@PP.0@.`@.@.@3 PP/l.@P h6P.0@0PP P 7Q<68fD@P.0@.`@.@.@ P Q QQ*P PoRUo DA7Pdqrxtsyxr$xx|xts,thtwxrr4y xrPL@T2 P D ᓺP+ E  幬 M.@<68fD@Y.@@.0@.`@.@.@,`.@P  =Q @[ @ 0H.@ wPp !pa  _PZ @ W@D8f<6.@.@.`@.0@P J @ 0Y=@D8f<6.@.@.`@.0@P .@ 0! ) P  'ZP  P0!  Pv  'r@Td*pj p` h.@0 P" @!P R p.@ 0&h.@0 p[JlP.@Q P dP.@   NP P{x}0.@PP `.@ 0@-AT  W: P`O0P @TH`.@ 0@P .@ $ (.@0P .@ @.@0D@08fpW.`@.@.@v 0.p@  *b0*C0 8 A@M.@@ PhF .@@.@0 @p.@ FKPp.@ 0{p& . @ 0p.@*g0 .@*C0 A8 @P 0! C P  $Mp.@@ P  <68fD@R.0@.`@.@.@q !Lp1   P% @ p@D8f<6.@.@.`@.0@P @T h.@0! p P'" p[fJpPl.@W pP ppd.@P pp  L<68fD@P.0@.`@.@.@ MP.@.@.@@B @ PQAh DcP'@[U@QP7 SP ?C!@p^WP p?Pp^ZP ?P^YP ?PrJ!@m pH(@EQ`T'XC/@@ X.@.P@ (hDQPPQ gH5P  ZP.@.@, OP '. @P  T(@!@ +RPj!@ 6p!@ 1u!@ , P @P P^I@!@㬼P1!0@!@1!0@!@  "@oQ|OH-i  (@!@QpOp@-@.@7.0@PPUp:"0@1!0@ (@`!@ QX/@P UP U!@U@ %!@0p@QU !@!@ p@Q !@ 0p@(O-TMMR hp!P@/`@P  3HuPPp GP gPPH(@PU}@X %P pp Z |@pY P@ VP`@"P@P Q WO gp ap l!@Vp j @"W p{!@Z p!@ X cp @P @ADP!@@"@! @0ダj @ מT!@ـ!@ рH-h  (@!@PlN@-M@#P   p Ѝ!@ ᯀ0H-M@PŽ 7P P Ѝ0谽"Pp H-P@P Q `CP <P`P CP rQ <`V@-@Pz P 妮  n0H-('@a1S  @ P PU  @S*Q0Q aD A0sPQ  0 c A 0C0H-KKH@-`(*' @!R0@T 0RQ ` @ rP   a @0 BH-HH-MMHH- C(@0 !@lhM0H-H.@@Q0wP6 LP  j3^/P@凧(. @ყ(. @w@.@@( P.@ (*' @!A< *q000O-,MPP_U.J.@P) .@X# ! PP !rQ 0p 0R (@㰰(*P , R P 2/0 R  2/ @P!p0@pp$p ppS pQPPP P `PVT `@`Q|l  P0S 0.@0 @sR Q1D@  @r  1 PUʰQ@ r R  @pPV`ӼtP1S.P@P8P 3T@PU  PP`` @PV` pPV `Pp@$.@ PS`/vQ  Q `@ @`R .@A 0PxP? vEP j(@  0` 夯 Q /@孬?dA(`@PPPvQ+P @Q0SP RPG@Q 4l@=P P/ <Pi>P* ?Pv < P4@ Q0r`E RQ V p1 AR#pa0QA ! dR(`@/P !30@SlL4x"P0A@0 B0!ARQ 1A0C?1wꆒ$pW n/`@{Pz 0㑪P PӮ$P߫/@刖 pP`U$ p`P V P`Q VԮ/@w-8 !0@ 0 GDQ(@@/@ PՀ PpP<P >P dP  P@Q:P wP uP qP!RP SPU PQ  axP .@EP.@PAqP$@.ᰚ/@Xwd((`@A =d(`@ dr0(`@!pS B  ) %(d(`@ xPQ zPaPxP@a@(P(@P  lQ w P ԫU4R``  R  2/pU P!PU   G v `P ۪ + `夫& `.@1 v P Ī含P 'Q P`P ' P`qV4 R  2/ PPP  P,Ѝ%$0.@!@  $ !@a0 @ @ 6.@ !@1 @ p;LIEO-M@Q`vp' QP- u `TP@Ug 0mUP` p` =P@U 0WUQ 崣p@ 1`VpGs\ R0A0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`P= !VPUrV !   P (q 0% `PqUP 8!0@  u!A ЍOC (. @ /Q/A(. @ R .@/O-M .@Pp*@.@0 T` $P4 `  ᣱ늠`P   @<"$P   4 H0,!0 S , ( X%! @, 80@D04<Pp岑$0( 8@Ѝ@-PJ.@Q .@A P P, A A @ @Q/Q//0H-@ .@ .@P@U U,U0/bU H-%0! @cH=@- Q@縷$x8иT .@P` A? .@ 8l(. @3I'. @.L) . @B) .@  "0  .@P  .@  # f4. @p0@QP  CJ&. @ @H-M .g Gf=ЍQ/ @P`p) A. @L$. @l(. @I'. @L) B. @g Q/ 縹ȹع" F. @J& . @0  .@Q @.@ H-M .g Ghk=ЍQ/ `p" F. @~I'. @zL) B. @vl(. @rH-M .g Go=ЍQ/  ,<L" F. @Wt) . @SK%. @Ol(. @KI'. @GL) B. @CH-M .g Gp<ЍQ/ 簻лK%. @*I'. @&L) B. @"l(. @)+ @-Q@4\x8l .@Qa A4l .@ -k). @.(l .@  !l*f4. @p0@QP  Cl .@    !@l .@#  @I @-Q@|Խ,@d .@Qa A6 .@  / . @J* .@  #* f4. @p0@QP k CJ&. @ 0  .@P  .@  @xN]Q Q Q/) A. @l! c. @hL$. @d0H-Q0@(<TQa A"! . @  P!@hPP    C0H+m8 Q Q Q/" F. @! . @t) . @aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-f!@8H-YH-v!@8H-7H-P.@H- .@^H-(H-!@8H-:H-:H-:H-:////H- .@,!WH- .@,!WH- .@,!@WH- .@, W//@-@0@-@;@-@4@-@q@-@/@-@1@-@1///H-.H-.H-.H-."2H-M3  P.0@ ` A 0 ЍH-M !.@ 0n ЍH-Ml.@ 0\ ЍH-MI.@ 0J ЍH-ML .@ B08 Ѝ0H-MC .@@P  0P$ SЍ0H-M f$.@p @Q  tC @0 # 0d Ѝ0H-MS .P@@ 0@ P D @ N @ D @"7N @7Ѝ0H-MJ.@ 0 ЍH-50 .@H-P.@/p@-P@`0!@ p@KlH-M .@ A0 ЍH-ML.@ 0 ЍH-Ml.@ 0o ЍH-MI.@ 0] ЍH-ML .@ B0K ЍH-P.@///////@.@@/@ .@!@/H-M .@ e0 ЍH-MJ.@ 0ЍH-40 .@/H-M .@ e0ЍH-Ml.@ 0ЍH-MI.@ 0ЍH-ML .@ B0Ѝ//H-M .@ e0ЍH-Mt .@ q0tЍH-MK.@ 0bЍH-Ml.@ 0PЍH-MI.@ 0>ЍH-ML .@ B0,Ѝ/H-MK<.@ 0ЍH-Ml<.@ 0ЍH-MI<.@ 0ЍH-ML <.@ B0Ѝ//////A!@/;!@/D!@/!@/!@/!@/H-Ml  .@000Q  aAЍH-Ml!.@ 0ЍH-Mk.@ .0mЍ0H-MlJ.@@P  0PYSЍ0H-Ml f$.@p @Q  tC @0J # 0d7Ѝ0H-MlZ.P@@ 0@$P D @ DN @ ?D @W4N @T4Ѝ0H-M  !@  0ЍH-P.@Cl * .@*J" A//H-M .@000Q  aAЍH-M .@ J0Ѝ0H-MJ .@@P  0PSЍ0H-M f$.@p @Q  tC @0 # 0dЍ0H-MZ .P@@ 0@qP D @ 㑁N @ ㌁D @3N @3Ѝ0H-MJ.@ 0KЍH-A20 .@ * .@*J" A//l A.@!@/l ;.@!@/l D.@!@////////H-@-M_~ @P  ^{^ЍH-'0H-P p @?~ ~00H-@p P0~{0H- .@ |,{@-O .@@aP {H-~H-~0H-_ @.P@ |!~ {0p@-o P.`@)Q y,@ @ |Az 0h~pp@-o P.`@)Q `,@ @ |Az 0O~ ~pp@-o P.`@)Q C,@ @ |Az 02~|pH- .@~0H-_ @.P@ |! z)Q ~ 0~0////!@/!@/!@/!@/!@/!@/!@/!@/!@/!@/!@/#!@/< @/(!@/>@/@/ !@/-!@/////////H-M .@ A0ЍH-ML.@ 0uЍH-M  .@ e0cЍ/H-M 000Q  aAIЍH-M  .@ 07Ѝ0H-M@P   0P$SЍ0@-M@!@㏫ P tC @0 0 dЍ0H-MP @0 @P D @ N @ D @%1N @"1Ѝ0/H-M .@ e0ЍH-Mt .@ q0ЍH-M  .@ 0Ѝ/K-@`!PRp  " RrǠ QX8!0@̐r> !0@ŐQ P !@f!xR Uaq wRb(q (!@ fY `M80S  3/PKQA-P$.@U@& Pח`җ(.@pPU5PWP:,x`.p@P &P`4.@0.@A-MmP(`@8.@p @U@-  pp' P 0ㆥ 0p pP3Pu !@aP @@<.@@Ѝ0H-@ &P (@PuT<(@A0<.@P:zP 8.@P*@H-$.@i0.@4.@$.@啕$.@娕@-@$.@i0.@4.@j @@ MH-M    $ЍH Ѝ/M0H-MP$.@@ 0yi0.@4.@( Ѝ0HЍ/O-M,X@(.P@.@0 <>$40DhT.@.@.@.`@ @P T(P@ 0@ @ @ 0@0S 0p0@ @ P P3P@.@P 嬖P 'P !@.@]P咖P    @ .@ G@Q.@@ `Q PDq[ prWnVUEPU ~Dh.`@ [Dh.`@p ~pGW  T 0T!@pP D.@(P@32PfP1P ~厎@.@ЍO.H-j @HM@-M@ 0' Ѝ@Ѝ/H-Mt @ЍH-Mp$.@`@Pgh0.@4.@, {('  0`ЍO-4MXp/oo`"P;$@.@e\ U,@`pWP !@ `,@BP姕(妕`嫕$` D@`@ 0 (@0P$x.p@3I 0PP@I [@I[$xPtP Q.p@  ARPAKQ,$`(@0 uU s2 0@ AᲴj@ `?yP~PZZ? Z_P뱞kAZ2Z6 AZXYIbZ` ZOY(@  AR0 B00@PPPAP @ @ P, `K  `Z Z#`u Y', K APIK`j[Y [P ,P ႦP`W Z [(@ ? ` P D,P K ⾍ P`:0P $ 0( @$.@e}0.@4.@ P QP ,   孢,4ЍO !@ @, 嗢p@-M,tg0@ `@(4PpЍpO-M$x@.p@P`|wHDU

VUP axa$ 㧧_Ѝ +(@0  !@  .O-M-nM M P.@Qf8 ## ! @pa㊯PD`<PF @ᯙU@*K@@᎗ nᅗ(@P`|s !@!p@ᑙ@ PpW<劯< iY⊯3Y iD @ > Y 8P P :@  0@aPp Y 0o  0u,@PT㈕8.@!@p0@tb8@7H@p PP.@`PD ㋕@a  yP @P4 $$ P @! @0. ( +0㱔pP !@ 0'KXP.@ @ (0 㔔p 6 !@m!@sPV{WZllP.p@.P@.`@ (@PAV{WZl.p@.P@.`@ !@~P<@ns@P T `q`40iv (@ᢕ + ϊL%pc  !@ P㸀] N.@@0 BPS @.@@0 R` X!@ @4/PA : !@)  !@% ] !@!  !@  !@  . !@. @ P  !@ 4 !@  !@ !@ X !@ !@ P)  ⸀~ 0K !@ bP< * @ bP5  !@ bP.  !@ bP'  @ bP < @ bP P P  !@ 0mP % ! @ 0P T .@y !@bP` GP  y% !@! @ 0FPF 4  O㽏.@@,(x 0vw 0qPXTO .@.@.@@ V 0P <P Uy.@0 T<P sz.@ U .@,. @QP** !@@T .@+.! @qXIP.@@ ד =  CP .! @[O P.@@  '  -P &/ .@! @PT.@<P 㤓 P  /! @+P 㓓  PPT.@E`P P T.@4A> 1% @! @ 0,PxJt?Q5 !@P@ !@ U,. @{0} 0T .@| 0U<|.0@.p@ @PK0 Q !0@<0R S Ls\p.@@.P@`Wp0 pV` `S0 0 V;W* @. @.0@pl0.`@S0p 0W*Wp0V; p @. @.0@ppUPM .RrF R   /!@0 p  p* P!@Po2P< .@H8,(8,"U !@4P 㡊P.@ Ph.@.`@P7 r !@@,P  @!@ [ 0!@! @W .@P  W*!@. @ X.@.@P  / !@. @ !@_VU .@Pg W' s  T(U<.@!@. @.0@@k !@F0 `+ .@@ A+ W{P  0=0P:.@P-  !@+  p!@ `.@ GO  !@}P N _ (p!@@PpPNX.@ (z> !@T(U<. @.0@V .@P VK.@@ᄕIF0P P X !@s X)!@. @0Q !@oʼnnߍ ۍЍD.@0S A "!@ ㈈ (@0d  !@〈|)D.@@T B>(@p@-M!I0@L PDP i1U .@ 㗑0 PDP Z1 .@ ㈑ `p8 PP@ @$ A`T.@(`r8(L PiUF .@ `#GP  L`P@.@@ ~ zGP"@PЍp0H-BMmCPP P.Q娇P @V .@ P.W .@V .@ %Bߍ0H-VK.@@᫔WzP.p@ᦔ`.@!PEPQ.PW .@P Ol.@@!@!(W.@!H"Pt @/!@/K-!MpP!@ÕPPH 1 `@!0@` A: 0`9@p1  !0@-P P/Q/pI/P @1 !0@P!@1t7 0@P! `! @)!ލG-PB@U' ; 㴤`!@(@pW Y /W P EQ 0)@  ކP p`T:H-MQ H .@@S60J.@ /RJ  .@! @)Ѝ* . @p@-M@P.@P  @ Q$  .@@EH .@"6JV0.P@`J@ !@@/P H .@o)60 /PP.@Pd)Ѝp@-@%# . @@=p@-Ml.@yPns@P H l.@.@ I.@.@ & x@P  ) L4!@. @.0@Pp B .@H l8!@@.@.0@ )I7.@.0@ )@ލpH-BMP.@P P TY.P@ H!@Pz  !@.@ .@P r !@F6~.p@P ` !@>6 @" T8! @.0@(@6@P* {5' 0 !@@l.`@P G ,!@. @ !@^5' 0 !@P 9 `!@   !@ T!@.@UQ !@U,<. @.0@ !@` X!@ @H6P9 P15k !@}d !`@x] !@tqWj.`@P x W*!@. @f U,!@. @`P  /@. @V(V+@. @P9S !@J !@SP X!@.@\P  !@V T!@.@QT S̆BߍH-pP@ p `bT.@ pƎ 4@G-BM@`!@㑓PP tw p@c P HL .@.@X F !@0@PBߍBt !p@ PP  P@/!P !PE @/PQ !P "@/!@/Q QcH-M @  QЍH-MPD 0p@!@ pp}p( P$ `D 0p!@ ppx}p  !@wP ~ !p@4/P kPpЍp@-@  !@ `TPPX @7~UPp0H-<&@0! @!@Q P P SoP P0H- (@ O-M`V! P@fp ȍP ~P PP `VЍH-,(@ K-Mpp$a g1PFP @H0L! p4/P pP 1/$qp , !@p@1/pЍO-lMP P< 8p@ L03/P' H$ 0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-M-UM0zpLpؐ ἍR .P@4@pPN`/@@㔠0p (@4!V @P#Q4"ZLpN/ PhH㴏 8X .@@.@0.P@Q N/)P p őP 0 }ϊ ֌ "ь .@ ̌ p0! 0P040P8Q@Z,L1H!A Z@ZR$()!0 `(KHaLa及 .@0 S< hH.@@a8X .P@P[b4bLL P .@$ $ (aP,qP,q048aLQPH!0 2 P.0@0S'tg `@@#Gp P`P@B$``P;$B@BD.@P H!L1L  !@v&@$p$AB :0<<8<P P, 8 .@]P  YP&Pw $1/$@Q() N}Pr$}PmK? /A$ePW @$48aHL; ZXF X * @! /!!  Z(:0_@p@X BBP` pzoB@B 庠4@N_T40PL zOU`0 0 4|p0PLp`zOq R@  0z Gp,W L@j @ M,LLpH {!x  0 p LL`0Pp PXJZ,X(P { hN(@@" $ .@@  .@p {  .@ UݍЍ .@[J [p8Pn AlQ#0B"@/!Q//O-CMMo .`@ *Q Cߍۍ)Q; A_& 0! @3$ !@ P P  A/!@ Y4F !@@0A_! 0! @$ !@ 1P 6 A/@!0@\ P60@p 3{PP A/P4`p4@00Y WPp`X:5;x@B!P PP4/P 0P  P ;x@B 4/A/;x@ 4/< Rp B<@R0PPdSdSdSQ|QR A!@ w !@!p@p<@RR} RP00S & ! @w# A!@ '  ! @!@pRr 1RPyi A!@ݶ{w @!p@n00S ' ! @P#(0S P' ! @G# ,0S P' ! @;#$) @P@ PT!@$ A!@0ᦶ=w  !p@@ !@!@p1(P,Q J' ! @#P A!@ ኶ cw !@!p@$ !@P !@Az w !@!p@  A!@o w !@!p@P0)pR00  A:tA?!@ Y  3 .@P A/A/@T pJ/A v0PA/ A/\0`^K-MMpQ8 @ P `!@  P- `P & !@P$  VP!@0,p W V`v @   0`m@PpЍڍ p p * YlEPT@PPJl@Q !@ 0 !@ 0H-PP 0 S,0S ,\ SH蕍 S:8 80S:^3O-{MMO p.@@*QD !@. @@/`. !@D.@PU .  0!@"VC B !@8`)QH v ,P7 N@H< !@ wP$ 䩝ܙZ @2P qPJm@p@U &@`PFv T:0S & !@ ~ LDPP Tp@ `T6 (P P PS Y v0 xP   @  0 0;5/ P<zt<Q  @@ !@ P" O  @!@@`DP(\ ZZZZZZZ[Zt7<@ 0@Pv+և8 !0@8 !@ tP$ DP P  sg8 !@h$Y ,' ކ  @@P @ @!@@ !@㏌P`@ 5 !@-' ! @` !@@}PY @ tG) !@ @@! @$  @0!@ ) ,0x9 ! @ (`qi !0@iY 0!`@!P@`P@d !@a08<0<  !@ DP r8 0!@pp[.: v# bํ܉w/ P`V 8 v/!@B .@@P@A8P !@u !@q !@mP  " !@. @dH H p!@0pLT; !0@qt' @  !P !@K? !@2-E !@/-K !@,-P T !@&-[ !@#- !@5K~{ߍۍO-$MMP $ЍۍLdJ P`p!@!@@!pPpG`w @d ' !@! @bP`@P @G@@P@s !@88c㒫`@ @`@O  !@@!@ @8` !@!@4`8$(@8D@dJ T pP`!@@<@PP 'P  !@ @e8 !@ ` `!@X84` $(8PEuG Pd !@@!@ yP P !@ @98@c `@!@ ` @`!@*84` $(@8Kp K@Pn+P3 .@ !@k.P @_.P )B @!.pB@\-  0 g@d@pW _# j.@ @ I  .@)Q @! 0! @< HP2 @P+P@pPT: j.@ @  -T*d0`48 xP  0;`5/P W + +; !@! @!0@0z0x0H-P !@ @HP0/-t' @ @0H,@-@.@ p8@0H-M .@ Q! 8 P Qp 0@ xP  !0. @;@5/P A.@@ P½PPЍ00H-A.@@P0 P㳽P0O-MP 㨽PZ@PM  ᛽PHJ@ ᩈTE `BI(@ wOp@P R USP  OSP   P @DPPP  _p(@  @T 9 Ѝ@-M @ ^Q Q P 6 0@PuЍ0H-*JTR0G-MM8 .@P, @,T A4^ QP0 `$P P0`AT4`0 P ,Pf.> 8 @0@pA`@40(@  0@78 R_ P4Qm @0R 0pW PpRaPVW:( R1/4@TQ* 4O@@pp@P@TBBP0< `Y P K? O9P 0P4PP 0`4``N@TV  y P4Q @0( R1/4@T:0I ߍڍ`[H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU 0Q03P  L03/P P `V:0Z `Pq Pl (0$`P5 (`$,q P) P 0QUQPU 0Q03P@ L03/P P@  X:0`V( @< 0`H0  m``` p 4<`8`P$`4`O8P  P 08p<  $` |zPtЍO-MpPlPF ` Q9 p @pp  L0 3/P# " p. @p`0t <P 05! # !@|P P r `rpY: # `Ѝ0H-@P0P 0Hhp@-P@3`Q,0 @ p@BA-@ PQ ` 熁(0S `V:0S P0QqPWS:1/AK-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMP x`p@;p p6/P  @;x` p p6/P Q  0!@-oBЍۍG-vM@0!@p  `!@P HP PN㗂  (@,(@ Q Q `P# a'P| ``04P A% @` P u+ `0! @XP[ PWQS @qPO fs@P I  @厹pj ` p.P@ @.@ :@ }$@0 LPUF@Y& @gP; &P8@f@#P2  !@P- b/"@6P' K?ntw p@p # 7q܄(@ G0 PPB@+ ! @ 0`@FY.@\ ŁboPL @ Q唑P P3 JJP㩁@pT ⥁ KXD0H@`L `P\`TrP P" K?tg `@ ` # Y7+p @vOP3 p167NPEQ, FPXQ( g!0 k &pA0d 0^K?^tg `@` # !7+ ! @p= ,@`70 pP(Q0030SP'Q 0W0'0Q0p 0WP07@&P: Q@ RQK?^tw p@p # 6+ `! @ 0NPPPvߍA-S `pW WW`V  0B pSW WW V F0\0@P\``vp W:v\WQ Q `&c``aa``a`Q p0RO-dMMpQ :j !@P P dЍۍ  !@`P `!@لP v/t_r@evGVv6 +p/r+ pB(P \R R 0S  8 .@@PU1 $P R 2/pcQUo .`@+o/+roP1`@PaUn:78aPj+o .@$P R44 @_R' P.p@[UP K? 4P ` R 2/p1/ .p@N_[p2/p p .@P$aV /@;x@ a㏇㉢ p@!`@@@ P) P$ ݃P p @׃P  !@уP  @˃P FO!@  o  o@ aP FA&P  jp @ Ppppr /O-M aPL03/PH t R 2/" p. @0@ P 00,  ! @P @ !@ n nX @ !@ n nP P..@j @r>ЍOo/G-M !@!@0!@.@Rfv' S0!p@. @`PW0C$s`0Qppp+G.@@W.P@.@.@P`.@`េ@pᛁPP@pᕁPP@pᏁPpPP, t7P! @ 0@PR.@ЍG&H-M (!oЍ@-M@ !oЍH-M !oЍ@-MG.@@ 0  l/ @ !Ѝ0H-]!@}^\ @P@## !@`0HM0H-M@ P$0 Q R  !@0@ Ѝ0HЍ/ !@ G0H-MQ H l.@@`#J@ JV0H !@@.P@.@ PT#0.@ PЍ0O-$Map V @t"X @`!@.@!P@.p@t @P N !@=  0 P=  2 !@.0@'㝰P#@`pP. HPL .@.@ "J.@ !@ 0Pp` @ 뜰P!yP! a! - @$Ѝp@-MM @!@fP  @ KQ u$f @QЍۍpH-MM !@pfoЍۍG--M( P0TO0L0$0LP$klX.@ԵP`  PmP H l.@.@ |I.@.@ ~|PP}.@ QP @l GPoJPmx @qW W .@.@&dP4i .@?*  @0@ t @T0P" l 0 PPPPPPp1 `mTETt㐁! .@-PW pI .@@P N !@ncQUU܍ oRP4 " 12 !@! @!0@ p@-M @.@P+ S " !@. @P#p .@HH lJP a .@!P@!`@.@@ 0&I.@ .@0!oBЍp/@-pI .@@PN !@@-@P b7H .@@tp@-M  * @P(  t) 2 !@. @.0@Pp .@M lQ .@KeH !@@!P@.`@.@ 0`I.@ .@0`@Ѝp0H-MQ lM KU.@H !@@.P@.@ 0I.@ .@0Ѝ0.@ r/0A B0 /.@ P/ @/ .@0Q00A B r  /.@  /H-7M(@*{(@ 0` .@ @60IP0```@7ލ0H-P.@P +T A @P,UT @D+U@K @@HL L@@ @ @*T,TS0X- =  @ 0@ 0 0A-q +R&K g.@.@ P"@@.`@p0+S ,SR  B0  pT 0T0 @pGw7.p@.0@ w.p@p@P !@0Ay:'. @@p@-MP@Q Qm !`@ % f !@!`@-P` 0ЍpO-kMH @.@`P J.@t PpWHL) P.@. @  U$ ! @0P][PQ 1/pPtбSP  P [ .@ p@\dbV[ .@? Y P* !@X R  !@0{  !@`ᤲ<V [ .@  j @ar .@rpP0 .@P   !@.@p[   .@kߍ@-@!@z~P @H( . @.@Q .@H-H(L . @.@PO-,M@}p$@oP $(P@` (``@ `$VQQ P*| (p@@A$o@P@PE p$poP@* $`PA( (```$VPP Z*`H z p@`  |(p@$oPPpP |@D@P,Ѝ4 ! 1 !@! @!0@/( @0*S/.@S0S 00S/0 *S/@-M   @!@0@x POЍO-MM0 0 !@0 xQQQ 0 0 !@0wPPP lf㥝 p0@!`@!@Q%  ; PT笙<ZX]V!P@i[gx !@db`;Za .`@tjVP ȉ!@ 0&;{P ZV`*[Q .P@ 媉0<`q !@ ;PJ PHlf !`@6 P  00wQ;Q8Q6 p PU/ P UP !@ ! P GPs !@   00LwPPP] T!@ ЍۍO-WM@ !@` 3 .@0S !@ n .@(@PP 0ᴇ C*U.@$@X 0S   R *R*U`Xq  Hi (p@!@.`@Qd QaP @L /@@mԮ/@Zp@p .@P N !@@0 0a vV @&XP P P* P P0+S ,S *S#Q APP @$PXpG @Pp*U$ v P  Qo0 `!@ p .@1pZ) P  !@.P&P 5 !@l !@ !@P  UpI .@@2  N !@ !@ .pI P.@@ !@(%P( ,0"#  !@G !@"P  !@<  !@!@PP N !@( ( @!@0@uZ  Qo P  T!@ Wߍ@H-M 1Ѝ M0H-M@X !@ @P P3 !@ : !@Ѝ0H Ѝ/p@-H(@PU jD ` @@P P  APUQppp0H-M !@pP ;v@O.@@ P J !@/l !@ .@܍0H-M !@M?@.@@ vy@.@ .@(DqHQ& .p@.P@! @0`  @ NKx @Vn<C#  !@ @H0 ` 0 @ 0 P`0P$JR(P@@tC,n*@0 ! @% !@)P ṷCnߍA-M`BO P @ u  lP`G D.@U.@ (A0 !@ @@!ލH-<HcCO-MT.@@T(@@X.@P(@TP Pz.p@@TP@@T?.@ t` xP@.@U   @ Vl |Pb @epeTU .PR  &u cpJ (@P .@P UPB  uX .@P7 X.@  u(@  P  P" Pz@.p@   @   !@ePz.p@P@.@&X.@p{PrPz.p@d3 0@ \eЍ@-M@P    .@P ЍMH-M  0 ЍHЍ/O-MM@  !@j  @oP|JO !@j @ePrJg !@j  @[phIplu> @Pe IprP@7Po p WPP` @㙠`w BtP `=P j @ ` 6P w8u8VF RP *@P!þP3  ?Q* 9PKP-q#P v P rj- @ 㠾 .@mPЍڍ 48 18,P )R PNH-M |Ѝ M0H-M@X !@ @P P !@ 7 !@Ѝ0H Ѝ/  !@!@"@- !@@P !@ P !@@P@O- MM  @nP2 %P2 @#P# Xצ p`P@!@@+~s P* +c T  +c T㟬P P  㑬o᠂ Ѝۍ @-@vQ| @!@ Ao@-@!@ xP l(I. @.@Q .@H-PP~a P#@Q/p@@U.`@ P ut h2>/>[[-V+VlHl0H-M@SP@6z  (@ !@ 03  !@Ѝ0@-M@zu z Ѝp@-P(@@*Q `Q wP *Q`@T@pK- M@$*iP Pp` pp p]VQQP:$iP ЍMH-M00 @ 0ЍHЍ/A-pP`P@V ![s P P8/AMH-M00 @ 0ЍHЍ/H-H.@Q !@ .@ !@ .@ !@ .@!@ .@@ .@y@ .@H-P40 0 C 0 A AH-P40 0 C 0 A AHO-DM @`P pP L03/` PU:pP K ` PVF pK L03/P2 剁i(PQ "0P  q PPPR $04@P0R@ S8p,00, SX 4 T\0 [2Y1:PDЍO-MP  @ @4 A0p W[ Ѝ@4 0pS RP pP P`4P!ip Br U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P pP` L03/P `V:  D@<08 8<P@ D01/HЍp@-PP` F@ P p@@-@ _(]@ZA-@PA pag0 hPUpHpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:AK-M @ ㈨p@ P`p@@@  @.@ :@ }$0 L@nTY@i stG @@ !@ QpPЍf@P  !@P I@WTO-M7PE B !!@ c0  !@ PU p@l pPa@PP# @PU! @p  Dp@{PP eD p@T  ߍ0P Mr @!p@ Q R@T: Q4`!~B a0P!@ 0 pḧ0p  esPR.P@+`p  >PP k Y᫧ 0T !@ a0Mt&(^O  N q Qp @ဧ 0!@ (  @0" 0 Qtt.@0@ S 0  0Q00A B r   " /H-7M(@P`*o0 a .@> 0@` P00P `@ŹL7ލ.@0+S ,SQ/A   .@0+S ,SQ/A  H-M`Vpj@p}Pppb !@iVk  !@!@V !@  Va !@!@.`@&h@Q4:Ps P)[PP  .@P t .@PP  `!@ `X @X@=P J 1 !@.0@ FY t) 2 `!@. @.0@~P.@QB@bo(`@ ` g]!@T( PPy ! P. @|Pfp@PPk t' @PP& !@0h`*oRWP.@Pf ]!@'۸PP@ .@P8 L.@PP1  `!@ `X @X@P' J 1 !@.0@ ? ) L4!@. @.0@`!P P!@ 0` !@ ᜦPUPލB$ ! @H-MP' @Dq.p@PbrP P% `C@HQ.@-0?.@.P@A! @`,  @ YF(@P@T PfЍH-@1`*.0@\0?. @.@.@ !@-@@!. @ ?.@ bm\!.@ `.@grH-MM` p@;@+p  Pp q@t`kt`ЍۍH-|dP@`L P DP p P P  P zDH-MM @`;P`X+p p 0V@%`tXt`@Ѝۍ eDO-AM@ PPAߍP` L03/P  P@U: АԠ,( X*$ L03/P  X: аp  [ ,[( YY .@ @ 0 p, (0p@ .@P`$ `  !@pP  .@0`  op  0o`P . @@@0@P ` P 0iO-SMPP@(mXP@1hT㘰mJ `Vj:T 40@ YVp@$psPh 0p8`!@,P<@Y@!@ a LP !@@ RR@!@pP8 NRAX;p !@ 0 a<@ @H1/ @Pp`0dp0 ppp3/P5 e  I803/|P`$< .@!$Q ,$  @ Qp!@<40 8L0 d3/Pf P @Pp l4@ @%  @  0 0 7p` 00  @F`t P6 Ỻ@q: p<@80QU Sn4P4P@ PP03/q8r L0 3/ |`@D0@ X@<@Px``TPH, \ \T<@!a8 RK Ba"p,V,PT 1 C"#V @BtS: q8d 0@ 3/P2 T `Q4P, 0 `V/  0S# @0d`4 6/P P ܍0H-UH-2 !@H/O-M-ZMh@PTU tP o(@(P.`@Y Y Y .@$LHP M) ! @ㇹP X;P3 ) ! @z4P3 PM3-`n) ! @0fD.@X (`YW 0!@ (`PWp(Wo2#.`@73L) 0! @D8Y  lk).@.@. @P`P P P 䍊`  @/@LN/@@ PdL<E D @@& F0hp0  0pPPPE(@ᎢZߍЍ .@/%PJ|PCQp@-@Pۭ`@׭ !@0p@SA-MY @!P@pg@DP.@ `W 1!@`V !@S !@\ !@K !@t O (!@ 0Ix !@ IGTP ) 9 ! @!0@) 0! @P㋸ !@&2P 0 !@ +J@-!@ RPJoЍ  .@"/0H-_@.P@Pb !T0  "D.@ Q0( 4 .@ (0@-@.@PH DQ, !@@t0H-@P@o0@-M@ HQ T n ЍЍ@R@-O.@@P x!/K-.@`P P (NpOO QPP R 0 RR;p@DQP ` A A @1 0 F0PIW# (  Q$0X, @!$ % Q K-0Mg @.`@ PrP ЀP 0X0$ 0S!*P    PP9P QP P  R 2S  PP0ЍK-M⺛YB0P,`(BpW@T V `VPY P\apHPW :X X# Qq^ !@q^ B !@ !@G !@ 0 Ѝ@-0M@    @ @00( P, 0ЍO-M.@pP  P vo!P0APP S @0SSP`RЍȰU P0p 0  ]((Q $UP,QXQ  0Q  PP Q + $; !@! @!0@e4O-TM@<p4`,$  e@8  `2Pv (@D` $0 R 0@, RRH `L0@8 R P T  ^PP T0W .P@R 080 P@S 0<Ġ⺛Y" 0` Q BTPPQQS S S @ hS:@Q@@bTb 0`Y P @ ( (Q $TY.  *$@`T& u"  @ 4QP   v]P 1 (p Ps 80  RTЍ0 r/ @ SYH XL0 H  @DL QG-G .@@\K T$ `p0SRUSSW W W P FW:PSPP@U@ p`T`\( p'1!PE Q $0T`X ul QP vO !  @@@0H-@PLPP  0O- M0p4`pppQp@ pappb@Q w1 Q, w* @TPPPUPPPXPPPUP PP@(0P @ 0  T PD" P%00@@P@ pGY ЍH-@+R 2 `PpWpW V ` SPT p !@ RPT ^˩  p"` pG pPO-DMM@XP \P `P dP hP H0  O0P0 !@ 8 8pWQ t 80`(p@PPPQ PV`:pWSp!@ a @9 0:W` pQp S0pPPJD`l !@y@Pk ~ D `!@  !@ `0 d !@\h 0 !@X  !@ P- \ !P@!@ @p)ap! @0  p PP  p !@ @X  X: !@D@  !- 0!@! @0pPᙇoRDЍۍ + ; !@! @!0@p + < !@! @!0@g + < !@! @!0@b^ + 7< !@! @!0@U + R< !@! @!0@LO-$MMPCP @$ p;p7 p e0 D`}pTHtPPL$WXQ  h` @ PE Pv P P  P%q P  $ 0PP  M Q t 0P0P p[:᠅ 1 !@P㭳P$ Q:P a0rD`V `VpWs0CQyp$ЍۍpO-M-8MpP+`PK PF ppp@ dt PpQ p PQ {8!0@(0\0 XpG(-ϊP !@ `H `|(  B䐄 8ЍЍ/h/p@-M@XP \P `P& dP, hP2 P0 Q&Ѝp A- ; !@! @!0@g  A- < !@! @!0@h A- < !@! @!0@i A- 7< !@! @!0@j A- R< !@! @!0@kH-R0H #LH-H H-P`/b@P p@H LPaP:a@P*Q P @ R R@P@@-P @@ W- f= !@! @!0@ᚯ@- r @!@ひ@0H-@.@PսT T@HH`H`H`H`H`HxHHxHTT T  T T@ P"T0A-Mo@.`@PP "T*a= w .@.p@Q (` (0S0  R4``U* ⦿P& P4PP) " @0@` @$ @ F[pm p処@ @* 0! @O(``@pEЍ0H-_@.P@PqD  Q "P  .@Q ' (0D. @ S Q4 p0O-$M H 0L rX`0SP\p YPT@QpS 0^0  0N Pp0 NYp [Pp   ^ T  YP `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP@S@@@`Y```` PZp^TT@ ` p 0NPTp ^P pY8 P  P   p  p^T T` P @p0UNPTp ^Pp Y\q:p $Ѝp@-g @.`@PPj`r0Rv+Piv@ 00  S@ pO-$M  .@0 QA x!p@ P - LP@ݑUP U [ ` 0 H6/P Ko Fo@P  0H  p1/$ЍG-@P# Q 80Q 3/P41/P D0/P@41/@K-㡹D@p Q!@` 0/P``pWV  .@` P.@  TR!HA  qKqp@-G .@@Q W `.P@! R 2/`V: .@p@VH- Mzpw 0@P UUT @U@00@P` VVU0V  PP@Q f @0  !`@P!@ , ЍO-|M1/H1/4 .@0P1T!sP 0Y, [(0I4p8P0`0 ` ( ,3/PpoH`P ! @ A A40 eQ  DX 3/ p03/pR H L03/PJ QE pH L0p1/>H@$ $p40 ( 8,  7/P\ 8<RLHdh 803/\  p @03/p 0[ypp|ЍO-M⴯ @.@P )`Q(P ЍTP - = !@! @!0@ PUa  .@Qq 뀁.@  ,0Fp0`@@RQ0.@0 P``噗p &0PHpTPPP@H@Q@ LPHLPJ4P `P TPQ `" R pQ 2 !0CPpW:T`V:P Q TP :@PPT@PT:P($3pt P` @0(C0``.`!0$(0 `]!@$Ţ$忢H`P A P0 A0S B BP @8 3/P XP@THH`x .@h"@ @ e/Q :P@, oH `A 0` `````庖p Pᩖ @,uP P`4P 0 ,LobP P  P* pHP` L03/P PU:X\P P`(VY`P FP R 2/@``D.@0S~  2!@ 3>xO-LM@ PpPD@ !@! @!0@/////G-P\1/ pW иP W  Z I0@@` @V0*PV`:1W [/  Y (". @  x+ @  !k! H"0 @p,  "o!0(> 1 p@0@ !p 0 A0qA Q h. > !@! @!0@yzO-Mp@@ܟP` p P ӟt @ 0Pr .p@0 H됰 D .@ <DP `R@ #X  p@@6/P( X\ 0 hhl 3/8qP  h L0 3/< h4pl0p `D @0REV@pPL[:A.@@NB %,  PH>pCߍ/O-MPQ `$@@`(ܴP `"!@pBU $Q $( @ Q "B@p@ЍA-@8q X R 2/P Q8q6 1S  `@ R   `0SP P $0S``0 3/< QP0`2 P$pPPVP*8G-M|.@PP[xB.@@›|.@DP㹛.@DPy㰛.@DPz㧛.@DP{㞛.@DP_㕛.@DPŦ㌛.@DP$ R p`(zwD p`P$ V:< 0 RZz Lvv(w`wwx"2. @.0@Qn 0@ b`8pdp``J 7/x.@@P(= 0!@ I @.@ 0C`x"2. @.0@ @.@ 0Cx"2. @`.0@" . @ 0 P0Cx"2. @`.0@p 0.p@ p !@p.@0x.@ Q .@ !@nލK-MP1< @Cp(0AS*d`08 6/ 0( 堝08 pp 7/Qh0 83/ލp@-(M@,0/`>PV $ @  RL 0 @ 0  ׎`p ᖊAZ(ЍpK-0M8q L0 3/P  ~@P |@1/ P@ p U`0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  ?` 0P`PP ٜP p@ 2/Ps` 0`PP 応P`@-@Q 0 A2/@P  j@g˙j @@H@-M@8q 0 3/P7 Ѝ@/O-MM !@G Ps !@dP GxPh  !@WP :xp#ʱ !@$@+>7xP  !@ 0!@ @!@ )x !@@+>xP  !@ 0!@ʤ !@@+>f !@ ỤP / 0!@! @㲤P O P!@@`+> !@ 0!p@ ᕤ# !@+|> !@0 ᄤ| !@|Ps !@p !@pPg" !@@+U># !@\ 0!@ [PR !@t@+?> P!@E A3 !@< !@P;P22 !@U묰+ >3 !