'V L f0f0tW=NetBSD/earm ramdisk 08".f<  ".fx\< <".f@@<@T 08".f<  ".fx\< <".f@@<@TU ".f<xxHA".f".f".fA".f".f".fA&".f".f".f(0A".f".f".fA".f".f".fEA".f".f".fGA".f".f".fcA".f".f".fdA".f".f".feA".f".f".fgC".f".f".fpA".f".f".fqA".f".f".fw$p ".f".f".fmC6 ".f".f".f (08@HP($".f".f".f (08@HPXE$".f".f".f`hpxD$_x".f".f".f=$y".f".f".f ]C!".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f4!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f B!".f".f".f B!".f".f".f!".f".f".f"!".f".f".f"!".f".f".f"a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f\!".f".f".f \!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f$!".f".f".f4!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".f!".f".f".fa".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f\a".f".f".f \a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\$!".f".f".fi!".f".f".f!".f".f".f!".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".f!".f".f".f B!".f".f".f B!".f".f".f!".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".fa".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".f".f".f".fbpf!".f".f".f $".f".f".f$".f".f".f8$".f".f".f$s".f".f".f;$".f".f".f@$".f".f".fBA".f".f".fFm".f".f".fHP$j".f".f".fX` $".f".f".fhA".f".f".frA".f".f".fsA".f".f".ftA".f".f".fuA".f".f".fvA".f".f".fxA".f".f".fyA".f".f".fzA".f".f".f{A".f".f".f|%V'2ZIwF 9Xq'd|ażrOv;Xەt N2Mye$TIf} Yi+i K3?t4a q>  DB>A9acyg6q6q=A\oJ`i{=Q,em_^x'ZWF. qlK.7|O@PQ872Wt"gw>-&fVl?`;)< . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2 2003/07/26 17:06:40 salo Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF( 44 4 (,m,moo%o%Lē H4oo%o%PtdNetBSD/NetBSDearm P P0 -HP `PUL(0`&a`@@03/T舗$(n$A -PRL M@c !1 P `0SR 0 0S  /S 0S`10S QJ L1 R !00810 ]m0S 0010'뇲0 X *0 )pp03/ Wp0pW *0(@@03/T ZD h0 0000P0000@00 $D\zPՈxHm$Tm$-%LL -x Lttp@PaV #pPOU< {uP 0$ں@ qu㟸T_H,&$2 P-L@ KhYH0`  BR` pR RFX X/+&+& -$b$LP p00CS0f$p@f Z(0S TpWpT0S  0T0R0S  债16@ G 0S8 l!l\tX16@ ; T 0S* $p&1 T0S! ^p( I0S TMp -p @000 ^p T@? @xp 0 @0@ 8@P;000`00$06@$h1&0&+&+&Jo -@`0LPp0Y  #P 0Q @Pl00 P <@0 P0@T0`00 -0S+&h1&{O7$1 -LMVpu6 AX$0%XS!(0SKP<0 S(0(` Vp30P$ :$ 0R+( , $ `V( $CT`P $ (P0(  夞00 K+&h1&o -XaLM@LqtH1HP$H0Y5 , #P@tH$H& R  @PK⓳p0: S :: @P]00P0P0THb0s 8#T 0S$K+&h1&{O -Lu0 #H,& 000/E' -P0ML@ `  T0% 0 _` @ (KE'Y@H,& -00L$M@4K@K kP K& x1 -0`QzL@0  P D%0SP ((̝P報PP 0V;0P᧱呱P 寝P W 0Xp%V ᐱp%0-SP噱p 0S 0<厝PVPP l%3=E'G - LM pp  T5X`0S D50S850S (50SH50S+ U%C00CS00 4 Pp@@   BR 0 0  YYXKP p <D!ʰ+p 0: S +堰pP300 +台pP 3P ឰᜰph P Tl'R,K0@X 0܌K0 30 ,K+K%0R 000 0 p p  pw@Ԑ А 0Td01# 1Y |屜@ -K@i ?-K0S -KK{T娱P0S  0Kj(0Pa@ 刜@0S *P {$T BP@ @@ 0R?o20S 0  `1 0RKwP S@ 0R 10:#:2PP <@0S 5P@ |0 塯0p  S00S (KE'E'E'E'E'+&l%SH,&VE'E'E'E&E'bE'E' 0- LMPAK@A 僯p  0K0U4@ hP XXAK@@✯PAKA0,0P XK0l%E' Q0-L@ X۰PLL<可P ,0廛0$0P0K0hl%E' Q0-L@ \幰PPP"<P ,0嘛0$0P0K0hl%E' -L0 r<H,&0$/E'0$/8F' -L -L -L -L - ML1  0 0 KE' - ML1  0 0 K8F' - ML1  0 0 KE' - ML0  0ڈ 0 KF' - ML0  0Ȉ00 KHQ8F'E' - ML0 $ 0㳈 P K3p% - ML1 (0 㞈00 K>F'H0 -LM0 0 0 ㄈ0 KE'J8F'H0 -LM0 0 0 m0 KE'\E' -q,0LM!`!PAU- @P x =P `000PS @ <1 040,K,@ 关P,  0 ,  0003/0  R0B=00 B  &60  R  P 00P ! 7000X0X0TL00K8F'E'E'm\H#=F't@/L0 0-L0\@ tP !QP0800 0  n@PPQP F'E'8F'0  /E'8F' - LXZ -L - LKX -L -LM80@0K(3/P $ ?0: S80 0 Kt(3/ 0P  (  01/0 QP!0S 00 0Km8@ -(PLU@𨝈80 03/`P8003/(` p-LM@P`, KL80 (0(3/@  ,KP PKpxF' -4CPLM(S  0 0`< 80 #KZ#K20 F 0ԃKR ~ 0P  8pp (1/0 QP2$  lr4 P0 0$ LS 0S $ 420 r# 0#1!}# 0#! 0 `#q 0##K SR!܃K SR ! 0!,! 0!'! 0!#K SR 0 0S0$$04 0 0 $ ?#K R 0r K0 40`p#K P0!QP#K![*0  `  000L0! PA0< (Ko (K8F'E'E'F'/2 -LM@   p 0  TK_0_e0}s'3b@D%H1#}*K'*K@_@XP0!d!!K! @ P !wKMK 㹫" xStR h!KdcK9K 㥫" (S$R !KdOK%K 㑫# SR Kd;KK }8p?<` !0n/00 /X dp`KKK \$KE' F'M -@LH  -@ALM 0P040P! 08P (1/0 QP5$ `0@p 0@DT% 80 $0(3/P 0 h0h$ `V`P 0S0C0<Y$|$KE'E'p%+ -ALM 0P040! (08 1/0 QPK`p/ 03K004 K00 800(3/P9' $ #ԠWV.*  !` pQP $ 80 $0(3/P`p#T@WV:03K800 04 K((3/p$ (K8F'm P-0LM@0 00 0K0 K 傱KJU -LMp K`P @P@]KcP PNV@K\ -\@LP`UPE Q PoF' L1-#MLM  Q Q  Q 0S=(KoP@8X1 0S0'0S 0 ! P 0pSD ᗥ &K@i >K0CKKZ P K AWPN@(KF'1 P-L@d 1 QP 1 壁P傱p l*hHdaPpU1TA U0000<pJ-Pg 00CS0)00 % ! k 0p0CS000x00 屰0U0 f8H DTU  ? $0I'I'J'I'TH,&(G'TG'!LG'\ -0LR R 0S R,SI' 0-$L @ 0R0 10PP 0 P00 T@% . P 0 P 0CPP0PPP B0SP l P 0P 0PU 0<00    0TG'(G'x%LK'I'LG' 0-DP@L4 000@0@000000L'LK' -`L)PP@ 勰< 834 0p S@@ft .0S  剀Ph |0000 w `0T0? 0 yK< 8L  @  ? TH,&!I'I'J' 0-@0 L?0PP@ P 0P/SX0 @Pɔꖆp` p>l0P ըbH 崔@ʨ K'DK'4G'(G'I' -`LP @P @ׯ d0`~\ PPP  T- P,0$0@P@I'(G'`H,&0I'J'H0P P-L ,@ P w 4-0 0I'(G' -HL @fP(0( 00000 SHK'+&I'J'@-44@ @00 c R   (G'J'//// -P`0LSp.@l0008+PU r00CS000  Y0`0CS0P000 K'K'K'TG'TH,&!LG'0 C-Pp0`E P @^ PV00V00\0K' K'K'X0@-T @P00T0P 00\0K'K'K' -LMPp 4KU 2P4@K 0KO@P@dbS&HPD P? PU#  PP00   R R 0`00 SPT1@t@00S PR P PHF0KP ,A00 S5! S0< 0< 80 =*80< PX u00CS000  \ 00CS0l00@0   (K褶0 zU !aY8q00 0014p T&0 40P00  只00  BR Od10 G 00CS0 10 0 S00   Z @` 0000 0 "p0@ 妪 N0 `00t0 `0V0`00T  <0 (K+&PK',K'TG'TH,&!LG'DK'L' 00CS0 20  X0  X0 C00S@E0P   R R K~PU!)q U80 4 %4 80P < 嶩+00C0B  BR d! p 40 D140S @EP 1 00 C00S@EpU/@ U00000<p%Pʩ r 00C0Sl00u v0p0CS0400gi00P(K*.TQ /TW ?TT ^T ;Tzi R ,# 0 Q0  ƍ@q 0 E0 "Q^T-T b  @ ^T-T  QL" )0 ,0垍!@r "RQ  .T 'Q /DoP( T  Q 00GPQ  l ;T0000X 00P0V Z0 Z Ѱ(KL'0&00 1 pF 2P00CS0 P T  #P 410 > 3 T` p p` p  T0000`0b0@|0@x00S `0 00CS040 (KXK'LK'0K'LG'L'@K'(K' -pAL Mp\1@0TaSPPTP@U@d0d0gp@@p 0P 00 T<@T2:   OP P 4 W4   pP  BR   0 ^ p0 00CS00w00@00 (K0K'XK'L'LG'(K' - Q 0L0@0[`P 00CS020 !+ gPpH0TEB00S 0@h@@dd0p\0 00CS@0$0LG'LK'@K'L'(K'2 -BLM0pS P0 `00VD d0P   Rl1 R ,80 4 4 80P  呤 00CS0w0 p    BR   s 0`PxA0 `S#000d1U0<` P 嫤( $S !0 `0CS000 A "`P%0P0pGp0P00CS0p00  rP d0 00CS0 (KLK'LG'TH,&! L'(K' - QLpX`0C4000! @Pl> [00CS0$ C00CS@00 \R pR  p `\0  CLG'TH,&! -|EL0M00 0S 0S Tg0K{DePp` 00$PS0 S 0<P ( P ޣ 冣00CS0B40 : 0$P0CS(0l40(0h! P%S $0Z$$0( 000\Q0 0 P 0 S !SW#0SE(#U ,080 `80P $00(0CS0D30 $$3 U  U  (0< AP 0$0CS(0200( 000S "$0|r Z( Z ( 8 8 P`28 4ڢ0O00CS00T 0$0CS(00KM0(0P` S7*,0qSu , $00 P(0 0Pj  P0< (80  80P $00(0CS00 0 BR0   p004ܐĀ`U0 U000<`P 0`0CS0P00 (`L 0P  !@o(KLG'30  ]Q\ Q ]S -頑LM`@P0 SS [S \S PP X0 SH@KPP0`f( V1 q V0,000< R@Po 00CS0(0@ -@ s0(0CS,A000,A X0  0PS 0(Ko.H'TG'TH,&!LG'DK'8! 0-L PH P10!@R =0P S0i@P `0P 00S#`PP0(x t墚p\0pp`0 0壉4PP D0 0!0q0q0 P%A$4@p0 S0p10Sdqda4 74 P0`00?00P S@T.` T0000<PZ, ԙI00CS000 00CS0T00L 0@  (KWc+&+&H,&\\\0\X X0-dDT V H H0R\\o/0X X-dDT V HH Q\\U/X X0-cCT V 8 80R\\</0X X-cCT V 88 Q\\"/X X0-eET V X X0R\\ /0X X-eET V XX Q\\/X00-GX0'RT0\\00/X -gX 0GT V \\/5S %R R S R S&S H\L\S R 00////DM'M' -LMQ  60S50S50000P 0 @0P P P P P P P .K.K-K-K,KT 5 SS $$\ d 0!T5 !RS<5 \0.S(50S 0! 