@'tJp 㷟 @`(@!p@!@ 0j(P  0PE u P %WЍۍ O- Mp`N=@T> YP Y8PDP0 =p !p@Q:  =P J !@ 0jp @"DPP Y Y A !@0; ЍO-MMP/l@`!@ `upWP P J 0! @P+= PS*Ap/RPP `P FQ Q/R 6vP:JP vP+ P  Xi #7uP(J/PP& 0! @p+B=l!@+<= PvP J P+0= P:cD?`D@ "v $uZD@`ЍۍXP /PP) P`P @`@ PU  !@++- P*+%- P* up t`%D>"D@P`H-IAp@-M Pv@PJ  @tPJ Pt`t V P: !1qQ0OЍpO-M 0 ` 00 @(8p> DD T`C0   S 0 ( 0Z(080S 8 0 0Sp 0 p P  Pp`\0`0Pp P@u8 `  R0 8 0 x R@@Ѝ(C0H-0MA .@0  !A$@* @0 U.@ @67CW C@.@P :%0Ѝ0B-(M^@/P@#3(Pέ(,/ .@(h1 0@Fp`@RQ0.@0 P``gp,0%,嬉(0(`P,`((`(ЍO-4M@(@ ;P (pU 60@`0 p  0`Qp` @@:!0@81, 0@ 5 `$ V 0Q P ` L03/P  P U:PU  0`Xp PU@P0,p(EAԈ(E@4Ѝp@-M)@ʔP8 P `0000S0P`pP %+x@,u+ ! @P0>  ,+c P 9 @㨔*Z ^]!@㠔-R0 .@Z@+ @F.EW !@.@! @0 ЍpG-pMQJ@PPㅑe: 0 ` V  2" . @p 0<s$: @ r`T P v# $ p`! @ .@0 <: P ! @l w! @J& ,Papv 0! @(H0  R P5 ` p=TX屪+ @/ P 4 t R8qS TX坪`  P 㳓ps ! @(0{ p㨓 `㓿p 㟓s ! @p( 0g p`+0 0@0  J !@p V \U pЍ8=0p 0h`up{ ! @(02/`P O-M⴯ .@)$qQ `W W PQ% P!T11/PPP(0`o"P P`pH!L1 0 `1/P p$qP P pp`@ L03/P P P@ `V:@V?@ Q<@pR  2 p.0@0S P1Ta(h `P0l0S h 3/,tp @ p0#h`bpdC 0p\%0p`ǒpÒhb&T %0 `屒p孒hb '0 ]!@園嘒0p`,(P8T   @'|pp`  4 @,0@  .@03 0@P 0 :(P   @<0op `A0` `````嗆p pᆆ @,(Rن0ppW PX!\9GP.4|̛1/``pphl 03P pM`ph@l1! ,1/4pY<pAH@1/0` C(   ```4/Pl`h```!(0l0h 0 Q  01/ Pp 0 0LtPUj xH QpU_ ׆ p!@`@,P;Po `VppUH ,0 p(pW%  p0UU: ,p`e PUU(PU  BppV+ P^P BG0@ PX SR bpQb 8L0( 3/P px8 0 8p08 ( 7/xPPpP P t0 P |xp`tp`ЍpH08 L` H ( 6/P px8 0 8`08 ( 6/x@DxtPv 0 !@! @!0@ᡙcO-,M` p@.@ PQ/0`Г/P PT  B!/Z  P3;P pPY v`ِ żPV᫫P( ЩP) pp aƩP `P(pp AfRp6 4X,T  8sa,ЍO-tMP .@$hZ`P @ P [$Pd @  R(`nd` ``<<A `o  @0H0 ```墄 TdT*`$P>JP (LP7 P Pa(P!p ?P* p`@p@@b" dhR"p| Pp F)6 @0 8@Ph  p hl@ 4 h lh`o `tЍ/////O-lMP pP4` Gp Gp G0Pp`@W@R $0 000@ pPp0Q  pCP *.!@5P  P:R ,0ST0 S Qp < .@lЍO  a @ .@P r $,4`X( ,$PQ ` Q 803/P ,(Q  RR(  (  ,Q P  B p,P P*4Q4$@`G !@9P % !@9P GpP,,(($`P P p X:(4,$($P Q 8p` L03/P LPTP P (` V:(8 0 P1 88`p L03/P HLP  08 < P    R pW:H1/` [*k8q p  .@Ѐ@pT 0@t0@pW  0!k , P  0 2p@P@0@ X*S 0pP 87W!h0$ [ 51 0 7$P5 X*1h2(0 S&*1c20@00@WP,  QP@p`A R80s@0p @X0p0pP0@WPZu$4p W!*µ!P: 0` 6g [$0`p@Q@`V0 @Q@0@P [#* 0P` 6Y0px /p0S P  2p@@0X0@P0` PN0 @ Dp @P@0@ ? P<0,p@(W :Q*Aa^p q P rPU  P$0 00W* ^ 0@PPR6T!g0 lЍO-EMP@d0UhlR `80 R0P pQ0s  BYP pPK ఍pPH@V p 3hP0 lpp`pPW:!8phP @T pPp ~3h L0 l@3/h @T:PlE oq-A&KQPH@0㖥P` <H@H1/XPP ThRL D #"``PTX\Pz  0+ @p8q hh( L0 3/l0@TpTPX PLT0 @pz5\ PP\lp0`Y:Z6*l 劑jD\p< @  0Pp P P T0PLX `O5Pp !RX@`DPR` RP PUL< .@ElPhFH@pd (PtY @Ud H1/0W `P(``R$`_ cD`H@, @8\P 8`@4p,`pqZm P85 P g\p 08 4 pD @ Hd3/PM , tp0 Pp\\PU0U p8 0 0( pp00>/ k< K\P A0l0 , 3/p P\ L03/0 $0 P` (  0P`D @0p4UHdp@p0T:H@W P X0`Hq T Dp p @p\`N Zd@ P8q0 lpp0[: hQ|  0Q00XpT`Q0  dp ````3/Pl Dp @p00XT dp  ``3/P p\ t l`0p\Hpp,pW0X 8p 0 `T`:/ g+ Ad0,0R,P}l 03/Hp l L0 3/PpLpP`X T03Udv l`V~*Pp L0 3/Pg Hl 0`06/PI  PXp0 RT`0  Hdp `PP3/P  0`D P@ P  XT Hdp6/P t0p p 7/PQ P PyHP lpd`g8p] 0Z QU PR@@ Q P L03/P  ! #") P U:T0`P8( @@Bl` / @D Ѝp@#+H-M$, P  @Q0.@ @ ; * @ @0@ЍA-M@P+ .@Q !@ *P*  .@P @ *P/ P.@P @ *P{ .@p00 @`CPU PUM pW@h .@ 00A<p8`V 4`V HWQWLg .`@N0A8&04QU 0QU }WE< G 00@  O! ! @3NC0$ xP  0P05/+ ! @P0N@ ``0` `PPPpW XpW,`! VB\! ! @$0`P"` PЍH-!RJO 0S S %S80S00 80S0$180S 0|1S 00000 R b" 9 !@! @0@mOH-8Q b" 9 !@! @0@mA0H-h .@.@P8H .@@Q QQ   Qa/PU000H-@$P xQ R1/0HVT$ Q:PxL$P U:H-0M@$P L0 3/P* UO  .@0S0A`0  BR  ( .@pWpA`p'`&p  BR @! 0! 0ЍH-0Mp$@`P L03/P $ 803/P $ 0 `Pp7/0Ѝ/H--xM @PP` .p@ ϊ@ϊ4$@p@T  ϊ ϊ,⏊`a$AP [㳭@|xЍp@-0M`@8PP PcB" 0! @P 1/$ 0 x`   06/U U - @z! ! @Q 0!@& 0ЍpH-0MPUJ@$p0 x` 0  6/ !@ P xX xP@!0Ѝ0H-P@!@ (P @ (P# @ (P-  "@ (P.  !@ ԎP0}# !@ ʎPP @  !@ ᾎPP 4!00B !@ ᭎P 0P   !@0ᡎP0O-M-MM,pZ).@P P ㈇ .P@.@P 㒛PrrU L .P@.@P ゛PP 㬷 .P@.@P HtPrU .P@P  f P.@xr .@0g M.`@l' 0P. @@PG Π.@@Hppp PPX        ' . @0 0`00p0 p x` ' . @P .@PP0PonppK.@, ϊ,⏊ ϊ `G R @@0 @pvp' @p  ZrvP .@$P 8 .@P |QZkPPPލڍЍO-M-M8h .`@Q|@.@T  P$P |Q1/$Q}P}QAT !@3 .@Pu PG p.@@o  !Qb  i( RU  80 0S N(J 0! @8 .@PU  ,P QU}QU-hX!.P@.}ϊ( )<,' " '8 .@P a/beb'Y [ 8h .`@P }AQ  Q  Qa/@TY@T  8 .@X Pp k0` )!a `R `h10@ 0 8儁Xs$Pl  @ P`8 U5*L0 3/P+ &P# _[%  kQ$!   8 h@ V P `0$`1/``$PPV, @P P L03/P P _[  kQ  @ 8 h@  PU:@|  Z .@P P | .@h0pxtlzh 0 P.@| \XT0@T d@`@ .@P  | .@@0H .@4,PD@0, L@<@8@ .@P l .@| (0${ y|!0"d% @00  4@ .@00QARQݍЍ!.@Q/Ѵ!/O-Maa8@P<0Q|Q+ 0" !@ߍOPxpW  R/ 07/P- L03/xPPR 0_tw `0 p@; $p " !@P;  ? P!@IPN P`Ip,!@@h!P RP,1U A i e0UP @P 0IP4# <! @ㅾ@D$ L0/3/P0T" P   I!@㼥 `(P pP !PIPHRHQP "# I! @ 0@PҎ @pRo!@P   P8p@T 0x 0SU #_R*# ! @&R/"IPI`- 0! @ 0_tw@ 0; p@ $p !@ ` @lRo$  "@B`  "` I  cQ `4800PS `_" ! @̽ 0$ R FU Ro @  y!@ $ 0 _tw@ 0; p@ $p R/!@0O"@~j @F@@~I  I ߍ.@/O-MMp8 .@`@.@T! P|P $P 1/P $ R  0P1/P 1/P|QAT p.@$`P W 4C.P@~`@ P #  ! @0 ) @P ~ !@  !@ 0 !@ pPQ+ XQ(0 zPPTq P0xp `` `7/ .@ PT0 0xp0PW H0.P@ `7/(@ Ѯ,! Y !@ɮpPPQXQ( 0 @PPTq 0xP `` `5/ .@ PT0 0xP0H0 `5/(@ ᙮ .@,p! W~  0 $ !@㇮ !@ヮ !@hW 4.P@ !@ 0.P%  1 !@0#PF  !@ P Y  !@ P `NZ .@P_ w r D`.p@!@D@uP <  0P@ PP P$PH`YV( 4@0xP  5/ 8 B$0xP0 05/ !@0<  幈P!@Y DP.@P k !@ .@P  O@p.@㐟 HP`  P[  0x BQP !#RN0`(@@`30Q   P!@s !@ lP3 3!@" }" w8`@T0`4@ !(0S % ! @㜻C"d !,0S "% ! @㎻C"V !Cn00S )% ! @"G0 30 !@0!P0(`Cpp  RF% 0,0y0,! @Pn0S"M% y0! @\Pn0D" .0k& 0@! @(P!@02"T% y0! @lPn0#"G%P % ! @0 "0@6%P 4' ! @0C"4@CP0S [% ! @"T0Sg% ! @"X0S n% ! @Ӻ"`0S u% ! @ź"d0S|% ! @㷺"h0S % ! @㩺"q% ! @㜺"d0吟   !@0@,00pWx`!Sp (@0`` @ p HV0`   08Sa`a0` R(@  R   Qx .@P L C~30.@@,QP 8 (@.@`VG $ Q@  L0 3/P @HXP$ Z:* ៪ S$ P/P M$/L .@ @ C$   P{0P ,0` 3$@,0$TaV{_ 0L 4.@P,PY 0`x A$J  ! @0@- c1 @Pt @ LP   !@0 {(@L .@P,00448!0Z !@aLg  .`@  !@QP (@L .@(@@TC@Q 1 1Q Io00FF !@ $PQ DC.@.@@P PP"DP.@P 4  !@  (@4 !@9DD.@@P  4 !@0PP J  !@(ߍۍP@-@ር .@P P!@ @p@-MP' @$PP# 0PP `HP L0 5/PP  !.@$QH`R UPPЍpH-8MP8PFP @ AT A4 @06 P2 $q$Q P .`P``V Q  ޭP W  V P  h <.@|8Ѝ b" 9 !@! @0@msG-Mp8Q P `Y A A4 @P bP $A1/Q  01/P P1/P$QPH1/P򘀍@ @ W A A*!@ 803/P<0S  3/ !`0````X@ 3/Pm d 0 H3/pc h L03/5 @Ậ  p㸸ϭ PA @` L03/P |Qxp `V:W$:P" @`p L03/P  |Q h l0"#v` pW:v```  [.@|Ѝ b" 9 !@! @0@mᑁ T" 9 !@! @0@ሁp@-@`QP <ƍPpP^.@p  @D KT pp@譓O-$M\+8 p@`!@.@\ 0 PU PPU 0P 0`~PU "P Q` V$ЍOj`$ЍH-M"`A#. @P8@Q`V P RxpP qD .@.@`P   !@@PPqTLLdLihal *.@ @P`9$'l@ @0@ PP $, .@P @; P@* @ @ P @0@9:0 0.@ 0@0 0 @ - @0@ $ 4.@ 0@03 @ X" @0@' 0y. @00'9p@p@ @0@PЍO-MhP@  `p2f1 8 00  Q7` RQ`V, P&$pW Q 0"  Sp @PF'@au"@8  `@Ѝ uK-MQR@@ $<Tlw`  !@  Ҏ p!@PPP XP  0  ,p! W`w`  !@ Ҏ p!@PPPXP  0 ,p! Wj @܍ P8w$0 "P2w 0P,w 0P&w 0P w 0 Pw 0Pw 0 !@܍KK-HMI`(@@PDPpo 0 0(@ 08k QL b@Xt P.@Pf7 .@ fP/D fDPP$U'P㐠" b@ b@o@PP b @0&pv' @zP 0p {y2OPWHЍO-4M@Q> `PpPP TL0 3/P X o 0P 0r000"P,`! VU $@Q:P P+E⚠+l' @. @PJ4ЍH-P 0  0$ ALJG-(M.@-p`W Mp!@@P0v-PpGP wppV\ t   ( p   0 @v0 @v`QP " . @ 0*  @̴p@`@u`Qu g!@0XP  Quj$0 @㪴p@> P P$1v' @㚴p@. P P(1v' @㊴p@ P P,1v' @zp@ P P01v' @jp@u0  g!@(ЍK-MP P@ h,T|P  0 ```Hx /P @ " ! @00\@/QPPePo_PP[ 0.@,!< 0PMPoGPPC o > PP: P7Io PP0 P-Jo PP& P#Ko PP Pn0pv' @ҳP 0p wMPWPPލ@-@Q P p 0' @. @PUX @-@C4 `I @ 48<PG-MVP`t VL8 @p^ `@!P@P  2  . 8p@T@)&*@t 0#(0Sv' @M@+,0Sv' @B@ 00S" ! @7@-dt 0 !@܍K-JMIP(@@po 0 0(@ 0hQ  /b(@`LX?dP+P)P . 0Pv#n,@1b0@0)pv' @P 0p vLPWPPJߍO-4M`p8` P`f`AP $$ L0 3/P`8@ V V 4Ѝ@-@P$ 0 @\ @4( , 8EQ"d b !@@ΙA-BM@VP`s  Vx8d| d3@s 0p@s  !@w5@s`0g6@ys`4a7@ss8P`mPVksP !@ 0XX0S+ @,@8;@Vs`d>9@Ps \0!@/`0S" ! @@:h0Sv' @@l0Sv' @@= p0S+ @@>s 0 !@ ?@st`Qs 0!@ BߍK-MP Pe@CbXp (\tdP P 0.@,!< A0>0Po084Po42P8 PB 0u%dPodo\pEb`pFbhpGblp0v' @yP 0  zu1KPWލpP PptPotPP P@-@ Q}Q p@-@` `Pt` F`r@pEQ"d b !@p@xp@-@MP@.@P JDP R ,@! pc.`@P  TX0P @ЍpG-Ml.@@?X0,@gP pW pW (pArr` rePq @ ,0Ro0U 0 00  2fp paxflPJP`,吁!(Q !C A ,R㐁   ލO-t @9t@ 4t@ /thP pY? z D ]Op8e D VOp4 uOp) 0( PU!*`U  0 P  @0 *@@  ߍ6@ K-8MM8 P;pP`p @0 P9pMW ` 2!8ЍۍH-&  .@.@PQ@-C.@@P@g 0H-S@.P@Q@[ 2d.@Q 00H-S@.P@P@H T T.@0Q .@ R <Q0H-0!@ R R 0S0P 0SHv0H-@PP 88AoP0@-M@ ⭜T APqQ ЍH-MQ ЍH- r r00S@"rQ! & 6 !@! @!0@w0H-00PQ%S?o2P 0!0@0P A A A@ eT00*eP*A, E00 ,000P S:A-0p`PWQpW P:PW D.@@P oV:@P0H-0M@ 8PP*{" P  0    0GPPP0Ѝ0H-0$^(0 !1 BR*o 0 ?oRQ \Q A ?oR  0AQQ QH-M@00oQSrPW;$0S7( Ta p  0CoQr `CS0pFP@`))**D  P @hn PЍTP#%0H-0o^B Q0 A00OoSB P@P0T@$PU(P !QR@@0^0@ Q0A  @ S0@-0o\Q^$@T ( !PD` |@Ao\ DT@0/oPQ"R/DQ@@/A/oP" 0AQO-wMM0P@pXQ  ؀ X R:RX &RZDQQa &AoZ P((P@堐@8$ `0q!Pl ! @A p $8$Q $ D@T  8P $$  & ! @0 PG( p;pPJy( L@KLp@ J( P@Z( Z ZpiDP_ 4E ((0@\p```@\PppP. @(0J 0P9 ! ! @A 0P5 % ! @8Pq|d`L $Kp[ PY(  P *  P$I $ Kp? d& ! @.0 @ṫpwߍۍY( @$% 0@T T@!P@Bo 4@{H K [:$吇y( LKPH J! & 6 !@! @!0@7u! & 6 !@! @!0@.u@-0M@    @ @00( P, 0ЍG-P0@pP ` Q ` `` V R:RJVH    P PP8# 0 0)"  p"0'ԄP    04pP Ѐ "XspX< .@O-lM([ 0p  X  0p`P+ 8P+*`0 d40 P  ±P% (p80$0 JP   C"  R$p0 "[ p[ uk[p& !@ᔆplЍP P0H-@ PU  Po0H- 0pS8 0P@Q U `PQ V*`UU U P R !@0I40pP "c  0p@ "O-GMM@8 P;4PPP/J4 D`-Jp( H0P# P 0ypp PpW pW` uWPPPDP 4` V x !p@#vPU`04X 8008,D$( 0`8p P# !@iv؀Xr8P PPa 0 #",  #"T( 8P  !@9vPDD$ P  !@ +vP6x@pW W   @dP& ) !@[P  !@ vP 8 R  8!@㚐80 8 !@uP PNDR0`V> ); !@!@P3 DP  8v880p W P pC 8 P!@pk 8!@ pu @  `,`V 0  oPGߍۍO-_MMP .@P m P!@ u@P _ߍۍ.@) Z`! @0t@PH㇂P @Dh @@(P坙p㙙Pd `T 0,@$k<YO8`@p4PpHL\Pe`sPH P [ [) [TP+T 㘚`0\ ㏚P \&eXePP  !@ %  !PX  uP d! 0  j" `T`p  ePZ @"P h@ P K@ P \P @Pd\ @ $ H48@W$,L 0 HPp=eP_!@ X\㶁HPL7 Y0 PD` T0T `PP0XԐ4\<8 P RT P  Q <p< @㟘Pd"HLPp <@84,0DP<h 48@<80p@壃0`v?(E+_/`;DL W/ ,0`0 R 4P @  PPPQ088P`8pZ0W PỬP0]@y,0|d[/`L 0plZGP<tJ}Ppql0 [/ `IG`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R `xp W: ED@+! F) Y9 !@! @!0@p! F) d9 !@! @!0@pK-0MP* L`P! H㧀P @!@T`PpXrY80!!!1PppW@ ``8 p<0$ 0Ѝ! ) >!@! @"0@}p/ /H-0`@V PpD,P 'P `pV@p@-P 0P@U  մ喂`哂VP厂p@苂! ) 9 !@! @!0@=p@-  @!@$s@A-c.@.`@p@W Plj @PU# 0 4 `X `8T 0`8@D` `X`@0`4p`ZpP@p`Zp P0p8`Ѐ`P` p`ZpP[ De  PpPppWPS ЍO-EM8aV) - @V!@p@"P@ P   `pV  0!@poEߍA-M ( ! @oP- @㦔L !@S oP @㚔P 0@[p`P@ p@nP  0 ეPB@ЍK-MP`@S   !@ PL  !@PL  !@PT % !@P6 - !@P6 3 !@P< : !@P4 @nP. Қp` @!@P P@P@@PP {n`P 0@( 8@ VЍD` ЍK (5P )P0P O-LM4p sP㴐`8  000<0尔,`dDEF$`<@!`@ P P  Z48 p+lP`<@p!`@P P p W48 v pFGI0H + @Jp4800 p,pK`$` 忢LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  002 @@ p` P 0 QQ1"2(p`p!`@@ P p W d I(. 0rp 0O-lMP# ,p!@@P0  @ ` @ @` ``@  :/p WlЍ0H-MP .@0!481 !@c  0PJ  !@d  0H@T 0 4/ᦿЍ0O- M .@ .0LQHA04q8a TU @ QW X ?V p ?`\p`  0 ЍO/ ЍO-\M RZ s=dvw @ p@0P ṡ P0fu;`@>PvG P @@0P ᦡ P0fb;p@P @.@P HL0Pd!0 PU@P?  0  0$%PX@! `5/p`\Ѝ@-D.@@P 0H-T@.P@Q Q0 T.@ D 0"QP!@ RUR00H-@P *p- 02 !@H)  * 9 !@! @0@j0H-P.@@P  T.@ T TEU P *!@0T T00|00H-MP.@@P  @lPPT bP ' . @QQ Ѝ0QЍ0H  .@Q/^ /0- @ S :H-M /0 @ ЍH /H-M /0 @ Ѝ 0 @ 0H-0MB"0T00    000#P0Ѝ0H-M0  @ 0 ЍH-M00 !  @$P ЍH-M0 !  @ 0 ЍH-M "  @ 0 ЍO-WMMXP- @0`p @P $" $0 @ P$`VWߍۍ刵P AP*[S ! ! @xQ@[q % ! @p0P QH㈠ 娰X\`@dPpM & ! @0@0  @;@@PJy LP@p>w  $`刵P * : !@! @!0@i  ~&(`(P@ L03/P X( \,0"# #" 0@ T:$`& ! @ 0ᵟ@o0 0xp 7/@`p@-M4  ?0PBT T TT bRPU 0 Q T TT @0  A PCЍpO-R R@>  pTЍO-tM8^Pc  4.@0@ SD0AQ0R^ !@L0` p@SY PPTTT  rp 0`:T 0WW 0.P@,0Q0)0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^tЍQ @ P`P ` `P`  T.^Y:^ qw?10`2plppS 0 pl  40p0 PJlPU4PU8<`Y,P  Q Y  0Q0p 8 .@< @0RD AQ 0pS  0.@@ SD0AQ0R  .@@RD @P QbB`0Dp  W T `V@`8@<`@D 40 P8PP! "A8 PQ o PQ txP 5 0@ `p0p @Q Q< `V@ & @0D (  T, @% @0DP$00(PP0Q01Q U, $0Y"  PP (PP^ P $040uP 00U* /O "U@@% P$ (0ER@P@D"840 P"5 P`V PV wugB0P0Q  0U @P$ (0 `,0 V R8<V@D408 PPU PU w; Y P W VuPY U r@@"800P`V PV |w  5 0 D0pP T" PpPP PH` R V R RR Q p`@VP 0S`@OP;wPU6w4 R< .@ + ; !@! @!0@dA-8R4`U @w@TwRP2" @ @ @ @*A-(Mp@`P  B0 H@&  @`!PP  "0P 0`08Q 4PU* pRUUO`m`Vm4WRU PP  4 W @@P !@O`m`VmO-M@㾁p_`EfPP V QPکP"0@SKQ RY  "(  `FpvPP P[Ѝ @- P0r0222R0+080@ R  @ Q"  w- = !@! @!0@Zp@-O@@T  @P`QP?@A@p@P`QP?@A@ @ 0$b #b QpO-KM`P. .@țhO  x .@!@@/p@ DpPePfP lP zP<bP ePs !@ 0Z+. @ @ 0L pH(@pW@T  /pj @ @> ZC XAT? ~ F!@ #. @㭫P !@% m0 P)   P% +. @`p@ \PI $ +. @Ŭpʨ !@p9l@Z2 I/p !@p !@P(/ ~/$.(. e"!@ @0_P  !@$ i/$.(. 0.@ +(@SX. @kS.`@fpF/@@PhD/p .@P eP !@pI;/pR !@sp  !@$ZA/$P.(N._  !@jD.l @  .p@P# P( -pdQ P 0@T WP t0 !@;m> !@(.^OY ` P$Q00P0Q0v 1,P V V > BIkP ᝍ@-M@c0t @^  (@!@ ኍH- #9/ H-@-I(@@p- .@P~@o O-M-RMk{p.`@.p@.@[.P@. e J . 1$AS(aP@V .@ @@@U* k@ Jk.`@P\ y Y5 Pp@4@0@ 8@ ` E-P. A@0@@ PP.p@ @ @ 4@4@08@ ` @ E-P" mP { .p@0S j$ @{ .@`PV;1 A ᠋!0 A .k @  _ dUdP0Z` .@Q-pAP }pG WEd. `! @ . @Pt @2?G k7 @`TP@p:0 6@ uP[p!E:R :WpL '.!@k @ P @ P .@(A 1$q@DS  -T=IB PpJ 1 A .@㡋0 P @[0 A 0 Q*P @ :0 %Pkp!% :S0:  @` &edL? a "%!0@4.1 @!e 0帍P.@ R5 .@pX(@% R!:ZV.e @ Y@ .@ R`0 A@1F@ p zWI.e @{PY e @sP .@ P +RߍЍc PaI*. e! @XvPc. @?eOvQP%.ra(/Ob"(r0r 27"cAh. @qe8P.AH-0M0P  B ,uPC0Ѝ@-@@H- M  ` A?, ЍG-RQ PP7Q`>p@!@: `T 0@`P: A-M`@P@1 tP@(p@P P:PUPP#-P  U   TP V  r`@P@ЍH-`@,+Pp  p+P7+Uk7Pp@-P @+p  `*@ +pp@-M@ X,p D@ЍK-`P* pP  @P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM !@vpQЍۍ0H-@  p !@$P  PU P R ggP  R ggPU0Hg@-@  K q*@O-MMRR @P T k p`P H`Vp@U,  0Gp  !@}P y#P,T P$ P U p PFP@ R@ !@ Y !@S7 !@ !@Ѝۍp@-@$`PsaP 0" 000` Pppp@->P`@p D# 0 @ 1 p P# 0 @ppO-lM `KPo2p, @ Qp * *p *p pP ,+p" *p *p [ 9 4 ) * lЍ -  F C0H-@P q  U{)PpPPq  Dj)9p000H-P@@*p@P@0p@-pM`0 @p P <)p @9)pЍpK-Mp@` ?Pp% jtl @!@T.# 6 !@! @T X  . @W @W T @ ># ! @h0bЍG-MMQ07QPp@y ` VPZp` (ЍۍH-R @P`P pW  R: QpP 3cpP,pP  QQ*7dP  P ``0p   |'  @Pp[ee`0H-MP@     /(p P P PP .p e !@[ e !@!@Ѝ0p@-pM0@j` ?(p%  P-(p#  '(p  !(p  (p  P 0 d)  @p !@ !@ (pЍpp@-M@ #' Pۍp@ ۍpp@- % P  @ DZj$$ SPV  Qp$P%Q%pH-@q%@Da$ PU  fSPtj P  @ @H-M@kpP@ @ 0`V %PM`PPO PSL @QPK %PL1,  @0'  0Ѝ -P (  (@ !@㧉4 )'p_ !@ 4) .4T'4ЍH !@ЍH" P P P L" @ @^ @ !@ЍHb^" @- @ !@ЍHXp@-@L#@@PU j !`@ P,PUp@0$ p@[A-HM@pPP M0@$92p !@o` 0P ptU @  !@ , !@ Up  L1PHЍA-@`k5p@$   '1?  6  rD Q 0>P :&P P P aU e 0A- MpP@`5HP$pP9 Vz P : [ !@!@U LP pPM`  15pP  ᕼP P ^8 !@C PO LP!j G  @, ЍAa P? P<PP@P5P !@dK.'& !@ ЍA+  !@U !@+8 !@tCP $P  5up$P % !@dU ЍA ЍA @-M@pM0$1p Q  !@? !@EЍH-MP@@p)P? + 0 - +;P  0 `  !@P @P RP 0 0 R { !@ PSSP HЍp !@ЍH@-M@xP Q  xP | 0s !@ЍH-@ PP ` .P p@ 0 0 bp !@ P tH$@-@B !@ +LP P>@HPG"  P @!@@*p@-@`HPp ʴ@P$  P9B @!$@P cp !@VA p !@Mp@K-MPq ' ` 0 pP5 @P4 p  P7 P P  !@> > >$Q$G **CP @ P  !@ !@TPH G !@Gp6p= Q     Rp  !@LP! ,PpV  PDQ   5Pa!*pЍH-P@`  !@pp@7 @A U!@P* 0P PBH O-MM` 0 %p   !@!@s  !@}ӽ@PbA +#` p!@YZ !@Iv7P  PP@ `Y Z !@5d!h1 PJ PP `@P  T`V) @P P ; 0@` Q@ LP! < 0@ ` `V`= Ao !@Ѝۍ@-@ _PHH R$ @M@-@-@NA-@Mp@PR `NP V :7 o @!@@ЍAP"R P  !@0r>pWU% * zP P `*<0 r p  !@g <0g  !@]X>P * @ЍO-$M` !@PPK  !@PJ  !@PPM  !@PP ZRn@Zp Ph@Tp>ZP  Z`FY @  ` Z@ P pF  X @P& !@ 8A0 $ЍOH (@` q`YP@ @P& p!@ pD _Hd (@( p !@!@@ p  0xjPMP4P 6P poP kP nP NP UPqpP xPJpz`v v H(@ P 0 a@@@T! H(@ P ` ` V pPP P PZ V 'p4 @T  !P)@T H(@ P P P U p`P ` `Z U S'p @T@@@@$ЍP, H(@ P4@T `@ P PP@P Q Y 0 *0 Y  PPH (@0@ } oP*  PK-PD!Q*D! `V p@p@ P  `V@-@ P@  P @y;p@-M@ 0GPЍpL1`P @!@ 0P0@0@00@P 080 P  090 00  Ѝp@ O-MpW> (@[ P ` PP PXP[ U% PY @` !@&  0.> U   0OpWЍO-MPPD@ @: !@P+  !@P( H`8R p!@P (@Hr, rDrLrrrr|q Ps| Ptv &KpH d @@Pc u (q @`!@!@!p@ 0`}v>P?PGph 4P 6Pf@Q(H`xN@PQ !@ /@] /@ 8 !@J !@@F0 !@O@KHg(`@pH<P  HQH   0`P8 H 0PP7[L} !@Hg(`@PH@  0P& H0PK$PfH !@ H 4  7 2P !@p !@A  !@!@* !@d@U @`[ PPPD 0 *S  @$  PH(@Q t7& H 0@! @+00墀  !@ p 3!@!@ P( ( :!@0@ N(p P HEpW :`  !@^ PW PPHW:9PJH; PPuK0o?o P2P  z!@+ p P  3' !@!@! @T  !@ p P  3' !@!@! @C HKP pr 3H !@!@H@2@T% <`P!l!@t' @ @0pP  P @& H! @+S !@ !@3!@``  @ @<@Hp 3!@!@ DP !P@  R000 O Q[H u0P 4[<[H [ q (  CHPU ( (@,P [P@0 !@~  [[@|p @P }ߍ< p[ 3!@!@ p `hP  3!@!@`^P X P /pOH(@L $|| -(H0 @uP 8p tP 8p "@r48tp P p) .{ !@㓕$ A|!| -(H0 @uP 84xx-(H0 @ !@t( 8 @! @ !0@ 0 "@iH`pU ?+l&p !@% .(H0 @j!1RHD PA 0pP P P- !@ !@ p1W` Q| PQ`QL 4 XpF[  !@!@Ѝp@Q, Q= Q] 5 =+ !@!@! @0 QB QO _ g+ !@!@! @H>p u !@Ѝp@ - $+ !@!@! @ 0P G O(!@!@! @L!dP1BEЍp  $+ !@!@! @ P0 Ѝp@ N V+ !@!@! @|@T @} !@Ѝp@@-M@4 p P  !@!@0 !@DЍ@HЍ@p@-M0 @+p  (@!6Pۍp1 !@ۍp@[@-@.-p7P  P@VPB !@@BK-M@PP`Ѐp R p0 `   !  T !@8 !@ЍK8 pЍ0H-@TP PXWTPTXWX\P P`W\P\`W`lP PpWlPlpWpRU P  ,PPRWtRU0xP  x,PPxtRWt0@-@ !@@@-@ p P Q 4! @0@W !@@p@-@b_ p `PPJmWlQP !! @0p@7`+` !@mp@p@-a?@ BPP) p !@Y#!Qp A0Sm(`@XPP `P@` XX  Pp@ o|4! @0p@np@-@>P PR a `L0p`> *m>@pH-M@xP |q P! @(P pPxyP j @!@PP !@f !@! @U: >Qx^ `t!R p P 0P 0  !@.'p=-!@!@tP5 >P1 p *P> >LtP% h !@0PPp %P C !@% RP  up^Vp|qЍ !@Z`V >P`tP !@J>P p *`> >p@ !@4uA-@_0ϑ@`\```3puVp 0H| p CSR/A-PM @`Q pq PP Q L QH bP L P Q   V `PX OP  0Q0p@P `!1!@! @!0@IdC!1!@! @!0@J[CH-MЍH-M 0ЍH-P, q \ 0S PMR Q  B P 0   "1!@! @!0@CH-M\J C\ 0ЍG-PM PUS @ CSV*$`(pW P P p0pW P 4 OpPP# P( `P Q   Q,p,ppp,\"1!@! @!0@qB\"p2!@! @!0@B\"2!@! @!0@BH-M0Ѝ@-M@bA̎.à.b@@ 0{Ѝp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p&"1!@! @!0@#GBH-P P T="1!@! @!0@78BP/H-P8H"1!@! @!0@J&BG-(M@ !@ `T+ @+8 <PpQ G `P8@?P:<"1`V: Pp <PP A p `8 sp <pW:P(Ѝ& 1!@! @!0@nA.@ R/ 00.@/0H-XQ@P Pp @T0@4(@, @@@S0P/@-@8<P Q   SQ   S PQ ,  S(PQ 4  S0PHSHL@/@-@@SG-MP @PP.@P.@P @ @R D2/(`V P P J  P s Q_   P" 0S Hpw `V``0pSP00 pQpppp00Q0P0HeP9 `pP2 7pW. P  Q`Fr  Q 1/p P P Q 1/V pP,1/4P`4`PPm TЍ`) 1!@! @!0@@G-M  @O P/p@P@@@30r`T`0@ 0N j kCs T0  0(PU @F`pPp*` ` p@W*P p@ pG PU h LЍMH-M  0 ЍHЍ/G-AMy`(p@@Pp ` 0vp$  VV@ V  (@㰀 @ Dx gC   :`AލMH-M  0 ЍHЍ/G-M@P`& p 0=v_0 @ pۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ/ (@/(@/A-MM P$:`p @ PPP  i(`@j @`Ѝۍ (@/@(@U_p@-Pa i(@(`@ ;@㘵dE A_U NV@p9_P/@-@7Cb#@kQ0H-@"Pp ! .p ! 'PpP0 @-@p p P"@AQI0H-M P@f  L 8p $Ѝ0A-M P`@pJ  㐀H Pp !vw? PP 0pPЍ$ /H r /Q@ !/p@-XM>PU U7V*T @`@Q ȱT TPUA @@P> <0@  !@}> K"P> *@&XЍp@-@T=B@G-Mp`W P P  SP Q  R0 @ FBpW Ѝ 5@-@TB@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB 20^0R030O-aM0@p`FPg @6JPr  po UZn   RRp$P  PP bP ZT@T }P @U @sP @U@Tu  \@P(Y P` P \P U\dX @h nP d@TdX,TP X YP T[TD, o U( Q [P!P !@ R$PR$PPTPI (BMP @` , X$- 0 @   pp  @0 DLlpA@ 0@S0,CP !6SR S2 @,WP3RlA(TpQP P@T!P( !@$P,SʇCP%:S!S SX(P!@ X (@ T!@KT@, ฒ*> n@RX , p r!D pDL}D 00H C!@ H  !@, @Naߍ !@ A- MP`Pt` Ѝ@ 3P P ,P*:P `  p8W Ip`8  P (@ !00:P PPA`p ``0Q` iP.P  ` ``Q4H-@MP @P`R ~p `V pT P P `V`@Ѝ Q/$ /p@-M `@P)  T@ H~L 0pЍpH- M@0 P:`V 0 PpPP `P`V R: R #;0P Q  Ѝp@-@ M PP ` `,PV:PM(`$PP` ` (`,PV:$PM$(pp@-P@:KP% @@`LO@  !@ED@ !@h@pO-!@2P @,P+ PE xFP x|;\ < @ @P2 "@ P. B!@P G!@P O!@]6\ 0 0p  5O \> G┅`R B 0` P0 0 P P  0 P !@\\  G0eR B 0 P 0\ = PP `!@ P !@ P !@ }P !@ vP !@ oP !@ hP !@ aP !@ ZP !@ SP !@ LP !@ @DP  O,0 @a`P/Pt 0xP t, x!0 t,0 @D`P/Pl 0pP l, p!0 l \Y  `W q` \H A  \ @ 0p[!@\2 HP P׃H\$ 0!   @ }0 R !@\ GeR B 0 PP 0 P p 0 P !@ _ @`P@ R\P`  G\ 0` B @ "^0 Rj !@g9# @0a AP[ p)!@o\ , @P P`P V  0h# 0 0@ 0@,0P !@@\ R 4R04S 6R 6R\[ 0` B @ ]0 R !@x~\D XU \X\ ,@`ppWP" P PG P^| ⹩Pb |W, !|P  P PPp\   @#FᲂP7!@4\ G%`5p @`P Pi!@c`3   P    zv\q l i\ B !@YZ$PSk $\ [9` `VP P PF : PP@ p0p! pp p\0PU ? !@\g P$ ($\\ $PPUP/ P P0E` A p \0PK  \8 @g" \& P<P p\ :@ 0p i  !@;1Q  Q QQ0 !@$PQH Q Q@@@QA  Q QQ9@TP_ P PD0p`  pp ` p"\0P  !@=P p0    @ \0 RF  0+PP@ = P  81!@y24/g830@ g&!@ p / `@P /P@ *T /`P `P~!@f!@u!@rp`Ppu !@!@T P P P.PQ!@U Pp @PQP !@QPP p@!@QP @QP @QP$ >!@ QPI I !@Q@P  @QP  @QPP, U !@{QP%  !@uQP  !@nQP  !@hQP (!@bQP /!@\QP 7!@VQP#  @PQP" m!@JQP  f!@DQP 1!@>QP P_!@7Q QP@P@ r!@.QP  !@(QP  !@"QP z!@QP !@QP  @QP !@eVQ  Q QQVQX !@1`@  P  `Ppa7!@af!@`VQy !@Y@@  !@ p ⮦P( 娥 %q!@!@VP !@4 <9 A 0p hp`7!@ C`_`P P PPPQ  Q QQVP !@`4Ѝ3v `P`, `hPZY:7d Q QuQP8@P` Q QQo@ !@ P%P !@P c!@P !c!cT`/ !@ P !@P#q` @t 0p pP:C !@r`h)A 0;A p P @hd  @Q Q QP!` P P~P1Y`7 !@P` P P$PTQ Q QXP@,0 p ( p P: ,PB 0? 8(<  P   "\>h;4,0@ @:4 0@940@h7!@FQ Q QZF;P  0V7!@FP P PVFS @P Y P !@  P @@  !@  @@ W !@ V PQ  Q Q Q" !@pP@Q Q Q@;@OP  ~P#B P $$ QP `0S0S  ,PQRU, ,PͤP P$ % @7!@W AAZW ]`@ d]`0K\pP @ PPPF-0-? 0YX0,Q !@, `p yP 0`P08,P P P\F!@PVPT/P @PI PG@x c;PT 0` `` `X0(Q !@"TD8!@P G@P(8X`D4@@U@@U@@[ \WW\\V O- MP`p@"Py"P @p[xVQ UP X `*`VU\P @mPsPnP: rPXUZ VUPUPS 0P/ bPIUK GtP? xPA(@ p 0pp  @0  P5 U 3  1J.U!   0RP P  JU P U U P X: PpPPU [7 ЍO-MP`I|P" =@P" U``V? 4|P @ PF  A Ѝ !@ЍO !@!@ 6p P `VP |P po? qp =P       !@dЍOL?H-MRP`@PUT' ``:/AP p   qQ !@pU ^P W /G`T ,PT`U , !@$`ЍG-M`P{P"  @.P! Қ @z{P p \P @ q .PPP !@  !@ !@>>ЍK-@M P`@P  A p A A A CP t t 7@ЍG-`p V`1@PAP X FGZ : J 0Qp00@T*H Q3/K-T`V0 TpW5 @HH Q Pbqp ||PPPP DDPQPQP3PNPPPHY 0,A<!@! @!0@+ 0,U<!@! @!0@+@- @e!@ i!@@@-@P@H-Q# P" iPP' @ P` TpPW`9P  f+;!@! @!0@3+ f+t;!@! @!0@5+H-P TP iHH= +3=!@! @!0@t+0H-P0@ P]P T 0H0@-P @e i@ +;!@! @!0@[Q+0H- @=P0P= 1PP00H-P i_ %P @sq7@P 0 !@y@ +;!@! @!0@[+H-P QT +I<!@! @!0@+ +3=!@! @!0@*@-P @PT@ +I<!@! @!0@*@-@^P S@H-T R H +;!@! @!0@*H-P @ e_P` pTP#W`p@- MQ @T R$ R* PeoP P+ `! @ 0` Ѝp +3=!@! @!0@~* +;!@! @!0@u* +;!@! @!0@l*O-MPQ pQW H< @ 8P<  R`T}\t!P@P PGP CP V! !@ g!V !@tt= @!0@0V !@ !@H0 !@  0!@ DЍ i,q<!@! @!0@  * i,3=!@! @!0@ *O-4M$`@ !@w !p@P   P@Q *P $ RP P$`P@  pT Q P P T8p !@PP9PPP [ZTe|X P|TTQ88wP4  P P P P  !@P TT R8 8CPYP XX:PxxQ bp]VP  !@e_ 0P= t`@!@ p#`PP+9PP'k LPT P   p  P P } !@\uV P l@p!`@6iP AZ pP$gd4ЍY0Q03Q/K-Q TPp Q @@P @Pr> #@!@W=W, | |TTQ~PtttP88oPP ` p1P- V !@*P# `tt TTQ88LPx@xQ! o᠒c plP G !@`T p]P @Y e !@@x@x` +-2=!@! @!0@*(H-P Q5/ -=!@! @!0@;(H-P Q / -=!@! @!0@Q(H-P QQo/ -=!@! @!0@}'@-P @Q QoB/ .=!@! @!0@'@-P @Q Q@@oB/ .=!@! @!0@'H- MP9 @PP 00Po Pa!PU ` eP /`P8|.p@P `P  A AZP` Ѝ .=!@! @!0@e' .+>!@! @!0@'\'A-PP@'`TpD  U/Wg T d8l.`@Q|P C.Q>!@! @!0@'0H-P2 @Q8 PP QP P 0Q0QQ0/P@o1Q01 CR #P 0H@0 .>!@! @!0@& .>!@! @!0@&p@-Q( PR. `@P P pQ  0p@ 0p@40. @\Pp k.v>!@! @!0@m& k.>!@! @!0@n&H-P Q!.  .>!@! @!0@& .=!@! @!0@z&0H- yN!@P @!@@\Q0O-LMHwpP P0wpP Gw !@PU @ !@@`@?P:\!@PU !@PU @ !@@`@?P:D!@PUpw5 H 0^PbwU &PH LЍM0H-M  P0 ]p @7)p@@Ѝ0HЍ/G-R'@PU`  R R* R3 `PPPpV' P* ㎛P a ZpP /6?!@! @!0@%YE R  @T:q/"?!@! @!0@%H-Rp`@PWU H A:G" !@"0@p @0P `p``P QH RU p`0H-P@p 0Hf0H-@Q pPWP i@QJo!`@ PPPU:A-M@`PPP]  yp+ `p!@ P( !R0 e !@0p* pp PP ` ̴p8P @!@\O!@X'ЍA  @!@KRU zO!@!p@` !q4PUЍ P PQ4S  !@!@ /QP PD0!@!@ O-M`Q @U ({ASP# PC@  @㊼/! @P !@p  !@}p Y !@ tp  !@p6P,  !@0P$ G  @*P  !@$P & !@P A"@P  !@P  !@ PY !@ 3p  !@!!@)p xC@ 0 PP 0S  !@ Pp @  !@~p DP R׸p @Y   P{ @! @  !@pm HX #8+ !@!0@Q" @0Q !@p\ D $!@pU L 0!@pN $ >!@pG I !@p= LP pM0$p R !@p*  tP \!@p C@o !@㻽`V& P P   P`!@!@@ЍjD` @@ep D `R^g!@Zp  RP `  JV j.  @! @lZp Tj @ dZp  4`Ps&p  !@P8 !@P-  !@P' G  @P! A"@P  !@P| & !@ P! @ PPj Pf @ @ )  @!@x!@pj  !@pc %P  !@pX %P `V %P`V !@p?  !@p6 PP 0S~  !@ p! @  !@pm!@)  @A-R 0S pP`@!p@ vp 0SH-@P@pP'  I`P.P$ + @ P  @P !@ 'P HE .㛵P`Nq`P @H-]@'Q(P@(`A p`pP @P` XXpX Y`:`pP @P` XX X Y !@X !@X @X  @X !"# $@%& '() *+,- . / @+!@(!@%!@"'!@.!@6!@=!@H!@ @T!@ 0 !@ ^!@e!@l!@q!@9X  y!@3X  !@-X   @'X !@!X`P@`XX X H!Y 60@0S /A+ R 0S,0xQ t2 R Q,0 /H-QM`@P>lp % 7 ! @ D!! @ !0@W` *Q pPE Ee *Q:ǖ`G  !7 !@! @!0@lWQލO-4M$\(P Po 00 @"Px J`0`, @@p@PPc  !@ ٽP!@ ҽP@U P PY P.  {J,P P @T,P(@$PT= P  aJ,P P @T,P&Y# `P$PX  0X  0J @@P"P 2 24Ѝ 20H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \0\0O-MSVP` @ Z7*@p` `V2 P@PF V :QE TCYP=@Z7@VC*^p [@ @@.@ Z:pWA @'*^`^@NY Z:`^ ^ N V "`Q V`FЍ7O-Mp8QtP@` X,{Y PcJQpʴ(@ W Q' \[ PJ(@ \[ V9 WS\pG4V0 WJ> 0@pG+  `%P /[ [V W2  0pG+\`V W pG`@ U:@`tV W  P P@`7@Ѝp@-PPUTp$( @@ 0 .UP`.U0'U, -U U PP\ R@ -`R-P _U_`R P R  ?Q  PPTP p"PH-M`P @P RpW"LP p-M0# ᷻!!@! @W 0UЍO-,MP0@ \p P(P  0!@!@bp P P* `p P   L0 p!0! @b!@  pG ,`Y:(PW $`    08/P(,`Y:( $0p8/P^ (P $`  R 6 Q S$ 0m(,`Y:$ ($0(pGp8/P-!@n)&p 0p!!@! @0,ЍOV !@8W!@ !0! @T/0,ЍO-GMM@DP`p ApOp j @ Tp U  @Tp = p W  @ {   WxvG۹ P @@"@ p W  p +-36 >@AD   .0+P j  @Tp P PH%A @Tp~ p.   Tpr p" p p vTpc p  2/ 2/Yj  @aTpN pW: K 0pA P k p;   @j @   S& 0p2p j @@@P`TP0PPEu 2 0 pA$M Gߍۍ@- @  QT  ᘾD08@Q Qp@-@ `P` P `,PV:(Pp$P`(`,PV:p 60 GWA-M `P+#p@ Pۍ@@P `(P @///p@-M@ !@  (PP2 P3" Mp) 0`)`Dps!@!@0P@ P`5p!@!@ 0" 'p!@Ѝp0H-Q@p i.0Hd.G-FMP>P# pF`ᆹ    @ `ŹyqH`> *ູ`Fߍp@-@P p  F?`/@pp0H-@M@iQ S !@P @@ჽoQ Q@Ѝ0H-Q  RRL`"2!@! @!0@$ Ho/0H-@MP   Pp 0H-(MP P@ 0 B C ) L0p`P pT !W:7 /`(ЍH-MP@ pP @$` A` `58(L p!  P(pPP` @ A㰸 L `p`P``ЍK-MP pP@ G `䰐ᐸ :L (bP qЍA-M P`p@v ܷ @IЍO-OMMQ @TPP Z @@Z8`tpTC@BLpHP(p@Lp P TpLpXP3pLpYT|  xHHPpt`(P 0T @x Cp 8Lp[DT@x@ Y PⲀ @ @ @  @`  ;FV@L ` -FVL@ k Ⲁ @ @ @L  X @P@@ D$r pOߍۍ #3=!@! @!0@5 #;!@! @!0@, #;!@! @!0@#G-M"0`  ````(p: P8 N&P4 `0 p' pPP+pP"*   'P\P  @ᠷ WP LpW:,`Ѝ߽ ,`W`!@A-(M P @`Q ŽPp(Ѝ0'x Bp pWtQ [  QG RP   RQ|@|  8;  Q' X20Qx  pPTPP !@"PT2#<3!@! @!0@CH-@M`P@  Pp B B0 B G T !4P$!T@H H@0@ЍA-p@0G0"PWP`R*t)P b `EpḶV d@-M@Q (!@ ` Ap  2"ЍG-]M@p$Pp Ul U`l`jUc`QcQU AR`*PW(Q`ZT $` P PK   Ek? pA  RRRppuQ  RQ  RQ^P0 ` @  @ @ FI! @Lppc Q p AR:QwPh`]ލQ QPP1 P .0`PQ vp P " ( QPZP , RRLa +V`P` `RPQN ǵ 5 P 1P HY!@!@IP*,i?Z.0 0jpH-M 0Ѝp@- @0 Q*P`E`U``@ TpŻpp@-MQ @P P R Ѝp@ꮻ&PPP @ꞻ/PU ` BN@ PU@T@Ѝp`>P* ᓂP @TQ/@-P@@@bV@-P@@@SVP/! ! @ `K-Mp@`@围@$'PG @pv!@@@p; f D Pap/ Q(P% p lH Np ) Fp 9/P ;p -#P !@Hp )@ЍO-M`币 !@P    Q4:  0Qp@T WP pP ׁP   a 00  R:   q ЍH-Mg H Ѝ@- M^ @*@@ @@  0 Ѝ@-@7 (@(@-@p  p ~BpH-M@P8 `!@p `P x *`!@*@ G gUH P" ! @\a b 38" ! @\a b+ G   +X!V/ZލK-h sP!@`@!@!p@LQ™\ r娃`!@T 0R ,0TQ mL™`,p V:T c!`@ ]L,P@TO-MRչpЍ` @!@!@PU.* U p `p!W*P%W Q  ZPP>R  0Lpp 4R  Lppppꎹ"G-MMRp @0G`P P Pp j @QpPnPЍۍ dPQj @bLPp jpG` @W tp Q NLpGpe@-M  @@T tЍ @R S0 00P Q:@OO-,M`P h,Ѝ@ _ @  y0cP t @o 0RP~ !@`P*``[PN` P ZIpPG@PE Z( q(  p j (0 $  R R  R$ t( $8  P`X@: p``"``@v @hhc X !@kXT`W@ !0PN pJPH P`Q( # ;Pk ( Q   Q  QtP$ ( $8  ?P`pW:0p!R Q 0p$tP@P0 iP pP$($ P P( C @8 = P`W:`O-M P@ᴀP"40$3P$Q``pW pWO WP0  !@p P"0P` $Q:` ` ("0@0  0@`,@V: ߍO-MQR @cPPSP VpЍcPl,@P`  p YZ*0S S6 Z `  X4S V R  @  S 0W  Q "P X H00 ` Q p ï@ ^P  ᷯrWz0H-@T P PPPPPP@P*"02S0@"PU 0S, 0 00H-PU0@L00H-@\Q0 P`\J\P0@-@`q S`y`H-M`# @p0 P0p pxp" 0 ppp 0)gp PV @   Tp @;Ѝp@-M`@P3 0hh P L2 0@ @ P  y$!@! @_ !@ M 3!@Rx"  @Ѝp@p@-@`P`@ >P:&QT RpRQ TQ   >P:  !@p@[@-@T@¾@x"  @p@-`Vp@@PP"  @0[$zM !@$L @p@xpG-MP@`p$ H`P " 0 `` 0  0>@# /@0`P!@HvQ V !@ `0`8PP PT:j   !@@ ` * H$M`(O0 !@ !@$M  !@!@H0BHPbP hO !@!@RS!@HЍG$48L  !@aj @ `  4P 8P K !@@ ` * g @ ` PdQ Ph $L00  !@.P<PP!@H0p 4 2 0@@Y: 8 0@@R; 0 0@@K4 80 !@48@PC mhH P dhP  Ѝ  !@^P P P dp` ,  @0ЍG+i` !@ 0.p!@!@ЍGL00  !@sZ !@kA-MR{ @ ` 0Q0@ 0p 0S  R-  . 0P Q :  BPW ( 0P Q: P3 0 P 0P: P 0P; P  60dP Q:Ѝ('8!@! @!0@(6!@! @!0@H- P@`5!@08 @Y!@$ @0@@ L <  cu% @`H_0H-@P@  !@8 !@ir!@hhL0H)p@-`@P\P) @ PFP\ 0# @ꀲP (@? !@@PL @!@Pp K-P`p @@P'   JP%BG  @P  @  3P&6!@! @!0@1  $P  d#P $0 .  @K !@"BP !@HKY !@KOp@-@`KPP c SF Q pKp.  @~Q0S/00@0 dQ Q/8 !@A-`@VP 0A'P!@1 P i P P<P $-J  !@\ 1 0p p pp HP@pp hpdp  $  CU@O-[MP`R L@p@Qp1Pp}Lp孁 @ {P @Y4)! @) lP @Y4)! @(y$! @y$! @" !@ R 0 S  !@ R 0 S T0@ !@ P8`  T0!@8`P@p p `P opn !@` `!@ "<@4`FK `@PX dP IQ* Y( RQ cR R SRcQh > B(P* O@  P YY V_0uF @ ((!(R `@0p@YYT0c4SFP@ $0B S DpW@Y Ydp,pW hp@,p@pS NP :2 $ @0NS* !@ 510p$0 S D0SI o <Q NQ:6 p <zD Y$`(N0P8 X!@ `O*`p @*A Y P  PxPlY0 NP:2 pL0Y Y<Q NQ:30pNP:70pPI P ,0+ <00p @p30p`3<`P `Y`:Q ,p(0SZ p,p@pP, U:NPI+ /(p,PJ %0,Q,Ppq`W U:pP( NR8QU C  p(@ p `   p@$`(0SYL  H P<`yP NP (pP0 _-NP:|P00P 8弥 ` NQpP ầP($Y@:0 P8`E&JPDKP00Ko8h\ @ Jpj PP` p  ᅧD   p@rE)~u@ c\P 0Pu2'  !@륭0@2@P' %Bq "@ 0dP $P  PZ@  !@0@ X  0[ߍ<@P{:"#DVX!$#DP! r d/ @D@` \XTP LHVDD\ALaHp !@|NvF0<^NP:]p %00| @!@G- M`pP@P P !@!@0 ЍG[pG ᯐW:@Q Q ЍqW:<Q:P /r0S:r R  RC P   , p pp{P cE # !@Z ` `bov ] P 0 /r B @H-P@`R P1E0 !@T : P'E0 !@ HpPd@ 0H>0H- @PP Q \Q000H@!@0H00HO-M@p PU& `;U PQPUT P> R* ZsP  !@3 0Ѝ0H-@PVU XV T(RP@P0P QQq  p 000H-M@@J PP@ P  R  @>P: ' P 0+' P P0    }!|PZM !@@  0+S70@ @ Ѝ0Ѝ0HzDO-M Mⴐ@ P(@@ q; pD PUnP P` i`!@Hp 0@Pp`@@ ((q* `EQ" P(  -p $0 @3 pf !@Ѝ ۍO{  O>@t_P(\ @((*(> Τ (P >Q * 0/  !@ 0&  !@pF @L@- @@ _) ` iP)  !@  4)*|aP( (((1x|!v !@r  !@Ѝ ۍO !@ (@$PdPp U  - !@! @!ꩪPP   @ C@  50P   : !@P PP  z cQ0S0SS 0 PcQP $P0 @Pk cQQSQcQ0p i P P{ cQQvSQcPq n@TP PL bP , `EP PR cQQSQcP~$B 3  !@#  0<v@Qk q; 0@h `( P `PP  ᑣh hdP y0cSacSPcPfc   V2f !@a@! r 0 `0 P0R  !@ $@ @@4 B80A0 C48Xp !@$0B   !@ .Ѝ ۍL50@ #  @(0H-@' @0PUhP00HWO-MP@pWQЍP PdPq  0!@q8 d!@ " uP@Q P PA  !@.``@Y `@P  H Q $!@HHP P {P P  0 Q 00S A AR:٨   K-M@`p@ P P$PQ9MA  !@i@P/  PP  0UP 8 !@H@D @ H +0 0@ @Ѝ $ @0H-M@0P Q  R:U 1Ѝ0% @RQ:0AQQp,R| p/O-M@ᴀPPBT1P> R *?oP   0ЍO P( ( Q e0 q W 0S: @@ !@r|Q  0u a Va 0S:  50OPQp p WPv!@P P !@L  !@!@$ PLP`p0   0PP{`VW6p@v   60PPk!@e @'@ ( !@ЍOP` 00   0PPW6VC`V` l 0PPP0`*! @#JPK?0|9 0u`QP VZ 8 !@i 00 0@@?!@7!@ 0K  P P  !@ NG P" B!@Ji[P 0 0@@[PP < <Q 1P !@ 0ЍPQ % PP?  P`:W QQ QjP_`@`Q$Dc   60 PZ QW:<U!!@ 0  uP P  !@ 2!@lI!@ 0W  2 00 0@ IP-   P0P!@QT Q|!@5!@j<`B   P0P   1!@ 0i,d!@ 0a Q*f eP 6  ٟB4x"  @0ᗿWC # @& QP *> =P   屟 0@ql !@;" p!@`H ``兿\PPO-IM p!@P vHPLa p` X" X>PP !@IߍO P @a Po ,0 60$@@$ o0R03p 40@P'$ R ", R QP $`!@@ @0y P>Z @ !@ `W F!@@C @@ ` P=Z !@@ !@A @!@0 mIߍ !@|IߍOdH-M0080@P PU`PЍQ P  pƞ@0H-0M@B 0~P P ,,P    ,=  !@ 0Pm 00Ѝ0# @vp@-hM M@ TXP  0P  XQP` B C  0  COp T(2 !@hЍ ۍpH-AMMp@P\`$p 0 mpW\`V  P Y @!@AލڍH-p@`@PQ ]P P P( [PH; !@eP!@HH0H-@P M !@X(hLh0H00Po ap/A-`@ P:(P P@qP vfP 0p !R P/H-0S ^Q0 SR 0 S QQ/) 03?#R/Q/@-^0S\ 0Q @T 0S @-\ R0S @ " 0S@-\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MPUt ؀ @@ P ĐY PhP dPe  !@%d P PV `d|Hp  |HVd HP 9 ΚP$  ǚP" p8PP(  `ሜ |  ૚pP p $  P Hp`H d8dX ep  }P ` ˙|xp |dXP   ``P$ ؀@PUN H!@゘ KP P. OP* 8 JP% 6p @oW W  P P 0<  # P  PĀX  P@$p<` 5$S`h0O  Pe pttkXX e8` X``dxQ XWSh07 Y` љP `H VH 㿙P `Hp  㱙`P5  <  !@5  <  !@\Ѝr.>!@! @!0@*p@-P  !@㜽G@p1P P P P -! @  @ʽ`V  R 0S `Vp0QP   U dPdh@-Q @ P  !@㔽K-Mp@PP# @PP`V4e P ` P  `QxV !@a@OT  R P` 9000Po @ a,! @3$p94 0@@0  !@ p  ``@נP !@!@@ ЍH-MpPWp @P $`PP3( ,0eP  h d@ LꛠPHPPH !@>hP EnH12 R P` R `V( R, R ' !@_d R Rhd`@PHpPЍP  RdP   / Q /PP  Q  /G-MPPU @ `qU 00   0 TPЍO- MR0!@<R  ᱽP PP p`PP!Y Y V& P PB 1؟՟ ЍV P PP3T? 0S= Q4P7 0` P0` ` ;8000Po, a ! @1[P: `Y ЍO ``c!@ ЍO轻@-P@TQ    P@ p@-PA `ᵛD.@@ .@\@ H(@.@ Q(  P:Q0Q` 0@PP@\Q @ @CQ:Q`VQ`C`Qp@L.@@P J D.@p pp@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0   0ЍO--/@/@/@/@./@*/@'/@$ (@ Q/@ /@(@(@QA /@/@/@/@@]P xA 0;/(@P) Hy /@ Q,@+((@(@x h/p@/`@R H /@@2 0pPphp/`@p`PPH^30/@@(P@008P/0@P7/0@ @8/0@ 7 /0@$x0 /p@ ,x%/p@ 8/0@(h 481 /0@ 0q88/0@7 /`@  WA/@ <(/ @/P@Q$ f @@@/@@D/@H/@L/@P/@@(/ @T8PW/0@"%/P@Q@P15Q*!qX/@ g@/`@P /P@/@,ЍۍPP@-@</@P*@a PPN @^ O-M@`PP /@Pk ` P<V3:U3UE3CF @ @ P *f@pW:/@W<P/@(:W&\dPP `V `P/@P4 `P/@Pf @ ` @Ѝ'/ @ 000 0[:S[ 1pBW(/@`Xe,T/@/@[ pp1Y PY /@ Po `,/@;H< H/@` FZ0r !$Z  8G088S !!B $00P  "T QV  /@00#0QJ 1q$R ? w`w F/p@Z00& ) aJT` d(`+ +! + +8! + +! + +9! `Q0  @0#0Q 1q$R /@0# /@P B/@P D`d/@/@@P@P@Y pG P `H H = ` W G. @ /@` /@P 㐍/@Pው (@@?"@ (@@?"@t' @04/{H-MP`p}P?FPT Q :Pp4/@P.V@U*</@P*P P/@PD/@U :L/@U :PPz PP , p/@P ē P@/@Pf @ P@Ѝ (@@>t' @"@04/G-MP@Q P/@PT PT `</@Q*,Q/@3*  ".iPP p$/@P;PeF    P E1o 3   P "2//o 3R= H R D(/ @ R_L(/ @ RZP pU  1P ;/@Q *Q$*/@P PQ: /@(@ 0 2!0R /@PU*FZ a PP P[ Up`1 ᡌw[/@PUEFpO C p@/@P Q @ /@B 0/@ 0 p p@ /@ /@P U *HZ @ /@z i/@PUEW/@P  p/@Pf @ ^Ѝ (@@s=t'B @"@04/ށA-`,/@P$  F/@02!ႁ$0SqWk  BA/@PpPZ 㴋GFWh " @@@/@P^ QY Wt/! @   Wh"@'Q0? 0R!p  RP QQ QQ T.*P | @'/ @ ARZ I A` @@/@X/@PZ 6 T/@@AN @-M@/@P f @@T?Ѝ@-,/@Q '/ @ @2>$ RNT C@/@ R  ///O-M/@P tG(@ @@p"@ 07/pS "@@ @07/7/0@/@0b#XgS @ @/`@1j( P`"0@" @ =3p @ 0@V0"@7/7/0@i! 0 /@gPS" @"@/`@G-xU` @ @/p@<" Vp!0@ @c 2P"`@ 0@W05//@gv\ jfvF\L `@R Q5B1/! A  @! t7"@ @ 0@ @PpU@:Ub:@  0@ @dp UP@ 5pP$@  (@` 50 "@ 0@6//@Pi `T 7(/@ P0/@ < kd@PHX/P@p- ,/@㟻@` pKP pVL@/@ @T P/@P `T*` PV@TЍ`PT P/@/@PU! p#W`` y R  R/ R/0S 0Q0S /p@- R S `0SR@T 0PU0 @S &  @ @!0 0P e0 FS@^ 0PU00`0Q``T Q @ T 0`V0@0 \ p0S  QXSS @T 0S$0 S  P0UP P`R @@ 0S0 S  P0UP P`R @000@@0@ `V @T2PU @T @@@ PU @T'`V @T9@ }}V @T`@ ```V @0``V(  `@S `$ P@ PP P)`V @T`@ ```V @0``V-  `@S `) P@ PP P.`P0@ `P0 `` 0V 0 000S 00S 0`R@@ `P0@ `P0 `` 0V 0 000S 00S 0`R@@ Qp pG-XX/P@/@ /@x0pFW G`/@@P2p V* `Pp@- R 0` @S@S@3* Tp R`@V` T  R Rz0 V R @T R  `1 R @T ]PU @ `B R `  R    R' `  R# &0@ PV  `  R0  R @ PS  00@ PV  `@PU 0PQ   PS@@0`V pO-M,/@7/0@0`P 22@A0s0A2`G/@@@`T 78/@W$ppG 犱4/@ P *$q  A Q `*Wp5P/@P (/@ЍO P (/@ PЍO-DMD/@P P;LH/@@ P6㷸PPp  ̸Uh Th`d(HPp/`@/@/@/@@/@Q  @P@oPN@QI  pW:> ٸpɆ`@ ᘍ (@@10"@ 0@ 4//@P4 (H/@@PT/@Q `Xd/P@/@ @P@+P @Q PP/@P`DЍe?PH/@ R@up@- 0R @R`@R@ Tp R`@V0H T  R R|0@V T R R  `1 R @T  ]PU @ `B R `  R    R' `  R# &0@ PV  `  R0  R @ PS  00@ PV  `@PU 0PQ   PS@@0`V p(@/(@/Q/P  P/Q/P  P///////Q/ 0S/Q/Q/ 0S/Q//\/0SQ/0P/H-^0`SQ0CP1S 0Q  /1S 0Q  /8(@/py0pS C  S \ 00 / p(@/p(@/p(@ /p(@/p(@/p(@/p(@/p(@ /p(@ /p(@@/p(@/p(@ /p(@@/p@-`P@"`@zP @ T@pQ Q " @//Q R !R/ R/ RQ/r(@ P/P/p(@ /P/@ RRR/@-@R !+~p(@/p(@/p@-MtW@ P@P@`d: 4 (@u!0@V0"@ ^Ѝp R/QQT(@/. t @ @3P/H-0A Lr RA C 2r R 02 |s R|s Q Q"@Q"@/(@/ "@Q"@/(@////MH-M  0 ЍHЍ/0H- P(@@j @9P  @  0HtMH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M UUE3333C@@!??@!11@0! S Q:P @x@uЍp@-m@P"`@P P UppQ/-" @/O-MpP `@ PP:P@Lr pP TUAU$* P$  P$p`ㄐ( @,}|Wp .    @@@ B @ 0pP0 0 PD00 0p4p ` G E$[@   P * @ + P:Ph/@  $ A  yT`P Vpp@ P0pP"=SM` ȌȌȌȌȌȌȌȌhhȌȌ<Ȍ<<< [Q< Jp0p @ =Q P90 p @4< ["Q<"Jp0p @" `  >#Q>#"R RRW<0 [Q<Jp0p[ Q P0p @  p0 @>3S<P[; tP,4 [8p ` >3S P:/Vh `/@` < Q:8@TY N` V` < Pp` <`0qp`[kP  P A,K Aq P ` P8 @[  AP, 0 B P *PK0pW q1Wp! Sq:0CR A1S0!A1 R PL*Q Q: Q:D 0aqPWP1pQ Ap60 >#R R0S0CRS 0`00HE2 er0@0 p0 hR`/@` V TppЍ`8`;P`p2`1A-M@``>Q$A QI 焑xxxd(PPxx 0 (  (e]Q?Q" [Q \Q(V:hh/`@P`>Q* <Q-&'^Q {Q |QP<9P7 4V:Ph/@ @`@` V $P*)P )  V LP*`)P Ph/@`Q(**0@SpP p@{P0S * 4(0@000,R Q h/@VQ h/@>P *PW +P0@ _?P` {P`0P*0,Q(@< 0VP h/@ Q* }R X b. `? $   $ uPh0  @+0  @&0@  @P!A>#" P   ?Q^`!p^ ]@#  x(@'Q`QP  P  }RP P h/@P* *0BS p` p@ P h/@ {R P*(@ЍK-M @\Y P:Ph/@```JY0JIPB紙dКККККККККК/y`qPLP  O$  F*YV .Yz [Y]&}Ph/@ Dq{YKP2 / @`@` V $P *Q*\P)P \) ( V LP2Q1* \R)Q Ph/@3&. +P hh/`@P` `QHV x(@'Q`Q|h/@ {  P#*0*SPh 0) @0  @Q*\S{Q $YЍ*`0Q* 0,R<Q*(@ 0VP h/@ , RQ1*0\S0}S+ R *Q * Q\R }R P P^ ]@&`P{P h/@p @-@P*^Q  $   $ @-@P @ (  (p@-`P pP@P:APp   !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPh/@tPo u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AM  R0@0 @1>3 " :]P Ph/@PP  1 B>3 ! A ЍO-,MP@Q **"@ uP> 1"@ uP: @  NP& P 000 P  A A E @ <P* ^R 8 P *]Q -Q- P h/@&  ]  14  PhX 0 Q/P@ $  *0]S  R*-S]P$r-S! [S'R%* =R9 :R Q:PPP ]R-Rh/@PP PPL7pPB*0-S>Q<* ]R9 -Q0-`/Q:h/@P]P-PPPP==  PN*Q* =R]Q P`W  Qv:8(@Pd:WPPP WW w  8(@qpPPWP MP  hXp/P@`PspQ*4(0@0 `@V:P ~upp "@syP? p WPP PPB?p`&sPPPP psP ` sPy  hXyQ/P@:_ "@P`6/P u  8P(@PuQP MP 0`Q`00!*hXP/P@* :R]P!hX/P@P q P e t0(p@p00B[hX/P@IhX/P@P   - QM*]PHPK8 PP p`8(@Q!1P35 PPPP`pvPRwP(q/P) q7 (P `P  @0 A@@ P H A  APPP,Ѝ,PP  J@#,ЍOP<P(p@-(M@   (@  (@(@rP(Ѝp@`] q`(Ѝpp@-PPp@`|a!EA(0S0"(0%P0S0"P0% q 0 !^app@- S* (@@`PPP Q PP@ U0A R  Q R  h(/ @  pG-P@ S@SpP@ WW`P   ZPpGP PDDD,,,,,@P,,,,,,F 0u @ P!A># " P   Pp  PpG0H S@@X@P >F 08  0 @ P!A># " P   PF 0  @ Gh/@H-8r`(p@@PPQڥ  , (KP+ ,( , P<P! (@0Q1 Sr1`$Q( @ Pr0P h/@@-@ P*Q* [R .R. Q 2R1:Qh/@Ph/@0.S ]RA-@X 2R1 :Ph/@q`0pSWp]W `00S:\8t"@P"p@ qP/uP pPWVPH-@pR P` P 0!crp@-@PP* `SJP `PP h/@pK-qG `p@P># RR: -'R:0$<$$<<$$<<<<<<<<<ش<<شش<<<<<$$p >Q>"P P P Q`qQ` O-lMPe"@Q` 0E P  lЍ8(@,0Q : P  yt,0  X8P= it,0 ; @Z:,p$QX 4Q8P Rp.*$pJ @P< [:$?,0P pKZ+pP(P0 0t,0 .@ Z:, p$P  4Q8P \ p*$ p J @P< X:$>,0P pHZ @P$j:,P Q 4Q8P$PR* P@pp@P< [: >,0P $PKP<@ pB$ W B*d@ W'*P p W:(P0P``@CPE@T`VV[0V 0A`1T@1@(P,0p W: p <@ pB$ W Bt*d @ Wj*P p0(P`@P@0C@T`VVXVN A `T@10p(P,0 W:pD#RR>p&A Q (|R p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp t2 Q@  0p@ @P>  X@:6 "0@P`<<<H>S 0pm `Rd\hA^c p @ 80PW@[ >># R0^B*(@ _Q7^ ^/^*_Q',0^! 0^ ^*$0( @  pp_S0^0 0^0^ _S^   0^* Q(@_Q 0^^(@_P ^s (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >8"( @ `SRP 8010 Cp <@T6 P(@P"  @-(@_P# Q@P`Xx:?^  y_Qv(@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0T$4HXh|((    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ8">( @  s(RP 8 7  000>0HpW2qQ@, B<.Y PPB((@ PP((@PPBPP  @T" ,ЍH-@8(@PPQڥ 801 ,P $(@( @ (0<pQ ` u`R* w u`R# 0P4P 0 QR RP$P `p vP$p`W:88oO-DM0@h` 3 (pP* 0lP p Pp  P Yl P   /$@Y p<<p@h` Sl @Q~@Q40p,@8 Q$@ $@$$@<(qQ@ @ Q  (pP8P@PX y  X0yp Q@Q# (@8P 8=(@4p 8_P @P <@ p_R 8Y 4 (@r  8 _Y ppr \ @ R < r @_QpqQw  0pY@P"Y <(@q@_P4@P 4(@q_Yo#wP'< (@^rP4pr o w@ $@  w /opP"Q~  R0(, o0` PPP SY @V#RR>p&A Q XxR p>#p!>3 S @ 0@I`8  0A FPP @   0 @p2PZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpxPph2 Q@  0p@ @P>  X@:6 "0@P<$>S 0pm `Rd\hA^c p @  20PW@[ >># R0^B*(@ _Q7^ ^/^*_Q',0^! 0^ ^*$0( @  pp_S0^0 0^0^ _S^   0^* Q(@_Q 0^^(@_P ^s (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >8"( @ `SRP 8010 Cp <@T6 P(@P"  @-(@_P# Q@P`Xx:?^  y_Qv(@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`pT@ QV,ЍXP 0 0"$  ~(p-+Rq0d888888888(LL> AGE !0 > Q  > 1> Q@4>  >@ PA*^# $p!P$P P(Q qP p  zQ ^J @`∀Vc^J8">( @  (RP 8 1 >083@8Q` <@Y PP((@ 2PP((@ 'PPPP @ O-DMP, 04(`  a   0Dh  lP  a 8P PU8l@ Q ! U <<$l@PP  /P@8(@p0S S@  @$@@<qPU U  (@hpp S4P0 @U,0@T {B  0@T?{p Q40P,\$ (@,0P^ hp(4,4(@8p _^ \ <_\p ^hp(8 (@r hp ( _^ @qQ?@0p s0RtB  0(@@ p0P 4(p^\!^ < (@r _\2\ 8 (@r _ ^ o"pP&$<0( @^ s8@s0 0otp0P0 hp0 0t0 ?o4 2 Rq B 0kPo@p pP4 @ -P@Q( $@[$P ` z`<@0h tB @@8@@ @@P\a < r [_\fXlP h@P DЍO-M8@S*P`  >#RR>p&A Q PPPPPdP(HR p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp88(0Pp888888888 X888882 Q@  0p@ @P>  X@:6 "0@P4H4>S 0pm `Rd\hA^c p @ ^,0PW@[ >># R0^B*(@ _Q7^ ^/^*_Q',0^! 0^ ^*$0( @  pp_S0^0 0^0^ _S^   0^* Q(@_Q 0^^(@_P ^s (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >8"( @ `SRP 8010 Cp <@5T6 P(@*P"  @-(@_P# Q@P`Xx:?^  y_Qv(@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0 0  t |     d d d d d d d d d         h          000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ8">( @  s(RP 8 7  000>0HpW2qQ@, B<Y PPB((@}PP((@qPPBPP  @T" ,Ѝ///H- // //0H-tX@/P@Pt/@bb Q0P00H-tX@/P@Pt/@PbPTP00H-P@PP0^@P/qQ@P@   // /////@-P tI&/@@0" @P.F"@@P P/O-,MQw PQqT/Pÿ"/X@ϑÏ"ࣟT @DpTd`@# bqQpd`p$ (O,. 0C[* !(  0C@ 0(@ 0PE CXP! d 0C`p  0C@吶 PP'v! 0Yd $   000  (-Q ,Ѝ7k O-$MP Q AQ`#dP p W1Q``dP 0L@HpC[* !* 0|Cp@ 0 p0 sCX d 0jCP`  0cC@ᐅp&Re!P 0[  0$   @@$Ѝi @-M@(2<FPZdЍ@  I  *4>HQT ID I , I I  I I  I I  I I  I| I d IT I T ЍJ    v UI % O-MQ`P@T ѽP p ýP P nPoPoPa@PThhhhhhhhhhhhhhLh  ]P  ]PZ U ]PZ T ]PZ Uhp ]PZj UZ< ]PE ( ]P?  ]P  ]P  ]PhZV U4 w]P'  q]P!  k]P | e]P h _]PBZ6 UZ UZ UT13TTTT TTU  ЍO/a C0w   f T/ , w p@-`MP0 ` B@ @F?Q @@@@@:G_0"1P ӏp$ 0H Pp Pp  Ï@p@@@"_HP P_P_ P 㮏_P`ЍpO-DMMp yX@@? p FDP 1`ỏv P `e $($ ;$ P@ p @ @q⨱8`pp tpW1 @ 0ᄏ?X A  =ep P= ŏPÏPᆏP Mp ^PX*^@ @ pTP  @ h\Y @ I/ @U gH ᧐DЍۍ ш  $ 0H-MP @ 00Fp /@Pp U i PP  Ѝ00H-p @@zPT 0Pp x1 P&^P\@@PHUD  @ ^@P0(DG-CMH@T@P@T /5MP@!1@0@ 0 P:]?,@@㖎@p)  `ሎp]PP坎w !0  0?QP@U VU P ]P@]PCލt 0H-MMQ@PP_p\ T /LP@!1@@ 0 P:]?AXp L([P :4p%@@i/&p- +2V멏 0@p 0@Vp   PpH]@E]@PЍۍ0>]P#P/p @4]PD`w |  hH-nPO-M@Pp]`]U^>T, `!k,P P`k P P`@0P   H $ +8``0@PP X 0@ @l0? A0? ?0@ @(P EP ȿ 0X\ WA q *   0TS dS S Q  QTQ tQ "h"S"b .R  Z    zRLQ @I s\ !pk\P=LHX[p zQ \!