00 R0!0 0S X`'/KK.KR0 0.K!KQP.K10 R0!0 '/KK-KR0 0-K  \(h0 .S0, .ƌ Z 0 ,KK 0,KK-K0 -K30S^ 3Q 0# K⤑0K0 w0P0 3Q 0# Kⓑ0K0  0P0 a0S0p0 Z R 8#0P (1 RPK0S00 101 0 `P㱶 _ _" R 1_`000 @.0S \0 0t X0 0Su ,K&K-K&K420S0T0  2NK B@_?!K&K10S@T  @T 0P0 0KL0 .K !K0l!H KK\10S0@0 D -K ៃPK Xp[4$ Wpp( K0 |K"P60: S/ÂPd* xnp Tt00CS0p YX.pP 0Sp 0S  QncK P0: SՁP |́pPl5nU0$S 0/K 0DP"n?/K ?/K0S %KAK 00K 2C?KA?K0CK WA?K h /K 0  ႁP jZ  0mP  mቁᇁbႬpm|0KK0KK ᪁P m ᧁP +0S |m0;0 ᛁP Tm@ᖁP 0-S @ $mEP ᧂPpW!  &Rp0 X l00CS0Tp0 P(KM'SH,&\kJ+&ymY@b  p-L M@$K`PP,0P㽬 U $$ ހU $埁㜁`@ 嗁ᔁD@$ˀ ɀ0 PKp% -q~ML M0~\KS`,PE~,勀P`0KE0,H 0EpAP\h! 3O0 H0EPM0!~,c@PD!~,Z萟P 9 E0p 0E~݁P) Vp tQ |=300Ep @P >8 3(K褟%m.W00CS0 0 / -DLPMPp Ą$t000000 0000SZPPDUx$x4P  l$P0L$83p 44Q 9U00$3 #P0 00#3p 3Q  U00#x3 p#P 0d#2T#030S@3PRbP h2#02 qp 0: S 2 w20 0 S\ KP S0 00 00 QP30S00000!S   R RgR1 a pQW10R SNhh`h~K 0C 0b>K 0C0@6BK0<60 86 @U B>K 0C ɂ BK @BK A J{Ur(K%+&X''`'h'8'JP'%' -BLM0xStR0000`b0ST20S 0S <2 P;U @P00S3 N,L##00 3/P0  1S 0 !0:*0U`00S T*,@DTD Ad,,(K%آ%N'%'N' -qLM0`@,KF0P@(80 80S PPPPUVPd21PT 0@@10S8% 4+P0@0$03/0P& 0 R T 80 3/P 'P00S++@ A-`0 0L Q < L80 2/80P D  0(K'N'%>h'dN'8' -LAM`/R@P)A^Kp PEpP /00P Vd0d +T0o"/0P0 0, P0P+Kl'N'00CS0 ;0 / -CL0,M80 0PpW aPN P0,03/P3000@0 dt30SKd1!PL_P <P (PP 080 30SW '#P( Pb4 CSR wP8 7"?+ Fh `P 8K& k v0/SPE BV 8KW 10S 8&P0S S100$Km1 !x000@03/`P8KT : 0S TQ0S <19008K '04 KD083/8KP 0S 젟0S 0`U!KP00CP0PPPGU  xIw l00S "0403/d(K't'$'h'p'h'1'|'l'h'8'('8'H' 0-D@LiP ( *00N'K 0-L,xp@ K0h o*0h 0-L@wp0 _*K0h| 0-LMPwp0S  S SS NS K@axp 0: S @K0 -LMRPgA0H03/P0 03/P;cpQ`pPI 0AS0, K@0a43/P(1C"K(9P2)P%P)nP$0/SP A0 00C06@ \x )P0 CP0(03/ 8[v K'h'('l'm'+&+&8' -LMP\tE0H03/P0 03/P Pb850S K (5vP %)50S P>P 0AS0 K@0a3/P4C,KP P  p4 C\LPT40S KDwP 8d0S,40S KvP0S4 R 3(KR0 3'KR00S3(KcPP mY F0/SP1 .4c0S(30S KvP0S 20S 2(KR0 2'KR02(Kb0S S20`0-KDTp2 4S P P20Sa@20S P^4S S# 0CSKG  0Sq GX G0S7 a0S3 100-|0S4cpP P1$a` F Fp0 K@03/0SC 0S `0S 000Z0C,K4S 0S D00(03/ pt(K''%t'h'h'('P'l'p'\'''L'4'$'|'h''%8' -bL@WPP T T 0 '0H03/P10 03/Pa0S0 pW PPh0S\10S P1P L1{D1 K  P]?K ]K ? P:P!8U$#=]K!QP*0(WKvrP:8 =$ G?K KQP *(x0#[?K_K R0 d!R MP0(K,' T'П%Af -@L,PUP&`p{P ڈ00P(00$0 ? \00S0,0 P00$0 P d'П%T'`''d' -0LM "K0TTA($``l?P 0P`p0( 1Pş 0#K 0, K e1!p^P*"KK`Vp`p 0 V0$0(`P0{P00 P00( `V(p$Kd'@'`' -鄐LpP` V$0(aPSPPfU(P@@  ]`d(pd' -=LMpQЁA0` 0 KpqPD@TL 0!L3#Q0 0@ 0 X0/$0(`PPA?XL0K 0 (0K^P0010S(0  S    R 0(0XW R =P0 X0 |0 0SPW0 0 j4 R r"(K d''1 -qL M`P0P P0V" 0 PX1!P1U00$0SPeTX@E0@P @ ?U 1 $  00 00(0U2Pc ( -P `` ? 0 @s 0(000Q ;Q  0 nP0 D V$ Pc40 (KH'P'П%d'T''d' 0-<0<@0(LP0$P `l0(PK0hiT'd'П% -退L`PpU$0(`PT0UP(0U@@ `Pd0(0d'П% -鐐L`p V0$0(`P`0.P_V(0@@  P`V(pd'П% -LMM=`pB WKA`10S WK oPF:84!!(T0$0( bP1P@DZ6?T ( CnP&(0@T_(0 j(K oPj8h ! GK(KQP j(D$!@ j8 (K,' d'П%3T" -LMPKoP\0@T@ [b KWV *KQP  @ KP' 0-LMPK@nP&00S!0: SPnPU 0H EoP40( 0!K0P'/|' 0-LM@+K 0 KS  '1 PR 00SKnP0S'Kt,Kǻ 00S &Kd+Kύ ^0x  K5nP S0NS O0@  0SKmp K0%% -L@P`nP  mP $0t&0  |'" 0-!L@mP0$0^ 0K0h |'@ -0LM0@/SpP/㛑`P/ 00KnP/00  p/00 0S  dnP KnP[0 Kdq/00Pu K_nPPPZYUP$K' -PLP 00/S 0APG 00AQ  $KklJP0 0 +`0S L밐p0 >sJP𫝨w0S p0P4` PT@$<YP'] h''|' -LM`PK@prmP9$10S B+KQP *KQP U20: S CP lPmPW 0|  PmlPW@0$ | KP'/ -:LM(4P: S =!R `V0000K @0Kmp 0: S $0 KtK.: P/  0 e -LM`Q[ZDT@kP0L!#@1P @$<a$10SP((tS|(t쀟P2l0l00a00S00S 0 00! "4S `kPd`0H l, 040 K]'0''%%h' -$KMZLMt3(W0`p@ 40CSN$%%%%%%3CP&30S" KAJl0P4 4: SBK<# A-kp 0,#Z) H,0K4[BNK4@ @D Z<zz= kMk    0k P Y Y  PD20S 00" F|@$<P20S @$<z ?o2P0S((4Q0R(44匡S<X1P6 lP!KAkP 0C#QP J(hKP0P P0ȤJ8 (K}  -TH,& -cL,M 0@S0SzB 0 0P@P#PP 50C S3l2222222222\20S X<K!4KHP0 000#K #K7  0!$!8 0!$G0 㓭 J X ,(4: S'  S"  S  S906 S  S1  S04=! ,0410S& ! !" # "0004+  gPq0 0u0  040 70p  J.T0Tk@P@0 0 <(K'H'k 'e -L'\n0d KxWn4 CR+ \SP+ In ( K$'TJ"){m -=L\M@TK"p:hK(<0T KhKK1 0-LM@Pp bP Q 0 KK((K0P:R" 00 S 00 C R20C Q A CR27Ca CR/2WC/00 CR10C Q//@-PpU@`VUQ/0C0\R! \0W  @NΌ! 0 S:0CΌ 0SC$*0G-\:R900 S00 C ZRB ^ ^$AC Rrb ~ 0aC0 S 0 000C R !. !  ^Ѝ0@- 0C0\ R#P@U T0@W@L@  Ό!B 0 S:0CΌ 0SC$*00<0 0-@LT@@  0': -@qP4`LP VA-PP@@@@TQ S KhC@KhB:TP0 ` 0:SH 0V00 ,0(l?@@L.'%&uH,&/C p-L M K`1 @PPQP9 0V6 kR bR mR wR$ $P 0 0 @P$ 0*S xS S   !R0Kp 0P-L 0SÉpP$  Y@@ @R 00T0 0S ,X=PS`P H @,P 0P ' -L &iH,&$0 -RrL %@@ -8Lu&(r& o&l&iH,&-   p-L M K@`P0l #300 0  R R0 0  P@P,0   PE 00Kp' -Lpx9l@I`PQp` Y /00&0  `z(  -_LtM/?OP00P h/h?hP ` P倠 删 0 @@4?4/ bp? zP`hFhKAhK\FhKhKhKhKhKFhKFxFFFhKhKhKhKFhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhK(F0FhKhK8F@FhKHFPFhKhKhKhKhKhKhKhKhKA`EhKhKhKhKEEEhKhKhKhKFEhKhKAEhKFhKFhK FhKhKhKhKhKhKhKCDhKDDhKLDhKXD`DlDxDhKDDDE E$EE,E8EDEhKXEPN?=P ڀl>=>0 -R,Q0 000 Y =, < =<=0S _Pp< h< \ PS70*S0 S 0PS 0 PS$\  !^@@]P P p-W p]WW \\ @\ !NoT^Q X' 0-@L/T N@@` P0D0\\$A$*0C0SS$a%*0 1p-ML MP KP,KP KJ P <[S.SL[T|Kl`.KY T K@fKp'$Tv  -Lc=KcM M(0C3K`r2KK4@D^KpV  000c=K0C 0EPc=K0C0c-K B00 ;RS@ՄȄX 0cK$A 0cK; A0c=K 0C0T:hXPHcKA00Q &Q \Q01CP cK A c-K$ B 00CR/c-K B2 &S\ScKA  @c=K0CP  R0`Sc-K B  dScK ,L0k1c=K,0C0@c=K0C 1 h,c=Kc-K 0C B0 0bP;T6 0S3 0jX-`c0S 0T:00;T0  R S 0 %JKS,@D8TS   ~c=K(0C0+0 8TS 88d0 ( d(K'"< _H,&u -MLMPP R`$\S``0S?R00`0S1 \S`, R)OP 5Ghr#@P p RP B.K; BMHB.K0 B Z `# M.SS GS0000SPS pS sS gS0000j0 0@< 0P@@@@ K' -`PLp 0Sp@P\P`Pq80Pp P @ @@ @5J'X0 0-@LPT 0 U(P 1c@0'wTH,&d1  -RLPP jDTPK 4PUD P8\)QQ"{P 0S/  00 0S/  P00  @0/S000 0D 0T 0 RHPP  04'l'X' -0j40L@PTp 00S 00S0 00/S Pt0D0S@TL0o0 eP04'l'T'2 0-SL@P! 0`.S0.S0S/S 8P0 R0 fR S.R S.R0S/Sq 10S10S( >_ QP:$0BRSR    AP P:4 CSR 0! (aPU: 0/S0S.00 p6 300C0U00 PU C 0C0T T0@0 B!!00 0 0C000C1#@DSd00000C #@10C00 0C0@00C1# 00 0C0@00C1#00 0C000C1#0F[p`0& -ALpPW : V00S; - P  PQ @PP!@TQ CT Q BT@T0S'= -@PL= PU: `0S7P, #U \U0#S@'`P@  /  @_l"`QpU 0 T 0S'P0$ '= ) -@PL= PU: `0SP, #U \U0#S@^P@    x@]l`QpU 0 T 0SP0$ '=L -PL 0SH/x PP000P`V 0F P,VY B00#.V00S  i0@Pc U 0S00PE` R MR CR cR mR000000(e D0S P 000Y 0S  P E 0  `V00 l3 pX 00P @ @@ @,! 0Qm'0 -LZ`pP P WVU  @P@ 0 01`0A '= 0-@@L0S 0$P 0' |1 -LMpX9 Z4S7 8Z4 k#8#K4AT1 80 !KQP"QP 0@80 T @P o|P " #K! 10 A  h  94S0 0400CS008 0(K' - 0 -@LT:8$R𫝘4 CSR𫝘 clSX!WV@"UT Q$Kk|' `0 0-SL`C'<@PUTpecPW' -@L`V@! Px @h0hP `gA5T0p@0< U wX@'GK''v% 0-@@L 0S 0$P  0' 0-@@L0S 0$P 0'= - LP2 -LM0@Sz kЂKKЃYX K K}PP  Q+ YXW #KcK`p#KSRZO  dPP= #KSR00 00S }P/ 0 " 00 p`0 BP#K0 QP 7P a0 WP 0 K0$K` b#  47 ,4  "$K#(K' G 0-@@L0S 0$P 0'=} -t`LM0S Pp0@TD0PU ! pD(@T K' -LM #K!`#K0@T, PQ !WV SR (00P@0  z@0P K!Ka( 1(Ko(K'= -0L@`Tp AT !(YX SR (@00'=/ -`0LM0PSp 0/S AK AϑPP d(q@P  t[T Kh$zP 000 0(0 $` @K'' -PLM`@pT& 000S$0S 0Sp00S ! fD00S OM@K'0'%%% @Q-L@A@ M!1@T Pp `KpPU @?\1 K . S44: 0K -鼁MLM@`Te pP!AT$ 0U @d!^!QP 000\0L$*00  - R 0R40: -M0ALM Rp1`\p0.P\  *RJK$@D0PC ?R*K$ B0PC0@ಀ A@TJK$@D0pC0K$N N0*K$ B0  C0/S :K40C KZKP :K40C KYKP:K40C\ PKYKP:K40C4 $KYK K0&/ 7BP -0 L ,[ -L@Q`e\ 1e #Kh; ˾PR   _00S  /0'0-@^\Q4PP0''  Q0-LP0S   pzh P0s L00 @0T000 % -p夀L@P" PP 0 xp0d l `\P  BR@0 00%0' " -LM`@P೉(":Z0840K0CS1!`60! 0 1-  d } (l <t @|  =-0B0C2Q0 1Q $ 8$($)KAPa耟KQ  v B` $($ *($5Q/P $($)($ 8$ Ёd`(x(pB /R00C0$K$'' '' -LEMZ@0@S#L4$44030S J(J( J(J(R ?R%R |R ~R$L "I@`0=S= >S?000|S04  =R 8.0<S0 =S,0$0&S0 0=S0   +R  -Rt&#0 00 0 0$K0&'#'''#**+0 - Lb'7+0 p-PL M0`0Q0`~0S@ PPx@ l0R@ K @P᣽0S 00S $Kp'(%W+(h+ 0-@L@P QꀬtL`4@̬P H UTq  PƸ0¸005!000T0? y0? y0T0R00R0T0SRSR0"#00+++ -逑L@P`p\/ \# \. \F@1P "\ $\3 \= T`vpP@0#SP,D(0XP " 40 /0 0 P0 !0 ,1"&0''++ -LMPp`80 쐟#K@04K @0DS &00S^^ PU@  0  0DSL0`@0T8 pQUU (K'' -L Mp`E0 @BTp0@P@P0SX0 @00P TQ@@@ K'' -L`d00S@PL0 p{000 0'' -餠L Mp`0%S@P\000 0&S P(OH0 J00S00 0 (K'+'0 -L0M @p$K0T`0@P S0 DK"WP@V DP@ 0 F+P@4 P@8KvN 8KDNK') -`LMP0Kpg/pL@lP 0IS 0NS @ 4lP@@d@L0L@PP0S`p $0KP/K'''+ P- AL8P@5 q ! Q 0` R  BR ԥ å0/ 0 @@ T B Rå `0/ `0R @å/ @`.@@0P@ 0$J0Jܤ%Ԥ%d((@ -P 0/SSS00' -L`L.PYP x.H0Kh..0"S@ VN',0 p-LMM `R" %@P 0/SS_KpnHp KiHp +KQP *KQP9. 0KpL%,/' 00S/' -8cL#X 0S*SP C000000000CS020S Q  VM2 $KkOM$KkOxRxr-p2rd2@000/S 0 R 00CS00X0ĥ@.0X@00S/S0@D00bP  T%P)0000t/S0S LP 0/0CS0ĥ.@|.0X@00S 00CS00X0@0T 0/0CS0ĥ@a.@PĀU00X.000P0@  P P U00k- PL DL00CS0 00S$KkJ'''',,d(ܤ%'Ԥ%/ 0-PL0@00FP 00CS000S ) 00CS0X00S T @060S40Q (bI000''%'TD2 -LM`04P$0@TtM@P4Y$ qPU ჊`P P , aP0`b@ 0-S0SL1@T41@` 41R@0.S00.S000/SS00 &MP ,KFP K> PP0: SV 0.S0/S0S&;P$K0%Sx(,'(,4,'/l(E,L, -L=,0Q  KhK Kh',[, 0-LL@Q30P@000S iLT0@ xK lK[H`@00CS00 G 0 0贾x(,'',,% P-@@PLUpB00CS00 G 04ᡵP@`p ᙵP`@`pp쑟P0Si @TQ \T  R: @eT' aT 0T \T. +bT cTZ &rT @% fT @! nT @ tT @ vT @ @0@ @@  0BPA0@D@S\@00CS00 cG 0@00S 00CS00 OG 0 Wl @(G0%#g -@`0 LSP 0S SG0 Ri GU  GT GTKp `Gd@00CS00 G 0 KhFȥ%'Ms%Ąܥ%,0 0-SLq rz''@0 @-,Q0L00 :H''0 -LM@x0T   $K@$@ @ @ @ CD00S 8060S /K''d(% -,0-LM R    ' --L M  0 -L' --L M0@0 ; < -L@P`. / --L M@  " -@L --LM00   K 0-LP@ K0h --LM  K T -0LP P   F,'0/' -L@CPPPP Bp` B`P Bp` B` 0-PLMP`0 6 F -P0@T BH@G,0 @0  K0%'4( -PL M0`S@'<0P`{ 0~`p {0 ~ I06S00S T+  0P0S@0P.S  K'N@-c 00 0 0 0/'''' 0-LM@PKT! P 00CS88  000 P 0 a1@K0 0-@LMPU PP0K xgp Z)P  PP0K<gp  ,c?00K0'P%k=X% -LM@P 0S0S 1P 00 0 KX K4( -LM0pS0dA0\00!P`U: 0(0 0S ,KPVA*   _'P00CS00S V=(0S,A(= VA(,`AP0P`SP$00CS000S $K''-' -cpPLP V0S V0S 0S|$` $DhV0S3 V0S20S2@T V0S2@T20S T0S 0S `2\2M1DLD@T  4@@(|DC >w=0Sa 0S^ 11*1fDdDR FKgV0SEh1@TA\1XY@9 P R3/ ,)  0@@"= 0?o2040 R   @@$@2D|C@t00S B 0S(00S@@T 0B%''((.%$.e).ȥ%( p-|`LM@0KP (d0 ,T@:P0 S V0S0K(D0K(Kp%(% P-L>P@5 q!Q 0` R  BR ԥ å0a( 0 @@ T B Rå `0O( `0R @åF( @`p'@40 0 0ܤ%Ԥ%d('' -Aq0L0P`0y0V0S+0S 0S 00CS000S 00CS0l0 0d S0S S N0`S00C00`''%'' -bL,MV0pS1@KP 쁟E'@HPKDP T  Rh@D 嬁@AHP  UㄑW 0S/ 1|1/BlB B00CS00 B 0= C100CS00 xB 0 XB  FP0VP R R  BR R`  BR P  B @K&(K%''ܥ%'((%' -aL$M@@K& 0HK D 0ؐd@T* 0pS$PU 00H0lP 匠0 RVPU0 SP0 0xU0 @P@00 @K0&(K('%' -apL@x0GSo᪢ 0S h1d1.9BT7BPU  <8>P0,B$A$Q000 S$P00CS000S W<W !000CS0|00S W0S0S00,0.A4A,KojA%((.%9.'''G. -L$M`8KP% !00000 0V?o2Q0Sp1@@K000RP! #P00S {@C><m:00<9>@0 000CS0(00S b8K% K%'-' ? -_LgM0@0 A x1 > 0SK1 >! 01 >@%>@1 > >Kl1 1@0T S 00 0=S0 K)0@l1^@1 vZ?Kd1 1@T .0  d!001 p1  =R ZK@S!0 ! %p1 S!  00|1 @=60S 4=0S1S10|1 Ř1!10c1 <0S1StV?K ;P N! KPP0 : S K04(V.0 -PLM`@`P0KD!@ @0@808@0p00 p0KC!K''''P0 -L`$h00S\00S  @ 0C 0cS  $0 0 '''''// -LHM'4KLTK4L@KDPK<`Kp0,(` P(T0K <$KJ.% 00S/w' -L@`p39PUV Go $0 0 %8P(' -LM0 QpK R%ppP@0`S:S0a4 h  W P04X8 4 8  U4   7 X/R/  0 | W@` R:R 0:R ` `24 0`(Ko (KԤ%ܤ%' -L M@Pp/ `!]P@ 0 nt@`VJ  KP0S0 Y_0S [0S W@TT0 T> DR~   PY 0'' -LM @P`RI\<(1p0$K00( ;pWZU x; .Q d;Q T;L;&Q <;,;U $Q000GKr00CS000S ^;0K;;| 0@S 00CS00 ; 0* 00CS00 ;H0 0 $K4(....''// /% 0-L@LPP 0S%S0ᷨP @0X) 0-D@LPP 0RᣨP0@0(T0T- 1S Q QP 0 R|%'0 -頀 LpP` @@P 0S0SS0W00嬼@P|U00CS0$Kk/'|%'0 0-pL0`P@ Q Q:RR:QppR %Ru`"PPP0V:S@0<@0 0?P0SuP4(')/|%0 -錀 L`@ pPU 0Sp000GF`|V00CS000S$KkD''' 0-`SLP R\0AqT ҧPp@PPTPU |P000C0 @0 0  00CS0$00S 0p''' ' 0-0@LPP 0@P00( 0-D@L000400 ϻ00CS00K0hX' ' -LMP/`@0 ZP @@@ K7P00š0J0S F0S B00300P@ G{P @^P R R R   HQ R 0#"  " /R0  WpPZ0 R"000  KpPi 2Q 0S/R x P 2pP dP2T P0SvKp7P ϩ R ˩ R ǩ * R31 R -S1@`9 P R  |>%Dh1 @ RؠK RؠK $ Z 4 1 @ 039)0 @ RؠK RؠK p  BR | R Z 0  000(K4((/|%')/1/ܤ%6/'ܥ%`' -PLM@p`d#0P$ b0CS<$,4<D`p@PY 0001@ p` Y@0 儡& "|1 Z 0STVXW S000  @ @ Y6T@0@0 Y,  P 0S,V 00S=XW 0 08K IU 3[s  P eG9(KK/x(4('|% -x@L0`000PS SD000 00 00000CS0Khh' 0-t@LM0 0002KT0P>01KgD K 00CS000S K0'%' -LyP 0SD -LM`@Pp"P pP vP@ VPP0cS    $p  RcS# T7袟`VP< T 7V0 PU 0R Pl7 XP T7`H~7`00S ,R00CS00 7 0 X P` #K 0 0 8KT#[RF/OXPXd!0` <  <K@ N`VZT!ZT7@Q75PTG7T~pR;T T T 7mT7peTtH000(Kv/z//x(S/J/ T///%4(a//T00/0L0/ -bRL$M@Kp0c0@T' TT*/T! :T TTT:T @KY R    BR @å0H bH0@,AZ  W0000S :`P3<:P` `:@KVp& X" W 0 S00CS00 ~ )00~0000CS00 å00 (Kܤ%'d(%% -LAL0PS81 pR(a1P 00000CS000S  U0) 0QR0U 0tpx`R00P 000ӷ000CS0000S  U𫝨P'''' p-L M0@!SP 1=*S@S``00P3 Q0C/ P- R (00C S%5 K`@.0S 00S=ST`00 P0 T 0AD1U 0  0S 0SKpФ%|(( -h@L0pS`P  R R`00` P'' -D3DsLM@0  0 $3$SP 00 0 003`K00 0K1 0@ 1 00`DKKŸ0010100  BR 0Sj00CS0L20S K1`P0V00U`F` 0Kꌥ0S`V0 V Y!0 S@ 0b0S00C0?@ ch0I0CS0 00ĥ@0 0@0Y$10S@0S 00 S @00C0~00D @00C0`DPq1P P 00S 0a`00@00CS0800S (K'ܤ%''&'''%'d('1 -L M0Spl1P 1000 @@00TQ*0S@ S``Z0 S 040 |U40P@,sUdoPQ0@+40 00E40S@PPP T*0S S``0040 KUP 40xEUP@`@PXZ0S P0(K'( %']= -hPh@LP 0`00ٵ0`0CS0,00S 00'''' 0-LP@^0 @0' -QLMp &`0P 0S !P%*00f `K@PKPP0`SP@@0`S@P K0S0 0-LDM@T X0 p[Yp *Y\ ?Y8 Y  Y \Y# YY T0S 0S0S@0S Z9T0S 0S@0 S RT0S 0S@ 0R@pT0S 0S@0 S @S S?S [S S TBPoQ R 0*SS0 R @@0S0^S!S  00\0Q Q00]SR0d0 0d S T 0CR?o20S0`0 `@ `00P\0 0P0 0Sa Xl [X/0:S,0h0 lt`P h0 cl  f/oc"Q Rh  @K˛l ,0K0h [@K C`P \Փ`P0V0P0 P-\XXP0-S!0]S \SS00P0`h0 \0@KHKH0 D` @ <` +1P\0@KH0 h0HK@0 D` <` 1P0P0\ P0X0P0 0]XPd PR` p@ T0S 0S@0 S@X00S; X00X0 @X@ p(KY0 - LMPp@0?S*SD [S:0^S!S00\0]P5 [P$:P#P]P/P^ P0S/S:P0]S 00:S0 /SS P0P/PS P S@ 0/SR!p@RB0 \ R 0S 0UlK/PfW Q *0 P R000`UX 0U0/S@ 00EPF 0U/00E0S```@0 P Q 0/0 00S &V/00D' ȘP 0. B.S/o" R 00 P V0  Q  (K'/z(' 0QR R/ Q P0 Q0 B0/ -,QL@`TE  0S0@@7[C!0C0S<3o00#0Q:p0000SI P 0000CS0\00S 0X t0S@'@''' 0-,PL@T 0@@@0'A- 0\R RSP0C  p\! \ \0 \0@R  `R =TT ^QpR B 0 0R000# -0L$M %0KD0KPG@` yR0d {{PTpXLp-00D@D`V 00CS0`ťPbP` Kd( - RL$M@@0P*S`p #S $S !ST,7?S @S. -SLP w 777G6@A0SP0U&f00CS00  0000Q00Sk X6d`0S00  0 WS<0V: 000S: 0V S00CS00 ~ 00~0000CS00 0 0 0000 0 