~ ? ? ?(  ?$   ر  0pv6P XP\QH RPQP@\PRPj LP 0p/ /"l@P}d`P```3V@EPp3W@VPW P@`@L[PPP !$` AlF(!@ `L0$T 8R PT "0pP PT@P$ b(RV@ ! $QQ0!M3QTРPS "baZI@0B[!@@ 0!$ < "i$ PRy[ 0P $#@X  V(PU P b[@`[P @,ߍP *+ TP/PxP`E T PXP 8[@` J wEPL  \p2g'o0Sr"y/0S!0T 7 0@:Wl'0@ 1 "p'# !D@R!'p`%Px )Lu@BLt#(|@r@c1SP8 )|5@rL7 7 0@@`P@3ZT`ZP |`QZ`wo @!)4  L!HDB@P! !BP : :BRSBq/Dr AC!/@2 `L"HS p 0! MZPPPA HP>Z@ Ѐw PB v:  ;K!S-5:0`X/ VTptp`VzQ p@P@%g'E# Q "q` 2pG`Vp, @NPJ" 2"pq 2apRp 6ZT3Z@P4/@!  9P! !B1P * *BSRCq?Dr0AB1/@2 `L"HS p 0! , @P|| O-M`2ᜐ嘐@P p P ` @P8p,00@8L@DHXPPXH`<Cp(d$4T@Ud aV$uʘ ~_P `PP PN QJQEaV 4Vi F3Phx$L$DLXp @   8 ( D 0ll@"0 "eK p  02p;0s0 0p3@P@ 0 L   00 R&@ptp*#pRp`p $ L @$' r0'$0S(ʁW@@CR@dB¯ " p!" Z"@"B \0 @p 0@x8 0 p/"?'P:@p`!< !0 @3$0SʁW@@CR@dB¯ "@O!" Z"@"B \0 @ 0 B8  0/"?#P:@ p`!< !0@2a ppTx QpQp tp pT\$P ?/?#/"pSp"B"r"BB"r@@Tp: |9:  5; ; ( T9g L : Y< 6< D 70H-P+aB @p hebU:ᒂ00T0P0 P <  Q/0P  Q/ /3 @-t0 p0@ R @P  T@@Q 0P @T l H-T  P  ! P  0S \p@-t0O0Q O O@ PQ0 P`VP  pH-PP p@ PP `QP`H-d`@`P p P` PQPPH-d`@`P p P` PQPP$O-M`P6 PP5 @p`P  P QP{ @ `pPY W M m4`P Y```ЍQ  H-P@Q p`^P `Q0Q  u Fȹ K-MP@Q p`<P `QQ4 Ѝ FQU& mP pPpp^P`Y``!"P`V Qp 06/Ѝ8Q( @H xp PPP @-@_ ]@ZO- M`pPP PPQIPX @PP P G P ` PD `nPoPo@o`=)?P PPQ P Q0HQ  P S l`PDP @ Ѝ  l O-MMpP@O` VP:>Pr  VP /P P :p LKⰷPl #&80p ppu7pf 坷P| p0 d7pU `bP{ `嬒  V`Pn  HP 0(p z Dnpu  LPY GE 07p#  81 O `G Ol `GNP/]r GNN` Gp@ N`Ѝۍ 0p `P  d  0 `NX  0 `x4  f ) m9 l 8 , U U ,c Y H-M  0 6pЍH-M>  0 ~6pЍH-M?  0 h6 p ЍH-M8  0]F pЍU P   /4$H-0H-@FPP :0N? $  0 34^< NptH@(P 0<UZ0D`D8 YP48,(!Z: p V+ Y4 Z4P3 Y*DVpAPP>34^< NptaH@< `8 ( o`V  0A p  t<(D@@4,00 `V P:F,Q8 ~ 4444444444444444444444444444444444444444Q=VZD3 t8 @Y:8xtZD 3$@80 P@0S 00 PSEQR@p@4@ `8QUPSQK (@8 <T00^4   4,  Y,$@4@ @`*V P  p `t01 P3Q xD Z3 ( 00<RQ4 4, t,8Y8 48 &8 R 4,P @$t8  t P(>3@4p ^ pN< ^ @00 pY<34 $Q ,FVQ ($@Q  @`V_ D p R;H Y`4`VQ Z3 Y*`4Rp @PP>34^@Np< t00 @8 R{ 4@, @v N HP@J Yp0 00P8 8 tR 4@, @DZ3' P@U*=N< HP@ZJYp0,(xP 00Z Z*Y@=:A4Rp @PP>34^@Np< t00 H@ p RP@U : tPP>34^ Np`< lH @ p00  Y<34T  @P,@(U  p RWH YP4PU ZD3 Y*P4Rp @`P>34^@Np< &00 @@ PP>34^ `Np@< 00 @@ p T <@( HKH YC*=A<@( , H< ( ,@x @00@ 4Rp @PP>34^@Np< t00 H@ p @RQ < ( ,@T@PUs P@Um ZD3 Y*PR 4@, @ `P>34^ pNp@< 00 @@ p TH YP4<@(   H0 Y*#@ #4I(<P \>34xQ LЍ   H-M00ЍH-MPЍP3O-MR @ `pPJP/\0` f`V3 A1 Pp PU,P\0  V Y封:8@4pP" pW     p$\0 PL`!!rAD |  T@p , @QPJHp,pTPpCX  A[1C 0 AHP P P嵭UX,  [  Aq(P: P`㞧P `V     L` KX, XS @!PHa@D | !  ?p ,PEH U  `F dpZ$\  04偺p}P y`pu@ qPCV`CUTPCW8PpC@T @@C V(WP@`H$\pi(pDU,!`EPAD |  ?p2 ,`H V@Q T8` PAHXVTHTXpV,!dPFA`D |  Z?p ,PdUH @a Q XQX800P \P䰝 XKp,`Y\PB  APXY@,`pgp W5 ` P @嗬T,` W఑PP: @ウP [    X$ PUDg\pW A4@ P PSUX,` W[\:@ P?P\ PU   8Q8` 4PA`$YFX,pdh  X9 d Q P @ TX,pd  Xd ఑`P:P@$P d Z     DH `V(0pL WJ⼰ `XKP,` 0GLPU6 A P `屫VX,` WA[:` 㚥P X    0 8PJ┰ XKp,` ,dg8pW5 dA< P P_UX,`d Wd[8:@ PIPf d PU   TpLWXhl XIP`,` (dGLPUA dA, P ` VX,`d WdAY: P d Z     `PkߍXP$8 d p@-M 0,(@0P4`@ 0 P`Ѝp,Xp R@D 8  ,000S@H/`q RD @  40#@ 00S @H/(p@-@t RPS@D   000R/#@\H 0 R ^,@PA@@`0D``PU`h``@fpp@-q RD P S@P 000PRP@\H 0 R ^,@PA@@`0D``PU`h``@,pH-H H0@00S 00@0 0S@ DO-,MPh Pc |p80I$p 2Q<` P D V ѣPE `Q: PpApW `  P㷣P+ V T<@C@?3p  DPPP`|V  HLpq ;;P ,ЍQ``VP,@PqP@U  ; v,Ѝ @p@-P@P 8`冶PX_@pdp@-@PP `qPCJPpH-H ?30000S p0@0 0S( D0 | Q 0!0Q  R|(H-H ?30|000S l0@0 0S( D0 | P 0!0P  R /$bK-Ÿ`P @T3 ! !  !  !  ! 10qpp! 100"! Xp\ T `hijTpЂL@4P$p0  `hij Q (   hlhh0|H`8h8 A-MpPP`-PP `P @ ( ` ` #`p `PX  pT wpO |pQhPG PP 0PPP-)P9  0PPP")P. p* %p&  0 )P  _(RwhP P |P ^PpW Wp圧ᚧ@Ѝ, _p@-@|PP ^(`V (V`+@|\zQp@qH-MRp[` `P] J`` j@j@j@j@ j@j@j@j@ j@j@j@j@j@j@j@j@j@pj@`j@Pj@@j@0j@ j@j@}jA j@j@j@j@j@j@⏊@J@o*@f @#:_of!|0S R 0@T& r`VhSaW 0RQ  00FlP *Q!!Q b  Q BЍ '###|<>*><^vH\D\l P  R*11P0 c0 P C/YA-M @`pP+㼲`(P Up6P 3dP`Q >㞲<㛲^㘲v㕲8#㒲:㏲0'㌲#㉲ #ㅲH#ひp-}-y`_u|qompireyaz]{YM|Uh}Q{` *`.J`j`/` ` `pH  %  % C % % %80@01/0 !Af%,ϪA 8<% `# # (% P$% x4% ,% %   # # d" j*AnJArjAvNϊAh`M ez @| R 0S  pW) sPU1PPQ1W8SpU0U0 SQ  00D 0C gC*gp(KS0 GKp*C0 Pl0Ѝ fghijklmnopqrstuvwxyz{|}+,-.P[' ) XH-D 0   b*`(K @ Q*BK V$$0000000/iG-8MCP@p8$Q  BQ   BQ<`QP (cQ $ Ab8Ѝ Q  A AbQ @ @0K P HoQ_ 8< r R u p 8R r  p, 0p* ` ^ p"  `p <PJ p 4 P; AV+P5 AQJ!Q@ @y@& )`@ V6PSP #` m @ p0K Y " Q P  AVoR!Q HT0H-@ ,P&@p 0H00H-@P@p 0H0O-M,vᘴTp    E@pPi|Z p 6 P`v Z p  `!DZ P ! 4E! `@PQ0H P EP p P`v @TQ p   `!?!>0@Q QJ q" R R `!0Qu  0zQ`Q| 0 lpyAT `Ta  0Z`pe @Qb ᘴ/. A<Z P  E P EP/ p8 Pj`vW @UTQ & p(   ` 0on`0C10 p;@`!0Q J`C! @Pp$ @)!Ab ?>0 B0R!!`p P@P`Ѝ/. @@ <0!#dDq $8O-M@$f|P `R`P Y0 R ^LZ 0 R QLPk Ex!(0$0R  Dlh<p$('P  XKT'P  LPC XR$T0pd` x$ @ld00PQ\pP PP QoPHP QLQd_TqP@〱V,@P `p PS @Wm LATj /śPd P``p$V <P>"PV/⥛P P`@`p$V <P>"@PV 囌@ ᅡ სT [  0PEQ 0P E W 0PO L `C@pP `P@ \[ P UP&  ZЍ\[  0PP@Y0P@PPV 0P@Q 0PP @Y  0P@ P PV }0P@ H ͳ Xp 5p p0H-H@d0PI 4^0PC /Q08QP@Q7 P  \+P*mQ+P P PmQ 0 A R;A"o!!!0Q 1 A R:;A@o;Q 0A@ P3@00 )k j p@-"TX@hP`@`000  xpPl ,0\``0PD00 p@3WVVH`LVV(Q  X//p@-P@`` V PJpQ PP9PU3p@0O-MM@l``'P _ }|D2@@"0 Gy Gu@ Gq Gm Gi Ge Ga G] GY GU GQ GM GI GE GA Gp Gp Gp Gp Gp Gp Gp Gp Gtp Gdp GTp GDp G4p G$p Gp Gp`b` G``  0"`@T( QU - V#J*-pP`pGWP 0PU"`Ѝۍ$hU8U0U0Uf j  O-M@PP LsPp8$Q  BQ   BQQ8& P #P  0 P 0`0Q 0`0h2`N  cQ @8LЍ Q A  AP +ԡ oQ8<Q q ] Q* q.)p  P@ x"@@; 0P7SP2 YL&p  <PJ!p VP  XYm X PO@`<{4L@- $@:p@ p@-@v:p@H-M08 R   ЍO-M(@`pPP U PJpQ Q 0Q[ЍK-Q1Q+ PY# ],@Pp@DT P` 0`V"p 0"K-`Pp Pp W PJpAP P QO-M` PE@蓟 ` QPLU V V Pp ᾼppp@ /P\P D<!0|  @Z p\ w q!  P( PU upB zp P~ wb U pp6 0,q/". @@" 8" Q3! !@10q! PQ  RJr0"1pW XpA0S 10S0p1\\! Tq0poq&.  C 4R p@ .P`S`P tlx|`Ѝ |0 C?0H-@PQP J P  Q  0H&0H-@ 8P&p  0H0舂0H-@P&p P J Q  P0 0H0H-@P&p  0H0p@-@ l`P&p V J P  V p p@ꈁO-M-MPl@P( p0T`$, ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2p! p Š ϊϊ ϊϊϊϊ ϊ$ 0ᰀ @D PT ( 0,pP ЍЍO-M-Mp`P(Pp U$0 ϊ ϊ0ϊ@ϊPϊ` ϊ Šϊ4@% p ϊϊϊϊϊ ϊ Šϊ$ 0 GPE`U ڨ 0ɕpP ЍЍO-M-Mp$P@P( p0T ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2`! p Š ϊϊ ϊϊϊϊ ϊ $0ᰀ @D PT ( 0jpP ЍЍH-M 0 0Ѝp|O-M-M@p5%pR P( ap0V$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ4P"$p Š ϊ ϊ ϊϊϊϊϊ 0y `F @V( 0pP ЍЍO-M-Mp(`PP0 ,0p0U$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ2@!$p Š ϊ ϊ ϊϊϊϊϊ, 0(帐PE`U 0 0ᘔpP ЍЍO-4MP, X q\@Qa @QB \(YIP꜕PK X@PzwPX @ X` T@U`F8  PV p pf `VTU8P   DhP X@ T P8P  +paX@T PP*  @T  (0 p0Q Q 0jPPh @Uq0,D 0|@ 縐Jp  HLPEpG @U(0@  X@ QZCAZNTQ8P ' (0  p0S0 RP|Dp HLP`P 0A( @p Q0@ TP,X@` (0 P P  p@ s@H@PPU㰡080pP:Xp@@ P3PO pW@@ ZX@PpG pG0?W P P  Q%Q{ `Vjp,@Qp_|Dp^p `HL V!PMP[PT R 8P R P P@0@(  pP0@ TP,0(  A% GPPP Q `B@0F(  Q  IP4Ѝ,, a rO-M-M( PpP H@PX4$$x Q A wXPTX` FP8  P4 0P8  `,p,ϊ (ϊ0$ϊ@ ϊPϊ`ϊp ŠϊB@!,p Šϊ(ϊϊ$ϊ ϊϊϊ0 40 ` pG @W ڸ 0PpPxk  Q_ T P 8 O H, X@ $@`p0s@ (@ po0`@p`S0 p`S0 XD0`@  S1 HpQ! 080! p0pp CQ =ЍЍQ&@48!R!RQ@@/ktl48!R!RQ@@/0k0P@@/jk$Q@@/j@|"X(!R!RQ@@/kX|"(!R!RQ@@/@/j@/A-P8@  `@Q srPp fT <P  G P@@ijj R/A 000SQP T/iQ/A0SRPT /$QQ/h$QQ/Xh(iO-MQ @pP\PH@X P\T \ AAR `hPVTV[Z KQ`K V @ Y+ [  0@vK[ʔ P 0!!FPE V`,0pW!,!I YQP`,D | p   }pM `PVᰁH P PHV 0!!m`V,0 S!pppppp!, Y!PUPp`,D |  㰑 5p `pVЍPU 0@PXP lЍg\hH-^a^ 0S,P@ Q( ,APq`0SPQPQ RA/Q R  A//// ///dO-M@P H@, DP 0 p@Y* !Xaq | Pp pW:0@  LЍЍc@-T0 0SQR,@(r @@@ÃAtDD@-(^^*,@ Q 0+0N,2*PA 0r%r@P c`0Sfffaj(bb 0+ 0NR@0S QR@@O- MP6,`p@蠟 @T*Q QPPaBHQ0 0A  P !(R p(X! 2/p < 0 Ѝ Ѝ<``a\LA-@(P $Pp(pWa,Q Q 0aBa,pPq0 p,Pp@-@(Pp0P`(`Vpp@-00S S* $pPPCP @P `ACfHd$b`kk@k@k@@ PU`0K0CP`V P0Sp0G-P pP% 0P 0 R@ C 0 `0 V `` CV` V`QB   P BPPPC: ` P>`PTPHP@ U PU`P V `V`%P P0 S0 `0V `` BV` V`Q R @ R RP p h $P P@ @p $]L]] ^\\]\$\O- M@ZX'PQW Z A(O 00!,PP`,PaE`a0ZpPppa Pqp5, `PPm 0 ,jWPe Q,4KPY !0H!0p4,PPpZ P4P0PJTPP*`pPY, PPDp`| `Gp ⰱPZPPQ P ЍPU 0p S0G0$ p  `0GVQ 0QPC 0p0WC R R .PU  RQ/$0$\/ P/8Yp@-`@P#0P`T0p$ R Q P8UPpXXG-P@Q訡 $ Q P P0  @`$ VQI0S R H@p 4  0p$` WQI RPUPH p P I p$ 0 `S R0 HSPU P@p x@hT @T :q@p@HXWV`WUW0H-P0S 0@@T@PU @^8PtVx 8P,0 00@ PU @P@U@S 0A-PQJ@Xp0$`SRJ p`V` p`ApBX 0S0P P YPU   NPUP0 P =8 @ #8 /0H-MP @0@0Ѝ0K-MP P@Q E0Y  `I  `V PЍp`^p `V`4pP `0pD QH0 P$D H0` 0 R Q B(P,0 qB,0 0 !0PU(pS0H-MP @0@0Ѝ00H-M@`T0 PPE _oPRP PP Ѝ0dRPRO-MSP8U[SZЍ@<@`PP p @p8 V0$ @  AY  bP 㜊PDQH `$H(PPPX`@p GpW ,[D 0`0S@P"  PQ4POPH-M  @ 0ЍPP Q/H-M$000lЍOO- MQ@pR Ѝ`PxP @xP, {P0w 4|`P# 4<0EL0P00 `8|Q@`  P$pH* P@lp\8 @{P4C `wP< 0@0(Q?  Q8^U80@@8 SR$0p@8pSV0 @8  R  R{ !R$Ru RdQ8o} }}}@e8(^00 4 U ``  y 4` 0, @, `4U" 0 `H-MPЍA-@  Q@(0`p,0 Pa B,0 !0P P 0pW(`p@-X |R80 @^_O` P8`Q p$0 T8R0Q08Qp Q !R$R RdQ8p:/p@-M `0 B 0C@ P  L 00N```ЍpO-DM`@tP¿lVPFSA@?Qh`0C@C000 Q PR`F@PVpK@Uppo0K SpC0 SppVDЍxp aV` , YPPYZ |@ a $P   0 0P  Q:DHHH-Mp@pQo : 0 tx P`a'Q89 D 0` FA/   ЍlH`GH-M0   ЍO-\MX0P8  P0$ G  `RPR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S(0sp pqs4E R :[,@``v@[P PpP,0PE1PPP0PP 0P0,p0C1@@@000~`P4@4t (@0SK$,p(@,04q0 ,p$`Q(0 pR ppW8` p@(p@W@ ppW8`(@" p BR`p@@ F` 0V (0  B0s`Tq t@A@T00T@0p 0sP8P9X /  Q.,  ! ! B0S0 S0BR @ P  L@ a@a$XV P  QX0@ PQ P08 0p  `q0 RQ(X3N`P e8$/  PA (X` P[ !qPQ@Q  QXT`@, 0 ``V/  R@X0D,V    LA(Xڣ, 1Xdr ! ^ ^Pi08 8Ԯ`    W G, Q PPPZ,1СSYS PPdPN D `  0e  0p   0D W ,ptV P / K 0_PP X @ #@ $/ 2 @@0T, Ql `o ` N p QU @T 0Pu X`pP, F0GUT pp p A B po`  0vPH `u௟P 0 B Pm d`Q / Pd"P #@ PU PUDPP P{ / ooPdP / eQM aP@,W V   0@ `?Q@\>@tQ , Q (>p=P3, p0q0ppspP'0>Q=<9P\p@`1,UW   04=/ R/"@QQ<,x<00 X3!0 `p,pqPV&@T P`P @T`P@,!0H<0 ^;Px [4,;00 K[) @!0 `@p,p qPV@T `ppP @Tp`, !0;Թ:: @ R0C,p0NX0@!1 0`00&03 00K`PC1p0U( 0 " #@ 907H   @X@r`p`<Ѝl9 0  `K AV$A00Pp:p  P0@ $@Q 0`B!@R@ V0( 0R&0@P,pl9P@ U& X ,,`pP Xp`p 0( 0@P UW  S0,p800$ QT 0D0 7Ķ, P`! @ V 0 p P$EDP$ P& |p Pp` ` VpP L D0|0p66< pP, U 8 &l7755d6X6$6 U :k ` PE U k`;+0  $0[AK嘫P D {p00  0PBUPp R P $1A P -A$ P  0+ K`$0 P v255l454x4X3$`0,pC(Q,` (]$0 `V1V Q 0Q.J V, 0 ,PQpVP p Q pAPP pW P ( $ ,$PU :Oq  ,PE |GU!   0A Y 0,V \`,Qh23P Z$ ,$,pxD30322H2P,p R,`  02P (  R P e' "wp$`0 PQ eY1|1P D' US 0 (W@P @TD,1$0$R$R$RfH%R $ sf` @  0@ p 0@P} T& 1PY @u$`,0P//,/$R$R$R3LQi $` 2븅 ,@ 0@ p 0@P e% ./Px $  0qd@` l@To/.P tup?$ \X9 0娴@  N@T*H $ FU 0 d@` H8@T`0 A# ' 0pf# XZ 0S@Pc`, @T$`R,HP $P 0b@` H@T,,(,<,uL"  * 0R@P L@T`d0 AQD"  $0p, "  0++LP?  Q9qupyʼ! Xs 0報@  L@Td$ R 0  Se ++$ R 0  S.$e ! 1 0^Y\*X)()(('('Ħt'&ȥ<&xl&#p$#\#"#""&%&Dt!%"!p hDt"\8D t"!L,P ߱ O-M@`D0ʿ@H\[p\h`l0pЍ ` P0 BpH 0CRIpS   0pP`Pp94@  A@0H-P  oRPhAU@@, P H@_@ P ,0@   RQW@ ' (  @BT<[S8P%  PCAlP ' xP l `PCAP * '00@@ TAWgP ` lP PG@T*lP  PZP  PCApPJPP  [-FVf@P`  [PJKxPP rPCAEU@P|Q A T PPZ@P> 4up0@P9 e`  7 @pPUG/@TPP PCAx J4tpD@,Y```T P \@T`pppJ WF, $ 0S!`q 30S0@?3S P  P PCA W# @<# I@ P    Ѝ@PTP D" 4P ( wPCA  @T(QpaP` ^ qpWNGxPP JPCAp}p2,HPȍ Ԍ̌d |xl(0P\H<$ ؊hT@8 H8(4؉̈xHl\< 4؇t`@4؄H, XH؆|pHЅ`H<4pH-LP @8P4 C Bp8 RDQ/lPh%R/!R!Rt%RQ/ P/`G-鄤@ 80SDpW lPhPPP ,ğ(Pq# S < ` TPpP\0`p000 # Y P # Pl"0@p @lPh0P0P h"0d"00l"|2Tp w 0q0T0p@4?0SHJ\`nvpV@@ǡ@S?V@AǡO @S8V@AǡG@S1V@BBB@$@S(VOCǡ@0@S!VODǡ<@SVODǡGH@SVoebb@T` S 6p0``p`` 0@W@p@0pS p"0 p`p`0V!1a 0`(0&wtalrZ``0. LD ~ Z% PP H 1\0 H `p,0p W !V@@@ @ P RXP@0P8Pt0P 1tPP 4ԀPP,$~~u~duD} }p@-0P JhA@@TPQ PA@@TTp41hB0@T%@AT0A4 (40@BT0A4 (40    1pBl lR@Pq`VnRr`PV nR 0p$G-d"XR L #@8XE 0 S S' Q@,ZT ap@pQ@@T@@@@PU @PUZP,P U QAp@`@0SH@`pW(@-^8J00`0S2hl2@0T0'00CS@1,0 0(0AS@1,0 0(Xp@-M@P&J\ Rڀ PrfQ 0pfnf  R |"P 0 0 @ )ЍpL@-\JD\@ T،nF@@prH-| x l0S T0/0#'l"0P $n0wvvH-$!h2 0S%0@S 14 (400AS 14 (40t p0 00S P0/0#'l2 0P $Lmluuud/TK-T"@ R @" @  " (@hX P8 PvlQJn2pP p! X lb@0@qP |qld! A nZQ6?lQJn2pP `  ! lr@0@qP |q   n]Q |2q  \  P@@,uLT$pxh@-@`hPPDP,   @@l 4/0H-h@ Q pP QpP U  ljP00H-@ Q pP QpP U  ᬉP00H-$@pP080H-@pP0@-Q PSZ`000\^@, Tᒷ!@@ij@@\ @-R0QSZ\^@,0T ᓷ1@@ij@@\0p@-0SpP 0S! `0 @0P0SUPQPJ^@ T`,V0A ``Ƴ`@^```p(O-MxQ  pPCZ @p@P1DWG ЍOP\ E@P p"TT8  ,!aQ!R1'rQ@ AZ0 0(p0@ 0@`S0p@jp!  W ` P @HcT |DpV HpG W[:  aQ  G*pP p?㰡  : @`@]P- `Vpp Z 0p` Q!p 0 B`p( 0A pQ0@ ЍD| 0H-@ ,Pp 0H 0p0H-@Pp 0H0   O-TMQs p`oPC[ \P @P G PPR0@[bTЍP$0 D R pB 0 N @ P TU8  P PP P P P%XppH$poPCK $ opp WIpC 吇(+$ PnoPC P  Q$ `$@P@$Y@I XHNoPCJP3 @Q! ||h 9o@P$pPʺTE@Ct!)* $ $!oP C A PQ`F $0,(p!P@PPQAQP U!A@'r 1pWpp P/ @gQpQ [p|D pn HK [ U: `PP K*Y$ p(@P $P ,@ 0P,00 ( 0@Yp  0@ P$P @T @PP ` `P( A Q PQ  poP [.Q  >?O  D.Q `0000F 00BH/QDp *Q@`` `Q PQ` Q'qr GPP@7/@DTPH`PDp PPЍ P qp$P@7/@DT@to Q H-M0 R!R Q L ЍH/ $ R p\H-M<<000  0Ѝ __H-M0@@ (Ѝ^^40H-MP@PQ PQ   PЍ0dQ\QD  << x0 0Ѝ0DD^(^]]]]H-M@Qqp@P> Pl0 @!!N+A2"!K``!a  % a!`paP `V $Pp`Vp fPP@ @Ѝ<x j H-M  @R  qp P= P0 k,'@2" C`` a   ? @paJP `V $Pp`Vp nP7POЍw j K-MPQ| PPV `0 y-( ?,DC2" @ pA$` $a ! "*#E"!`qP* aV$ @T $P pp@T WsP P`V X PU r`tPЍv i 0 O-DM4al9XPj P @ @ A4@:3@P2 `4:P) P Q5 21=Q< #Qr Q+1 .80 8q<N{A''!K0`!a$ % a!`pq _PPz =P p"@kPi180 8-x ?|D<S'' @ 0A$` $a# "*#E"!`q P5  Px-1 80  s8k|<w@'' C0` a# ?@pq PP \ P P1  P- x P) d P% P P! < P ( P  P  P   pBY = P P 5[P6V, nq`Y  hq `U \`堀,=@D t PpᲐQ7PqP`Hq`DЍU \DЍds $e Wr d js Tf k Z B(x ; ޗ w w w O- M` VP @0p     00.R A*R 0Sf Pp%p+c p  00SB   RX%S ,S  RQ p00\00000+0AGS`1ppppp  pppppppppp$ppppDppppppppppppppppppppppppppppppp ppppppppppppp  R P       0  dQ00  00p  d V  QP` `0cp        p)0iQpp0pppp6 QP 0p0000Pe Pt%0Bp %/C0  `%%G +%|%+%+Ccp  p PB  p `*`  A0 *@ P,pD Oa0@@W:P\Q P^P  P \[$ `J P[ @ $< pn/> Ѝ

`@<V9 8`6P``2@ob.P``*PV``$``!` V ữ``P}P}PB~W OQ  ` OPa  P &A@Q# OQa ARI/A AR |@40 P*,P b`,TP\ 4,0`T @4 @` APT&:YU%Q Q  ;R ?R eRP$ P" @PT*Y `,TP 4,0`  0Hzp44, 4 ,``sߍHHX MH-M  0  0ЍH Ѝ/ MH-M  0  0ЍH Ѝ///K-Mp`PQt`P# P Wp-PpSP  @TpC Q& X.pX,ሪX# T tXdp P XG X: X7 Ѝh DpP Q  (P =P  _p(1P  _pXЍ@8#,  [Z YZ LZ LY iY /[ |Y -h }@-M0S C@P  ЍA-P`P p N@=UT  DpWP P P P P |P 0AX ~ gX UX CX 2X O- MM pP /P  0 ЍۍO}P= Q/Q9 ]P6 @`TV.Q`P& @TT  Pp  0`TA V Wg@3 :P$ `@Pt@:PUppGTP:PW g U g  0PF[P P9 P 0 UxP 0DP% @`P@t@:PppGTP:PW g U g  0PF P P Ѝۍ3W SW dV jV OV wU bU O-MR `@P pP P!  A @%QP P  '!QP  P (QP  GP RP  S rPp R  pPpP ?@p  `p[ `Q'pQQpQpQ [ P `A0Uup  !P 岐$ Q$P  $P` PPR yS$POvS$ ,QP$E `YC [ PP0 0Ss0  r0P, psP nP fP0p pSpp1[pp2Xpp[ `Ѝ/ p`P[Aqr 0Xp`G-MtPp!` 0v P4C@PpP+ Q.@P  07pp RЍ P 0P  0pP Pp pT,cP ,++*H-@`P! V PPP` |P p@U qoQWU _oO-M- M@P  PP,PaLP  `,`3@TRPH p|RP  倣P  Pl @@P,P U`-LP  P`  PP=p@=PPe   R[ pR P  p及WL ` P(, (, `pW> 岀PPUZPUJ  $Z @TP OP &P!KP ( $@Z㰀( ( PP[@H Q@[Q @ @及T3 Pp`sV nV fV   PM 0&  rP @T peQ ЍЍi Fl ( i A-@P P|``P,PmPEKP  pP h } A-@p` PUP KOPPKP !Vpఀ  O-M`i8P. LpW @@fP@pW PYPr @sP nP P@@ PZ  0{pW: 0Pn4sY nY fY  P H DPUP @NP'@P#JP H @DP pH@HHsY@ H  nY fY+H @(0H0$P& ,Q@?H P00@H 0ఀH @ H  H@H HHLPLЍt Vf Af 0H-@ PU0P [N.JP!0@- \ s\ 0@T sR nR fR 0S00A- pW `@`pW Pm`P sP nP fP` P``M0H-M@P 0 @Ѝ0HЍ/K-Pp@P @P ` `(8 H0IP* `p Q`   p@Q  p岐Q   pP p@ @,@P ,@(`  `<@P <@8`0 `L@P L@@HP PA@-0@@@@ @@0 @DS @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B A-@pP `VP MP!PHP A pPS  H-@`PpWP LPPHP `  P  O-DMp @ P  ,P ^P00\P`00V I<I|eP@|vP@P: DЍZ |P: 0 T oP:d 0bPPKP `< P`P,P0HPI  PT<`P$Z5 @ PA ` ,P> ^P00\Pp00W `F2``P,PGP  Ph<`P vP M<@MMM@MM M0MMn `FYP M nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- @P+ PP.P, 2PP(P! K P P"P PP P  @PPPP P P P PPP PPPR0Ѝ0H-PqUp@@P1 Q|,``P | p` `Q  W|`pQ  P|37`2`F`` {zz|@-P@HHH H$H,HH Ql/TQ/@L[ @-Q R$ R R 0S4?0LS 0 S00004p@@4?PT <@$0@-Q R$ R R 0S4?0LS 0 S00004p@@4?PT,04 <@$0A-P@P P$ RpW P`4@Pv0V&`v`fVP8Q(P(` (2/(`8 P $PP Q4/AQ 9@Rp 0 4%04? ,@0@4@ @p <@@@$@@pP T @@@H-`R @1P8S T* 0PS(00 0$+P$(3/P `p8`@4nP P$ (2/`vuH-PQ @1P8R T) 0S(00 0$+P$(3/P P`8P@41P p$ (2/PutH-^ 0S$0S\ 0S4?0NSq Q@0 S@0<0<<@O-lM`Yph P $PPUhPlЍo P`4@Q \ Q + 4 / 4% ` ??<P B, \ / t ( X  p  D @@P  D 0 T$@L`\P4 @RX !|8HX|$p @H ( <`$ | P P XT*[ T 0KT*S T0@K 0T0T*X[ T KT*R T @K T XTXT  X T*X0pS T` CT*R  CTR  CTR `0CT`X0@T:X[6 T KT*R T T K Ry T T K @TT*X[ T KT$*R_ T @K T `lXQ.:`Q08< XA p w:l(X PpA`G P 0QL`<88l`H@LTXP@PR H0S*` V p`F0S:8L TX!^ PNHa Q TX0S T 0CT*S T0T  X00CS T0T  X00C{S T0 @ 0T0X@Xr XXT @+X z!P2B@PX`P  CP`V XV`V`Vk T  H@@ p PTNHH@@L`p?L`XUP  @ p"D@0?,PQ:P N@:XT[ TKT@  AG pPp0`Ph  `T 4 p:X``pp@CL`Jp\T8 1`T*XT0[ K0 `S:<<0TX@ 4@@X@ 2&q@pW-pT P  @X@T p 2&A@^DQ@D⪡QL`<8XH@p40G:岀L`0C:@ /Q>Q    Q 8P R R 0S/$0S\ 0S/ 4? BR $0/A-M|P R $ R\ PЍy R 4?0BS0S@@T:SRl.@ <00<  P0b 0P!@ l@PE`0,@p0WfV03ST*@Q`: l,0 @S Q@`PpV@PaQp3WPT*U:PlPU  0A  PKri @,P Q0P04P4 PPP``0?pPPPTPP<@$`P l @ 0  % ,QP @0< 0  pWpW   0 LQP$ IpY  , QP @0 0 IPH  P- , R P0 @0  0pWpW  崺 0 LQQ0 p 0 00Q ,P P  [$PF  P- , R P0 @0  09pWpW  e 0 LQQ0 p $0 00Q ,P Pg,P7   R! pWpW  # 0 LQP?00 0 0 "$00  ! 0q pWpW   0 LQP PtPg P^ Qe Q>P tPtP9 8l 0` 00 00t0l C 0tQl\ 0R8UP @C l\V pWpW  傹 0 LQ$VP_ P t P*)tPV P P`l2`lX- 80 pSW) W W$ WgWfWeWdWc Wb Wa  W^ Xd8 00 00 00t0l C 0tQl\ 0R8UP @C/ l\ pWpW   0 LQk      B! R R` :0000B p0uppp 0uppp`  tppGl0tp p`Ql-D 2/4V= V\0l P8U BP l\7 pWpW  c 0 LQQQ P<V V-  0p V L D ptP\l pWpW   0  QLP7 VQ60Q7 000 "$00 #00 3 00  00  "$00  00  (ЍЍp 00 < 0 000 00"4000 `u pWpW  塷 0 LQP`oЍ  @0 0A @0 0P. \PJ8l 0 B l\+ pWpW  W 0 LQPQ(Ѝ  l@-\ @T$@T^ @ T9@L8T;AB\*\|0 p@-1"!4P#4 P%0U $PU^S p@T9@@8T;A*PBPP% P Pl@ T@T PPU `V$PU `V,@T0@PPTU T0p!&!'pO- MP 6, 0AS00Y @ *R:1\lp B`pGoQo`1V` V *0EV ?o 2 RiUg Ve&%o ᠒ 0v `@&@@! @P @T@T   0 LQW W8p\  ɵ`F\ P \, C0 PV  z 0  B0t@ `R' , V&*<l@P 80Al0 ᙵlPP8 0 Cl, l@V` l 8Aw,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l PlP ,R@ T@T 8  l, l@T@ p *pP,0qB\5/WA 1R0Q*pEQ0o0`r0S?U= 00S9Q7Q@@`U0Qpp0o`8 0 kp\P\@T@T   0 LQV` ЍA-Q`P P$P@T P9 @8R;!"P*PU 0 b *`J` gb&*@J@( A0 0gA3/`P p&p\ 0 (,P3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 ., @@ )L DD $  | `0 90 B$;`0;O-MP tP tQQ P P:8 lH` X@4 TP0"Dp @H p0Q , @ BPp`Pr: @l0`pp`0C0p pd```#d` C;P<;p0 S0CR @ B C`V @B@^ X+0=r<t@`T !`FRPQ p^ N p尀PX%P@Dp^ @ @`pPRP`b` PRP`b`1P`Rpc # `Qsq1#!@TcJ$ Q 1 R `pPP`P `F pVPʰ DЍO-M6v`0{Vp | @$@p^*@\" Pd$pAඐb@ᰂ`dW3`p p!`` $`pf@@D9ᰂ q@$PbpEB`gU`PP@P!`@@`$@Pdp@G 00H-PP @m"P/ 00Q/0H-@`"P" 0@-@!@L@-@!@m@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@(@-@{!@M@-@u!@o@-@o!@~@-@i!@@-@c!@@-@]!@@-@W!@@-@Q!@@-@K!@@-@E!@8@-@?!@Y@-@9!@sp@-@`P P R!@ pp0H- @P P!@ 00p@-@`P P +!@q pp0H- @P P!@^ 00p@-@`P P !@J pp0H- @lP Pu!@7 00p@-@`YP P @# pp0H- @EP PN!@ 00p@-@`2P P @ pp0H-PP @(!P 00p@-@` P P @ pp0H- @ P P!@ 00p@-@` P P i @ pp0H- @ P P @ 00p@-@` P P B @ pp0H- @ P P @u 00p@-@` P P  @a pp0H- @ P P @N 00p@-@`p P P @: pp0H-P] P @f P( 00p@-@` P P @ pp0H-@ P P@ @ 00p@-@` P P @ pp0H-@ P P @ 00p@-@`m P P @ pp0H-@Z P P@ 00p@-@`G P P \@ pp0H-@4 P P@ 00p@-@`! P P 6@| pp0H-P P @Pj 00p@-@` P P @V pp0H-@ P P@D 00p@-@` P P @0 pp0H-@ P P\@ 00p@-@` P P @ pp0H-@ P P6@ 00p@-@` P P @ pp0H-@v P P@ 00p@-@`c P P x@ pp0H-PP P @P 00p@-@3`F gPtGPPPpp@-`PP @ BP pp0H-PP @Pw 00p@-`PUP @ Pd pp0H-PCP @PS 00H-@`p aPaFP+PPTp@-@`P P @& ppp@-@`P P @ pp0H-PP @>P 000H-P\P @,P00A-u` g@tGPP5 P p P p&p@-@V`i gPtGPPPpp@-`P$P @ ePpp0H-PP @P00p@-`PxP @ APpp0H-PfP @Pv00@- @P $  {A-P! @ P Py`` `˝p P  $ p=  0 0Fz D [ @-P @᧝ @Um 0 0/ꨣ C @-P @ᑝ @?m 0 0P MK-M$P $@ 0p73PJ` F P  0P)3 pЍK Ѝ/E 0 0ꀢ  H-P`p"  P @`P!AT `@ h!@$!, txl!x!@! P p@-P @Q p p PP `pP4#\\"" P @@` Pppwds vH-@P PQ  pP `pP"\\! P @@O`|@vr (vQ/ 0 S /uQ/8 0 S / /R/uq H-^ L0 SQ 00S P "Du@q Q/ 0 S/tp@-@P PTQ p P ` P"@ptp Q $ 0 S/Q/0tDp K-M@P, P`Q%V# Q  P pX XP0 S01@ Pp Ѝs: o K-M@P' P`Q V!   p՛P x pl0 P`001@ Pp Ѝ(+$ $0 0Fsf n  М P , 0 SQ 0S /rH- R 00 S Rݜoqm H- R 00 S RȜoxqm P P 0 SQ 0S f O/ P Q0q m P 0 0 S f O/ Rpl H-M$@P PP  P0PP, 0 P# pP `0 P  PL  P  Ѝ\p?H-$zਔht`oH-P Q H3@a< <0 0m(b$ $0 0dꠘ | _ H-P Ho 0 0N$ u @-@l?P X9H|<0P r p P8<0H-@ P PT0P P 00H00H3H-P 0 S ,  PQo"p@p0H- R PP @Q!$ P  ,  @00d` `0 0LH H0 040 00 0 < ] ؖ  Q J 0H- R @PrP  R000H-P<@P /P P PpP P>P  0H0p@-@ PP ` P" `V:<xP P PpoP P/gP >bP  p@\pp@-@PQ@ RP> @;Q <Q >Q&E`P, g&Q&:`P! a4P m/P p &'`P l!P tP ;Ppp`p0H-@P<pP| P P P Pp PU:<Pg pPb lP] iPX sPS tPN  PI vPD eP? rP: sP5 iP0 oP+ nP& =P! "P 1P .P 0P "P >P  0H0n @-<@P+ /zP& puP! lpP ikP sfP taP >\P  WP @Q0H-V@P  \PP P 0D 0A K-`@Q ^p@0 PCU pP<Sp0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP` p(`>PX` P\ bP/Q PY $>Q; $>Q5 Q PQx  Q&  Q@ P A=R(  P R0!,PP"Q qR  PR "R  PP>Q  0 0h ܌ p@-@P&U U[ <UT `Q TT*P@PaPEUL`QD(((((x((((((((PpU% mU3PpUP;U.&P`PtUP;U&>P`PtUP;UR``<pP >P `a Ѝ`q s  O-GM  EF T 1/  0PQ aVk Q 1/P@aP pf T 4/ 2/pT 4/W }aW WqqW) @qa@Pp Q 1/P`uaP P  2/P V 6/p V 6/Gߍ 0 0 0 0  0 0p;l l0 0XET T0 0zXBT T0 0q , ̄ P ` l , @ ؂  " H x ym G-Mr@PP`P>. pḔ  Q:]?EYA Ob@@fpw3  P$p |PzCp  q)@|P @Q/Q @ @ۍ/Q @P*T @T P/Q As Pp1 ᡑԃ G-M`DwPP @,p pp E0e ``V*@Ѝ    0p/rx  Z 0rp @-@ h@H-(`P 0 0sP~   P/ O-KMp( P@$U QTFGo  0PE5/P JI/ 0`P $A(qP P7 1P$!( P Aq$A(q Q U JI/0P @J_Io($  2/ 0PKߍ 0 0X| :~ T~ //@-@@,H-M  Ѝp@-P$$~P `Jp(P @ e AیP `,pppP\pLH H0 0PLT6} v} } H-M  ЍH-M   ЍH-M  Ѝ@-@T  R(O /Q 0 S / !@  ! Q/ q3/@S"# Qr3/NP , 0S0! 0/(NP , 0S0! 0/MP , 0S0! 0/MP , 0S0! 0/hM0H- R |0P0U 0A  t 30t0 00 T  0@0 t : M0H- R 0P0U 0A 0t00'R?O 0T 0 0@0'('RL0H- R 0P0U 0A ! R 30t000!T  0@0! R :K0H- R 0P0U 0A ! R 30t000!T  0@0! R :8K0H- R 40P0U 0A  U0H@0J0H- R 0P0U 0A ! R 30t000!T  0@0! R :DJ0H- R |0P0U 0A  t 30t0 00 T  0@0 t :I0H- R 0P0U 0A 0t00'R?O 0T 0 0@0'('RI0H- R 0P0U 0A ! R 30t000!T  0@0! R :\H0H- R 40P0U 0A  U0H@0G0H- R p0P0U 0A  t  30t000UJ 0@0 t :hG0H- R |0P0U 0A $0t00%(0R UJ 0@0$((%(RF0H- R `0P0U 0A   t  UPJ 0@0U|0H-(M@|0P l   ( "$PPP XP $cP(Ѝ0j Ld ,j i PH-P 0 0@TP0T`Q URSU!P&PQoQQPPH-THtH0H-@@P 0PP,