0000CS000 0 0S0S 0000 0 00%T00CS00 00004弤 040P4$4V  0< @0 0S00  0080 W00S@4$< 4(0Q: <0 QAQ~k~AQ00 X00 00CS000 00S0S H D 9H D00000 00U# 8"VXĂ @00 0C00CS00~8 8 00~0000C0S A RVt0Sq 8",00CS00 Påf00Pa00C Sr0 0K0 PᏟ0Sf000S=SaU10 \ڈ1 UX0QE1@ WT00 hQ\A@ p1\!TQHAV``000SC 0 S00CS00 ~ 00~0000CS00 0 0 0000 0 0000CS0 00 0 0S0000 0 00(KФ%`('|('%d(&(% %'( -L04M<0  5p08 00`=00 O0%80H0 P@  500 g0  @000S  0@20P0@  0R@@0@%T %  b4 $~ R X@R*R  Q*H R g APTXx 0 R2 Zt$ 00 p0CS00 00CS00D D 000080  XO#04`a0`0000B ⼣L #  XD # cQ2L0<SQ AQ ZPD0Q QAQ~P P ~P P Z80@  0@S20S80@080 0H S\t*D)<)4*4*p)p)p)p) )$rZZ OOoBTI80@00Sn@T= !q00CS00 L0000刡p0 pc<0`040TP  00cpgp g !0pp4T `40 .P2 4`ꌌ@Z 0 040cX" 0 RPRP B\T   R P R0R0S@(Kd(#('ܤ%%\0&'|(' -0LM P40  # ~R )cC0 00 pQQ*=Q Q :Q Qq QE Q Qy Q Q Q"  R R @R0=S  00CS00 w 00w00 4 00CS00 u )k00u00#40S  BR  ~W ~ 0p0CS00åG00 Z!000  T  p  BR ¥8 8 v 0~Ss=Q00Sn 000 n Q 00000CS00 å8 800R =MPN < 0 aAF (K( %d('('ܤ% -1P^0qSP1 | 0tA0p10 0`1`X1LP1 V0  S000`0`0CS00 å000@c@p 60  @ ]  :0p0 0S 0,000%ܤ%''d(Ԥ%''('@0 0-@L 00  aK0h+%ܤ%' -dadAL,M0ck@Qp00CS00:0000``$c@K0cY0$K@K 0 0b 0S03x0$K p +` R"Z 0H0a0 `c`F000`f`(Kܤ%'d(() -4qLM40 0$QR00 08p `0@pQ< <800  P40YP Y 30S  |+0l hd0A0\  *. 0 b0bP0(K'%d('ܤ%%Tt0l(}0 -,cLM$s80 000 040 000BSPBQТQ< u<00040080YpB Y Y`0`pH_ 000 PYUぐIoᩒY00``V:`H0V*q 000 00P< BUW *VQQ*P F``HV: P1FUW * VR R*P  F` PU R``V: g0  a0aHG 0V 00  b b BR\P`  ƥ 0 B0 0(K%'d('ܤ% -PLM8K`+ 0@ 0嘀00p000p00CS00 på00p0c )@8K$Kܤ%''d(Ԥ%' -0AL`p@ )00CS00 _) 0 P U簕P)00CS00 C)|0 0h P U)00CS00 +) 0P%[ -Lv0 -Lp000S  R/ဤ% 000 00C0/(' -@帀0P000` LRp   0 t0U0d0P p T 0 0C `  S0(00S$Kk'%'(('0 00-L@t hQ 00 000P ̪00CS00(00S0K0hꀤ%''((' -$BL M0R rR 00CS0!0q crp 0Sm _(](`0AS20吡000 00/0D%P"0S 0Y #R  D% P   <%P(p b0001 0S  S0  0c00Q 000CS00 0c0CS000R0P0\00S w(H0'P0 (K耤%('ȥ%%(0%ܥ%, 00CS0b 0/(' 0-` `@ 0L P 4  D    000000 000(%(' -L`@t! $T T@0Pڷ!P0`S  00 000,:%(( -8aLM0p0P0$@P K&P(0: S$0 0 Kd$P K`rPx$00 00 k$d+!Tc$L00CS0,00S K'0001 1'0 -` Q LP @ QT0P囓H0D0@0`00CS0(00SKh_''((%' -@0P  PL `!P 90S I0000\ P 0D 000CS0(00SKh&ꀤ%'((''0/ဤ% -4`4@LP0SS U4뀤%(81 0-P@L0S 0耤%( 0-PPL0@0P0ط 0P0耤% 0 R/ሤ% @-nL1 0@\   P@ T` p\@ Q Q Q00 r "@T 0s $PU  0  ' #% -(bL0pS20SPBS p ^ E#p PPPU#p  Q5 8P&|1 F p#0P 0T8#5#2#`#,1PP #p* p/ܖ* oE#0PP #p˖* \p* 00"""p(d(%C(O1%`(1}1 -0LSP@`0p000V Sp 0VW*` t`0S J  PAoQ`00CS0 00SKh'1't0 0- @ PL P @00CS0000S0K0h'' -LTM@p` 0 %ԐY `Y   0\`s   SP@_oRPUP P `Q 00SЀ 0Yp0 J0X838 40bC1, 0W+  |  "W -  "lK%"lK%lKuP l0K"0 % iP rl0K40"$0 lK`"%)l0KL"%#S R"$00?S " P l0K  lK!m%0 l0K1l0KP@ e l0K( PlK%00CS0$0P U $P p0S& 00CS0$0 00CS0$0 | p00Csp0   %P0㓉(ЀH00CS0$0Ѐ p8_$000S@(K '% #1Wk1112%&22 2 -L MPP` 0%SN > P  0@\0S0%S S+S -S 10I10sX ! #0>d1@XJ0S 0S0?S0  00 e00P T:@ PpT0# P  0QJ R R" P 0S ` S@ C# RV7 (KE2%&2 '52U2 -$QL 0Sap0_0@S0А0cC1  .$0X!%$ꔀ00CS00 # 0 $0 R  0 S 'Jx(c2s2 #2 2% -L00p@`P0T l#@00CS 000V#0 0S 0 00Jx(%@0 0-@LT $P0@@d0 'E2 -QL0pS P`VJ0S @00@00S<ZaP0009>@8 L 0 R唂! P000 @4$00SA0Q0C  S0 00S  R@P0000000h000W@00CS0 00S  ''t'( -`!@SLPp@!T\1@WV% L1F0S! U 0S0P !P V 1npH' }V!!U 0S PPd|IP llW H060S ZWTT(0  d((%%10 '0< F R Q  R  P l% -BLMp0 Kp`0S0S P,2, ( P@8 <0  80!TD*0S? 02 @ 0 @ S&*|! V~]  ^Lo \ PSP~  ^Lo \ 0Q R00S R0 @U 04<S 00S  06 R  U R P |0)00<0< 00CS0 H00S  P (K(' 'd(%ܥ%' -L Mp0 J@FP1F0St A]PU @Ip"% -P`@ V! R R RZ R X R   0`@X(K%%1 ' -LP\ P lPPPx0x@60t`S0@P0S 0p 0 0 S{ 1%x(% -lALh- dq0S00 SNS@8Q8a00P`"S* R Q 0p- 00 S0C0@ @ 0P0T0S D@@60S0000P OP 0Sup@ 'Jx(% -xAL`000P0SU0S 41cp=%!0S 1!00cC1  S 0 1#0P@#oP  S P R#P xRS00 ʁ0S00CS0000S h'% 1 ' #'t1 -QL`0@SHx@ P`0U !P Q00CS00  0 d!pP`0U p 0U~$ |?PpP000C00CS0@<00S  'c2s2 2%%1'' -L 00 KhJx( 0-L@ K0h~J 0-|@L 0SP0 R\ PU40 00 0000 '2G-|" 00t2Plrlll  ^ ^"00NP0@S SG =ST $Sh 'Sf "SS \SF^S< S"0!\ $0!Y0! S@$0SS1 .:SV /@0 O@   R  @000C SD1 R 0 0 0#!S0,"0 ,11  }0$)0 !,"0 Q 0a1 }S` :0 P 0  0b\0 ^0 R0 Sq00PЍ((%22222229O p-PcLM@T 0S0ScTd$ddddcddddeu0@:(80S\T  BR @ťPdP@G P@   BR ťPVP@    BR @ťPHP@ T000&p@zo!p@j< @d((00@00c(K脤% ܤ%Ԥ%%d(0 -L@M0P ` R@Z0 Ph h d01 0\ "LKLKT4V0< U$0, 1 0uLK븥%R7j7 777 -LM@8KPZ0C 00PP"`@pWwpPT @T@*DPDP @0 {P8KB KԤ%ܤ% '770 0-0L 0S d0P@U U L0UH0@0<0P ,0P00踥%(J7(p(% 0 -L Kh( 0-@PL00CS00 ӥ\PY P \ 000P00<  P< >  EK0hA0('%%j -LM01 H58 0IK0D! @1 0(1 (50<1 500c41 EP (1S (C84 0 XpUPb>P0 |P00.&P00(T_<P >P &P000L0p0  ,,0 p70,0-P   000P(pB0 0 0 $ 0p30 (K+0 0C00$00g?(P(Py A(4  B"!  B "0pK 0 K}A {X0`0 0Ap (#P'}P |ß尐 }PH    2Ȣ0  AQǥpp0#0H PAQǥpp}Y 0@ Q 0Apm$=0AQ0ǥ0 00Y%X :X #X p Op|/P 0AX p}X pIorpWX0C#!1S p0IS0 0@ppYpZ DY @#NڠR0S0 \00B#000B"1<  B 00! 0@#! p ,긥%%ܤ%Ԥ%d(& $'%('8888##0& 'D8U8 -`L00Spp 0PU0 p 0S 00   B/o"ak00@p$0 00 @0S   $30  $0 0踥%& -4RL0@T  @0S |0@0q < 쁟 4 䑟00CS00 `ӥI`&V* V vV V X V #V S;V, (V6 )V0@4 I\V3 |V D Pp0@000  D&P0@ @0;|P0@ @02&P0 @ ;P0 @ @00@@p P  0 0P400 0  p( $Kk踥%%('' -aL0 pb0 RP: R UUP U)00S%@P  0R!zP@jDAPP @0SͽP @x /0 p U00 0踥%  -AL0`(P P  0S(00 ,@R   RPP  Q   00000S@ R0@0CS0 Kh 踥%w8 -Lh0 000踥% -餁LQMp@$PK0pK0 @%Sta P 0@  $ 400P0 R(@@pR( #U 0X/P"P0 8 `/,pP 00 0< 0b0$08pR00Si( 00 00  40@0$K踥%%8 -tWLM0 ,`K00& P0(00`) 000P񟗠ꜷ̷رвв<HԴop@p P -PW pP0 R     P1  100S 0 00@nPfP ` P0,u0 RP 000@0 0J P$00 R xP4pK< P 0  $ 400p00400000CS00@400 0004    BR   0 P Pp pYW } 00 @40< 0b 0 P n00T30  $ 40000P p0 SxP 000 0 0SM x0p0S00l 44 8 $  80P  0 Q 4008 0 P 0@S8 10  P 000  w00010" $0@000P- aP 41pppPpW@QP0 00S 0000@)00S @000 0 P0(00`t 0000000S T 0S 0@000(K踥%8%% -aA0 LP P0SU xP 000@P  0 p@@@pP 00@ U000 00踥%%8 -L@P P PP` jPP0 000踥% -|AL M0 `P0  PT+H10S I BQ  U#P,V:   P R1wPp R  4 #4 U  W p   000    (K踥% 0 -L P P.0@@3X`P P 000~00S 踥%81 -L_M0x 1 t 1@  0UK|1 xh1EK01 0p1 ;P+<1@AE/K U?Kx!t0a $0S R0 \1 ` 0x h! X d!  ZK00 p1 000!0 0|![ Nl0! p1S l 00CS0 X00S ZD00St1p1 .pK'%%& 9ܤ%'''P 0S// -@L `P/00`P p-L M@$KPM0SP  0`Ft P P $ t`P$i iii i0S 0    l% $Kp- 0/,'RQ%m -sLM0P0 U0000@0CSv@,LL` n@P{Ve v r]`d"d(`2N0S `Vp@0"8 Kp*xPa&xPJ0: S=Xx00@`!`!3@P,4 P P U0S00  P @w  0T+00CS0D410S@ W>%@fU4200S -0 w g0@@w  T  IPw`  \ T $K'%  9'':y9 P-LP@  T w`W  .: -@d`LPpT Q00C0W Pˆ@@,' -`@``0P0L000孈00CS000SKh诿'('\0 -@L`T VPPcPU@(x0 0- R @0DL T  DBPH@dQ0 P 0ĥ%,' -PL0@ S $`PT 'v0S0 Sv0S   ,' 0-PL @9P00  0(P0 0-@LP  R 0K0h(00S  R/( -L@PP Q0" p`U va  X"pU vS  00G:[:{:O -LP`pp@W 0 0P̀Vpp0S    0@ V  T V@ 0S @\ PVT$P  80$Kk%J!+1U:  0-PPL00 @Q @p@ 0  / 6p@  /p@ (p@ !p@,儾P003/@0,': - 0LMPp 0S8K" '*070K0@0 60002` `Uw 2@ T@00CS 0T  P`u|  9@0SM PH0儑000 Sq p#u R R R ` P|u0 00CSP000S ߽A  P   0 00CS0|00S ýT` 8K000 P70[S< <0 60[S( ,0 (K(''=:,''@:%%ܥ%03 -(sL M 3@`P< 4@ 0@ "<pp sP vP T @0T80 `c1 PV/圽0+S -S4K0pK d60K4pKPpL0Q- S: @0 l@0P  000 VQ <08 PUg pP00S ^pPX0TQ0 B@0ST< 4P0p0      r 80 80pt`  P% 5S p{tM tY0  V00 (KH.L.%&:U::!';;A;a; -PQL@pS 00CSQPa10SN R 00CS0|0 p01@00<S0S>S0S  0a@00CS00$ R 00CS0H0 - 8|!; 0-L@LadT800SK0hS 0   0000(4'( 0P-L  C>R, P  %&t';,2 -LM1PS@ @T@@10S( YT%U U U U U 16 R! R@T@@ t16@h1F@T@@@@LpEQ< K1p <0S!FQ6 R 8EUQQ0T T0 T0 T0cp` Y@T0>W<0 80 40 00 Cs002$ K1 pwp <KG$K(d(%(( -PL MP@M`8pP#T@??T T00CS00 A 0 @@T$pP T@` tP 000KT $00CS030S I@@TP2oP@pPEU@ ppoPVPEU@RW 8c@P1ST(N@n TD@P@UT <r@P1bS 0ST.@N Td$@P@UT D@1QS 0S D,1@@ToWqPm`0-S0S`U 000 "] PP%  o1P P 4 {P P@U4 h1 `000 Y7 ZP 0P?UW䐟 PqB V  `P lUa E00CS0H00S j0`(KMg;% O'(';2;;;XH%&ܥ%b< -@pL`@PP 0S 0V00*` T D`@00CS0$00S &PU@(''<0 -P@ L BR`@bV00( -lPL0 0@SH0 @ @@`P`p 4 p4'((' 0@P R //4' 0-<@LL0PS0LP04' -LM K4P `0C/K CK4P ,0/K $0P R '( 0-TLP'@!P0 e?T00! 0-`0`P  PL @ q00000CS0000S0K0hp'ȥ%' -Lp@P`U PP`Up` Vep0S  Q0-L@0 Q0P0 aP1Ա01ı00 0001 s-L@0000101* RP 000 0000CS0t00S sPP `00 0 00f000C0$('' 0-L@P0S 00CS00  U 00T0K0hȥ%0ȥ%0ȥ% -L M@KⳬP孁K|< --L M  K -$0-LM  Kȥ% -p- LM0 0 , P@`0K2K4 QK,00CS,0 0KS00 0 P1[@00DKp -L@'` P$ 0S! xi0S00CS0/0 " h00CS0 0 " 0S jpW PpP 00CS00p ' P'YF 'Y0 0CS00 U 0CS00 00CS00 \ 00CS00W P PU LPP 00CS00 U 00CS00 ' 00T$Kk<!ȥ%0Mȥ% 0-@LwK0hsȥ% -LP`p p@?o0S 0 -0 L0R,0`P0=00=@ @hiT pppG0S=S0@0C@0 S0ץ0ťPb0P0S@ťZ@ $Kk.\ܤ%d(Ԥ% -L M0 8@80 00b00 0 0K'(< 0-LApT  @ R0'SO`QU  0S 0S   3/00 `P@'TP( 0-0LS@K0hagP4jUt'5PPXK0hM'S@IP@0S d?0;<?5<< -P pP xP nP3V0p0@@U@T'`U`V!@PV 4100SW100S@ W00S00 W@p0 Z! = P   P 0V0 @0U00 V  2=x(= -LM` Kp@P@30  R@, PR000 00S 0000   | 0 |@@DT@ 00S K'l(' -`pL@T, P0U0 c _|I0 R R   0 02/0 F|00 0000>|(%% -`LPFP fP eP`PvPP xP`P0P0Pp@pGP X a@U T@=x( P-L KhP 3 l#= -L M0p00P0-S` @TQ tb@ F (K@P=P   8(0 @0 0 0)0 00 P 00000 00=S   PPPt0T 00=S`0   B P0@ `00CS0,00S K'%%('(' 0-L@PT z@0 0-LP@d圲NP@TuPxP@ IP@,P0 P W0C=U=x(00c/ 00S0`/ p-L M`i0 K0X@Pi0S0 i0"ST0Q P\ 0@0 0 00V0S >Kp0&== -LMM@QK5P K.PA?K KSRd0SP0K -LMM@QKP K PA?K&KQPd0SP0K 0-LMQOKPP KP*KQP)KQPK0 -L@PP13@ 0PC `|VA {Ppp`qPJ! 0RAtz -LM0-S0S" 0S0 0x00S`0`0 0S40@0 0,e(0P K"X##=" 0P-@L0PP 0S0P `V P 0S0)S 0S%P00S P00'' 0-hPLW0 R@   0$P0C0  000' -"PLM@$0.P %PT0  &P 0  @&P PP0Sv Rs P T T Ts[o TKkP} P*Pv@DTK (8P`pK  P  P  P  P  P  P $KR0*@@;T0TB 0S 0S 0P0 0@T嶘`pV0pn00CSc ,,,,0\TdZdNdKdPD`pWV9`pWV.`pP0`pP0`pV0  V00K'=> 0-lPL0 R@   d0#P0C0   [PT00' 0-@LP;dPPE|5dP l尯U`P008g Q?o2 P 00P">>'$> -L Mp P `YP 4 KPc[VP`P`@P *P% CP lbU 00Vʈ@~P UT00@\0 Xq@P@@ <@hhU b(K"ht@ J -L壯0J>>ܥ%40 -,ML0 00 @9'ܥ%`> -L M K@` 00SaPp0 WV DKШ> -L M`P<&VG@F0-So0-SN S; NlS sS, I0S@FPPT.2 000& P@@@T,p P h`X2)0S`@V`( ,cPP! >PP0Vc0S p`/PP 1 000 oPP Bp @DT PlbP@T J0%S`P.$ٮ: 0K>`000S`Pq0 WV ?SP0   s000 P00 ᵮ0 QP `p`勮UU@T DJ0&>T%?(4?QG? 0-L@M0   0@@DPU =P "q @0TK)TK x8 pp4 hh0`0` PT(, LL$ (@ K0('.? %<6?2=?@2 0-@L00S| 00t 0l0l 0   PU D@D D0 < <0P 0wvP0('(((%%ȥ%%%ܥ% 0-Lt0@@fd0 \0@X0PU@CA4 @0PB0SK0h'Ф%(%(P/ 0-L@PT 000@0 -LaL@PT0   SDTTTTTTHTT,THH`` @Kh .`00  `00 @h* 0\0/ -@PL`g 0P  SY  TTTTT88TTll00  V00,  0 000 00 <   0 0 0000h* 0-LM@P 0$K$0 0 0 0$T K0 0 $0P00 rK0 -LMP` @KU 00000p]P@P KP000/ P/00S 0/uP/u 000/' 0P00/'0 0T'@ܥ% -LM@PbTp`@` 7T0T-*"TY 'TW TM\TR aT@O FrT @K fT @G nT @D eT:@@vT @= xT! tT1 @7Rh0 `\@-0 KS #0K0 " K$K $@K!0K  $0K00c`@0$PKS $0K0 # K K "0K@ e`R$70 @K/@'J@ -(qLM@P`P@ \P@; 0cR  0< 05 0R@ "! "7Q $0A^@MR 0-S@5/^S0 ^R@0?S0 KD@[5/K0&' -Lpk^@@T@ѫ@8P`D _N`j00@00h@' -p开LPP0@ TP  T`  P000CS00  0@00CS00  0P'% 0- LR@ Q@<~vb"P0F t0 0~@@'x p-L M0@T 00YbP KP `VOKp'@ p-L M0PU 00 'R"R@@ 1b K@\`@ Kp' -hWL,M0\'@` 0gpD70@cT!g1D0 0<0 0D0P@U \U 0K_6@00CS00 +6 00 [ %U %R@ |600CS00 P6 0Py8]PD0*S`\` Q0p.S 0*RpMp@@@0Z80 嬪`808 0dZH0 00 GZ BZ EZ 3bZy XZoZ gZiZ &uZ xZ sZ  tTP r]nP T' \^0\I \  \" \ \b9  \ \v3 "\0  \ \e* '\' \\% a"f nrt M pp\?0 \@-0ǕDž8s00NjP@ XP sr\pPXp mr <@\pp5nPp\ x`8 0 0vs00 t p0 c0 t 0 X Sp \BX0@ P0Ph40 R 00v td0 ~^twWn v t  hH 0cCt 0\<Xq0Q 0 'R"R00,% 0`00KM0  0 0v t  .t &#c80H [@ P0   0L80< Q RC  @0(K'J%&%@F@0&'@AI] -pLM0$PKp %` 0 D@P 0 (@PA 0 pW( PuY <Y]PP0' 0ES4K sP Ut Ð400S00H pFt^YPH0?S0 -S00H0,$K AADFfFlFtFFF 0-xPML0@0 0 XQ 0D0  P&P! K0hANGyGG -LM`0 :;P0 $ 0$K 0)00( K pcW\P(0000S^  L@PY 0SV =PiiW lW@\P(0 0 (Q+$x\P(00 q\P( K(0$0oWc\P(00 \\P( K(0(00S PQI\P00CS( KH0( 0 0S$KGG(BGAgGzG0K00M00P0D0 0C0D080;800,0/(08 S<0,00,<008 8 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@( R 8 ", 8 <  < D ,-D  , /[ -0MLd00$ 8 K 0-@L40000 0-@L4ޡ0000 -8L M(0@S000  KM0,0K`t -L@`P &pqGP[`8q<q@qD, 8PUqUq\}q`0,0; 0-@L4唡8ž0,00 0-@L4刡8ⶾ0,00&o -8L⾾ Khdꗐ(0 S0-L@ K0hC8❾@0<<@00,00 -0LM K"P0 KtG -LP!nt G -LPot G p-LM0`@K0P-S00(0(0@0 @  0| 0P 0( RT  0 0S40,9rj03/KpH&,BGDF -LPp`@Q ZP 000  ``-VPpQ ZP 0-V0 000 0- PL@0@P ,0T 80$P< D0TP$ <0<P04C(DDE 0-(@L0PS J00P0( Q-0L$  BR t M0- X  S^00?0 S0^@0000 ((lF -l@LP`U PIXHP8B0? :0(e2 -LM`p@~PyU  , $ TP<  XP PW PU  PjT 8 T8T t8 TT8T 48}T 8tT 7kT 7bT@ 7@YT  7 PT  t7 GT00?5{S 00 6T0'S.TZ 6Z%TY 6YTX 6XTW 6W PT <@‐p RS DR0 T0S TZ 6ZTY 5YT<S <STX 5XT;S ;SplT:S :SHDTW 05WT0S 0ST 4T 4T 4{P8T0pPS X S`\hTXLHaTW 44WXTU U NTU 3UETU 3U<PT;SS.< S S  S  Sp hd`3 T*9vXRS R0 T0STZ 2ZTY 2YTX 2XTW |2WTU \2UT`@K 0CD4 zD 0P L$ H4 ~H4L$PpbGqr Yp0: 0 0 P  ip@4SD$ i@42 9RP@ (DtW@4x00S D HP@40 AP@40 l:P@40@4  D Yi@8 RP,pDYW 0SWS 0 00 eP@4\0 ;i@ pD   OP @4xS S:Ƒ0#i0:D4pS<4KC>K 0C D4 QP DH D QPD0 $ Q P000D P@4S +H0  Q P 000D P@4L0  Q P 000DP@4X0 ` Q P 000DP@4P0 $ wQ P 000DP@4T0 u gQP  bQP 0 00DP@4\0 _ QQP  6 00DP@46 NX @Q P 50D0P@46 > 0Q P 50D0P@46x . Q P \50D0P@46h  Q P 000DuP@4p0X h Q P000DeP@4t0H D4 $ papG0S0S 40W: %hW0 h K@ 2D$$4RH4  K@Մ3DH$ ZP4 (  1YX D 8g@X40S 4T4 0\4 T4 RL$ ' d4 Od4  QP L-d4PT$P4 a2B! LOD 0S  0D4 0S/D4 -T4 \40S\4  1X4D  430000@4  \$000 P Xg@@4S gg0@4 P4@$2 P4r0 Se S S) SESC S S K@ P4H$pD4(ST P|  K@D4 S@ J O K@D4 S > K@D4H$qS5 P]  K@D4S@ + yO K@D4S  K@D4H$S P?  K@ՃD$1R@ ZO2 K@ȃD4H$S)@'Tp(K(ZTF,OSZiii/ZEZ(OZgZ (vZf(0i(ZZZZZZZ[ [[$[/[ZC[^[~[(SO0&[[0 -LPaV|pPU _@P0\f!!0U<0 ``UcO[X940 0-SL KhLR000%! 1-SLP@ 1SIP KhJP1S AP P𨝨+ 1d`S1S1S\ @P 0P ((JedAE\rdA'\ p-1AL MP 00 0:f1`S 3 1S PQ0S Q0S0 0 1S  KtPxqt0tP-1S P PaP@j KpWEV(fdV\mdg\0%,[(gdx\ 0-@ LP f/JK0h( 0 90% (md0S 0 0:/ -0-L MP 峻P ᨔP 0S S@@ TiP@K0+& 0-8@LQ  $y @`K0hq8%lbsb -@MLMx0QAKp p @P4[SS CS cS sS 000屍K (Mbb -l@MLM\0QAKT T @P 4[nS yS0 00卍K (.qHbb 0-lLM@AK@PpP4[0YS DP (@PiK0cc#c 0 *(+& -DLMM@AK0 @EPAK A<K1c: 0-0@PL =0 K0h+&*(*( -LYM M@Z.K BEp\(p5< S AK@@ P4[0YSp5<0KrdAEc^cc -LMP`p@(j`86b #Kc -LMp` $QQz (K<(0W@Pp TQ6 GQ. Q CQ `MQ! SQ KQZkQ cQ gQ QsQ tQ mQK +8 0% 1 1 0 00 0 0 @(P 0 00SP@ 8 0MKp0 0``DK`p! $K@ (ccH0`  BR` pR RX X/+&+& -L M@P\`P @pW 9KpT@ @0 @H)PEL0Fp00 00W  1x40 u U40K0S00 40 40 p(Ko`I]^+& - fMLM@pۋ&0BKS0!