HzD D0 00, ,0 0L6P6b e 6c b ie ze O- M@P Q04Q8 4@T ,p`PP gP5 `P@D¤Y@PAtl༅P& ` P04Y0p,P# @P" ! 8 ,@0pQ @W3cϋ`,V,6<V0<2FO,@0p 4,@Y Pt pUC PEp I!s4,< 4<a@+<@@4@<$@V!nP  2`?P `p P;* O|@Z Ѝ!r4,< 4<` mY( `^z 0 0 0 0 0 0 0 0tUp p0 04H82P^ Q^ ^ a B_ v^ a a R^ Oa ca ^ Q^ P 80 SQ 0 S /`0d0O- MP @D`Q Ѝ8.4P* ,婰 PqW& )P PIQ0 S `C!r4<@4<:8 ЍODz@ @0 0?,G( (0 060V\ A_ \ 2\ _ _ P 4 0 SQ/ 0 S /..P , 0 SQ 0S /H.P/ R/$.P/ R/-P , 0 SQ 0S /}-0H-PP @P  2/P P PP00A-`P @@PP xp$P,<P ApP 0p A,G-Mp@ PP 08! 7P (P 0! )P (P$P  Z`Ѝ0 P P*  YP  `RP H 0` P ,I( (0 0:X = BX \ 8\ _W H-Pp@P+ `SP  2/P P pW | P OKPCP0H-P (@FPa00cV p@-M@004 R;P,S Q R& `V8 P)  0Q Q 4,A4P. `ЍpQ b 0 0Ѝp`Ѝppl l0 0XqT T0 0@a< <0 0&V V V U NV V U *V \ U V V H-4Q , 0A40Q H^@< <0 0i($ $0 0`T V 2V T U U O- M` 4P H apP P C@P  Ѝ   ЍO/P P`P < " *xVj Pg<PC4PQh,@qW:  P0U. 㥰PC ᰉP PPEQP@T^  P P  bP  2/Pp P p@ P| @T: Apr(z$!$1 0c 0 0 0 0 0 0tp p0 0| |0 0|S &d@&&{ { oQ oS Q "T 7S nQ R R Q VS S Q 2S S Q T ^R JQ T T K-P? P`VA@V U1 U1 44P pP 5 , !$ ,,P  Q,Q 0S pu s Qp D}@ @0 0 , ( (0 0"O Q Q bO yQ Q @-@K @H H- H ꘼,H ,H-$  !⎈ወp@-@P ``QP P Q `< R4 Q ,  a ph{d d0 0PcL L0 084 40 0!M DP O M 2O [O M O O 0H-@P P L R< 0H  0 0fL O N @-L@ᡁP*  0 0L,L O O 0H-P@P dSP P H0H0  0 0'꿎K mO O @o/K-S" pP`@W  @P   0KiHE 0 0K O @O H-Pp-@P `W  P  `ᒃ`H-P@ `P oop,W@PP @ H-P@`P oop,W@PP @H-P@PpQPP T@ p`P  @5pLA-@P PQ P`@V pPW P  PPP (`O@P 8Q/ 0 S /Q/ 0 S/H-0S L RQ R0SRȂH-@P  R  `PV U 7P  pᬂ@U D@ @0 0,( (0 00K TK _K J 0K bK Q/ 0 S/TP , 0 SQ 0S /G0H-^ 40 S 0S QOoH-M$PjP@P* !0 >P P\   `p "PL  PF"P 0,!,1 0h 0 BP1 `pP+ `0 2P Q IP P` pPP \E` prЍV kPEBI I I iO-Mp(`  P@pW=Q@10 A \yQh U P V T0* A U UP V P * A!!  P V P* A!"  V T7* AP y-* pGZ@X$ pЍ R U:0p0@ `BV  =R p0`0@ p AR<Q Ѝ I @-@P G-M PG P VPx Z%:܁`p@P &nP7 $ fP/ % ^P' ? XP! JZZF pZpp:0 S 0P1:p  `Q CZ  ЍGP@`- J0Q0@ p@P`' P % P Z=& P = P ( ЍGSЍUE VD q9H-0S RR MoP P@< <0 0($ $0 0B B C A B B 0H-@44.(T$PPP0̸ܸ@-@T  R Q  0 S/P/Q  0 S/P/P , 0 SQ 0S /0H-P 0$PP @ 0  P |PP 0h  P XPPTTP040 00 0 Ss hKHd\3A qA A p@-@@@P@P ,``p輶P/0 0 Q 3r J R ,0 S/Q 0 SBo/ 0H-@@P 8PPPPP,

= 0H-@P880H0H-P@8@0H-@P `xPQ p4@P,AT  R 0 0`lI; ; ; A-@P `pQ P8@4P-@,AT ,<Q<@D@ @0 0#,( (0 0U: : : 1: : : G-P04`V(@8p!V, P X ! },09,0m4p,< 040 < A& 0 059 ; 9 p@-P PD@Q p`@pH-P- @PQ`4P$8,qW&  R *!!Q @, !PQ00<@4<H{HD@ @0 0,( (0 0y\7 T8 *8 7 08 8 P , 0 SQ 0S /00H-PKP @P  2/P P PPI00A-`P @P@~P dpBuP,<p @$P AHA-MPU& @`p P 0  P (pP d p 0pzPpЍ$B 0 0 ]5 8 8 2H-Pp@P+ `P  2/P P pW ) \P P뽂P0H-P (@P00p@-M@004 R6P,S Q R! `V3 P$  0Q 4`@4ЍpQ f 0 0eЍp`ЍpLdH H0 0O4u0 00 0F]3 3 4 3 3 3 2 v3 N3 H-4QA4 0 0.2 3 3 G-@P`y4P 3pP  TP P c_GP w` PI < L* Q-< Q4P0,ppQ 2/Pp P p` P `V:LpB 0 0G 0 0XZT T0 0@< <0 0DQ0 2 1 -0 1 !+ 0 2 72 u0 1 ]2 K-P! PpW2@W U1U14`4P`P , $! ,LH H0 0J 0 0A. 0 * . 0 1 @-@@p@-@P ``QP{P Q `< R4 Q,  afphZd d0 0PBL L0 08G4 40 0,- 0 / - ;/ _/ - / / p@-@P ``QP2P Q< p@%D]@ @0 0,Z( (0 0, ?/ . , 6/ c. K-S' p@W PU `Q P U  Kz}  0 0$+ . . /A-`@PpP P P @*QrP@ TBP P0 0SA 0 0H- 6. C. #. b. . @-AT\ T%@QARS ^ lDQ B@R S ^  Z 0 0, - - G-(MRP@U tP0  ` p  8P ᠥPT(Ѝ-      /     / 2/ / /     / 2/ / /     /K-(MP@`PP(ЍK5T{$P-P (Ѝ 0   0 B  ppQ P QPT T (ЍvPQ @/@-@Tp^0_0`ꀱ@-@P @-@PH-P p H-P ~p H-P sp H-P hp H-P ]ph H-P Rp< H-P Gp H-P Ѝ}Ѝ^ B2$(/(/$/H- Og 0O << (/$/R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@v P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pay8UUE@33C @ @ /  D\**B"6 S d18@HHPHXHtH|Hpc? b Aa-lsww -   r !=-  S - Sx s S  w -   r -  $0 S- Sx s S  w -  r -  "  R-RxtT /G-pP( prP5  ppP-*@p`qPp`@pW   uP =P qPX|Up@qPTq80H-M, (2P$R0H PD@P<80( P @m@pn  mp t|d xt㰬p PPP A P\oBK sm om?@QP)PS)dU)0@)lq8 0 Pxq)U {P L@ xgp{P L 7m 3md RL@Ѝ0 Q 00O-MP@R D "P {XptЍ`{wP+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0]@I" 0Y{ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Ql00O-MP@R D "P {XptЍ`vP+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0]@I" 0z 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Qlp@-M0`(04@0`,@ 08PpЍpO- M`pjzDgz@W@  0kr@`YzPVP4p0`QzP Q Y:8`

`?`t@```Ѝ쵟 {x U pDPK >Q >Q D P-?Z[ \V P 0a R@@i0S Qa`Qk t`@Tt Ppp@T  [pPsP> u  0S 0S QPZ* `P:PI D *C ``yP+ppWL$PkPu BP$[" PP:PHQ p-P+P[VpP:P ?`< @R_[J S:P* \TP:Pg<WppWX P:PO`-P+P:`:Q :P?`P!10 PP  `P``@PPx`P:P \ gQ @ 8! A-P+PWQLXttdtXt(rrqpDgpsssttdqqH 8 \ dDpqpp\ptntnL px `P< dd$ K-p`P+ 00P!-Q@⤂@PPU% -U -PR)p"l2 00<<PU (@$" P@::U 1A -P@@-GeP P AeP! :Q1Q @:P P>A!1 00@P00 ?`P:P P   0:`:P ?`P  0zhizjiiziHzHiLhHh0h} dxgghhhPyhthgxg  H-MP`QpuP3@UP P p0P 0PPP PPP `PPFu`uP@u`omP9u`ЍhpA-@` Q0 pS P1Q*|P pEwn Pp pAWp n Q  1 H-Q Q Q(s% 0 0sAQtT xt t0 0Ϡq R010 t~   " a u H- X{40 X0/o" F 0F/o;" F@-M@ 0BPЍ0 H-`@pJg0VVQ UPqgA-@`pQ PTPPT U}P  ?D 0PpB,@VtO-M@`p}PU( ĠT (VWp` @ @V@@V }P \/ @D P $(,ЍtHЍ4r!#/H-R @P`pw0 !#3/p pW@T@ /0H-@PU 0H/0p@-M0`@PP ,P  m$P  xm 5oЍpK-M@ x0P |P0}P  d/ P``QPPP Q 1/0P| `P !@ppU sP sPP 1/ !+pPtsUW  1/ 0PPPPPPPP @ P 0 QQP0wQQV JW ڤPJ `V 9sPPP2sh`  `ἀT00Ppp@ p$ (0,  0 iPЍHHL0H-@P e0P @ P 10 P  QQ$0f0r 0p@-0`P@P ,P  l$P  lEop0H-@eP@P0Pe0MH-M  0 DЍHЍ/MH-M 0 00kDЍHЍ/@- MP @Q n  @PJpQhLHn@  D ! Ѝ [ ZntP,E@/A$Q//1 Z1 \ZA-8M@PP 4 i`oPu oPq oPp oPl oPh xoPd doP` PoP\ <oPX (oPT oPP oPL oPH oPD oP@ oP< oP8 a`<0< RR `1R `2 j)0!0$! 000000 0 0 0 0 00000`  `2mpT  gj4P8Ѝн   +  0 ? K R ` k ^ u } 0 H-M"Ѝ@-M@P@ЍO-MMĄ`P@p$q p0  P 0д @4 塃P @刃 4@WQ D,@j@̔D,P; P8e@l8 ;sTppP8lP5 x0 Wp6Y p0 Np-p@Rp*pP. |áY t忡 \x@ 0@0PЍۍK @@x唡|]PJXp|刡YOptIpԢpqtoRpP$lP"?nP# :nPl$QPQ/P~x!P @46ᠢl ,, 2/`~P`Y  A[ [    00   0 2 bb vf$  E O ` T 8 W ϔ  M J..G O-tMM$`ᬅ@ppQP @0 @HDL坠p `@,ph,<d $@$@T=  pPJ ᠠ 墠pTᡠo0P ,@,o#P~o=PQ0 op 4 h1~P 0 $whop @ 4h ~P  $_h @X T`@@Ꜥ,Z@,; , EPU(JG,``@# 0k @kTXXP崅PpXo PPLLoPj mipz Ο,pP@k Ÿk ἟k ᶟ` ПP`PP `P ƟP  㢟` P0Y7 Ο4($h( ȟŸx iPP( h0`f}P&`њ P!( `ᢟ,ᖟp0 apPtЍۍ,s렀Y$@nD0  p@  g y 3 XK   . \@-M@P@ЍG-PMP`,p@!Lq p0  P x0 A( ὀP @夀 @tpQ `p,pgp 0,@厀LPPЍp[ j[  K-Mȑ@PPU `0 AP A@ A0 A  A Ap C C U&R```R`  a @ PP:JUpU 5zp ڲp)m/$m@ᰞm@ Pp ᷟpm0P @ Pᗞm#ᏞPЍ+$A-(M`P Pp0 C C000P@T  0PP @T(ЍI O-MMLHP `RP  0@Ppx*WQ PH D ;@P^DP[ NN+"f+HV떟 $D 属D JD姞@`P pNHQpP  PhHjpdPDPP @@@  0P:@l@* PefPЍۍeYC H F ` N @- MT@ P@0 0 A !H Q Ѝ@O-M0  l- 0 kP PP@ R PK  - 0TP [P 0 0 p 3)p P``PPK BP[ U@a880` PK R RprQrQ  @@T -P +P,!P- @P-P P  0  !PP @PPP Pp  0 `   -P +P&TP- @P,T" 0pb*TP! @P3T" 0pO`io `rioZP p z ZP! - 0_P XiP pK@Y 0Pߍ h@- MP@P@   0 0 B !  Q Ѝ뜽G-!M!`ሡ@ 4P @<;D@@yPI@; 4p@yP= P  0 C0@4@ pp@}P)P:@;`pPU  4:``yP hP@ ; P0PP00@a}<P!ݍ}tQ(P ,P K-8MM8P`3 @ 4p43D@uyP5 P0` C0@ F 0p @<}P" `V 2@3Pp`V  42PPLyPthP @ @ }4P8Ѝۍ$t1 G-@PDd0 @P p`0@ZA*` p00F Sa0FSWFA0FS7F V W0A0CS:ppP W @ 0X4@dLppt\LLLX2@ 0 @0@0 J J@J!P%K-(a@`p?PU ?U` ?`# @0 Z9`P >U.:W$ .P p?0P V*pW:V'B71@4P1*p@@V *p`ppQ:,?V35PPiP3 OOp@-<`P@`(00 ␊@pзH-M0@P`(p( pr ЍyOpL@-(M d 0@0@@ ;Q ,P 0@(Ѝ OO-dMB@`0p`P"F  `Pll[ @  0@PPz `,Pp  i  0@:`Pc gP# , 0 P;P,0pF @eA=l oH0aAeap@`o&|@o&bA&eAܜ 㐰o```ba @ `H o&@o&O&@cacAabA\p@tp ` &`''tpoeq@`p`a}<@ P`qcqp`o$o& &`Ob! <@-8@ a!`!aq $@x`'@'pOc1 8@-e1 @e!a! 00?#`?##p?`i!00e!i1  ,0 ?#` ?#`#x?ad!,0i!d1  $0?#` ?#|`#?$0e1 `1-P p`!d! 0?#?# P?#l0oi1 `-a1 `a!`! (0?# ?#?#0/d1(  g1- g!a! 40?#t ?#?#0/` 4 @ fgf!0h l/"0/"" |?a0 n0nf" !!h/g hhn dp!p !_!@P/f c  ch`!x@!!on``i ciq`\p'ba'h'pOhqbqiq\@@p@`o&o&&`aOc10`qbq@@@p<`=0o&@o&t@&do<`iapaa} aq`qp8`o&@o&@o&Ob!@@ 0`cq-aq'o&|@ p'to&A &bJL_`0P Pp,@lc _$$@_% % _a,PpPbl! !_$@_%O%@oPc1x@ 08`?#@`jb!?#!#@堐l1p(p`1'@j1#0#'l@'(b! 40xp-p?#d@f!?#p#P`!"l_%?_%p_%0j1 "O`@$P tPa1O$f1#0#֡ O$_$h1-bL a1#O0#fa 0ba ha&|p@&`= 04Po&po&&poahp`@`aO$ba&O$ $`&pOhAp`cAm`A$ \`@$o&po&&poPpb!@` aA-o&pcA$ @$o&p&o`<` o&(p @la o&p& oc1` b1o&lp l1#0#o&dp&$Poa0`o&tp_& 0%,Pd_%4pb!o!la_%`a%da&_ `&b! p8`- D o&pkQP o&&PcQ``Q%dAP%@HPM p @dQ Pp aQcQ%" P%'L '`P `qx pkq_" aq'p'_%X _%_c10= 0ppdqk!'p" /"Tp/"/"/a Ѝ ( aL @ / #EgܺvT2K-P`@Q5025Б@P:@pi  Z)P*@pP:p  DZH-MpP@p  02/  ~ P `` ~ P U  0`0360 R PЍH 묓)  A-M✀pPQ)pP `\ V@"2 0d@ p (PЍ p긒y+O-GMM R@PP@PjJD`@u ʒpZ xp|X  0@YqG W+  RUA_⠰ W+  RL@P  WpW a`P']`PTP@P(JY)P AOP T p"2 0g@ p  @( PP@P4PP@PGߍۍ  0DА)H-M 0  jЍA-xM⼀` @pPt+ 7W)4pP `P \ U@"2 0d@ p (tPxЍP pꤏI(( a @L/ #EgܺvT2K-`P@!0!@`YpPp  eY p@P @pPW( D OYO-lM@P `0p%(   e+$L00  "$p d; p b)`0#ek0`{"d8e;Pp'hpbk#d[ @gzd{@&P@ `c['`m<`k` P%@g[&8@` b b+P%, f[ T,Xc+c;P% @0`["<@;g;g{P%$@pH@zf[b{#fkp'(@p\@y`kc{%` p',@e{&0@` b b+p' f{ (c+@'0pDpc;4p04pc=eK`;"e[0#0R/i0H-MP @+HP(JDU ?P :V ?P:Vh P 1 @ P 1  HЍ0ii/ Mp@-M@o`0T` P P P J 0`0 PL  @@`Q Ѝp@ Ѝ/s' xh0H-I \  PX0BS# A0,,,,,,,,,,,,,,x,,,,,,,,,,,,1+R -R& !3 P0 S@@PSPQP@S 0301  0O-PpPPP /0PP-PT PHЍO-4MeEU`ĥ@`P pXPpO\DY`XWJX0_oppåROPM QpP,PsڭG$ QG@dP&0S HORcPA &$ 0 d0 `P Prd0 `$D !( LP`X KpP4`\pW@ 0`LG`X#pXx  0UL`Xq  0NL`Xj  0GL`Xc  0@L`X\  09L`VpP `d 0#`FV2 Rp`z2 U`6P 0L`Pp + 0 L`Pp ! 0L`Pp  0K`Pp 0K`Pp 0K`p\8W8 0$ C !PC`@ 0K` PPgFEfFF`UWE8!0 0U2? (ppEA, ,`-d 0@KPU0`U6' 0  2d 0K0`P6' d 0   (, |` P`4Ѝx ]x x [x 3Y s s r p@-MMP 0 C0000 ,     0S 0R:@T\@0I@R*0@\T T   ЍۍpO- MM@  P :N{Q }PP {Q`P `{PV PFp HE  ЍۍO`pR p zR{R }RP @[R 0]SSSppp  ZVQSP@`` ZHzP ,P [P ]QQQ  {P }PV `FV Q * P: 00X 0Q1: @0 @M a@TM C@\  R: R  G ЍۍO-TMMX@p P~P\ `Y  P0S/S 0QpJ pQF P ;HN ⢵P1HP. |AP  0S  0 R! R  b P 0@0 BS`Pp `p;HN ⹵P `p `W PPTЍڍ<p*`V*Q W P   RS PUP pP0E EQP ?Q [Q ᰐ!Y Q 0 ]\ \!Y[`Fp  p qp1P!Y HP  P0]R r ` -Rp- ]W `P`w  3p`p pP 0N+pPrPP   p Pg  mpa p ] @`0 06ShHp@-@PpPU aPU` P JGpH-\50? CR,0!|Q 0SS *SG-@`p 0 ZEP  P= PP FPPPŐpԴP U    `Wź  0  0   QP{LCO-MMx@܄ؔP Q$ /0@Q `W'*qq` Qp/Q VE/Q@0T*/Q Q   P1/ @@~$ 2/Q    Q  :L/T/Q   7   /$QЍۍe  Q Q  0pp 0 Q@}( 2/P   PT*/AO-MM@0Q< PH@@ H@KX8@ **@PP X:8`LP0    Q 00 @P}$ P2/QOX QKP    Q 00+>D @C 1/@P @pxp7/P $`*<`(PF 4@0pI<`(u pP4@0p7/P   U R00*  .R   .R R .R R H Y RYP H8P $P HL@@QT I@P /3!1 0@(PH@H5尰@P:[ oHP r@@`v` V ` V P#@@  z?PV" [ V$(P J`r `V  P 3 pr` ,`R+D @D oR P{ RP HQ \ QP P ᰰPor:[3D s5r RD PD,pR 0`{Vs`rPD V D 5 @ .R*( p00 p  W oH r@ P0uP 0 U P U L@ P# /?@U [ U"D%P Jpr ,pW  P 3 pⰰr [*, @ B/o"P { R HQ S Q    @?orL0P:T@ D {P<`r UPp[  `r VD r`{ R V <`嶰@P{P$ P2/P{X Pw H<`q|괐YL@QFP$ LH< @0 `Pe$@T  $ P PUP>P. LHP< 0F0 P?IHob8tI4/Q. )gIP/H帠 PP㘠 ꌠP 4@ @H@U 1/UEIP $QЍۍ>=444} 0H-PT@P FP(P $0Z !Z O- M@P :0P$P; H % 0峵DP@" ܴ` TP#Q$H 0圵P Q 0 pp@ QHP H8 *PP "PP P P cp⠃堓`C @  PP  @AP@P  2AP@vPt   $AP@kPi  AP@`P^  AP@TPR L @P@HPF  @P@<P:  @P@0P.  @P=P(  @P=P& d10P\\\! ଦg c ` ] Z @W T Q=7PK=7PD#PP P P P P6P ЍxhY 4$ 2X $r]j_?_dV ^uP LU U U H-0P  P0H-.0"S S, ^\S P  @"T P @^P CP: S #S 0@0 0CS   \0#0H-RM@a` %P PRލ P  0 -/ppp x PP 0C\5PD.P%QRލh,Lb O-M⌘PpQ  XFP U  8@@w8Pp@<8a x`$@L:p04P  fH Ja0*f*AJA  C0T`OTp  p`3 x, @04PW B 2w[ p ϮPe p`  ( @   `,GA@ `0px@8<04PGP0 V ( HHL@wpC P7 G wP; GRRQ RRQ RRQ RRQ RRQ RRQ RRQ\ RRQU RRQ RRQ RRQ RRQ RRQ R 0R4PQP 04PQ RRQ RRQGY :[ ,P\GP]Y[ I PYoP{P pP PGGP Gt \GPG G0 G GA@Q PP 4P " G P  lu4Pd u0Y IP  uA@ uYA@P  ux 㼑`@p )P `㘑@pp '(E<!EY `@p  Ex 4GPGp EppV   4u$P D4GuGPDPV P[  [6DE>0PPPЍDH+(J #/K ?K K %'p%%%H$$H-M;0Ѝp@-MP@Q@ ``+  0P@ЍpF#`<v` Ϭ Q@0,O-MPP  `.vp- Q  #vp L㜰   RQ ᕲppᒬ`P  vp``Ѝ\@(@-l*dP XuP JD8@T@(@(l\@8Сp@-@PP xupdXa@"`P@`C`$p萡H-Iu   $G-MP 7P`LP<pU !p Z@Ѝ PJ00P Q ll`q@pP @P  @P}  @Pz   @Pw  @Pt  ?Pm\ dPe Q #P_ \ WP Q \ MP- @P @?PD @?P\ 0P Q m\ %P Q 4 T! PPಠ(P ?P  묐P l@@m|@@$QЍۍ2`lhS`B B < @U (S ߚӘ~\\(ȼI> u%# @-@P ܠ ||pP P \.?PH((4əԺ e0H-@P ||{pP NP \PP>P00((k0d44 H- P<|d@0O-$MS) C`@|50````0   @qQV  q ZR*R ?R>p/Pd P4 .PbP_ X, TZ X/PW&[R! \R R %V  q *R$q *RV  p/^1 ^1R  V 00 0  @.P  R pX T  X/R q/QT //P T TV     @p^0A!Ao?o2@|Y]Y8Qp@0V PP P\PpP_oR=p\Q /Q IQ 0V  pQ9 P-UV @@ @P\Y@PU |0S$ SQp@V 00 00W V   rQ'pp @P@@[^ <p8p6Q pP//*/pPp(pV  p@T 0  P/TP  p/P Pp$Ѝt@-@P PT TuP T 0kP ?vм0H-@lP@=P X:=P ? T0T00pO-MBp` @0 pPP uf?`-Pc``ᎧPP `  0ppQ  〧PM PPG p p  ` < U   0@pp) XᅫPP1   0ppp @  0pP  `Z:p@@ `L@@`-+ P ߍ^8 t  O-MBp` @0 dpPP u>`-Pc``PP `  0JppQ  PM PPG p p  ` <    0@2pp) XPP1   0ppp @  0pP  `Z:p@@ `L@@`៬ᝬ P ߍ < X O-MBp` @0 oPP uJ>`-Pc``rPP `  0opQ  dPM PPG p p  ` < 9    0@op) XiPP1   0pop @  0roP  `Z:p@@ `L@@` P ߍB p@-X`@P`R JP` RnP p- p@-X`@P`R P` RnP p8- p@-X`@P`R 2P` RnP p,   BnpMH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S7 QKHЍ/PMH-MPP@  00@  @@@ @0T 00@MР0    R  @ QKHЍ/MH-M 0 00(MH-M  0 cMH-M  0 uQ R /@O-,M 4Hp 00 4>tp0P  3LP0  )(P0 P P0 T p 00 0 ppbfotᔐ&$P"a``\ pT^*@ @@@!@%@p  p PP   p  8  P`  P`J `D LP `Q fF  `p_qvP$@p d&0%{ `P \1%o P `2%d P d3%Y P h4%NW VHPlᥨ@@(P,ЍP|) Ro) -) \_T ;7 %DTj vD X &mu9)Fl ;<4 DCIkCCCCCtCcCOC;CBB^Bvpp@-@`T' PU$ {6D`p Q/R DP@Q Q/RP @@`P PF/R SVP@X/UT@@@P4``T ( ; p8 87 W( K-MP76P@ @`t,@9` —`P* pPP$@Q9"P$T *Ѝb@ Pd88880888h8p9Ѝ !Ѝd< Ijp@-P`@PV@ 5P @Q/Q /VpP1 R0r/S@CPU@(P ;Prp6 '& ģH-@M04 $ (8 jp Q@Ѝ@Ѝp@-P`@p T&{jp Vj@U pph @ip P@jjjUip/k% ;-M ЍpFF|~pqMY1hpqpq1`pp@-  /oQ 0?o? #'S @c\ \ ) p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#  pp@-  /oQ 0?o? #'S @c\ \ +  p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#   p  0%D1B0D q1 A 0/0 0%D1B0D q1 A p0 Q/ 0H-   ?!/Po? So?`'P @`Q Q ? , (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +  H-   ?!/Po? So?`'P @`Q Q ? .  (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +     0D ` p1 A 0/ A0  0D ` p1 A p0 Q/A0@ ZH-@ p A@ ZH-@ p@ ZH-@ lph @ ZH-@ ap]PPH-t7`(h?0/R//R/?0S/R/P/R/H-&@-MP 3@T   0Ѝt@p : @@@P@@T4$ gFiꠟH<xtL Q A i괞H-(:7PHh개00O-M0pᔯW q   Pϟ Wb PU] @l%Uq@ P%EUPL0aXXXXXXXXXXXXXXXXXXXXXXXXXXXX P XXX4XdXXP$h$XXXXXX X X$ H X\ X  Xx @@pG@@TUy  `8h@2P X=P @2P N=P @2P D=P @2P :=P @y2P 0=P @o2P &=P @e2P =P @[2P =P @Q2P =P $@G2P <P (@=2P <P ,@32P <P Z p B`@2P <PI @2P <PC @2P <P= @1P <P7 @1P <P1 @1P <P, @1P <P& Y `p#  0@ Q`/^0 `6R  3:^ 03  ϟ0Bp5Q p UUptzU3pG @)0 @ R0`/SP` UPP3`:SP0ϟP3`0 Cp0B S pApG@7T 0@ P[pl  0 @ R;0`/SP`<UPP3:S0ϟ`PP3` p0 C;R% "[ P0 @ R0`/SP`>UPP3:S0ϟ`PP3` p0 C=R Dp2 PW0@ Q. a0/RP06UPP30:RPP30 p0BA4QP8llW 0`@ V_ 0PUR0SP::SPN* 0PA`0SE0VC:9VA 0PA0`V80S6:9S 0PA1P0@ Q a0/RP0dUPP30:RPP30 p0BcQ^ 00@ S Q`nA R0V::V * 0 B0nAaPU0S:9S0 A 0 @ R0`/SP`UPP3:S0Ο`PP3`p0 C R  pt 0@ Pa0 /QP0 UPP3:Q0 3 0Ap@ Qp0 0@ Q `0/RP` UPP3:R`030 ϟ0B Ap R p 0CBp`@/P :PW @/P :(ϟP MJ P50`@ Vp` 00Fs Q1 FR0 r0%pc#tBwpp#4#11C r  0 @ RR py P? 0Uϟp g 0@ Pa0 /QP0dUPP3:Q0 3 0ApcPp P 51ESr?dp0C+0A/S@`!0,|||`0@ V:T@`  V@0A`@ T T.a0 /QP0dUPP3:Q0 3 0ApcPpdl'@ R  51ESb?!a  `$@00C P \ \L @PUp9 0C\0@0S0/ $0`0pC W@B q<̟P@p u P k˟  0  Sʁ pXEQdpO MR`0 TR R XK@@@@@CR 0 R (k`` @ ˟R w 0``@rQ 00@ @R @ R @ R @  8P7 p  8P2  @8P, l  8P& T  8P*   8P%  @8P   8P @-` 8P @-` 8P   @ɟ A0A S *@0A  p$(ȟ L`AVJ*MQM0a a$p( +'# tpȟ  s (  ̧p <ȟ  [ǟ VRA 0``@( JQ> %P Ul lWEXǟ p< 0B0S  B  p. %!ER2?d a;QP.a! @QH \a $p( Ɵ Q JQ@ ak| `H @ Q` ` 00@P*Q  gP P@ Py$(Pݯpş şzU :0@@@A.ap$(@@@LA >a $ 0p%a ! Qe  Q*%!ER3/>bK/)<b!qp'qqpWQq ""q R3$40 #0 A6Pu4 `l0pEPQ0"/dqaQ "p Bqpv AqA%)b8/0!bB$I"IqRBq/!B !b B AQ>%!ER3/>g 0K5)lB6#sP%Q7sP0UQ>sp'r6sp0W03b4p`gpA W B R:4 b0 G B 1 \H%!ER3/>bK/)<b!qp'qqpWQq ""q R3!40 # 0C +pE0Q0"/dqaQ$ "p Bqpv AqA%)c Rx?1CqJ 0Q0 R00 "QߍP8 )l5@bL6# g `@cr0W03\P8 )l5@bL6# g `@cr0W03 X hPxxDTW  ! s  XX W ? ' H@Pp@-0M``0,0 0@ b*b 0PJd@*C0 D0JE00Q Q Q ,HDa ,H?a,H:a., Q0Ѝp_0 RB/R/K-@T$ `5+PpPEV QG PEQ G 0S  SQpp@-R0@@T 0R@B@Q(O-M@`"PT.p=Pp$$P8  "p1 *  X Z  "P  "P lpp P "  (=  (#p#Ѝ @-MQRЍ@襚)TP @PЍ>.@;. ЍO-uMMTp W*.@AP` ^@p7 @P:./@~⠥$E EOWdE`E \E6 0 K x pE匥pEE@PJWP@PuߍۍH00 MH-M  0 ЍHЍ/MH-M 0 00LЍHЍ/G-MP@R `UUYSJt 0P @ P ՛0p` aa`` ț\pUC)  Yp ` X ᮕP `p Y{U iPL Ѝ` Y ᇕ`P 0@-M@ (P B " (0 1/`p) p 0`VQ <`Vc !-`p eP @`O ЍЀ`G p@-M@(P   (0 1/`p, p 0`VQ <`V ,eP @`  ,T`ЍЀ0H-e"Q& @T# E" Q0 Q  ٚ P Q P0Ϛ (˚  ǚPU* 0 徚,P 4P 8P 0H诚0H-(P@P`S0HY,CTt@- @@RsS@LB t0H-,@@E SP>0BsO-M  `P0V ` xQ9`p@ V `W%6p@ V P`pV 00 !.2`0@P080C?o2k#0PC` Y*U .VPp@ VЍV @ P  BPR P P  P (4  R  *4 8/q 0X\S 040:8 R РS /axBH-P`@H DpᨾV  d Ὂ 3.p@-@P`+ 0 H-  |`V|Pa@<lHd `\Q`T T %QR|Ps:|P Pn V 0AnS{`1 $,4<DLT\d0A&0-Qj ^Qf00 0`?Q`00S 0 00 00R 4q0000 3q0000 `3`q0`0 0   # WAq0 S S~ h3q`0000 `{ `` ` q` V0 Vp =V Pq0#SP)q`0;V_ 20000U 10A@,\, ^ |2010S0+D200WA%0@0q`;`V`cT@SPQ^"PvpU# Pt@dT@dT 0A \Z ( &Q& Tpa``00 `"0Dq@ @>0A 10  =Q )`` " 00000       谹XԹp|( L H |O- MP`U 7 p@  0 PV. `FPp(p(V `FPU P&. V `Fg)@V D^)@ Ѝ0  00  Y6 A-qPpW1 /C!=QdaV P $QPXDP* V(V`,1/P- V;  $P!@`@`P=pWpQ 1/xpV@V T  0 $P X@ggfdgP5ff5'A-qPpW1  HQdaV P $QPXDP* V(`,1/P- V;  $Ph!@`@`P}pWpQ 1/xpV@V T  0 $P喺X@e4ede3dd4 &G-@P_ `$PZ qPpW  U` /C"=!i QU Z%PB @P U& P0=pWpQ 1/U(?PP   1/P $@Z $41/P  dcTcc1cc(11G-@P_ `-$PZ qPpW  U`  H i QU Zb%PB @P U& P0㔓pWpQ 1/U(PP   O 1/P $@Z $41/P ba\aa/aa0//G-R`SPP 0/` {O`V @@ P q``@@T p P \l``` \0Xp T@0p`@`P.____d_D_T_----K-R@SPP 0/``V ppGw P ``ppW `Fv P l`\ \0Xp T0P`p `P@l-^X^`^H^^]^,,,,O-MMP `Q ֎P P/P P &&~ e%?bp@-P Q @Wp@p @TC Wpp%9%"P/2PP- ~Wpp%"P !`P mWppȹ%"P@P \Wpԓ@pp@-PE `!