@po P! BK@WLPP PU BKAiPP BK@XPBKA\cPBK0 @@pB PBK Aኯ 6B>K0CPCBK(@p- P BK @}P BKA(48B>K0CPCBK( @fp P BK h@cP BKAX(4(0B>K0CPCBK, 4@Lp P BK @IP BKA(4,0B>K0CPCBK0 @2p P BK @/P BKA(400B>K0CPCBK8 t@p P BK 0@P BKA8(480B>K0CPCBK4 @p P BK @ P BKA(440B>K0CPCBK< @p P BK `@ P BKAXz(4<0B>K0CPCBK$L@pw P BK @ P BKA`(44B>K0CPCBK$@p] P BK @ P BKAF(44B>K0CPCBK$@pC P BK (@ P BKAP,(44B>K0CPCBKP ,@|p) P BK @y P BKA(4P0B>K0CPCBKT @bp P BK X@_ P BKA(4T0$KXQd*(+&dj+d@dVdiddddde eEedeeeeef1fQfqfffff g -ML M@<@ 1K0 @!p PT `V 5I K @bEP0S K@, A3/ P+<[S,<[`S,,\[`P8a`EV0K8ġ  @E0TsS01K` @ @p P K$ @wJ`pP0 K @D< D<P0R"0SK AaP< +8[S%,8[`S",8[`P2a0C" 20< S:LK AEBKx% AB.KK B  @plx5K0 AP0X0<0PK AxBK|% A{B.KK B @qpI P" <0x%K b A00 QPK AH 0R0x5< 0R 0K A|K  @&P 0 000S pP0`(V R s  R 0 0p0 0`PK AP(K+g>g8%XQIgj`g|ggggh/h>h*(+& (Vh00CS0 S0 S0 / -LP@ R1!0 0 UX0 OX0 IX0 lC b( X, L0 @8 44 (< $$$$P T  `p0 3R`V*\ XPp pWpKhD<i4Rniiiiiiiiijj/j>jQjZjjjyjjjjjqq -销LM@Y`pR S: 8 R7 ,Z4  YH  H  H MH0p"@Kv8  AH,  H  H 4H0 "@lK]l0K0a 0K00a 0 R1!`  0 S& S S S" 0| S S S 0H 0, !8Q0 G <0P+8cHQ* 08@G @0<0P+8IHQ *P 9(Kjjj4RkkJk(k9kLk^kfkskһ -LP`p(H@@8T 0@Kh>;ykk`8 8#4`#/ -PL@` "44 0"440 XC TC((,,004488<$"44$4"444<D$4"4$44"4$44"4$44"44DPPT TXlXQl `V(4"4(84"48h0 `R@P }0 0004!49 ( 0-L@j40Pjf/B080WEV X P-L PP4!!00Q KhWEV (@0 00-SL@ ;f/B080*(* RP0// -L@LD0 <44 R 0 |EȦ%kH,&l@0@?o2 P0p-SL M`P @FP  FP0 FP0 FP0 0 V`FP 08 0 D@ K@np0 (KpU 7l.(ud p- QL M KT@p  0   0  0`P    0    0  h 0  P 0  8Kp.(td@'l4lKlclJ"lllll#m p-@LTM( `PDKIl Kp  ( DKHV V l KlY DK AD KPp <80l K(EKp.(}d(@Qm`~d(cmum1 - L(M 1@`pP !Zp eP qP @p0VP4P 0P  4P 0` (4 K$p ,(0Q 000V4XPP QTW T0 , R|0|0,0T *00*X *  @P$KH.%&m.(|dmmmyJ2?mm -MLMP @LEP=JK}=K,@D,0CmK?,`F}=? T*K B/p h _FW !!F K,A !K$A :K$0C (PpG  :K,0C |?/0??SPhEP 0C<p (RYE@PR=K,0CCp> :K,0C/* R "u}-K, B/}-/OOO=K*K,0C,0C, B0:K,0C `pH2 l:K,0C` (G `F@ @V (-U(pP:K,0C/?SWP 0\ ` 0PxL~0ap  PTA  4`*K B400;0*K4$ B0!R0(00:K$0C p?0 QP0 + ,  P7:K$0C `Kp,0$A @(K.(wd0ncnxd Tn qinonnH,&nnnn o!ouL|b+& -PLM@ R0K 6?P P0K -?P0 TNG K :600S p`@G0"SV0Q PV00G K 300S P"G0 "RslHP `P K\eKL p0 <K0) K3o[oooooo.(yd p 0-PLM@ lP Khp T0K KK0 80K00$K$ K#KK0.(zd@%p6pDp 0-PLMP 0@ K,up4xK0.(d@gp 0-PLM@ PXCP HCP 00 K"(Np xK0H.q.(wd -PL M@ P 0DCP 00 ,0 K(,pweKp.(vd -PLM@ X K=>P 0d(0 K$ pwKp.({dЀ -鴐LMp`@RQ [CP @ p?h@\0P; p 4803/$KkZȦ%p.( -LM(0  WlqH,& -L$MPQ0`pD0 @0 <0 80 40 00 WDPKG DK=D@K p0 SP4  p 00Z:U㤠@X 4RLY 400 0@00TPU,P4W(KD1r 0R// -pLR0 `? PeA  `TX@d 20CV20CT0 ,Koy2(yyty p-L MP`ND K Ľ0S@ 00S>D0"S1Ds@Kp -L M@?0 0 0 0kJH,&}y -萟LM0P~@?`! dp0 00;0 QP   R0$Kk0L  0P  @D`,f< $K舧%{2( -P`p00LPp@pY!14X S P "  S R 0(X+|U2(!| 0-QLMP@/K`ppP%)\ K<0 2 P \ 9C !SR Kt0PL02S 0S "0  ` KU|+_|x|2(| 0-<@L0PST(  C010 \(2( -DL\M#K$0X0 30P T0 X0S8 2b0K dK0$K3P$K>K#K ?`px ?}>dK$KKv>dK#K $Km>&KP##KP ! R"d'P0P ~ 0 R00 $R0 S 2000#1-R0Q 0KT10PP;P00 S`A 0@Pm 5(;%1 ?$K@  2"(|"0 0 >|" 0ᑂ 02 <12 2X 2XP0P 0P000 0 S >0T 25 X000P 00S 0  0<8   l?P  X?P (K2(|%||4(+&bT0&]=}}7}H[} -HRL Mp`Q0P0   .4 00 4 V000 XLJ h $-,A0U !XU !#$sO(@#$(, "!"",!{JpsO@s _:0 2 `c`b &$)4a!ڑ&(1&l)8)!a1ݑ00 0     0 4  0<     0@000(K \(_}2( -p-@L M  ˫00CS0P0 Pl` Pp 00CS0D}0 p$p Y@oKp+&g}b -ALM~[P?`!0ep K090 QP%  R(KoAꀐ O0P#K80 QP PE,9 &0P (K舧%m}2( -鈡L0 M00  0pP 2S0 KXPL卹K 0CCP ` PP``V BK @P,<x(K$](z(0](; -L 0KMcw0P  00 ,!K   KX0a(g$0 0-SL 3/ a( 0-L40 ,@ 0  C%4@0a( 0-L4@4%1%4@0 -`pLM @`PP 06/0 P 0S l000Ka( -ML M 9 6 6 ) P||H#9@ X9q Y0S PP 93/0P9 K  @`PK ArST 09 09 0B.K9 ; BpP` .K B|pnK` `Ft/X50@p0V C pfp0 4PU  +P0S PY0$P P04P0P0t4P000 `V 1P`YH`]p4 1  .9`000ppk9g YMC 9PS3@ ) 9S9 `PU  `V ` P PP@TV ZBK @p 2`V+ 0Q+ `9S B0S P"2 R@bT  Q 0T@< hG,4p#tp) @ 08 0 ,$$0SSR  R 0 000  p0 S   W0 00L1  @@909 DDD00 0R0C06 U B { Xy  Su0 PUP 0S 0S TPe 9  Z_T 009  "[8="[<@004 000(04 0QP 0 bK H,U P7[O  5KO P 4 ` 0R  `eVPX`V9 p0G, 0 ##;;`h)XX$ $ R,0T ,0T0T0 R,`,D02P1Y0Y 0L0 L0S y s&a `\`d,\\0ZX 0h00dpl0(K1Kg.RRaArrAaѡ<`ܢ -MML00 PP0@`d'00 0QP &AK+ Aᨻ Pp<0P#$42K3"K#(#<12K@02"K#$02K/"K#(#<."K-2K0 00<'00 0QP 4 AK Al PK艡ѡ -L ML @0 S !0!0% Rl00l0 rp00p0R P0R030# r0S P rL00<0L 0 ,bP00K=?O -LM`X0 00 PpA<00P   ''00 0&YX L X@ X0  X 0P(K蒣 -L@,M80 p@l@00K`P PPR<PL 0-@ |.00 LR08S6\3̌ P\`p @P \ \ \\ \F Ÿ P\p\ \ \\\ @' 0Ÿ P p    P@@ L0!S s @0PPp0PP0PPH1L R0 r 4 8 <2 0 0P @pP0W:% 42 0 @:#: 0 0 P0 R@* 00 P @0j?80 d?8 00(Kģ-DWP p 0 p// /f_? -L MpP@`P0Vs*  Qk  A r0J< s* r z  z q  |b xPH0O p0 @P 8P6 $P 6 0p =  P( s p0 + P P0 0p tP 0 0 D 0 00`P@(Kj.Τ>[o֥00@-S0PS *BPR020 -LpP|`o@P   TfP 0 R R 0PR*"09 -L MPp` R*$0S 0 sS00 Pࠓࠃ P#^(0@R  0 PP0U`*"U XBTD q DSU tCQA TS0000  b 0 x+U  0P 0 f 0P ZP  T*2YPEBPT 9 P(KTЦ9 -LMpX0@`9PP. ,0Wl0L  0R0000 0 r  0000Ÿ5Rp rppH 00K/ $P=v0 $ = L2 P p$ ^llB B BRB02#BP0Q:*^ll0#40 pWllp PQ "* 0Pll B0#20B`p 0Y* X0p##  K0 ##KSR D`  շX'=(K蒣A -L@pP`P0V&*$0V  0S 0S,0( TI0  P0 S$P  >P`p00S7 <q` l Q $P l0`<0@qV P0Q*l0S 2Sp h hTPP 0 S*Q@00 PU.§p@-\P@\#3Pࠣ^ ^`V `V?L@pb( -\aLM@P01p0< 80 TBP0T*0T0S1 080  `0D#  K0 "#KSR   U08 X 04:#K "#KSR L   U0T <0B(Ka( -0P刀 L@/p%0S` `W&0`S 9#p@@P@T0T ? C Ca(f(b(0PK7 %/a( -LM@ppT de Řo0l l0 @0YP 5VT W Ka( -LaM@ 1Tt ` d! h1  SP0h!R*@0Ppx1 A 1 p1 l1 |A `1D0 0S`1`!`  X0b!" `!`1``h!0` B"`aK0㐂,a?K t !a?K SR xt> t?V0V`2D>唑 e`F1S(100  RRR0(1h1| 1 C 2 5P( (1 0(1=` 5 c h!t |!0c0d!1PM h1!ST=|1 5S H=H-HH  S 4:I@,P(10(1(1 0I0@0@|! |1  0Sl0 @!  x!?o2r0p!Sl10 ,pl1 \)0Px1 l1 pp1 h1l1 0x!QS UpWl1p1  Pph1 Pp1 1S11 ( 0C1 + 0!"0, K01"  0! / P 0!(P 0! !\!;R: Ul1pp1 0pP0 4R \ Uph1p1 0pPHK/VK( 0VK<  0S , K0br \0S:\ 0L![R L!K UW00 U PpqlqS WP 0 000p0d!`ts@ R, K . B 0,K !A !A 0!A !AVK0p  Q C@ W 0 3 0P0x!R Ul1pp1 0pP 04`!80 L r ,(080  0W4 8 <40 V?K, (000x1 0UX T1 5 Wl1h1  VK! 1 NP h1! 01 0p1d!0`0t@0W h!lR8 0Y07 5 SY I40S80`"ǵb `^ P@ Sw P`@-P@TjᘰPeV0KA SR000 PTU00> `KAPH 0#/P>.K B@nP"0S4`K0!@pK @ˮ@P#Y K@PPK^K PE EDP?P (P 3X% P@(P 3U Tᰮ(K FF F@`8 8#4`#/ "44 0-0"44 04"40 @4"40LPe? $0 ($( XXddhhllpptt0 "44 0-0"44P0L@ "???DD?@@?HH ?LLPPTTX|X\y` \`ap` p] K0hW 0-"!LP@T `@0 0-@LP>>>>0 - @PL@A`@R->C>->?n}C4X1X\.\+9>>9>:>C>:>CF>?>CC>>C>mG>F>E~EnF>G> XJXQ}m  $$((,S>,e>S>Ga>F^>HHLLPPTTXX\\ -PL@P` !"44!1"44 1 $$((, ,00V\%1R L5sP pЀ08# #4\0Xp ,t mTiT`XeX\a\`^`d[dhXhplTlpQptNtxKx=0Z B`?<p p$5R3 \%l0Rp `R# P5P@ R TU `8 8#4`#/; P 8#8B@ / p-MLM@R0 ANK4 @D8 PK0C Z 0apH8 hZ@ tcZ< X@6P 00" ZE K 0 1,%0?; 0 1,%0/ * pp[>K0C t >K0C CK9>K0CY@`PP `$5P 9.K B0  P 6Y ! 0 ( !R)  & 88 ;>K 0C 00 8Z >K0C  ₑ''H400Ȅ>K0CЁ >K0C ( ((300hh(؀K0A >K0C K 0 A P30P 8 X080 Z8% @L0  >K0Ch0Svܢ K00 >K 0CY0Sf Kw08 ^2(000  S* Td@" 00 0 20SЁ؀P 8 >K 0CX00 8S  850@%0L  >K0C0S( 9CKp)10S Y5P 0 0 0 L1"]K0 PE0 $? <8@('< p<0A>K0C  Q !8100PPTP!8( 0(00`Ph@h08 >K 0C780 (Ks(|(r(xq(%аr(s( -L`p6P@*8P0S $80S @!WVP P80S @ 8P0S!WVP -Lp`@ba 00@$Kk -ML MH@Q J(#02bPE?  00 ş 0' 1,%0"R 04``04 apP "0 RH20S+ 0$02`P04VUn8.8#4n4#04 0 0P 0 00" RP0]`00q뀑PUP B~K pG P 0S<10S%4[&$[&4K%$K@p03/P. 10S 00S0S%4[&$[&4K%$K0$ p00h44 44 *0a80S t0 0 P"R0(Kr(xq(r(r( s(r(8s(q( -LAM@P`p'' ߭@ 0BK(7UTp0 UTt@3P n<0<B.K  P,'BK 'K$(s(< -LM0 K -LXMpP`GX @tKq0,0KT0fKp0 0P &K@0 RpCR( t>tK$ 4K(s(QC-P@P@S`RQP#WV\C(s( -L$M` p)| QPK 0 0肟4 B$? 0 :2  B(Q"( P[80 QSQ0<30<4p24Z0 K<20SP (04  0RA <0  <0@@ 4 T* <0  <0@ 800S0<0U#KSR  6 0 A50S 50S KT 0#KqK`p `$pK550K050S K5 V5000L I E40(Kxq(r(% s(r(s( -(vL@GMK MP A K@ fX T"GK I:4 $5 Rc&0S 0S0 0  000SpVtVl2P =K 0C 0 =K 0Cr50000 0x5H0@4 0<4K54 0S4 p4S8 tKA4   O&0S L000 0 P6 Ta2P6HP ($0000S" U IK A SR @ MI>K 0Ch 0 0S ث0  0T3 0`C<om  P4 <%82P6 `L0 00O0 H   00<4K24 G>K 0C`4 K@4005Hb40S \p%pT2p}L2B>K 0C0 00BKpH0H J W  0 00  g #000 S0pP:%Tq400C04 S> \q  4$000 1 0p p I4000 E 0 %K A0 QP 0M 00S p(Kr(s(<#2t(%X]<Ts([fЪs((s(ܱ  -LMpP`HX@1p`W |10S p10S 00 03 Pp<$Kk^`pH`W@  SR1H R 0  P$P gު0S!00S W 㒪y$0S 3T0S @g *$Kk\0P P0 W$K@q(r(q(.t(%<4BYo{s(`8 8#4`#/ 0-XP@0L85 0 0 00 200 @00xq(00S 4 / s( 00S/ s( 00S/i4 s(P000 R0-SL$M@P2P0`BPP0̢080KR C `pS Q 0C0 0 0\7`p ?#Kt82\P 0 !?' ? #KT 00 ԄK>1P 0 !?' ?R 0^10SX 1< P 0 !?'K0 D 0,1\%<R 0 ?!, ?  0ة.,R )\# PKR 0cK`Rp ?K 0 X 0ᰩ00 0@00 0ᨩ(Ks(xq(r(TͲQ P-L@P1 QP 0"ȡq UP3Qx ?UPL:`1\%R ?O Ÿ 1! G00ß?,.0̟.  ?/x ?*` 0 ഐ0S   0 10x` Ɵ 0 1!&0 \00SD0`0x ? (s(+k(xq(Ts(s(0 -L$M@ CK@P@KQPCKUT|L"x3 #KK#KSR:\3P3@L3\%PR ? b1!pK ?&0lp?. 0`p ?KRx ?` m0d ft2KL`Q\2\2``T2T2#K ? `$K/,20Sl 2@T* p40@ chp ZD3BW PL|Dr2DDn2Dk2X040 c240S40c,1T0T(uH10SK 0C0L(t`S<(8<!!0 K N8 8( !=K0C>K 0C P g0Q3P0`S 3 Rp W凑i0p0 0D3*.R  3R<20t0V14" t Z+" R por   ppW"KP8 ڥK.P8Pl"p P" R p 02-Yt10S  10 0 P L8SH83/!=K0C L+F 000TD(@H0 R0C?o20S7 L1 @ CK.CK0,+Pp'?00SP [!=K0C  P0S O!=K0C  P0G#O0 000>K!K 0CA  P0!KA 0p00p(K2xq(|q(s(r(,ys(5Cs( -RMLM0 S000#4@Y`pb : S  P|T0(?V0`4<V 000R00SQ Y !0 h0S Y RnK `F,F RnK `F F 0弓0 `B? @ < 8 S>K 0C SK R0 A R~K0 pG0S08%  L T  080 00HS S>K0C10 0<%@50bS.K B1$P)85SX2"00  CK-CK+P#M0S00 gd<@N00\TX 03/q` V`80 00SC0` 0Pß0<5 0<%SS>K0C 1C0 01CdP $< 0a4 BH X000R00S) 0  CK-CK**P0S@ P P |M`0 0t 7#bp<5X0S<5 (Ks(xq(s(s(s(5C@ -@L!pWP`#R 0# D   0-@@LPU DP P$0 QP00(s(@0@- A0SR#R 0#0000 0- @PL0UT0 1 UT0KP@00S 0Sp[P0SpQ̣Cǣ00S x忣0SB 0X嶣0S(34K0h誣b(s(s(ks($jsr(Ms| -LM@`pWP  1!  P <0p`W 0S L)P 0pK `RpH0`S 0 0 P0L /X00SLL, 8,00Khv<r(s(s(s(q(p( 0-LMP@ h @ ,0AS dalaxaaa000 vK0袴P5 -L,MD @ 00K 0#KU`+0S:K+0`S #K 0#K KQP:4K QP$ 0P ?4 倁0H0 0p@0 K?@SR':@00 S 0SP`P$@0!0A0 S!702:0S H0 3K0 `P+`3#0S\Q   00 0*0\ 00S@30 S S 20S 3S $0S ?+0 00KS0\P _?PM0 " 00C 0 |RRL3r0*0C0P2_,02p0S pD0P Pz W W  Wn0000000108P00A*K 1Y@$ I-00N D0 0X04K⋇K10T P  $-|P(( D0 kd4Kh4n00T  Ph ^h| @P@h080SGvp<00(Kr((s(xq(r(ȴTr(0q( s(U 8s(q(s(s(r( -RL|M2 @?K\%2R 0 h ?! `p ? )0 `2吠 0XS0 S S 0 +$2 R #R )@X K10 (K'KpW`pW8 tW4 XdK  < K Rpp, pK+*00<0[S 0 0 408 K- `RpT`3  0KR0\ 嵟? 0 " 00 0 @PL3@@0*00x0+0S ,P P)0 P(Kxq(r(Tr(0q( s(U Ъs(q(p(s(8s(q( -騂L$M#K2@PYpUP``00U<0 00 Y  K0H0 iK$K R0 Kd P0`pH0U A9 `/0 (Z0U< 0 #K V0cK#K#KR0#K< R0#K80< 2"X0 ap$KU2 A 0 (萟P@#K0S`p 0K! 0K$K0 K 0K#K00000 (X@H000 000 $K(Kxq(s(7 -cL4MP@UУUpK 0KP KD0  P0D04KxpP0K0040KS K눁'4 "0pp 0` $K X0܄K$K$KR 0*$KL R 0$KH0L `2"V0 ᒁ %K32K000t20S \KYV<MhU 1 J0!0>P4KPP 1K00041K0S K/1 4$0琡3 'P00A4KpPv P1K0 0040KSK 0( 0X0 !K\ X0\ 0 0000PK 0`V$K" $K 0S 0K 0 40p00H000 'PWe0h0 #K0(Ks(xq(R -L޽ 卟W믵H,& p-L@ M P` Ky 0T 0S 0 Kp! -6FMLM 0US OP 50S 0S 50S 0S 0SlB 0SXB0SD<50S 0S$y~0A.B.K B8C ?!$0KA0 4 4 [0(=Ѐ?(`"?``pp 0 0Pd!(d0(" 0 >K0C |0Sn 33  0 R03 0 0b0ST P ,?Q4'X``p0L 8  ??)$KL@ß@`0P V0P2@P@0 0(B0S "@T  ؝B0S @T |  ɝ`2@@1\R@X2a@0S pt4BC~*m2(20S 0 0A0葟S1  (0q,0X01P 0000S 0S tvp1 0S+0 PR@g0S 0bP >K 0CC~P( 00>K 0C 0C(OP 0SDq(K@q(r(xq(8Odr(q(ʶ -Rr(qr(s(r((s(s( 4p(;hs(s(8s(q( s(s(r(s(ok(Ơz(X -|@L`Ph00S 0S Pp P0S $Kh+r(r(ظ -L$M!`#KH0S#K R0SR KP+ #K x"tŸ  R0 TP20S DsF Pc,2($#P {2  0'!q 0CK@0 @0< 00dSeZ-/ 01!. 1R#K0 #K R0#KK 0 0#K04 S2@  0 40 . DP & @j  R0 0 S@0 Q UT  UT#@P (Kk(͹r(s(s(s(r(r(00S 4 / s(00S`8 8#4`#/ s( 00S/Q& s( -kLM,M8K<0CP=8K<0C@.%p(K@ BW:08K40C: S?W ` 8p-P $'P 0 ( P XP8K40C 0!0 8K<0C  "P 8K<0Cj0S, `%|: 00(K< B`:\ʟW0S> 0?/0 R0K4ASR :0K0 4A? R00K4A QPK4A0Q!P00*  R00S 90S 8K40C t !p9* 0XiS R#X !P8K<0C 8p0W@4 <90)408K40C88Q00K0 4A`B`?_P0`p x80S 8K40C`x n  Z`p8K@0C0 S70S5480S1 8K40C  R0S:R)h0S& 70S 8K40C008K40C  8K<0C <8K<0C8K40C @(,70Sh0 0!Q87(^ K4A?QP:47Q ;P8K40C00R00S ^/60S !0 'h0S$t60S8K40C   0anq 0"ao#q V0 `F 0Vt`F!.0 `p V0051 Y)P t p   (  R0 50S  P 0S`  巚AS` 0 ᭚ < VpP0t p?41CA 5 0ᑚP    R0pWX  40S Pp qZ P d  0 @PoP 3<8i P $z8K<0C 4 8K@0C0 S008K40C 00008K<0C #0008K@0C0#600SX30S p3P P 8K<0C{@ pt 128K<0C RpRLtRPXd00H0X084 <0$1# 0S zhn QP# 8K<0C, 10S -CP1X 8K<0C 0S@ U8HhH0SE  0 #K<A P0L )&98K<0C lC00P8K<0C00S, 0 1(0d 0K,I0 0" o P! 8K40C 0Wh0Sm S(Ks(r(hr(p(q(*q(p(s(k(xq(r(Kr(Z s(ir(s(! s(:p(s(TDq(r(l7 -dWLM`pP70, VT<'\ET .  ᖑ)Ο\K/ T ,  . 0/  00!. 1R R 0" (KP0`p4E.0A@B ş` ?T0/  00!. 1R R  0@"P X K@<5< 0 0 ,@ 50, T6  K4$0\Q   . P %P hT0`0 0 040 040S(40 S S 3  3S0S3x000ß0S 30,p`dz0p 嗘0030S3 30S/ tS0S 3S X0S\0/ X1>00   sRXX K 0`piKX`YX10 2!0` 000 Q0%!YX  0c0P0 \  r00iKWV Kv)K`p V0YX1a`pa10)K 0SR00Y X03SG00#,0WV`3p3: `VL1 0 `0$1 00%YX# !"WV  0-  0P"YX* e0 0  0(K@ 0(Kh0 (Kr(s(xq(T,yr(s(r(0q( s(s(q(H,&r(q(U ջr(k((|q( -LM! `p@ #KV. KPP@U KQP 0  #K 000UT00S P 0R #K`F 0#K(Kl(s(`8 8#4`#/ -鄁LlMX K0<0Kd1p0 \1 T1` 0,0VI8A0S ,0,P d0P 100@ P 0g R)UT@P%P 0GK0Q pR Q8 tR 4  R K  `p(Kxq(r(l(q(UH,&s( s( 0000c/00S 4 / s(00S`8 8#4`#/ s( 00S/j  s( 9-ML M`PV@@L9 9X P 9 QP!*;00#00`XSD9 $ L=PD9QP )C GP90Sj 0Sg (100\(*0~KS0 pG69K,059K< 0Sx80S69[5)[59K6)K5i[0``S` @ P ,8 0괐 dVP ᴐ]f S S#Q 00C0^  <LP#R0g哞K I30,S069K059K< a0S60S69[5)[59K6)K59[000D9 #0&   pD90P!8c H9 H a00C0 000S H9 bH9pP0SZ 0SW %e00jP5pKaP 0XH9 ?P l50 T D9S 050  0"0 4b0 0D) 0-P 4 #P  00C0Y cP.\V0P@$ .P 0$PPP3P 0# _ß0`SP 3`Ł 0n`V PQQ `㔓DßP3<0S40000P 3 #R0D9SO 0S30Sc `0 lP` L90SH9 D D90D9  Pc0pD9 0CSmDd<<#R0i02`0 02 uP1[ \aC!0# #R0  CKW0 K @N>K0C!CK X10S p=LEP`. #R0 š!ɡ0S  0R %KA 100 00&P|0  00C0D W V00 (Ks(r((s(r(/s(м s(ܼ9Q^ͽ޽r(q(z~/9DS -MLM0ASE(h P 7 ^ P 7 00QP$  7Pđt? \P`P     70S ^0000Ff]K6 圏 PEX 0D5K65 0R~K1 pG5 0GE 5 5S60S %0@0cC 0 @LH塓8&00@(0S S$$ &? (@P<0S( AE?  