\ȍH\E 88 Q,  Q' P:Q0Q` 0@@CQ PP@\Q@:Q`VQ`C`Qp@P 0,  pH% p4XXXHY(YY0p@-V" 0S P:S`@T V P 0`@TVET@V :RV :Vp@PppH-M0   0ЍO-LMM(tt` W0H4W XPU p@ R 0S Q:Q |Q T @DQ:Q @|Qp P4 0S 4@ ,VJ 0y'HP ޶ 0uPr \U`VJ$H4Pp(0`KpU:H+@U@P`HP P1W Y4 ppQ 4#Q 4p$ 0S @ T  R:RU |RS QA R :R |Rp$0`0`0`W9P P P :P \PpYp  p,[:4`,@KᔐPK ,K40`(PU TtY $`@0SW4M`% %$0`, BP @᫦ 4@,( @P 씟t4@ P p@:PtPP P0SRS@@Rn =R R@ @Rf @:R  RD@H 0$H@Z zz:$dZ  G B 0S:S0 AP,pS:W:P $ AR$p0`4`P PApP ,D4@E$PA0`p G0 @"  @堑0@@ @(4P,pP (T WJᴏh"P  @ၑN#  W," XN?#@4n;#@D`4hp@@8P pD 07/p P 8p@T <@p@1/H! #jPBP  1/p#Doᠢ  1/"   HP LЍۍU( @P 0S"@(P S4X  (P 0S@TV,S ț\4ПS! /lH-0 R ^  R:R |R S 0C R:R 0|R 0H-PX@P D8044  0000H,MMLLLH-LP w<00,,  000LLLLLO-$MM̳ CP@ # 砓堃Rs pY P pP 0SL `# R P   AQ (30000@:R#R'P\@o" R`PU dP "  P P xP Q R  R\R    ` Qs pAQ\Q  PQPU :Q P 匱 G`A:\  P6DaB `00S :S|S0BPP P `~` P$Ѝۍ뼘(LLLKKKDwKKJ8vJKt$JJI4`IHK-@PP `@:P 0S R p  0SR@GS@R =Rp@W dd`VP P]W\W P:P| 0Q-0@ 00Sd00@ 0R_@0@pp ^W P:Pb p@W:W\ @p`V PE dLPe Pd`p]WB@@2QE p:p@ppp p p p ppV E   P  ᷎K-@PPE `@:P 0S R p  0SR@GS@R. =Rp@W) dd`㏈P @P p`V PE d⬌P Pd`pW:WV E ?   ᕌP  cp@-0S< P:S0`V S P @0`VSEV@S% #S0@Sp 0S xP0P/`0@E T:a@EV`T:A@E6`T`V`#0pO-MM`$ P @P1/P,D 0d  4 p J|KP$`N p4 @YQ:Q(d P8@`@ ` I P 7P 3P .P(d:K$N ;K/$N 0;,D(dWp @P|P @P9LL:P 4P+YPU  P ☀ pAР B` O\$PK4 :Pm - @p̛-ľ :XH-  2MH-MPP@  00@  @@@ @0T 00@MР0    R0 O QKHЍ/WDO-$Mlr`p TT nDP"  0 `币]IPP U: @ P  E p p9APX qp Xp VQ!&H@ 0 ǰP"" 3q Q$ЍE8 P9$ P2 @P QX" 0# " !  P 'PHP  ,P*{ H "[ ,pp P $Ѝ p\><A/ۺ 0=Xt H-8G, , ]& ;|?@-M$@;0@07P@Ѝ;@ /  +` @a p  / = @ /  +` @a p  /=@ /  `A ` p  /=0 A@ /  +` @a p  / =@-0M@Q 0 !   0 T $PT,0 0#0ЍH- M 2NP ЍH- M "NP ЍH-M  NЍ 7O >O06OG-MⰀp@`PA$Q Q@OidQ`Q\Qqpq@  0tPa!Qލ4/K-rMⰀ` pP@qAA O6\AXATAxahayD | 0lZ@$-!Qrߍ|Lhp@-P@`( 0@>p0H-`@Pp 0@+O-M俟P`p 0Q@$ 4<`Z<``V`  @P Q AQ P Pp%Vp@0 p@WzP4!   0t|,8DPp00@y@pv@ps lKpkKphJpeJpbpPSPVA$Q AQ:P P%`    <       <<尀 < 00 $0 R P0>P% $$L00g@00 @m00@i`-00^[ @ `[ p*(8(-8 , p-Q*-(][ , oO`@PJpp W  pp pP-8Q ]Q( 000000I 00@0000I 4PuP J  P< P@\P0Z? @-΍D<`Q  `T 0A DD `Qz $Q 0D @B D `V P @P D QG0Z@<`D@ PZD A``D PP DHD$$00Ϡ mCDP<#0S +@MQ llLLLLLLL8888888888884 QYm-8m4 4%@M @` 4  BRA:m4 = D@V(0 Q6l044Ql 4m mD D P@h@EP00Te0` @@F ϰ T@l# ,0( ( T8@R*8@`+Vd -Vb Z] $4< <+VPIF%P:$$0  P P,VK0V_ xP8( 08@( @8Q V VQ @Q(@( }P?8T aQNdVEV PV" N P @ _8 8 @ UpV eV80 @PV 6( 80 @8 8 8( 9()V @   _P@_V w nQ @  o(V( @j0 @  P 8 0 lPQ 8 `P@`P@(`T8@:; pFp @( @ P08RJ @<[ P0 0H0`@ F `  F0` F@`p FP` B8 F`` B F嬒p P  p0 `  ` 0 `P80P8  B8P@ P [0 $$帷 ,<``@8ZK ޒ[ PH0  B B0 B@ BP B` B D@p B8 B Qp P0` p 88 Q8`p K-P ,JP`8`0``PKP [rV ,@P $8  0 @8<`P 0PV8$$̵ @R`B@ P TA-NQL  R `Z0A QP @P@` x@`PZ0A QP @ꄴ 44(`@K(Z*TZ:<`@Z D t`D  _D pX [ `PH0A@  B B0 B@ BP p B` A8 B Acp P p 88 ;P0JP88PgP P0Z-`@0@ )D :p PD P$`$W `$Q}T` 0`@kϠZ@TV] $$<`=4D[q XRDt D 4 0<` 4 0     <` <`<`<`$`$D H  @T @kV3@T0`[ @l P$ QADQT $ RߍrDip oPmn l"iO-Mp- P@P 0`PU  0PO0`puW  P7> QR@0BP#*@W  _P' ` 0@pQ  ~P #JPJ Ѝg0H-@P q@ 0@-M0$ @ 4/P @@Ѝ@-M <$ 0@04/P @@Ѝe@-M $ 0$@00 04/P @@Ѝ@-M D0$ @$@0 04/P @r@Ѝ e@-M $ 0(@00 04/P @[@Ѝ@-M D0$ @(@0 04/P @C@Ѝdd@-M $ 04@00 04/P @,@Ѝ@-M D0$ @4@0 04/P @@ЍcK-M(]\$!'`";)|{}0S(* p R!*`V4*PZi Q*T.(쐟PxP  8@0< 尐 8`4@ P#<! HPSߍP 0 0mtp p0 0m`\[H ZLWxWH] č ̍ n ΍  8 y  k H- Mlpp,,Y{U @{TP{{ { $Ѝ蘆pO-M@,XP P ?P# r `?Pk  ` `U   q?P X `$` `Ѝp P.  P.  P.РP\`8@,.V HP]P`U .U^PU P`L\ZPLp؃ #"@+*P` ```A-`$P@P*( Fp p P $T @@T(0 XU@ U Q00p@-@P  (=LQJPUP{LpPzP PzUP zz,y>Pp` `u=zV P`pzpA-`PV@ ,@ < %P P P R P, P%R+PAP&@ @ 0Dp"0'5P  0 P X PU$ RPU4 szLPH P`U #3 0h (<P pWzWP P, P=zLp\ ,  LP[ b2 0T,=P_0\` ,/P P]Q p2 0 P ,PyUPPG-` g<p(& y PP@,Be=P=P%,6([=P2 `(Y< `, , $ 1<p(" dP0 , @/Q/\0  P((<$PPV $?~}r r r H-M,`0@prP;Pp$ p=`p 8  "! @  "!<` t @; @`ЍO-DMP, pHP `W@p ,QH @GToT㠂<W,+Ws $mG@o㠂  0P  P $ ,,<@ ,  @,0/Q/ @ $ LpU P4@ I0@p `@P@? P ,  .Q) P@`㺐(p rP p\ T X  8@4`0@R 0 @ P$ @!Q .QQ     vP @T  ,$$@I0@P `P8, Q,L <P $ /<Q QP, , 0  $ w<QP& <@<YZ (@pX@p(pP" Q  \0R 0  B   RLQJ  \0R 0  B   R Lq,  $0T C4`0V0R TP5WT LP2 0 0JP!(PT"   DЍOr   w8 `P pwWot @P, , DЍ,);P H-R3%18Z A-@  P p`I PP-2P P-P PjwU W, ,LP/P ,t P9p p:`9VPPPtp@-d`@`P (PP (ۉ(ى( wwp@93  2H-(M$qP `p@P @P p 0 a C$ 0A = P"# (ЍAQ  4<H$ K $GG (Ѝe 2e } R/R  /2100<1O-MP@R D "P uXptЍ`SP+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0o@I" 01 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Qlp@-@M@ P ` 0nP @ЍpP 0`@Ѝp0H-P`@8@t  !P0P8P0p@-P`@`k8@t  PpPr8PpG-MMd`p 0o@P# 8  P oP() eP J9P J  P  pqPpns@ P p$p=P P`P^PP (A(u uuQ@PPЍۍ--J0H-M Px9@p   P  7p  @+Ѝ0O-Mp`$2@PK W  PP@BoP V PP pp `P`&Y P QsP: `E 0  8p `FPPP u 0ePPpP 7r7` p  P\`   pL@ Z p`*` pp W * IQ  Tq`Tn@P`(0 0D`V `V P P  QQt` GPP$PlЍX)0H-@ t P PztU 0 O-TMRH 4TЍX @H0 8 TnP XL@A X@H`0x HpZq H0XP0 U`PL 2/ PH R* 0@  dW*c C*DH @W 0 R``0HH paQ D 0pH ` P@` Yp PL  2/PH R* 0P 0p  cT*g G*CH 0PTP 0 Rpp00HLpP $(@ pP  @Y  @p Hp[ ` P Q 0A @ 4@U3 pKS U<*S4`@ P [  3U3 [1* :/P Q 8PH Vp  ARM*@} \ P&:\0 0  T02[1: !p0 k0S DRpH Hp  Q: Hp  Q:Vp  P*@<VT@00U1(:  0 e0S D\@<4`V00  T02U1:  0 e0S D\@<4` @4`  Q:@4`  Q:~H@ T.H`PP0p Y `#L  2/PH R*  0p  cU*g G*CH UP 0 Rpp0PH Y-H `P0p [ `@#L  2/PH R*  0p  cU*g G*CH U 0 Rpp0HD PPH` V P @ HL (2/[(P< @0PpPp i@4, J @p'X* Z*P@Dp< `L 2/DpPQ @@ `PV: U@4/0P,   X * A H`V* P 0 R c*c *H CP R 0 R``00PZ.:,j  Xe*H R:X0Q1:P0  a0S*h H *AHP0S Q00 0P  Z*PL 2/PDp' 0P4 4J, P PX*H R*X0U1: 0 e0S*h H *EH0 P0 RPP0@ Z0:L  2/P,Dp (&'T ! @oTЍH@0 U`0L P2/PH R* 0p  cT*g G*CH T 0 Rpp0 @p@-@8P! ( `V PPU 0# "  0S/PiP* !P` P 0" `V PPU 0# "  0Sp/iP !P` P 0pP(ցpp|H- P@U !P `'p&pWiP !P  0p@-M P@PUUU  P 0#" ``i R`P QЍpO- M@P pRR$$1  0:  B2p! P J `0`F`V @ 0 T 0S $0WT Ѝ0H-@DP (.P((00HA-@Pp31``P (`P  ( xP p ` P VVPPTp@-MP ` 0@ @@p@ P@`ЍpK-Mp@`P P x00 pp@P `P FPT"PЍXG-Mp@`0 4P 0p PpP `P FPT"PЍO-|M`x$ P V %P0, zQpA< p|<H $  T < p T | h<n 0xi 0s,j\0UQE@mW ` 0(p#/~7h@JpJ.mPSr`U)<S%mu0Q#17pP%Rs0pPn3Sn( `ᓴ0II;U (Lr E! /@!B BpNp T(T P(JmqR3/>`%)<#"mqr0Q#1'p0#2r pPnq3Rnq P V: PD P@!gQ VQH@, 0 | V4* P `@\oIHP% V&: P+x V,:E)@P"d cspgG'v2br r#18?Oc0Q ?H@ 0: V*P `@\/ H@, 0  Vp*Pl `@\ B/H@Q 0@ P ,0  VO*PK `@\H@, 0  V7*P3 `@\H@, 0 ȏ V*P `@\PH@AIIP(@!, 0 㥏 V*P `@\H@ `P IIP@!, 0 わ V*P `@\w$RE)PP"d cspgW'v2brpwY1(/Oc QTdp=H@ 0SV$*P  `@Q` PJ @p zPo zP V*Q `R`p=P8 V8:u$ H@, 0  Vc*P_ `@\ H@D,  0 VJ*PF `@\H@,  (0܎ V0*P, `@\H@,  0Î V*P `@\ B+H@Q 0@ P , 0ᡎ V*P `@\H@, 0 ㈎ V*P `@\} V* 7 V* P$Q `\h$C  apH @0 D pX \0})2@ > V*P `@\D V*  V> H@D9 P 0. V*P~ `@\# 0 W`kH@8  0 V^*PZ `@\$ HH0 1`HPP=)pEQ"d aq0cw#6aq r1OcPd`  PJH  `@p *` Jd @JG*@ |p. JdP `*` @JG*@ u~!  p P# /0$8 V*Q `\P d0p"sgb {tgYP#c  sqRdP d0p"sgb {tgY#brpwP@dp 5H@ 0QV:*P6 `@Q`0 $ V*Q `\3$h V*Q `\%1x0OQR0d Br Vj*- Q 0` V 18 ?OQW dpGw V*- Q 0` V $ V=*Q9 `\18R?OdAP3QH@ aB0 ̌ V *P `@\Qd@RQ PH@H3`B 0ᯌ V*P `@\Q; W  PCdpG; w9ʠ V|*-Qv 0`Vq o ; ac |2Q 0 Q!00C -Bo R `V*02R,0 R `W`H@HR2/3 !Q1IP2aB%d   , <0; V*P `@\0. . : `81H@ W0 pgBp! Vu*Pq `@\9 `0H@ W0 pgBp V]*PY `@\ `S `xP|Ѝ#19 u5 5 5 4 M4 3 h8 - I8 71 7 Z d* h G-M@pz#x`P P  0p pP `P FvPrTo"PzЍ$ 8 G-M@pzw`T 0P  0p PpP `P F>P:T7"PrzЍ@ H-p0PP<   ' H-p0\P L@ <4,@(   P & ܪ0H-R0P000@0@P@PUS  R0tuA0  )K-LyD@!P F 0 Y_t0INH@aOUEHOa!QA0SY  10"@PPT1S! A`VS0!V A`p@Pp1@@S10!Q0(K_yttttXtDtHt$tsO-MttBp@Ly`Q XT" BB!!0PW}:PD W*"2 r B0p@f@W P*0@P 0W*@P W?@P03@3P3!q  p@P0$01_pDPNH@Q/O0\Lfb)YIpW `!pS   !Q P!p !` @pP@1ppQ1 ! R 0 0 @@XxЍhsDsP  4 $`P.0 $P P 1/00SQ 1/0Ѝp_ y H-XM$p@P=  ` P00HOb0 bH-P@a`P  >?bP paP P `P  H/`P H`0H-P@aP P P`P 0H`00Hap@-MP@`P `aP P ,0 0~bЍpЍp H-@p`P P`P aP y`P t`P Hn` R R R#0!/ R R / /   /00 //   / / / / @-1/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/0H-PP! 0@T 0\\ 0@PU @U S000O-MM4J`pQ00PߍڍٛHPP*\*X t`X`X\^Q:[pZUY iYi# @[Z|q0(  L@TJ T*0S? (I <PWJ X3: Q:[ZPQQ Qs QQ}:@ 0S <( pXo'p BPf [`2Q Z, p500P ǟ B  B4  @ ``   NP p  P0!00p& ҂p P*0 gn&w00p ἂ PppAQ :`&  x60PnJ Pl*T&@pIH6 0ᎂP^JW\(&@pG6 0~PNJWL%@pG5 0nP>JW<%@pG5 0^P.JW,%@pGt5 0NPJWH%@pG<5 0>PJW % 5 @G0.PJpTppZ @ `X`4 \ 0pP0PPJYI`pZa0pS\ ?I#s0p P}J| PI:y 0 8o  {0`2(P P$0"R0p0P01P PP P p PP0 Q0P0UpY 00 0  P @PP( @p P  %pB@X10  0PppU YpW W WApX5  0`pPp!0 0 <&YP 0n Qp @0  2PJp P:p p0  0YP pyT    H  t  (G    f & CN S  f & C  G-1MX@C/P< XP C`Z=Cp x0S 0@P P P  `&`$ P P @P Z0p  ீ@P P  (%` ` P1ލژl O-GMȡp`@P   W pQ P PV P@V @P5wp  0Ep 0 P 0S:pp PY Y `(0P  _PGߍb H-M`PPJp@P Q R 0S R p@@IpЍ0H-@PUP0P#/ሱ 0H-@[U@0PP [O-M-M_P @4`Ppr D DH@ p Gp Gp G Gp G``ppx` R<D@08 ? 8 pPP H@T @p_P[V@ `P [PP8pO8pP @ 8 `*` B QP*B# Sp PP   R 0Sp 0 `Ss 0cpSP136Q p4P @ P nP`*nH0 A *ADpP e4*e F*F@ `*`ȏ @*@ q a ` *` @*@< Q;Q Q P   P0 S p SR`pV P VWPSR VWp<Q1 DH0 P.Q QP PD <@%Pz `TP PFD H 0@S pPy Zl wp>rP`DH0 EPXPPPPPUN  @p<H:@p 7XP ` `!  Npt 0 @ @  P `p C@p@DH0 pP`TZT` @P LZH@D 0 pW4@ Z@T 00`P `@Tv P0P P P P  P  0SI`PP P YpNP H܀@p8[P pPߍ Ѝ"<P p2p0ZD4PP pP a*a A*A `< P;Q QQ   QP0 S ` SRQPSR H0 @CP 4pA <||)|9 0Mg4@pP# a DH0 4pP1`V PPPaVDY YuGYW` pP ?YhDp pZpPp} 8Q8+PPX `VP @> PJP SP X> pPP4@ @` H f谝ppW@/ H`V,PRpPP$ Q @@XQ@Xp RRv pQP Q@P= XP0 << 8X. @<4 偲 @D|8@P P>  a*a @*@ .0 Ê及䐝Y& S Y p<`,@ P00@pPT*P  RP pq0PD `*` @P*@UU pg#Np a0ϊ ϊ0ϊ@ϊPϊ`ϊŠ ϊ AH0 ! PkJ# @PcJ  `pZ ,PPQ P?  `*` @*@  ⏊ R'  W R <`,@ Ppp@PT*Q 00 SQ q0spQD R Rp 08 p 0 BaP@P40pRP PP,(P$@P`N# >hI L PP @ 1 4@`00 P`V ZWP Q @@NWQ GWR@ P  @ A A4 @@  AP A6 TH 0fX@P* 0, g P JP  0 A B!0 0_P t@P@`VdX@ TP* H 0/P" 0\ 1 PJP  0 A B!0 0)P P Td1St`)x@d1#^*t R q PZ?[oXp @P R P P pt` @aVjH`Pd P 0XPp E EP E E0S S SK0d00 Xp`0\@00`@X0` 0xP` V @ N`( dP6:0,d` X**V  Z[O`0  `V pWp Pp R ` XV `Ѝ`,`` VX@Q507Ѝ_#K-XM,PVP @8PP AP A,p<004   bP 8PpXЍp  ` *`4 B*B pP TpPP8P4S,@004   3P W pXЍ4 P4TpSWXXЍKO-YMM⠥P@ `4`qMPL p0@HjMPC P84 V @ @@pU0@K  `$,PPGX,`Q  .QRPPP .@oRX_ <",`P  4P $P `Z!SXdX ,:7$Q :X PPZP `@.P _4 4  PW,` R (U(T Q DZJ H(P P:W"_P0 v4 PTʀ@W=TD Q 0@Q,` Q(( 0@,` 1 Z  Q ( XK*,$Q:vWAP ,@ .P  _P4h :,PP4 SP&< $ `4P0  PP TPPV 0   PTP:R 8R@t -W@(P 'Wh &R $RP`PYߍۍU(P  Wꀤ L   O-4MM,0Q0p @$P ( v , 00 `PK D 0 86`P:  0  8 c`P+0 0p D(  !$PU 0 #"(0? / r `VL0P4Ѝ؍ `V$P`2긞 ̜ O-M-rM M<iPP‐`@ Q @ @90Q Q TQ !QP90pwpP( (0 0 0WUPJ< (1/P ,P&`RR@NP VV@&@àR '@p0S @0T*o0` $BoPpBo $40 @, 08PUP}JP< ( 1/Ps PUU`U @V9K oP*0`!,0 TPSJ@< !(1/PH !PCPP@!  > 8P@ P[ [ @ 8P0`40S%T#*0CP ["[ ![^ [P `rPD %%0 ^^@8PK40P  \P'` $`%H%0 5^408P @ 0`S [R @8P[40BR@ @UUPU@!,00 'TPJ`< !8TP !' PIP !$@T8PU  PP PP[PPf W" %^ P0 S^ d VY0V^P $RM RL dVI `P[@@ `*` @*@ d@]MPP  ` !0[*` B *A@  @UP PoUPp@pM   8PUA PQi ԁP@@` ⏊0 `< D`堠L`P pP P P *O[ PW @P  Q T@ ,@@T@@d``Prߍ ۍ Ѝ2NS"H Ԝ  j 00@AAQ3 S_0@ 3?o20-0@?o2  .0\0/.P0 P/.Q RO-LMP( @ @p @La`0 ` *` @*@P! a[`7  PPP(  Q Q Q WpyP`V PPU  V ``VW DLЍLЍwO-MS`<@pP @0P@QQY P; ~PPxP~pXRP@PPz@ KPU P0 `! @t@*`@@  0*A D p0p  0PE @a HPPIpQP@PPE@ KP P0 `! @t@*`@@  0*A D p0pS  0|P @,@ 8XP P  8KP P@PdPPPЍ@MVP `P M L| T d O-Mr`@Pp   *p p P P Q pP Q[ P pgy@P`[ o@PV XQp 1   0 P8Q4:Zp Z.   P&P# pp Wpp Q  p WY P 0 SPpp8pp Pߍ، ` p Њ  a @/ #EgܺvT2K-P`@!> Б@piWp  D6  0 )P*@pP:O-MP0 $pp @R P x$ j'MT0H00 X` 0 V7 8N p\@b* `0`0p0p tB0D7`p<p`pn aLpdgehp p|uO0P8p0 p *v wD lb*,P0P0V0XJ0Ppǂ( `P` Pe FmOPteL `  ` h iFx`4 ` gDkH @b ` `  Od  B|@◊ pူ p  w \yH bu `  `"akFl PPQ]O aZ 003y6J7@p@p@!x yD@Hp`dE`p`buvO`PpmPp0P@s @pLPpD[0p@0Qz^vB0p8c9@p`@w yN@p@@Ѝ `Q V:pP,  pV`9 ` `pW* W:@V   DP    1P !O-,M@p(0 PHJ( @PD P0(0 ҿPkJ( @P$Ph  0Q^*0S0S S0  p0p pCpSpp0R 0S 0 p` `PFVPPP`P   `PFVPPPp  0pCSppp `PFVPPP `@FV@@P@ p  Q $?P BP(PP$` @(@T*PP, P  ἐp P ᝰ @PGP ∀ P PY Pt    P  AQ   p  @Ppp  @P  } p+   @Pp p i P   @Pp p T b$ $`D KP* D ,Ѝ ꤦ`DH-M@3p/ `p PU9o3@ 0@ @`Ұp&w <00 @P[@ЍO-M(Q:x pYP ;@Ѝ<(e>@` $V` $(p&PppZ,p*P( -!% GQPUW P:P P!*.D@ P[& [ P 31PA21PA21P1A2``p V S @0 V08p`FV8``F9`Z Z P 31PA21PA21P1A2``p V S @0V4:p`FV:``F;`k8 /@- @T ,@T  T  Q*! @ Q*  Q:@Qz A K-MP$PP (@0 t40:p  A0;`0$nB11 a#@ I2'-02&S㒐d @ S 0   ! 00 009p 8`@61`R ,0S SQ*#Q*Q: QЍ0 A0Ѝ@-0@S 3/@CH-7I) QN: @p @D` TP p `P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'"( QO: @ p`P @D`E Tf&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'",@  T: T T     MT/: DR@!(  ̌ Ȍ Č 6@  T :H`P 8pP 0޿QP,MPQVP 4P0a `P 0dЍۍO輿.L /cpPPW S>`PdЍۍzK V ܐC "PC HU ҐP P r6 B 3'XY}26'ԐEeQ"7/ | d XP H-AMp@P` 0p BPJ` P z.A $QAލ-zN H-AMp@P  0p  APJ` P S. $QAލzLN A-MP0@  0A`PJpP Q.Q Q.`ЍK-AM⬐@  0  A`PJ PpP Q.Q  P.T ` PAލy(M p@-`P@Q _P  @QUpH-@`pPU Q PU R P  HTj-p@-@P`Q  R  R`4 pHTpTp,0H-M@rTPP | PU RX LH$P @PP8P40 P@0 Ѝ049 f,8  0H-M@ATT T TPP$T T PPPPPPdPP l H$P TPP4P00 P@0c Ѝ0ɵu<Zr+S0H-@ TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01P lG000000000p0P0H0H0萇ه0܆߆ن݆׆Æ[0H-@?YP =p0 G0zMp@-8M`HP`@4@IPH .07d00. d@U PE O04P8Ѝp@Ѝ/wE ߅O-MP`PP@p RQP QP 0-P0+P 0\@.P *@q0Q00@C000A.Ppp  p!p >?O p  !.Bd0 p#"0f 0`@@@ Q *PP00@@UP:Al) Q 3T Q*``V 0  3@ V`:A@PR 0@ 0@1`00@`d.T``  ``i O   @ Q  P* P B `V  30@PV:IU< VP * Y 0  3@ Y:@R,  0@@.T P,@1`00A`d.TP`` P ``  O PRJ!.@P!.A` Q  P*P P †P@T  30@`T:EV T@ *PU 0  3@ UP:@R  0p.W p)@R P90p1`00A`d.Wp`` p `` O p!.A `P@ Q  P*p P @PP)) ) + + + ... P @ЍD O- 40`00pppPqp@0pG``rg``p@@@ @PA@p0@D```R PP@ BpEF2X<`Q `bfqoq' 2X c `bfqloOq' G2XY`pQXXXXXXXX\XXXX\XXXXXXXXXXXXXXXXXXXXXXXX\XXXX\XXXp!pPRq `0pF```.UPu``) `dPP@]_OY PPBpp@  @ P iaࠔ` KP0EP E`PP@ 4 `PP@.= O-DMCQ @@R  `*` @*@̀ !scp51 Bcr !51Aq%!E"d Rf@ <8p 0C a@)bpE%!Aqdbeup 0C a@xp*bd%!AqdRftp$ 0CtpW& @Z4 Y 0,8gObA00R0PQb$8cs D(01<000!pa `f 0EPW@#?n`H0UaCQAWU"/"bAY DRBZ/ NP@ 2/r!" bSPPVFSo.eP`U2?2c1FVR0FWo`P2`1FB /(CY 7Z 7W 7DЍ0{{fzyybyAVvp@-M`P1 P:P( Q@0@P0SP?83j8V3jaF``P+0;  0@P.U QR0*A0oPB P.PЍpA-M@@Il7  00 ( @Op`PBЍ uH-M@PYPK YxaP`F tYPB `YP> LYP: 8YP6 $YP2  `pP,$ pp n&`PV3opP $0<H`pTvpЍ% _ .s3 tlJl9lCH-M`@P0YP( Q PpP pp &PP U3opPpTupЍ t1 p@-P@GPu`Pu` V P[`㩻p 0R0p0Rp \ 0 /[0H-M@tP 0Q PuЍ0Iw0H-Q  Q  P@@PPHP0@@ P0p0 \0 H0 <0 / @-@<p ,X0@/ / p/ 0H-P8@p0,00HH/ / p@-`<@Ppp 0p@. . H-M`p@Pp 0@<8 40 0  p0Ѝ:Ѝ. ,. D. H-M`lp@PUp p 00Ѝ:Ѝ- - - /|- /h- P- H-M`Tp@P#p p$ 0ЍЍ(- , , H-M`lp@Pp p 00CЍT:Ѝ, X, p, H-M`tp@Pp , (0p0Ѝ/:Ѝ, + + H-M0  0Ѝ+ H-<p H :h+ H+  4 ! + G- M@ἠD`Vt@@P,0 @ p   H ЍjO-M M$XpP嘋K⨻⤛ Pd JP Tq  ppD Q`P `Y  2PP `\P P .PP`FP V& VD*  p  p@DKY{P P.P T, p pT(.@DK`{TD p p @ @3.PPV$*T:f  @P;;k0C;0; ;S* K{TD { {K } PJ`G  $@ ?+ 0d @@ P+ z  + A @P˞@3{& W:`  @P;;k@K`Fk ;S* @{ KvWo   +Ao{`KDP!!\!| X X\ X(!p!'!!D!hX|l!!!(p !!!8!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!%H   /$ ;hP NJ  @I`V`FP0 W): 7d @?0+ %P P'+   +A@W: f7@ p ]7`  ,?+ 0d `@` Pu+ 嶽  +A@cP p: /7?+ 0d `P PJ+L ኽ  +A` 7l?0d P P$+L d`  +A` 6d 0?0uP P + ?  +A `  /$ ;uP JP : IWP  P :   h +Ap W#: 6P + 0;?+ 0d @ P+ P:  +A P I PJP  P:    +Apr   / ?iPh Jlo` +R  T   +A Pr / ?@P? J@* d ` >+ 0@ P+\ h  +Ad ` >0|@ P~+\ E`  +A`  5d =0SP PU+    +A` @T _+lPd 0)p P+ @D T  +A    P*n O _` p    +A P* 0vPu J  P* P sp $@돎 _ / pk 0 PV J P  0   +A  /bTW: 4d P?0+ @ P + _  +AP? p @4 J Y  Q* WThV5U5E I!R/0 SP ZP@JP PL :   ~ +ApW p d @ =+ 0#P P +   +A@ `VvP$J! P*P@PPb @ ̺+;"+Kj V;A+  Q* Pf :    +A   /$;   /$ ; P= J P     +A  3 3 K 3 : K   / ? P J_  !WW: 3d @?0+ SP PU +  p  +A 돎 @_ /$@k f`caW :;+U*K᝼pP?+0{Bp + d p @ P + չ  +AP  P*| +\ p@`?+ P0d @ P + 娹  +AP/)W;+)K6 +A l(` 3@  3P +( <>(0@@ P ( _V5U5E  +AP I!R/0 SgQx :-A b+ 'B  @ ^   /$ ;s P J Q*+\‰    $Q6 Dp^$p@ W+ P   ^d 0!` P#    +AY   $Q:]$^<]\\ O _ /$p `;P@ Pu J P     +A /;P@ PV J P      +A IQp 2+ Q+  @ p+0?A`0p+ d @ P + UT  +A`k{*W:d  @P;;KP[PD[ ;S*y {kV -Z   /$ ;^ PJ IQ!0R1@C+\〠` [d 0p P    +AT ` P@ kW: T1@  M1P  F12 ?0P0@P P P 奷  +A @  /$ ; PsZG YVVW: 1@  12 ?0P@@P P"P c  +A@  / ? P Jm +R :    +A  / ? PJI +R :    +A  _ o 0 PJ# +R :    +A /$ ;`SW*o`?W/0I + Fd `P P @+   +A` P*h@p`? d 0`D[ [ d6`XPPX @  W6@`U `F P  倶@[ P  +A@C P).V   +A@˞⬫*Zm:.f@PP+0; B+@Q*TTZm   +A@? d 0S[xX00  PP .``0S Pu`VZ.`aR `@Q7    +A@ @ P=: @ @8嬫QQPP   /$ ;PJ P `   +A` C/?+ 0d @ P+\ ៵  +A` /?0d P P+L yp  +Ap .P  .`  .d ?0`{ @ P}+ E  +Ap! P@ ڷ@ P_P '  +AW!*n`p5d ` ?+ 04 @ P6+\   +Ad ` ?0 @ P+ ۴p  +Ap  P* +\ @d 0 ` P 峴  +Ap  P:<H?+ d 0@@ P PK+ 匴W  +A@( +\@ 0 d 0 ` P' hpW  +A@   P :0 i i@@ )`   P  u P2JP PP 1p  +A p Q"* 럎 O _P:@ ` ⴀp$ ;OPJ Q:P* p Q LdX:{P  PJP P:    +Apl P* Id 0p ` P 姳@D  +Ap∀  T P ) )@@ @ ⴐ zHZfp P@ ` P m0U  +A`0` P V0@0PEZ  +A%ZL~p P@` Pk 30U  +A`0` PT 0@0PEZ  +AZ P::    +A>+ P0P;F P:)   +AFX:D4X:?d + 0` P P}+L ὲ  +Ad ` @?0 P PZ+L ᚲ`  +Ad ` >0 P P6+ w  +A` PP   |  P:.   +AXo`/  Pr-   +A 3P  PZ =+ =C +0;A+`k0 p~==pSi`:k0ScPA<@A@@@A@x@PA%S@@Q@@@@@@@@B@e@PA%S@@Q@@@@@@P@%RR@@@@@@K @PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@@@A@'@PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@P@RQ@@@@@@J[UJjРKPEkS[ZK[:J`0CkS[??Z?x~p P@` P~ F0U  +A`0` Pg /0@0PEZ  +AZ PM:   A?8m `Lm`?-X pJ }pP@៳` P 0U  +A`0` PP ԰0@0PEX  +AX Py:    +A=W   +A Qh  A 0+ B 0*+ Q+ ;  A+PP-JP+@K`Bk$*V:`  @P;;{P[pG{ ;S*kV'*+\‰    $ R5 Dp$p@ W+ P   d 0C` PE   +AY   $`kV:;+H Kᐲ +A+ 9;+1 Ky +A+     /$;PpJ P*IV5U5E!R/0 SjP PJP PT:   hw +ApZk4wp P@%` P1 r0U  +A`0` PP Z0@0PEZ  +AZ1 P** w6Vp   +A Q^% A;  h* C ;(+ Q+C ;  A+PJP+@K`Bk*V:`  @P;;{P[pG{ ;S*66t5V   +AQt2y:@A+ 0;0r5F0+<(+ Q+ ;  A+yPVJP+@K`Bk*VB:`  @P;;{P[pG{ ;S*']4'3V   +A Qx A 0+ B 0'+ Q+s ;  A+PJ+ BR+Y ) P+0; B+  K[!*U:`  @P;;{`kpG{ ;S*G[U!   +A P: @+ m B + PdPߍ ۍ{^/-L(%8#((/ O-M(,P p`@@0>&P7J PP PW PLP P\P P .PP E,P R P W R  R.R 0S.  P*`@Ѝ@ .R R   B Ѝ R U@O-M@P[O:"Z ` B 00 0* ` 0S*R' p` P P,:\ AP:pGW A`P :"A  FЍ<``9`Ѝ  "1/d A-PSp@`p@DTq%pVp P1pW(GA-PQ!@ Q/ ڲ Q/ ڴ Q(2?0 Q(2/ p Qq߲( S p`(%ppG`WVVJ R p`%PJ PpGW1`VVJP p`$PJ PpGW1`VVJP p`$PJ PpGW1`VVJ  X ($ ,O- MQ)*@$pPP $P,(w(pWJW(W$P,(, W0GP` `+p Ѝ1`HX  r$p U`  P V (VJ,(p , 40 0G$pPJ, `,`P$ 0,0U/ ,/   R  `,`2/$ ,?2/0"(Rֱ(, p( ( P Rp$ (,O- MQ)*@$pPP $P,(w(pWJW(W$P,(, W0GP` `ꋱp Ѝ1`HX  #p U`  P Vm(VJ,(p , <| 0'pPJ, 0,0P` , Uh6oa0,83?1 0S 0`,`3? 1 ,(2/! R5( , p( ( P Rp$ (,G-MQ pp:PpWZpA`Q&B`B'?p @)sap``P@GGEQ8 @Q@@:`PVP0P1 :@Pp `pW FQP@A`@T`@TpQ=`†= R )R'q`ppPP@T371 QЍ[ G-@` p P0QS @=QR A QJ  18pP T W=*AT W5* A!" p W*T W'* A!! p W *pP pP PP  T W *Ap  U: Q @ Q=QQ @T W*Qx %O-00S0 0xS@PUR0q*`p0uP @PU8u^Jpupఀ PPPPPఀ P  0pK0 W P"S ppp0ಀx0pp `pp 00C S003020PU @\ :   D A-PpP`p7X 0V@W`.P 0` V7@0@3&b`7@`` V0@3```@V@µ/o/*ԧ///pO-TM.L%)$Bc`$H P 0"  I J㢕  @Z :M F32 W0!P PP``1 KP$g  A$`Q 2D0p2 @ Pe1 KP"pIX 2H02 @ PI1KP@aAV 1M02 `@ P)|1KP @JP @ZWXV a`P10S02 @ P``"N1P``PP  00P ppWJppppA EP QTЍX #4 #  H-p@`ΪPPr( 1U  E PE Aq 0 .S R:0pS\WR: S\R   . A-MMx`P$`@P J$PJ>oBPЍۍXt @-Mr @ 08@PJP*Ѝ &'ЍXp@-RPPp@` PP  p@p@-RPPp@`PP  p@0H-@PP  0Hp@-Q P@i`P pP ] p@0H-P @PP :Q pP 0膭0H-PQ RRv0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @000H-P @PP  D`P @00  O-M-MP@p|@ '`4P P P P0 0 0 @@@P DQ:*T T T ++T -T'HPHP@T 0T" xQbX 0 ` Cx |0hp?a`M PXHG@HP0T @80H Q400 <0 Q ! 0B PP0 H R *Q! 00B0pp DXPU.  ``V5P U #` 00 |0x8@0X X @| R p5pc|dx p0 ``Q p` L`,` L`J0X p pPP0X Lpp pL 1 H R ,p2*0H P)0X` Z P U p0 Up U RP L YL0 Y ЀppLL,PEU RDL`HPVF PP+X -XPP0`H V:0X,(PP0^ `EH`DR0 :RP@ PQ U pqW a@ p0kX 0kX<LR\A \|\@`P` (0TNpHpRLP)0T' Y@ IH%P=HP gbP @^bPGHPPHP1PNUH0N``P0`E Vi⌠ a0PH0N UP:`JH^Hpg| @`P`@ %pb\pB4PpU @PU6 0PUW5` _Pa a0kX `V MV`(``PL``4P0`W` W4`K:o'Rp``@pUPA  a0KX p,p 0YWP w,P]8ppwaP" @k{8Y$bP(@ P,  <0˟۟m4(4L0YH @Y(@0pLP4` G @(@0pLP4`G@T bbHbbbV" gP Dn`a 0kX @P,T,P  w~j@,RO p,@p@\P   a0kX  q 4bLb bb(@>bPP !  