B; ! CK!50S00( 0 C.K p5 R d5 f<5(@  5 i50S( $P 4 J0S( e,l4Y(0S@090GS, 0 R1 #(  Qవࣵ R04 04 04 S@090G7,0( S1 #` R S),)-*-3 RpHQRNKp @D 0D5 5S(0S ,<3`# X( R@ ) D,  0!S!X 0!!R@ ) D, 0 `!S X@ ,< @05S=(0S "QP r  0"0!P Ÿ5P00!T00C0X#P 00000C0!" x!5@PQT*p0S`U @0 !SR 00@(K!0 !!PY@ ,K< 7l! !!os(Ѿr(<0 #K 1R0R(3< 00S(t 30 R ԃKYX H0 "H0S^2 <0T0<0l) |2 KR`? 0<0 0 ?w<0P0K P0  00#K0< "  RH0S 0 104 $ b? P0L  80RT $0A0$0 @D L3@0  #K 0#K@00C@0 [TW" 0 80R0ˈ00 L 0 LL3D 0   ? ` i0 s@*1x0L00S P P @o P(Kxq(r(Tr(0q( s(U տs(r(r(8s(q(`8 8#4`#/ -LlMX K2p 0 0,0WB0S 0,P`d0P ̏000@10 _l2 00XUT`902GK (2R pQ R8  QptQ4  R4  XdQ 00<0K00ASN갲|P|\0`V y(P P10S?  0< yP 10S2  0-K)0Q$ UT 0 02   R0 0  000S | K< 0d*@PmpK4 (Kxq(Ъq(H,&r(s( s(r( Jp(.r~ -0STX0S,$5SN\? R I0S 0$5@@? *(??0S TP0 0X0S$$YYYѹ S0B` B^"$51 B Q1- 00\  $=@0T\0 T0!0P%X0 \ B 00B(K/B10\0K 00B1!L00`  $5d SBh̟0\h h   1l0h ` Q" B Q1d0d =K `AT0 -R!Lq QT00c(K!.B KA/A (K/B3A?0(K =z/B0@T0  90(Kz/B08Kz?C@0(K.B0(K>G}/B08K}?C.c; 0K}LTHRK}LX0S8K(K,0C>C{/B08K{?C@ C= CKuA 88Ku?CЀ Xa0(8Kw?C8KKw?CuL ЀX0&8K>C0KuLЀ/ 08K!u?C.Ѐ X0X  0(8Ku?C K 0uL 0HK ,@D(K>D/B0(K0/B08Ku?C0(Kw/B0(Ku/B,0 RLy0S 8Ku?C0, d}8Ku?C |x 0嘍00\%d9RKAKuL?,8Ku?C0(K␃8Ky?C8K>C0.B008Kw?C00KAKuA ?!8Ku?C!08Ky?C8Ky?C  ᰈ h? P0xS80 S S 80S 88 R #R 8Kw?Cw0S 0 0|70S 8 0S0SG 7p7(K0y/B0\%\7R8K>C 0KuL<,KuA咁 0(Kw/B0 K L KuN .KuAß 0d 3h000KyA  0\&\QKL KuN .KuA咁 KwAK NxKuGp'KuApŸ uh00 0\0DS 8Kw?Cx 0lh 50S P530S 8K}?C0BPO44PG4(K,5y/B00p4p4\%R8K>C 0KuL<,KuA咁 0(Kw/B0 K L KuN .KuAß 0d h000KyA  Al3C8Ku?C0(K.B 2"8Ku?C KyA 8K>C0(K0.B0= CKA 8Ky?C K 0A KAЀX0K 0A 2X=S((0(K08Kw?C0y/B 08K?C0 Xpbp(K,0w/B 0CR01 =S坩@010t0$5S8p00$00(0 SW0(0,0SWpp00pSR0X ,p00x x0Rx x0 4 1RT8Kz?C T \1R\8KA>A0B308K?C K 0A P[0008Kz?C0S? dV2 RT0T00! !2 PRPX0ԀY!d4먠8K?C 30 8K?C 8K?C !(K/B0 # 000$5S.`0lW3S  10CB!>A>A0B30P$ $$Q`W@BA0cAQB00\4 0(Ky/B80p($5S'l0h 0 pp\p0S $S00p WS $S0$0(KKDy/ByA0!K0(K/BA0 K 0(K/BA0! L 0 8Ku?C0  pBP; 60S  0K08K?C0wA 00x08K?C00008Ky?C0 '8K?CP6  v6*6!60S 30 060S 8K>C PT7 RT TRT8Kz?CT P" 8K?CxP7 8K>C R7 wRT TRT8Kz?C TB0 0480S 4p 0 R\ /  R\ /   p(K/B Rʔp 0(K!.B W28 R\gK!yA    Q\QKA08K?C 8K(Kw?Cy/B 0T ##+8K(K?C/B0 X R` /  R` /   pK!yA    Q\QKA08K?C 8K(Kw?Cy/B 0@ ##8K(K?C/B0 X R\8K C˅K{AK{ALK{A ؇8K}?CiP;m 8K{?C@ +000K<*:;<0S 0 0PPET< R 0S t Y|  PQ0 -0$ŕ0 B QB\`0 P30B0Q@%L  0 `P =` = *㠐<=|H=0S 0 0(K -Lp`@T*4TP$OPU @*/ -AL0 5 qP 3S53r`1 0- 0S 0S 1% 1U3 Px10a]0 Pa*D1810S -0 0PU03&0 PR 0S W0 P0@ 5*< 5Z000S 0 0@TPU$Kkxq(r(%cK4s(8s(q( s({0/l(0/l(0/l( 4@--LM  t AƄH,& -L@rq0 R 剆P0S 0`V~`  ]T)hsWH0 @R )0S 0@ `㉄l(Ms8q(b --LM  K --LM  K --LM  K --LM  R -qLM^K M HP@HP喀P^BK! AUK` Ip,0KT@B^K PEP PT5: S HSR00 0`P KAfP4: S%`& S00S BK  @⾞P ` PWP``V BK @OP,<x(Kl(z(l(; -L 0KMc0P  00 ,8!K  1 KXp(g$0 0-SL 3/ q( 0-LY0 ,@^~ 0  M@0k( 0-LE@ ;@0Q- 0PP0 0RR00PP0 00`RR\0\ X0XRTT 0 0000TTTs( s(r(|q(0q(T P0-L@0,00S UK0hr(Ms0 0-00@0 0P 00L22=p 000=000X0X0<0<0@0@0\0\0SH3H3L3u/L3P3P3T3T3G Ch K0h0 0-00@0 0P 00L22=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3  EEP  4K44K44h 4 5 5d0d00000P5P5H5H5 @ A H5h H5S>S>K0hY 0\\L5SPPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\5\S//s(l4 -LM@T80 LTLt% HTH ?#K:0#K @Pl0\~P ? c:0K 0 P ؀0 YX0\^Pc0S |30Stp30S d㋨\3\#0ST P#SH P(8?4S0S (E0rS C*0S 2@؂\hp2 h/o W" ڸ [@TR00 4<, 04 K0 000 d04? KQ:0800SOY, 0A   ? A ?pX 0S0S Z렁q0h |10S 1KP h10S\ Py,(1@41hpppIT* 0R a@Apz 0S *l 00S L0 0 0 00@@ (Kr(@s(8s(Dq(0q(r($s(s(&?U s(txq(Ts(Pq(0s(r(q(Lq(' ?-_MLM@@00?KA`p$}0X PT L坂}D0S {,?48 Pn@ 剂s7: S )Pg>^0Sd 0(000S l> > >|?  <8  g8  c ,(  ]<8@ X8,(QT@@R  =8 P R,(  )P.48 MR4r>K 0C0>K0C mp8* .00#Pd>0S! @{08P0S=0S @T zP  cg<0S@T4e>K 0C0>K0C -p 5[S , ZKx @P ZK @P Z.K BD oZ0  ܇X  8840S  Y  pW R KV. @<8 <8 0(5 `  R 0S<0 x;( RS?K`CI ?+'0p5 QÃ0, ,Qp5 0Bp5@0p5 T0I t5 SK 0 AG ? ` hP= L`p`5,h V&00`*S$ #0p5,(t%$,ß 5(%ߩ1`pP `5,(R 9)0909 09T: pJ)0\PpQ=S00 5Pp ) 0SW80 S4 @S * 5< 588]988 90S X9H9 p :0S 0ʀH9 0 Sp W 70S\8\(QPh 0<b04ȟ-B ,K(0  NBt 8 ``b( ᖎ.` pp`(  w.K B gR+' R'=S$0S 0(zPO |0 <<00X3P%0*d7c p70S u0 00S: 70S60=S20S xpJP ؆000> p 0L%000X30P%,hv *% x60S 70 00 <0S P5E5 %0 5*o5 50S 0 000S0,PT5dE00*Pd5 p50S 0 00<cQkP4D 0<0*14 40S 0 0pD0Sd0L%r/ Qڨ0Q)N0 0S (0S ,t*44 @40S P#0 0 00S00L%r, 0QQ&P0 0S (0S \C*d3c p30S u\P$#0 0 00H00q( 2 000cH00S \(0S B*25 20S G.Pl"0 0 00L40q(  2 400cL00S i(0S A*t1 20S PP!0 0 0L2 R@<1 A QP* ( 2.K0 BS>0S \'0S Hr*g@2420S  P"0 0 00S0(5 xS<S+ 0(0 S<0x0(50S d''0S s*2330S PT#0 0 0H= CSR* L30H  ? A0S 4&0S s*330S P$$0 0 0L= SR* 40L  ? 0S &0S t*4]40S oXVP$0 0 045 H   ? @L  ? h50S;h50S70,5S30S -P %0 00.K BЀH 0,5S>u <0(5? @L  ? *v6 50S ,&0 0 00SPd60SL0L5sH0S P &0000L50P5?T5V>X50 -@0@0$BQB!^` S20B 0Q@%  0L @G00*"T7H70S |'0 0 07 PR 70SG*770S 0h 088P@hPpL< @XI0 8@hT@E. Bd LS@P 40MP Y  [P8lz80S  C 80E Ad @ $ 0490S  +0p0088@O@P!.1/@Pd@)P < ,@)P 2 ) Q@_ UT @,*@4* <*H*P\*UPppt  @:P u:@@X0 5: p :0S 6[S gK @P:  :KPҙQ' $[@ 8  0P@@ 04 8  R L*$0S (0000  0P000 40 0P" L> R #0S @0000  0 DP 0 40#40l? x?Q?+ ?, O0S 1  az Q 5<+ Q 003p0S p !0B8#80WP @zP@U00`*t0PVdX 00H @04 0 R  (Kr(aq(r(r(r(0 0-S!4!: SL  S  S  S S  S  S $0Py s(r(1 0-SL` lh@ yT L10S@10S0y/(10ST10S y5Ppy00CS0嗵@0 @ T 00CS0刵 P 0  |0@YT0 0 SNT JyYTr($s(r(s(+&<+&@q( -pH0L0@S` .y 0|Pwr(T1 -L M@@<1@810 eP 1p @p p@X`P 0P  @p p@PP r P(0 AP0>0 PUp00 TU `W \ @ZPP 0 `0@(Ks(s(xq(.r(s(`s( -L,M#K10 40_##4 pB< DK@ 8 0@0 $K  ?W #Kpi 8u@Xx`D#K8!PG?$K8 0 1< ?1 P08 0`080 V,PUR 004<, 04 ?  0$K޿#K ?T$Kxѿ#K ?0x@ Lx(Ks(JOr(}4 -LMP`p4@?#.&#K00000 #K  :?X0  !  0axPX#K  ? $?P ጿ ?8Mx0P (Kox(Ks(s(G4 -L M 0pS@J PU 1i U 0` ``0 0T0؀p0@T)0 LS0@gT@SP   80E Ad ౠ@ `0q0S  0`00p(Ks(J8s(xq( s(r(0 -LM0@d 剠x P000 QP`p P0D D000P 0`PKxq(Dv(r(Hv(Dq( -0PLM@`pT d T SR @0 @T\ 0  00P00@@000$Kxq(`s( -L\M`p@X tKtKeKT@ KШ0 0-L@S0H0S `XT00S H @]P000000r(  -D`D@0L P(00S Khxq(r( s(0 /q( -0L `SRp* 0\`X00@_ 0@0 0အޱ1S0(s(/xq(r( % -LdM`SR00WV00S@ ` \Q 0S  BR4 EX K0 Y0Y 0X4*0-00S ?0 00Sr00S 0P0`d0: 0t2 0n$Kk nr(s(r(Dq(8s(Lq(r(r(s(xq(s(q( s(s(r(`s(s(s(ybr(Hv(Dv() -LMP:300 8Z4ʸ3 j@R_3CKCK?Q0% R pW00A10CB>A>A0BT3@ T 0SPP10CB>AQ>A0BU3@   @ɻ\%2RP%  0  ?$b@  ?000 h2<` 0`bS0 S S 00 <0 (2 R #R  000儒 0S10CB>A>A0B310S`0S10CB>A>A0B3 Z0\? 0 0080LZ240 00C0 NR 0 N40` P0\"0C00$0A0j$0 @ @R P0 @40P 0j 00@*ix00S P0 P<0 P(Kxq(s(s(Tr(r(0q( s(U տr(8s(q(0 -`L`QpU 0X PR @P8  G10Ar(I<0 0 1Q01/ Q0  /r(h00@- 5< ÒP0\ 9>@UT :. BSR0000xq(^F -LMp` QP"K> P; P60P2 Ѐ0S 0S  BK @P 0 @ @P0 0S 0S T0 jBK @P@ @@P 0 $Kr(p(r(Q`8 8#4`#/ -РLM80@10000 040 08T!0P@aqP8U4W 80 dtP80`pP(K谯h`0 -LS""""@o01S00 003B!000!00e0` -LQ#t#`#P#o0 !B1  2 P" a0` -LQ,$$##BB;