ã XpeP|LP pfcP X,Lp p@OO086 b``S O@DO B S 00040 0000L@P3P0$0@0C X YQ cP 2cP P6b|PHHQd<`LPP|<`LP4`Q_cPP JQdDPP 5?55?AA5?DDLPQHcPH| dP` Hp  `dY0pplP  `I : XJ `O`8p v`K  KNN @ `   Q @,P G@PR<B0k2@< hX GAPp  p KXKd PG@_GT 5@`p‐n h?p5fH`g` q a0kW `oG@olG`T`(``L``0`` lGT:pppGpGp@b`Qh`!L  ` ` 5vpG@Z ` X` ЍЍ^  XzjWKW`6W`7v44pHL4pD<4LDHHL@@(@LP4`G@P:PPKbP HpbPYʛPPYe X ,@(@PLP4` G@P*RBk@ h  q vX& `/ @Q9k0GPV@Q@!:C C1,0S @R(0?G0CPr L kpgPwpk `@(@LP4`G,Q{ @Pv*7P4ꄼ V )X'P@ D XE ,P[ P @(@jPLP4`W@D 0@ O_@(@LP4`__H___,P {  a0 Q G@p(@LP4`Kpg`wp @ vY@,P% P @(@jPLP4`!@D 0@ @ꐺ @(@LP4` p p@(@LP4` , @(@LP4` p@  T@,Q GjPD@(@LP4` ,aP Hpa P`WpD@(@WP9 P ķ A-P@pW  `P P ePA-Pm`jV)fP. bP3  QQ 0`@pWp@T p @TrBTr2S QdC` `0 0PLDH H0 0G4E0 00 0>*3.-0 0 㥏 0H-P@P P Q080QQ R:00@e< <0 0(f$ $0 0xT@-@ !oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Qʒ 0P*w-r--x}  0vS-S rS  wS xS S //H-\:Y  P/P/ Q Q/@-@P ᒡAQ@ R RP//@oo//@oo/H-/RRp 0 0H-/RRp 0 0AP/P PQ/Q /H- AR*Q *QQp 0 0H-PQ0H- P @ PᣤP塤P P뙤P@0p@-MP@ AP Ÿ`ᄤ`傤PЍpQЍpP/0H-@P QQ P:PPU:0HH-`V p@PP p`VO-M[# Pp@aڡP @[X X P*K! !@PK ЍA-MMpRl@`hdP@`R P@SP POp[ U01,H-0 O-MM│`xpKlBPh@P宗PAPP AB+Q8 PPPPPRD@V U D QHЍkH| hth4hO-,MPP_ @(Pp!`Pd ` 0P p` PP p   0` pPA  P  PP PȝPq  P P0_O0PP0 ɝP P PP@ P P@呝` P` p ,Ѝ P% `0 ` P P P Y:  P% I`v0`P0 R P*P` B  `IR:BUP` P ٖ Hy[: F   ƖV` @Z@a`PY:  ᰖ`I@Z P$ " s#K-M@Q `Q6  P( pP" P  0p`p   0P ޜX  `P`P` `Ѝ ǜ`O-IMM̼`L@PS X P|p(PP  VDpp@wpPP@ `T 0<PJPH D 1/P  P`X8 @X 0  ᫘ PL 0 'HpPULH V*Tp8 @Ho/oH"  $@4< D(P080gPJP 8D1/P `4p @T,74P1 Pp0U)JoP+0< 46PJH`  ,D1/P 0@PT%* .8$ⰹH 0DS' ~ XZD L%Zp(PZ8`Z/,Ps %x0l  P, 0 @@8`P@$`@P:PP7  VLH $00< 4 PJH`, P $@P⽗ PPP8 `%@`̷ 0(Po0J(PP8K G , ᰷ P VZ008P ,P `ᇗ00 L$ `V* Zy*  ˔ p00$@ Z@+,PH- % 0묶 0$@ @P ` %`0T (P00< ,@80,$@H0S< < 40! 0P9J`H 81 0P/ ĵP 0$@80 P2  Q:`p P4 080Ap0 p$@HSWUU4PE 0Wt:O8p 0$@PpV,L0`ߖP0000 XQ Z:h0@D?P* C P $`pW?  RW4$R$p$AK^AL 2P 2 \p R$ PR@PJ@p P-*@ (`W(p@6pPP Q* H P(P}  ( up XY(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P +pPP PލI3H3 H-BMhp`@P 0p'p  0!QBߍ*32 Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S(00S00H-Q 0S AQ:Q Bmj(G-@pTWo᠂P` P0 P1*T`P YP@pTW=:(H-@QSP`p R 9PpGP`W@A-PA@T  QQ* (Ap`PJPQ`@?@-Q 0SAQ:Q @(@ۇ@ MH-M   ЍH Ѝ/@-M@ 㽹p TЍЍH-R0Sb 000S 0s 00- O-M`PR@ E @"PXЍptP+W -W p0W xP `0W`U`0@ Qa@"Q#L*@`pQZQNVeZUP@@D"Qp00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PR-@pX QЍA@QuG-M⤀pP`@Q$A AO O | 0xdA`A\Aqpqp@!QލW1+ K-rM⤀` @PpAqqO\qOXqtTq xa 0ha|pZ(hp!Qrߍ)1* @* MG-sMⴀp@P`{1A$a aOO | 0xda`a\aqpqpp`!QsߍGЍ/04* MK-M⸀`P@p!1Q$q qQOzdqO`q|\q a 0pax0<pp!QލKЍ/0h) ( O-MP@Q I@@`ЍpP0Q  UAp/W }CP%p@ wP@UT@p`*VJV:@V@3D    @]P @`@V PH-`p@Px 0P y0H-x@x@P dddXRPP P P0?P E@0$G' L hGF F& 0H-@P᫅ 0HH-`p@0h dPW  ]8 0uc H% $lG-CMr@Pp,@ PO  `0P!0D 020" 00/@P5`P A0@P+ PP1 !, 0h P',`P! ]P  03/$P QFHP  @,PCލ/? !  hP  !0P f!0` B` 0 0 Xn@"P ( R $2/`P Q ,0 0>n\% `PELE# lflد (DDCCخ C:O-MXq@T1 p0DR04PD (Q$a$qP `p !X0*P        ЍO)Ej!)@D j jiaiH-@@P P`4qpP( ` PV: ` P  pdP q0G0 PP Q `ApP OV pHdEXA@ADA A@@@O-TM@R  SpxY `P @,@Q PU PQ$$$ ( UQ P"$0L $( 0@8 0($" PM ZRp P@p@ XJ VAQ@@0! jPQ 0 40|0ZP  P QKK0S | 3/@x Q@Z@t@P 6$Q(( -xxAT@TЍ|  ??` X? ,?(? 4>>D>@>4x  d <<O-Md\ !p D@ D 420S$I"Pq QPP! ``V*AT pW W P P U \pXppHDQPP `4p`W*V P  R  2/P ҂U  @@ 0?Q 0 0ktloЍܧ 8<(<H h ;;;;;;: :X:X:p 8: :L 0H-P@ P00H@-0Sp& h@RT@ @0S\ D H-\ l60 R0\p/@-@@g@b$ O-M|BPP@ n~ P`3P LPЍ`PJT 2@T@ P X,QA@T㸑!  TI PUG` lph00 S h,q`p-p0p@P R PUR& `V#\hR 2Upp pq00c00-0@S5 R `V  RTT Ѝ8|8l88778_( 0_l76\6D66H8H- EuHFM@-$@@:u<@ !0H-P @P  P P{H@P0 O-MQ `PF   <P P:PM   O PF  +PP? @T Qh`_pPE rPp`@TpWȀpPh@@T  `S}P:~PpPhD bPh KPPPPUC@ UPЍ\\0 O-$MРP `pP @Z Q"  P R @Z 0p T !"p P xh&t2p0 S ( P $Z6 IZyP`pO 0| h !0 v Z@0Z0p00S  P  !!R;aSP ppqApZpppW RBRh @P P pplh&X (' P "ap 0MP .0"@0pZp S p  p1p$Ѝ28Z2d 00H-LP@P=<s00, 0@/0| //p@-L`P@`"8s, 0@p !/H-P@ ppP `V`  P x `X 0 P <h&800 S ( 謚 T0$/VW4 .0V.@-@L  P4h600   0R0T 0(0T.UU,.-H-P@ppP `V`  aP  wtl0h 0 V P Ph6L Lp p0W0T0(04 .-UV -H-TT -A-`P@èP PpWp  P  0pGh 0  P Lh6H Hp p0W0T0(0 -,TT 0,SS,0H-`P@P!PrD0@ 0@T 0H=0 \++p@-0Ml`P@`XrL0 PU 0Ѝp0Ѝp舖 +0H-0M0@ PP P0Ѝ0p@-@P  $``P P|UP l P T <44  0p@ \+,*QR< d)p@-@0r2  R 0&``P sPUP  =P | Sdj\X 0 S@DP^p t) L*)PQ, L( Q  rP H-PP@ =ppP (`xV` h P P 80, 0 Hx )'`OUP 'O-M@PU8V pP }0 07 @7P `0P? 0t @7`P 0P0 R/JY( QN@v P-@, $PN/8P(ppph0@@@0S0`Vb`` `V0pP@`j}P8Pߍ'W\,07`$l& PR Sh@p@@7`8P  0Aop,l&2 0Q S h&,?o 2B(P p 0 0` @7P 7 0 @7P 0`0PTPTP@`  \ p@-0M@$ P a` F 0 $ 0 RJ 0 eJc0*e DJC*D0Ѝp0H-X \ @LA@RP pR0H-P@PpxP X8" Q `A B0U0pPUO d #i"܍ O-pXB`Q ЀA`FPR PphoXPQ @APE`\ `pXP\`U`pX@P\_`Q`+PQ@APE`\ `RPR pX@\OR `\P @QРA@DZB!% \ !$ R 0H-Pd@TXPLo@P  0vP@ @0ԋ x ٛT  O-dMHR@P@`!P7 T@:Q@/P# 3xE?PQ E `noB @4.kP PP/Q.QQ/Q@㳭P,{,@ap"& @U+Ppʡ{gHcPJ X u`t8` hhpD-(3$,,P`2&p" Ps`X*`)``d%@```+P`T!Q``0p'`840`pĆ`0B`p0t#p` `p!Ar `0`(0p0t`$ p$!@ !0r 84p0pDAV 1P\4`J8`\QJ}QUJ1UTJT@0S|JSzL@0@<@Hp4#@0;#00,@Wl@KOoB  ,H HH2 0@H f4PPc [k:_L R RQ@ R RMQ PTi( P\ 0$ Pq\@ P0 0T= @P[0t@ pP8`PtP40?`P8pPtPA4P0PPhd `V8htP p4X'<T0p@U@ @Eqp`Z` `XpPPPT0P`8`\ Dpp WpN0@R 0\,@`8`\ 0Pp`rX40410 RR @  @ T \8` @ T T*0@0P00hv300Q1 : P0p apW ET0 T h60PX0` P BP< `0 0RG \ [ p p(Pp@$ Ϡp(Pp@$ XD pW(xt p$X'̂Tp @Pw($  Z >L@V\  R P 6L@08`  `R02R T 0SS0R@p00 R W 0SS0y dЍ``HV Q PA Q[  P   pQ8hX`L PPT hZ)PpW` "\ @ `vP `W`u1Xh pL\`TTXTTP`q  pYX`.I 0p0pW0@P` Q@XX(p8`X І `0Pu0p@@ @0pP000`V$ }Y"`1XP@p2T@D0CU 20P'O0'PJYX0PTp`XW h  pW `0"0 B[ `V6 ?@ !0S9 `0O?.P @pl pFT PXh\hLPpZ$ ! [ [\h& RX RpL P vT9l`0OPPF P !A. >l0& /@X0pp Th\@hLPPE@DU#! [[\h& R RpL TuPlX0P`V#Q `Vh-0@P l" R \& P2@S _["R [GO-|M@PQ <Q ` RZ >R `0 A R+A"Q#:Q`@PpV x?P  V}qT PDh  "Jq@ | @P@@D0hx+S2Xxp0HQ <QR4 p:Hx张`ἠh@  qPpPZ @  p P 0 A R+A"Q#:Q8 @8pZ  Q|Ѝ040Q ,Q;QFxAtT RP( ;P,P`@ P ,QLP PH0xp4 tgl@> ?Opd@ET.Ao|% /,,QJ@@QD pN W(j@PD#pP )@L!(<2@a!Ra  @P3@/+0+QZa\  `,pp L(p,p(0P ),@"L(|"r@b1S,pb ' @Q3# 80! @ P $$  RDRB p7W 00++pWJ@p0SD0 . pPp,, p$ pq0?+p+0SJ@0P80D . p p80,p$ (R<a p QjJ(@80PfcPl&0pr@T 0St ,g, 40PxH@/haxPD&0pl&,@ p0QhaDP ˆ  @TD @ K@@/ l&H@40@,H@40 kt    ` 054( Q4H ` A0%(p @0Pð64$4P3`2@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s )u&uT@^ l @- MR JRQ@@00 C Rj n! 0 B Rj00@C T:Ra@R 00 C RY ! 0 B RV00@C T:RM @ .RS00 C R? ! 0 BR@00@C T:R7 @ P.R=00 C R) ! 0 BR+00@C T:0 B@ R* 00 C R n! 0 B R00@C T:r  /R@1tttT ,@  K-P8 )|5@rL7#(lb@cqW w c2p@S30S Sr10@x\U@QEjd0UnJ @Vr`: :BSp?01D@COR@_gf0@pPcVp@CI?4I2ISCA?1CB@X@BY(1Pi02@ 1P0I`V0S@@\@-Ԁ`LPV:P[P;2Pp@JcpW*d d`V;0K0 p@ `rqP`V0# > q?Op@;P7&0^0QQQQ(\(O-MR`Xx0" Q A B@pT pQ0 T  P< 0 0@<倁@ 0o`.LHn౪lW@RG8?hgBh/ B  -) ,* -CR BབkCBx/ (( BSw?*f 0op)` O0Pza`o."b@(97dd 0U%.0`QU[/!@ `@ *),8"L\?H\_UO!Q8 5@!.+N 0#q"!? 0U(<2@0:.+NQ( %@!".  pCP  @  3(@PMSK@P@ᠯmP2 ʏpYPyd 0SU'.0@QKU@Pyc p0 y O3o@.0-o@P[p{}P{c p0 { oo`.0ovl[ & &J/0 !!0@ [!iIIQ p@A!AP{d 0T(.0@ATrTЍp{d 0'OT@D.0T pI>@HII%Q 咓cAs AB@  @C0p 0R00p Z *) 8L\?H#" # N Q @ ao"!/\O P( @  : NQ @  "2p C>! Q  @ 3l0 0W ` ` @ 1pG@W$`  @Ѝ% O-M`, $  ( P $00@S  YJ88H32 z?8 8HP206jCQJH2p z+88HP20p"jWJ J"* *BP@!jTJ JQU%U%MP P@ lspzqTЍE@P@[] CP ) 1B n@7( ㏂L@0@!Kj[ Pp%pe!Re" Rpp3VE>dPP"d0 ␨aoQ  /o" q[ K \>zlJ PjP<Y'*/! [ JZjPP( ) %@L (( @h!R  h"@R 3EP;I; Pfj(phA``/00b  P P圀Y@,$ 07/P |PxPt PpPl PhP 4 q 0!" (  P !0" $ Y @Y\P@іP8 q0@SQ/0 OS)CP&ʘ0@ p"/" RJ08@,$ 0(p407/P XQ \P LPHPD P{ PJ P0 8<,$ (p7/P 0  Ѝ,PV ,PQ\(P,TH@,D lR,Qh&ppGIW Q  0$ P8<,8h05/P |Px Pt PpPl PhP P8< p:@P< P{8Pw dJa*d J0 40JA*J0 iP$O-tM@PUp3 `c ! 0 =v .l V P 0 0 ` PP !`[ 1H @lP:Z oToP  aO*a  A*A @pP tЍ [,r4 mH-P   0 RS~rA @-@8P P 0/ዡD 0H-LPS@T0  0L 3/P o H-ph`@qP PT@ o - P` K-R @pPT&9/P pGPP`Vpp@-P@`T |  B0S0S A#q*P @@  @@DP@ptp,p@-`@PT |  B0S0S A#qP @@  @@DP@ptO-MPtll\qpW9 PL@  `U P P#Q P  1/1/Y Pp `PW:#W*`@@pW@xxp A G`PT PU@Ѝ@LH<  4(0H-@'x  B0S0S A#qcP <P8  P4P 0TPO-sMАpq $P@`Q$A AO VO | 0p`FdA`A\Aqpqaxap@mT!QsߍN H-M0 0 Ѝ MH- M 0 0   ЍHЍ/T H-MЍH-|pPpX@|``P`u`pPu` V XXP,``H P  `0Q`0pp0Qp \ X0X /X MH-M   X@ЍH Ѝ/H MH-M00 0 Xg ЍHЍ/ O-M`p!!WV@P  YR `P pU$.Q >mT @= *P[p I?jpC``#W  fpGk*P P  fAD`p?`IjpЍMH-M  0 ЍHЍ/MH-M 0 00 ЍHЍ/H-M `)pP- PuP) @!そPJPlppd  \00PPLpp@ p$0(,   0bpЍ  0H-@d_P_U0p@-@`Ph RUP TP/fp@-R@&Pp@-P0@QQ ]P `l p @Q]Qp 00 B Pu`Q  V\Qppp@-P@`^( 0@f_pп O-MMh`pP00Q7@P ]P l  h` P<P8 ~@B⠖$ Od`\AeB?6p60,0D Dgk& ሶfxfƍPJg\PTh@@ lBcBd8$4,gL(@0ppd00@ ḀpppD PP@T%TU `& JQP:P` h;[Ppp g0T T @`@@\pPw@ P *Pp0P@0G P:$Wtw @ZP^p p p p p p p |p lp p p p p p p p p p p p p p p p p p ,H\dp p p p p p p p p <p pp p p p p p p p p p p H\d 8p @p \p  dtp p ( p l p*W 0G` QP`p`0G Q:xdPPrpl p 0pdPf P `^0PpQ QPIL0FP @0@ Q!P0@ Q:$P.Q pl p pS 0Q4 ++! @@@  Q d L0d  d @t@dP0 A R1P0 A R:0 $QR pl `O p 0R `R dpdp pdp`pgT   p  P d pP d dde  @  P dPd  d IP dd尠d/X0aW Px0pQ0 d PVPCVG`PUPCP d  0`PVB @DȐP HPDB I4Pe B?Pp B`P AP A@ A0 A  A B A d     ~ @r  P[ d[ P  t / p Q5 d5P1 DP fP d ?  ]  Y Q do`PP dP dPP do`    4  0 P dW @Xu` pPBH{P4 dQ  o 0 Py P`U@4@PAqDP uPDo 0Đ`P-ydd DNP`W/ H \GP4 $py VD``WHPX`p$p@+ +Y-Ii PS gcPfFQA110@000 B0P0FBpP@ a0P8 Կ AoY LpP W@4 Y2@Pt Yr`X`P IRpXP P`PXc Y`0EQ0V A , @pX`DH@r  P d@l  P d@f  P dQ dQQ dQP dQP dX`X P` LpDpHIP d P 00BB/po 07 Ro TPPv` ڀU`B/Pp A` @P @@ @0 @ @ @` ApP00B/pQ:pP@dpdX`BHoxP` v唟P P dPFP dP >P dHꤟ P dP dP dP `4P `)PP dP q` -Pu`B?P  @ ` @0 @@ @P @` @p A A0?PpM PH B?P @ @0 @@ @P @` @p A` A0 p) )Pa daP` d`Pa dPP  hYTPD7 V J WP @ZbdHd@X`p0PLP FPQ*P4P .9PP P& p-`P`%P `P P R  pP p 00| <`P 0PP pLQ R R( R %2^ !2 @!S(  08R 8S p0L8 @p" `8R 80Q |L 8 `8H @eZ_dP`Pd0@X`p W RQ\ T<JP`@D`TPETC Tp?P00 +:TPQ- hTP'  E UP/ P :gQ hTP0 0TPng0P    Q  :P hTPg0gP     0 Q :PU hTP`g0V o`OVoT`H TP` /:TPQ5 hhTP6g0- E UPP`0:gQ hITP0 TPgV g GR9RpP` A:TPQ hTPppg0 ! 6 E UPP`0:gQ hTP0 p H Q&:\P0) hS TP  @ P`V<:0\0H  S 0T:g^Q h\0,fPJD4H @`@ V `VXDQj:P. hSPppsg0&H00 %( H00\ 00S %B/ 0:g^PK h}S0P00D npg  PP: `0 S0):\Q0- h[S0P00' M`p a^!q @WS0R 0 qTp8\004SH A    :g^Q h!S P  P 4FP<P#0fPF V`  R  :g^Q hR0P   i<R0000:hg^Q R0P00 00P,S:P hRTPPppg0'a0 TP0 0 `E! E0 k%L X  p` 0 R e: 0P` p^! p F\000j X0`0S Y  0V0 T  gX 0S X ppg IR8Rj`P` -:TPQN h[RPpp*g0F E UPP`0:gQ hARP0 i`%TP"00gP  ( S :Q hR P pgHL` P XQPQӦ h``P PEXpU`PpGLWXp`Pӏ LP@R L:Q h`QPg 0g L@` `FV`VR p`:Q hQPg 0` g Lp@PHgP` R` +:Q+ hQ P Ug0E U PR`0 :gQ hkQ0P  6 b g ]@pTPZHHLP\0 ,0( Q %B/0  :P h2QPpp %pgP 0 0 g0s*0P  D4HpP@UPUpQP:Pp3 hQPpp(g0+Pp(p%cs0<0 E U PR`0 :gQ hP0P   pg JR2R\P` ):TPQgp&` E UPP`0:gQ hPP0 \. . TP: T8ڼT$#P ,:<@gQ4 hyP0Ppp, k@E Uڸ"P P :gQ h_PP0 O<@gQ hLP0Ppp>p0R` :P h7PPpp+gpgꄁ\"ph`\Ph`DPU'(DPh`P PPh`DP  DPh`U  PDPh`:` 䀟U c@PpP ZP ߍۍ h`@T`@$8DP\oO   % d& ؏ $ # ( X( T  D H-`@PpR 0@,SO-,MPPp(( @00 @pWP  %Pp R *` A 0`B0 @ R :$Pnp `BZVU AL L L L L L L L lL L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L hL L `0L 8 L L L @*P2 0 @ p R0 @ R:}`0A P2@!`0A P:$Q?V*:vi @@@ca [ YWU`0A P:!p`0A P:$QJV1:O$Q@V :  p00p (Vp^7*^ :  `00p (^ $QV :(  00po (Vp(^*^ :( `00pV (^ p(^*^ : @`00p8 ( ^*^ : @`00p$ ( !^     c^*^ : @`i00p (^*^ : @`V00p ( L : K \  ^*^ : @`700p (   , = ^b*^ : @`00p ( ^O*^ : @`00p ( ^<*^ : @`00p ( ^)*^ : @`00py ( ^*^ : @`00pd (^*^ : @`00pQ (  e ~  @ ^*^:^*^ : @`00p( ( ^*^ : @`y00p ( o^*^ : @`f00p ( \P^*^ : @`O00p ( E^*^*$^~*^ : @`400p ( *^k* ^: @` 00p (^A^R*^ : @`00p ( !^(^9*^*^1*^ : @`00p ( [^* ^*^*^: @`^*^*[*(@PTTX :PI ``X:  00P0( !R0!hhhh0 P0pp00 0 P (@P(@,Ѝ@H-R R RT 0p Sppa r A`PqQPBVS0U0 P0a0p , ,L"!1@00a$gF fFF PU:PR0^Ba/a`E0p`pf pSW Ua0`V0iKK-MP`pV`U 0W@[@[Q Ѝ p!W@[@[P [@ [@Ѝ g*g @*@F+U`ЍG--@ VP bP(0,&/O0dL &  */O ( Q!UPUppGP `UGT P GI`GWP  !G@Q@W"Ppu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P:  UJ`}J7%O-M-HM<Px `@0pP P> P@ P0p0Qq   JG R    @ P qWp0    HЍЍOf0p00W0H @D40&P *ʠ* Q0  L D @0OSA$  8AC@ 0+QA 0p1+A; q+ `+b p r a @  0C  AR00 `0BBD (q`a`pS$@Jp`Fc U@PU  BU@PR80, ` p 4X8\<`P<Q<`P<`CP/ 4, [o Q Ѡ 8V \   !,H "\ = l0 "Q h( "2-  pQ0   `t   Q T-0  pS  +a Q:a  ZVQ@L ` @ Q +`q1 R %B1 B +PP$ ;P+  ;r p0a :Z0(p$`yPD?aCoc?`(?+ pa @ (p@$` ; p@  b0  Q + ` ; p@ *0 P+;qc $.+QA;KraK#JP$ `@ Ka0 pa Za@a Z (p$`H ora ZPUPE0P 8@(p$`@P%J\#ʜ (p$` <pQ* A + ++`b+x@+;pc+NAB000@@+\ RJ " BQ D3$6PaQP/P @ P@QJ ``1P8@ P 0TRT B@DPES Q" WP 0P p0 0p, R[ [ r``P02pP P  Q$ P 0p,Q!4QX QI o  pQ ` `  `P:@0P @ <P8T; ZZ 3P0P @QPx PPN [ o PF  P**0P/(p$`Pp9Q^018E80a8U0PWPpR0P PP' T`) P[ HЍЍ,P,P0P@PJ |` (pP$`8pPP`@0p0EP0PV 0  W0P `FP  K0P 8@8P   ; PYP p! QP 0@PO` 0@CP~ p4PQ @P<@ 0@P`0,[ @o <4PJ,P P PP,PeQ `[XE4   P3 @  0@Z Y'   Pz Y  0@` @ HPpP 48 Q0@ (pQ$`A 0P 0 P18 04~(p$` PUPE0P z(p$`@3GQ? [=P 0 }P2/ 9Y 1*9Y(p9$`E'% 8 0@u9QS1 8 @P ?<P1EQ 9Y 1E p@E,@w v v v u v t r RR:S S/*/*/0H-@PP:P PQWPP@0H-P`@Rp:ppP@P p@Q   R@U0 12 rO- MP QepB`  @ S T@-P 0@` `0V00R@P @ `PA ` P @PQ@JP@PP J0 `P` 0`PU0P0W Q @ PQ@J P ЍH-A-RM(P@ND@, ` (  L 0 P ` B` FFቇ#H-PH-p@-@PQ P PQPz`P  Npp@-@QPi`P  NpH-MÅЍP H-M D" -b@/  ɅЍH//b H-M  0 =pЍMH-M 0 00UЍHЍ/0H-@ 00: P:P P P! }N; @0000 0S P/!C/H-P@Qb  @P `Q P QpAGMGV f1 O-M-MP`d0@pP  t p l h`Y NR:*^ ^ ^ !+^ -^@@x^ 0^ xRQd xl00Ph@xh@xI@x0^ 0 H 0 C R`\@TP X ! 0B 0x000 C R *X! 0PBP  @XSD R p`@@T `R0  x 00S S B0 x 0X pP@LpK0S p0pxpp0p0S p1 CL R@P2*0 C R*0S @ \` p1 V P 1V VpW` ` p `pVPV Ёx0P@Lp pPppEQPPP x0`+Sf -Sg`bhPr X0h\ 0 P 0P0a0^ hx0Zh@ P@@X T P a@ p0kP 0kPLG`P05Q ph pQ[ [[V`  50DV h0 p AX6PP px00C Q0Se0x0 0R C_pxPPPH0^`? T: IC%P7llx P x@xx PpxTx\@BPd p  04PEpG 1BpQxh@0pB@@`0D Q`x`0 0C0pB Q@:`F0P{ p&@ h p%`[h`!K a `pp  p0d 0P T`\@Bh@0S)   a p#W /#C HSDt0Ctp P t`1VW0A@p/ps0c    p#W /#C HS`|0Ctp P t`1VW0A@pKt`0# tVPpAY 0RN   a `0OR F~h@Q@~QpgPcx P Xpd0x (Px xXT\@KxT\@t`0# tVPpA 0R   a  |< Pl | `@ | pAW@ |@ | XpB`00VpT`\@l0|Q"XdWO HP> lPC@@`V pBW>l PlG D IpD h 08@@m {k Y. DP ``,($@˰ ۶7l R0 @%Q"[l xTR Tl ЍЍ`W Lt r hp n $@ P  ! Jl P lP Pl |倀@|H  P s P qQ ' Pa tlT  l  P`l W. pg P`l  Q `A@`TOW, `pPpF0 W* I4PI R `A@`pT*8@Pp@@ l|p|@@Il[ h[ l Pl@ |p@|@@@<0 <PM4 | `P/0P, J+h  hb#J`#` y`ZT1D wPlg`@ @plHp|@P @@@PlT`d@P\@@@ T`\@dW U!WdU!4PW8@ R - P h P=U W2 0l rqR#*`v O-MD@ x`D 0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R 0Q 0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0 `pDJ\p0@Q0# @D`BV:@pG0@ `Rd P@pI^p ЍS R \ @Pc POZM` Q QLP  P U0b`p\ uRP U V`  U  ``F`PP3@@ Pm D` 0f `Tc `P`]Pe P( P(Z&^Z I J"b@|`:pE n@P r  B7P"Z8Pr`bV: Q@ U`:Wp ECX h  @2 ?@ `  @ R <I"@+@Y!@IU6pDV` `T 4` ^PE;Z `@@ V P! P P @ P> PB PUAU9E P49aQ `pY "@@U!@ 0"@PP!@  eP X!@@@ Q @Q >I"P@;  P /K-`p@ R 9C P0Q @P*  YppA PI`V0 A P PUpGpHY pY @D` 0 @P @Tp`0H--M@PF  B ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A0PP@Q@@ P :Q```F `F`PU PPR*  T:  @ Q`Ap bpW CU P(PࠁNA0S " R10\  R/ R /@9+-A357A4013Aa 00A /|UA-`V 0K@R!0 R1*@Q c@`@6`V: `0S00CC X* 0# 0Q0!p1S`0F`C&11T&11210Q1:(`Q1!ppW a DX 0R: SA@-MQ @ R @P:@ {@ЍH- a@`P TQU  tPU P xtPtPEQLUPP $ / $. DTLT l <- - 0H-P @!P:0H蹵dPPQ ThL0!S A0,0H[ ! A0- , R, R@-  #"!rQo"(r^2"$^@\""0"!0S    O-M?Y a_ pA pp\0[ `QY `H8P `! @!P : <6!P: 6`3Q% 0!S  PPQ `0!S  `h! Ѝ$`! L+ d* P0* P+ * P* TPP31P"0"11P 31P 31PA/A /0H-@PPP@0O-M` @R@` [P4 P[ PA@?Z   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` L P@P &Pq r&apW!RPP qpW EP` pqpP 똡 猁PP$ fPG pT !P:)Q 1 0RA   A@[ p`WP pW3P pPP HPQP LPЍsdWl( ' 0WUW ' ' ' & LL% K-` rW WPl  V:RUP>0`! fP@VPPS5Q:UP)p`V AA Q*pV` `F`FP`pPp0p2V1 :0!q1P fPU @^pS:YL! !P: ulPPQ \"T0!S  4$! $ # I# I 0P/00 R @A P/3/G-P pR 0!p`VpA BQPJ   pp3WAPAP0 /0A P`p`pPpVpp PpW: p P*`@``PVP@0@P T0:@ @R p@- P`03P@P3H1T"D1"1T 3B1T 3A1TJ  R @b@P SP b 0A5 S>0 R N+b S 1@2@@pK-- |P kQ Q*Q&V  KL&a@R% 0_G"!0Zv@T0Oo&8RspWB#4WB\@#2p@#1#pW. @`T+r0S`?o"hBvpW2&dWP2U0&bp0&apW" 0 `T @` `@  0 @ 0d302$`R` `Q 3$A5d# 0 @`` Q20DpQ031Q""11Q2 31Q 31QJ ```C R/  R/H-MPUC@: eP3 ` @]tP,JpQ Q( up   P wLP @`  \XPP  L00@ 0$( ,@ЍjCgCO    au0H-@"6P@PP60Q A  /@- aR rR wR:<?0,0 e@BT APx%0R +R$0+0 Bp@-@P3 5 P0 QQ 3P Q 1/pPӼ  0P @ P 00`aa6`O` pB p@-@0Q QA 0H-@PLP HB @H0P @ P 0<PPP80  v3P%P.4 PP~E!$P  5/PP0 @ P0    Q/83H-M1?A 0BЍ0\ \ \6@@ ,Ѝ6@@ bЍ6@@ Ѝ  //O-OMPAYPwp٭PP @[Q    sP APAPA[ 0  p x|Z : `,DpP (8 4 E ;[  sP P  `X P Q P4P PQ Q$Q4@>P3 P!0! P$6lP 0 @, !P2#(0<  R5PX Q [0$4$tP P"Ÿr b 2p `0P @XA/QX q123P7` 5 602 p37 $1$(1(,1,010414818<1<@1@ D03?D0 @Q0@-@R * 0 0@>??,H-Q p?@-@S ?,  0@@-@ ?,  S 0@?G-M@So`pi $PJW $( $ ($PQV !R WW(0Q(( $QU 0"P;  !Q(PU((U$QJ(q 0PU(00S0P  (0S Q$ $D?,Ѝ(qPpP P 0PlQ !R U0 :pW$Ѝ pWP G C (QЍ0H-Q ?0@P P4P  P 00ZP@0A0O-M@(0P!(P5R%p5Xaꇑ P.  pؑ ` ~" -8 pa㳪P (! ! PD  , U , 0 ЍOdЍ@- 1@3/, (P0G-M4P Ha5 !0@ 02/%'()*+#,"-!. /'0&1%2$3+4*5)6(7/8.9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=@ J<` KC0P ``  LB 0P` 0 `P  MA` `0 0PP   N@`0`0 PP$ E O!0"`#&P`Fppp DPE@G``G`@Pp0`@Q0`A/ ⫾p APP`P@U 8Q 0,` hP ލ=O=,ލUO-MP@ ! `2/,V( o0Q 0H Py  @ᰀX]:@ `YTZ :FW P*Z 0 piPy@iP1   0P @ `㲀VoY ) Q] QA0 iP ;@ @P e R  Ѝ bP  d P  bP (@Y TP ( B  ($ @$V,O-Mp`@S [2`p PW , P ` F P, ;O@T p }l@Ѝ 2$( "r);;P;  )P ` )P pPH ` B4 b* ~    `    ( M 0H-@Q PB*P 0T;0A-M@`pQ P+*PW ?;PЍ fP ` P r 0aP!@ P *P )O- Qi +01A3?450@  Q Qp^ 00s^PO@1 `@@@``pp P@ @@@pp `PpP`pP00P@ 0 P@ @0  P P 0 0 PP00PP0 @0Pp^^ 00s^VPO5_@%@@@`Pp`Pp ` @ P p @ P ` pO-M  QX   Q Qp[ 00s[`8_PPp@@p `P Pp@@p `p@p`@`00`@ 0 `P@ @0  ` ` 0 0 ``00``0P @0`Ѝp\2 00s\'@@@@P`pPP`pP @ p @ ` P@ ` p P@013Q7a Ѝp@-P@Q `?(`'`p" =(p P z P sP lafdi`P`pp@-MP@Q `(`T 9Ѝp & $   q'P b@!@ @ b b20 + @'@''P Ѝp  ЍpR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/@-Rq0 @2Erspq ipp @R*R/0Q:/H-Q  0 th\PD8,"0"0"0"0"0"0"0"^ O-MPR pW0 Pp-0!13@`0 p0 o2W$`@ T0( pP P TDtpo `0W ! q  p =~ 000T `pWp@W@ pp0bPf  `q6"01qA S 00`1 ZO `p0` t P P@P 0pb`P5` `  0S0`[đ ` o02FaP pp[ p Ѝ0H-  0 A1à\1#!K-M`qWWЍ@P ᔥppW R T T  0aP U P 0sЍЍ 00 !     /p@-`g@p PV Uip p7`g7`pA-CMHaP@`, iQ *!P1 P00, P:6?- $ g,/Pp ,hp  gp T  ip  fg 6@ _gg6@P,PCލ& zd7sO-DMpp` @@Q P%P XXwP 0S@PP%6@ QDЍX(P 6 p ,0 0P(p4( 0S p $80 P8 ` 0<  PX  $P 1 0p7 0cPE $P0  0A P0Q &:PP  p P  PJ   $u䱄崲 P\   $ $ P` X0P  $TP        A Q *0  0 GԱP 7R@ 0R B f00  @ 0q P RN( PQP"!P P PR  @pQ!  Z$ X     P`oe, x  O- M@`PQ p-$p dUe Uf jP PP @p0 P   R P  Qr 0A A0/oᢲ  P 0 ]pu P@   #[dPb P PPO4(4 Ѝ .#P P@P #  P `QE #  #PP 1 `@% P  m#Y     ]#Po"P#P, F#[Z qWD  2! "P| / @`W qQ  (#qW!P0ZP0 pJu !1 P P # "PH `W pGPP "  q"P6 `QV{ . P( `QZF  "qW;  2! J"P `WP  "qWP@ X01P  u P" $"P `X !/P @PP "  "`PO-M(p `Q R Qn Pp  p   p  G p#? P BUP0P1Q@ @ & 0_ 0C0sPU*Ps 0{P  B@0@TOJccRa@HVMJA\ ?P BUP0PAQ(E Q R QAʁЍ ( CWR [ K   `PY O@@p P   `Pe [I p PQ @U!P2 APN  !W㰱 ` 갱 `   0 P((5   0ᰱ `P Ѝ(('Q !P    KP  !(( ( (  s! O-M,pA T  2! P TP`@  p7 @P P% {Pv !P p  pX 0 0CR 0 1P0  6 !I?A@  '   Br0S*0r/{ @ 0 A@ @TOJbcRa@HVMJE\  ?PAUP0PB AD P p pP pPpЍp@-@PQ 8 P    Q `) P    pppH-M 0PЍO-MM`RPQP pSJGO@ PJ P1? F @Y:@/ P w14P Ѝۍ @XP>IY*;F  @nYFG    U -ap JT$ GcpD41P P p尀? "P P0PpP(cP! P 1 /P HXc/P   P 0{y0@oᠲs @!D 8 @-R@QPTP*qH-XMppT'PP@ ` Am  a@ *` @*@@2 < U TPXЍ ^ ^ p@-MtA@DP PP" UG @TGЍpsDP! P;ƱP5D\P#-P 0 p  Pibp^bP˱U2 P ^ @LD] O-M-xMXBp Q@t P `P` A  a *` @*@ )@  Ufbj`P P` ϊ0 a@ *` @*@ ` *a @*@n L VH Iϊ` F[ PG[ p`   `)?@U:%pP`` @  uW`pdPp@`:X @` f d)  @ .  * D@@tPxЍ Ѝ4 h\ T\ [ Z  O-M-XMԠ@ Td=-P@` p  ϊ, `@ *a A*AP U:P V -T PXЍ ЍG Y Y @- @  T @4`Y LY O-M@Q l8` PP  A0 ap@ *` J` @*@jaJ@j@  L  0 p) P&`8 p: Z 8  4 8P h t  ` *`*@ Dj $PЍOEx  p@-@P9 ` Vp p@路lW XW @- MA@ [ p/ P, 0 0[ ||x   0 Rq Ѝ Ѝ TLD@-@@` $ @U WU SU H-@ P ` p$ #n+H``O-dM(2e0bGpF,te kF @H Pp0 $@X@ @0,THL n$ #CP\PP`` 0 pPp "`X %Ha `h!TDfP"4e< 8`zXe' P %a8 #i @aX `\e<P@,i#d(nʌ dH,k a("i `a ``i *d,Tn "|fl'f8#afx.gp@-M0`(04@0`,@ 08PpЍp A O- M`pn Dk @W@  0@`] PVP4p0`U P Q Y8`

: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*Ap@-(M $ @T) 0S- P P` EPA FP@@@P`APV@A00S A000SA $ Q(Ѝp@ RRA$ Q(Ѝpd& ]00% O-M`PpR E"P fX Ѝ@DP+T -T @0T xP `0T`U`0@ Qa@"Q#m*`@P?U  p 0P됶kU[ @pI" !@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" Sʐ @T "/P  P" S! @T "Q/@X QppЍA@QNH-MP`@pVUrPPP Q:RqP PpЍPTP/d! //,! / /  // // //L // / /  / /  /@/l @//4 / /  //$ // / @/ /H-M 0ЍH-@P`p%4# W5#P0 0H-MP @/"%P?#/R?//" !PЍ0  0S RP/O0?c0 3??oP/O-M(@Q [ Z" oo A R;:TZ+ T Z4 X? JJT :o9zwK!T[n ;o 9 8dT   ^ 0b*RooA! ^ p0)T   ?8ooAP*`!18.9~^ 0n#9~8.3@n pN!879'p@p /`P P ` _ Ro p?^@ა(Q Ѝ)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO @- 0@ Q) / 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO @///Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0CS 0Q@-Q0@S Q^ Q0C@S@R SU/Q\/ R#%U#/!0Q0 /0H-Q@0S PUQ P0CPU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-Q@@S T 0C`PUQ P@DPUU PS T`PUPPpPQPp  ///H-P Qs R US  R/ / R S Q00Q/ S#%U#/!R  Q 0///-R/p@-M`@P P`h @X @H @8 @( @ @ @|xQ2Q2K2M2PЍpl P / \ H-b@-D@@4@@p  s@>|>////// //G-(M`PaP`9@1>>/Z/[/O-Mi@q`d P`PUPO %P T4 ppxZPtttttttt(tlt0ttttttttttttttttttttttttttttttttttttt$ttt8t@tLt`ttt *X; 0H Q 0H Q:pPpQp 0A0@ Q: { yyvi s q o,mk+i@ glQP  _,]ZX  0 * pn  c l p|  q ` 0z p  v  0c 0 ` pp x 0`pj  ] `h4  ( 0` P 0@uppVJ P @P @p0Q-C  0o =f @z` ) @z`  @ z0` 0 q+ pQF P P& PK0  *"&"@&bRp 0  1ᆮ!@aR p 0Q0p Z p:p  0! J0  Gc z `:p 0gL`0V Pr p s `00``Y4 \ V ` T`F 4VZ 00` T`4 T4 Z T0`0504 \Y0 T0C`4S00CS0 T0C`4SP T0404P 0` Y T@ 4P @ 0000 0 0 TKH``TPЍR -Ndq-n8 A-dP@X P`ppGX`WڼP 5/@ K-@Q" QK QH 0 Q0B pW pBqW s`V`PUpW`W+ qW' `V$P P pP`V QPP R R R RQ O-MM  pP' @t P@IY  0nQJ`PUxouo XP  MP $QЍۍ ( O-MMPa@ PU`p Q RЍۍz ' 2 ' 2, qpqpQ&`0HX& 07nPJ`PUoo   0 `qP`` `` O-MMԏ@`Pxt  PP Pʬd`a @ Xp0$ 0' Uh\d尰[m PbpPX` R 0RSR R!RKQ F!RA {P; p* J.-P0JP P  Q#Q Q QQ  QX MP  P Zd܏Ph%dᴏh P!?` QP0QaRpW p g @ d`p  PDQ `U  dVXT `J @uf【 D  a @ DJ XKQ U  Aw`FU  oJd `T @ XἏh\QP\P,dJ(<$ l_P H L Qp @ Q Q 0lS!S 0"vD!<8p4qpl@x`W )Pt  07/PU qPE_PPd` l  40PX4 0L\ @DPS@ pP p8PsxP<`\tPPPPq `\ 0 P P``p u0 / f\ 0pP* PHPa8P T`J(V0`J ЀTt$4J  00`XT\P头PPdPpЀX 0TP pd 0d. |#DQ@ (A)/"|S*P Pu&Jh0 7*P Ph`P\p% aL  _PX01 JP 0 !\h ,09P`aL  P_PHX0 aL x ^PX0 X0hY %%Le! /+p `  )4PJ`  X0 P0j 對+@P  Pp` t0 ``- pf\`'LFP``8 t0  - .`  XЋ \L($!  X0L BP`` t0 XX, ો`Y \ hYJ d\PP  P0H@ \$}P{p` Lt0 \\+ ulp\h l " XP\ 0 0Y A$ \LhPU PhZP4  `  XP 00Z Y  P$ `P \`L  L r\L  X0  L\\P  @ 4PV@P8Pこx XHtP$` P PD T<p fp  $6`pX6PPaP6J/ | |J*PJPP PPP  P( <孾P H PJ=  ~)P|u7D  :( WpPJTpzjJ^ 5 X-d  'PP@` p`hPq 'PfPAhqj Y``   `X0hPq R :q 'PPAV hI q  RJ,#'PڴAXh1 `a  0 XP 0r0hY "$Pp` r0 $ Љ(UP< $`\`p`!! QX0 =`a  p X0 R "` "\ R  N qW )P6t xl0p00 07/PU qPEP P4 $`SP t$qPop` @r0 # i`p RP缂hfdaU$RPPp` !r0 ``" +@Ph d 9P7p` r0 ! 1(p$`$$! 0D ;a`QP X ($@`Y$`刁hQP< H  H R\ \$@PLP <+P&p( <@U @=P P`` qX0T  ˈ`< @v &Qߍۍ Q0QPOl , PRQ /TSl  KU PRiR Tp \ \\ZZ ]Y T 6\[Q[\Q \@ J_t ^ [ h T Z ^Y| P) @P P p堁 p`V *PXЍЍ4@BЍh?_Ѝt0(p  t pd084$( " R!!|l! 7 T!t6 d̜ ( < \XH Dp,$0Hx`D\P4H<t\|HxTP\p`< h0H-P @@ D R08PNP P @P @0JDP044 0 00($/A-0`JPD @ `JP= P`Pep`P,PQ!0`0P` PP 0`0` P( dP.p,\t@W/O-MP稱qP㤡 ࠑp  AT `Px@hdA`T ,PQ!000 @P(P P$ |x  `1PPP00Ѝx@D@L@H-  tr @-@P !RR  00 !0!000T \hh0A 0 X HH0@0@|p\LL IP/@-@\P PQ@  P hO@eOQthP]O0H-P)    , xQp  !R0`!XX0  HP00P88@@ 0XpP/0H-@?  R1 S 001l000dd0A0TPPD 0 00H/ pH-PPU+ ``AT& pqP NNVq Fl  QX X0 p0H`pp`8 80 04(p@-@Q:`APP pPP0HP8 @(,!P ``  R  1S S 0``01`1x````l0lPA0P\L ` p,lp, H-`y@PQHP pU  Plh V H-@pP.HP `U  lPIE  /d ///// /T/D/4/$H-@@T ppQU `aP Mpp@@MaM@ xt0tp p`0lPp@``P X@@@@@@@ ܿп8 hxPKH-M,, ,0 0 R[Ѝ @-@`@K-Mp@P 0`pW# `Pl*LP00 -PPPPP`3P5 `P  Q N  -0P P` Y C  0p P(  @cP P  PRx|\ x PG \ @P!  !@V89& @   P   R @  W ! !2/p @$Y K`@Ѝ  %  (X ܊ P  ܉ 0H-@Q PNP!0`0K-M@PQ `7`EPp$444hH4\pW9`K($p (?! !`2/p9 rP W! # `P- W+G CP P( ( 0$p`!@` !2/`P$pP`ЍA-M@`pQ PPW `ЍpW W !` !2/`PG P p 0`!@` O- M@!R*IP4 r  W W( Qb%p `V pV "PP 0 PpU W 53 3 5 ЍO- M@ZF*ȁQpowb W U QlIP' H\ap֙powb PE WVH P   0> PV Z Ѝ Ѝ   ЍO- M!R*`IP/ b R ["*V&*P !@0p@@p@W*Q0`P ";  0 P [b Ѝ Ѝ   ЍG-MbV* BR P*pQ pTpG  0 P ` VЍ  ЍЍH-@P`Q pupV VP PP2@ P. ` 7oP"WU'(hP $ @P ` oP"7U $@$ P K-P`p ᰿pR  @Կ? `FR 0 1a_p@ P@   BP % 0o0s`V*0`s 0KP  B0p`pWOJfcRa@HVMJA\ ?p BWp0pAaF@p@-`@Q PPPp    P UP  @ p廘PPMpPpO-,M@P`Q pp U,ЍOk P Q !P2/p  0?P ,Ѝ !$#p(  $07/P0    Pp  07/P p  07/P   Pp 07/P p$  0 p 0ƗP P H-MP@S  `QpoGP: q `V P! @ #r_s 0Q Ѝ1Q>GP ⇾ЍЍO-M`, %P= 0    P* 2/ @0 Pps 0  @s W P PU 1 B@Ypq Y Y0 ~Y@paV w@ F ЍPYP 2! P V!000 AaVG-pPP GR`  QE@AZ  @tPڰ8 A8 E A APʲ0 S A O-\M@ 0 H壡X`PV  0㗡P P  , R$`  ^:`<pD8@4P*, V0ᰀᰐ@z{4Pp ఠ0 @@@Jtn 0J!p @@A<<崀p W,*P?Vx@PK  HPD4P0A @ KtBV 80@D@@D80080D<<D0B:!p 0AP$ \Ѝ$P  p@`,000<0( s0000AQ&w R D0 J:"p00 B  P @ P`DQ @$@0 0,( HL PPP0$S LpW TP ,0`(p p0 P!Q#*wQ: p0`R PP(  E !8DVT` !DAP @P`DbG-MP @Ppx(Q P ` @P `n`S <V ⑝@< Z ᄝ@e ? a0"! 0Q#QSS V`p; P P O3,P `P) ` V% P1P $`Q   PQ/ @ ``P @  ЍO-MM`pP  @TOzpg PY6 88崤[ t Q    P2/ Y <WP @#  PQ/ @ܰ Y< QU Ɯ@u ? a0"! 0Q#QSS  VqQ CO QЍ؍Tf e e G-P `=P pJbA  Aw  ഌ8qA-MP@$0Q@ @P $ 21qa`8Q "=,00 p!#!ЍA蝝O-Mp0P0Y] @  P@00@Y0 H sAqPY P`@ vX/pb"`qᰰB` Pe Ypူ`V Q` R  @p+0K0  B A  PU>  t0U/ Aq@U@U@st  `@v/ PUpb"`qB` P pЍЍK-@P`pVP& W Q" Qp  RpQ R  0P ៛`U  0Q:0pPp0A 0ppSpS0@V0 UU 8@8O-Mp (P @p` V P P@P ÚP" 0DP p PEP @p` VU ᣚP ЍЍЍp@- @P0`P P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0P`PbQ 0PٚPV 张`Ა# 0S 0[p0G ) R-$p q(9 ᱐0㲀R ἠᲚP/  Hp 0,pp% P  ਸ਼pQ 0p㏚P  (P$p q$pЍO-Mp` @PP @R'PP@P @>P> [+ (P  0PQP . P$ $ 0P=P   0PP@P P  0 Ѝp@-M`@ PpPЍpO- Mp` PP @0P0P @ :>@P. 0 0P% 0Pۙ@P 0 0P P  ε @@ ЍO-M@P 0 ps  @\`p@ 0PᛙpP  RQ 0S R Q Q  0〙PEp<`V 8` 0  @ 0t@@ s@@ B  0 P:@q ` P p`<Qp ЍA-MP`pQ @k@!P VY,\\,\\\/H!R*=PD 0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍBG9P " @i@W 0"P ! .?G 0P Ѝ V Vp$p  0 ЍO-$M8rP@p wQ p  @ U U   P 3 `PW p@U U@ `L P  cpJ  tP `A Q*  0p`P p`Pp,`' R B & 0!B pp "   F`8pp P$Ѝz  8R Q P H-4QP H O <H-<Q $P @P ~ H-xQ`P TT  R 800g TH\ 8P </0H-Ml  P\0X@0  P 0P, (0PЍ0@Zv>vA-0S  pp2l  P@`p@@`p R *PU UX@-M @PPPЍp@-MlP ЍX T@ 0 @ p P OЍPr$r |`H /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/}*/z*/w*/ct*/2q*/n*/k*/9h*/e*/b*/8_*/\*/Y*/V*/S*/ P*/M*/J*/0G*/QD*/A*/)>*/{;*/|8*/#5*/2*/)/*/=,*/)*/&*/"#*/ */*/*/*/////^*/ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/ ^*/[*/X*/U*/R*/O*/p/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/ 4T*/ */6 */*///*/@-@@*/*/*/*/xGtps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchroot aM`Txb! 4O\H"TS`V`D\`_`||g @!y( c`dj`i`ۺP !Pm`ls`l(d!y`L_`8i!`$!`H2C `t~!``!``U P``T`Tח!\ o!X p( A A ` `   # ` )> aH: t!V !H2 D a ! a a W  a }pL]a"a!l#x! `B:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-10-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written /.j0ajT0jl0 0@@fj1< l1jj|1@@pj1vj1j1!H2 }jX2jp2@@#2p2@@j1unblock and -DNO_CONV?8YYhYX_L_\YXy YXunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdoutclose%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0abcfGgHhiklmNnPt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-10-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted onUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupHOMEno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNSusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory ././@LongLinkFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.LinkFile%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %spaxXXXXXXXXXX/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-p] directory ...  гڳ4\ 4\ t 1EBZVk# _^F<>̴?ߴPATH=}-+?=###%%%} ["!t!=fids=cνmǽlսܽr y!ιp|nv ܈b    s "&*.38tV!<AHOV[ckqv}< mu!W( "<"EOF reading here (<<) document}-+?=X!*_6-03^^" !@ !@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.' *0Z *1b *1h0 *8rD *0X *0l *0 *0' *0tO" r}q" G { w H   =C !@!" .@  " "ۢA g 4 X*"D !^! _ X!7                 a 0ky|'" 2| 2c=''(o0!7\D'"tcA Pg :y!0o"\t!'h t!б6"б Dl Dll!lEs@kC!V"n)^!x&p%Q^ 8oZ"40oAlias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set:]not compiled with history supportCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguousCannot fork (%s)You have stopped jobs. && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-Current option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefcinputrcgetoptsfdflagssetvarumaskunaliasulimitwordexpevalshiftPPIDNETBSD_SHELL20220122 BUILD:20250329110946Z SMALL#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complex%s: invalid field width%s: expected numeric value%s: not completely convertedUsage: %s format [arg ...] : file changed  J!8 G" ! yϝ!  [":!8<hC8 8HXOZ !(!(4al m!\h\%w({ @>u@mquy~#}3#3233#"19* @   cipw[@@  UM@ C$CC$CeH HOV]e l@mquydiscarddsuspeoleol2lnextquitreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... owner:group|owner|:group;{,6@IP_fl"sx e y!^!QYa@g@m@u@|@@@@@@ @@@@@ $+28D@K@PU_epw}g!(/8?HOX`hnu"M y! ^!!^!'*!'7Jlyj Ab!4*bS 5:5e!$6Αh6"<<p<= \=2m=3"M y! ^!!^!'*!;{,6@IP_fl"sx e y!^!"M y! ^!!^!'*!;{,6@IP_fl"sx e y!^!MACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfsflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] 8A8O\f@Q{"8V t V<t (XXt Y!t [H\]^ unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s forceUsage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:%=d     $  F V m       ' < R j   !;#;$ &;1;2 3;4;5 6;8 9 9 : ;! <? =W @f Az B C D E F4 G4 H4 JJ Lg Mx N O P Q R S T U V W# \- aH cR d e f g h i p q;s;t;u v;w x ):d#C[x %BRn2AT_;;;;i:\\\u3NjrDo;;j!O;;9\o0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:!';{,6@IP_fl"sx e y!^!!!`ܠ!ݗ!![-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]returning to single-user after filesystem check dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!returning to single-user after filesystem check pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/netbsd-10-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@0:0:0:0;untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedgeometryPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-10-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-s||||| }};}E}"t};{>ɀ׀%3$'ȳ'<'T'l''''в'''''<'T't'''i%=d     $  F V m       ' < R j   !;#;$ &;1;2 3;4;5 6;8 9 9 : ;! <? =W @f Az B C D E F4 G4 H4 JJ Lg Mx N O P Q R S T U V W# \- aH cR d e f g h i p q;s;t;u v;w x ):d#C[x %BRn2AT_;;;;i:\\\u3NjrDo;;j!O;;9\o;{,6@IP_fl"sx e y!^!SFH0eCj_SFU0eCpHah!IdontNeedEFIz(s*K>;Φ!|nQn- q+|nQn- q+|nQn- q+Ƌϋ|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOO)4yD<#*=(?I3Dh&S[\ M}-n-чH-чH^!ZIчH!IчHܠ!ҌIчH݌2IчHS'@ )Ѹ *1@ )Ѹ%1x )Ѹ*4[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRdestroy[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglu] [-i index]gi:b:lua %*s %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuUUID changed[-o outfile]o:/home/source/ab/netbsd-10-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u  #/ ;GS@_kw 0@!#  ħ@#!X!jzi'ruyi@'L'!@'h'Z'(':e %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %s(!!l!A!s! & @ g:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point %s: can't read disk label; disk type must be specified%s partition type is not `%s' 2` cz;q9k 1 WTWTbSS-mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number%s: can't read disk label%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file SSSWTWTbD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@BC FI.L8NEOSqabcefh ik"m0nAoPr_spu1м|^t0 Non-system disk Press any key to reboot ) @@ @h  p p  p p f `   @   $create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] u) y) ~)  ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). |NAMEFND|MODECHG|REMOVED|TMPNAME|EXTRACT|EXISTEDdfLnqSsTtv_7 r7 7 7 7 7 #8 K8 k8 8 8 8 9 19 Y9 y9 9 9 MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGUGHRBD M@dmCLS1@2plbatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecPFPF0* XXX,,x<<%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname G ! H " H H " &H ,H " DAH " &H NH " \H nH " {H H $ H % H & H " H H " H H ) H l, l, I , func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)hw.disknamesswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node f!bS y[ ΑΑe ![ "X-w w x ***************************************************************************************************************************************************************************************************************************************t ~ ~ ~ ~ ~ ~ *n@ a^!s"Xg & g Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/netbsd-10-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/netbsd-10-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Reading `%s'Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)*"<" ak l\"*" !ϊ' q!!h-P-X-d-T-\-`-D--l------p-unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... NetBSD gzip 20240203123456789cdhlV(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlV] [ [ ...]] compressed uncompressed ratio uncompressed_nameoK^pp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks *0/000 %& #      8 : ? ? gi{BD psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s O!R!!!##'$?$K$_$&&&''' ' '('('L'L'N'N'S'U'W'W'_'`'''''''''''++$++/,/,_,_,m,s,x,,,,&-/-f-n-p--------------------........////@0@00011-10111111122D2O222MMǤ",?x./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@            4 7 ; > H O Y o##c$o$t$')szFW_rUU  ::??EEGIQQצ _)#*#./000>0A0MNƤ0k`('<'P' SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. S-?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tt .@ p LESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLINESkrklkukdkPkNkh@7kDhcxndatiso|^LESS_TERMCAP_DEBUGNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 08bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF8utf8invalid charset nameinvalid chardefchardef longer than 256.less-history-file:.search.shellLESSSEPARATORLESSHISTFILE.lesshstLESSHISTSIZE"%s less %sCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s option!done|doneNon-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found(P)/usr/bin/.syslessLESSKEY_SYSTEM/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledCannot use lesskey file "%s"Warning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variableLESSMETACHARS; *? '"()<>[]|&^`#\$%=~...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current fileMark not setInvalid mark letterlog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parameterssearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollwindowquotestildeno-keypadold-botfollow-nameuse-backslash... (interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sLESS_TERMCAP_Tab stops and then D"D#D%D'{}abcdDgGhHilnNpPqrs tw xy !:#=\ %lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] 6!5!& .A!J!J.W!t H._!t .k!t!.5!!.!!.!ˈ!l.!!I.!! . !t +.!t *. !t .)!1!L.>!.E!L!.V!t .`!!t.i!6!K.s!! .!!L.!!H.!v!l.!!k.ʼn!͉!j.!!k.!!i.!t .!t ."!v!..!!.?!t .J!X!.j!!.v!t .!t .|!!!!!!!!ϓ!ӓ!!!!!!;{,6@IP_fl"sx e y!^! !$! !ݗ!ܠ!`N!NAME=    !"#$%&'()       !"> |4H`x(D1L_ o  ;{,6@IP_fl"sx e y!^!cdt.0..../h///11$3|3O3H58:: <<@C4E;Φ!|nQn- q+|nQn- q+|nQn- q+Ƌϋ|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOO)4yD<#*=(?I3Dh&S[\ M}-n-чH-чH^!ZIчH!IчHܠ!ҌIчH݌2IчHS'@ )Ѹ *1@ )Ѹ%1x )Ѹ*4 ҹ!!!4 !A!{ &!6!F! Y!g!!!!hYYZxZ[[[[\<\h\x\\ ]D]p]]x`XaOchr4ssv0zĀЃ؃L`ć̇L .и.X...x.Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.1_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICdtbgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-30s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES ntpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeselect(2) failed but no child died?-s 115200 -l /dev/tty00/sbin/slattach /tmp/ent-mnt.XXXXXXfictious------------- ------------- ----***************************************************************************************************************************************************************************************************************************************t ~ ~ ~ ~ ~ ~ b:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...]  Copyright (c) 2006-2021 Roy Marples@!b c#d!e!fO!gH!h[!i4 j6!ki!lms!noz!pt qj r!s!#t!uK v!wC!x!zA y!A!B!C>!D!E!F!G!H!IJ!K!LM!N !O!P !Q6 S!T(!U2!Vfroutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deletedif_missfilterrt_buildif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULL - %s /home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %d%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeif_initrtfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpfBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sdhcp_bind%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: if_setmtu%s: VIVCO option too big%s: DHCP message too big%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_readudp%s not founddhcp_openbpfdhcp_readbpfdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s%s: deleting IP address %sipv4_deladdripv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cinet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route( Duplicate address detectedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B"dgn<""ā< ""$ D"dR+!""ĂBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~"4("P"X ""P "` ""gn<""< "" " R+!@"" # ##"g4n<"l"< ܄""L "R+!","d8"<"@"D"H"L"!`"P"V"Y"2" o" 6  c" f" s" v" `/" " "OLa """"!""" """" " " R+! "!"""#"$"% "&"'!"(2")D"*M"+W",]"-d"-q".x". /"/0w!1"2"3"4"5ak6"7"8"9":";"<"=">"?"@"[ \"\"]3"^>"^P"_["_d"`q"{|"{"|"}"} ~"/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444   +: UO+Gc9ca.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmesh-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%#jo%#jx%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZE[ sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Could not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-10-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank 5MS7) bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9#$ !     rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n^G^M^Ikbskcub1kcud1^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdbansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxonbitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslacscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom  # "  !""$  b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe     `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check inflate 1.2.13 Copyright 1995-2022 Mark Adler  #+3;CScsA !1Aa  0@`@@ deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c             (08@P`p  0@`  0@`/home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist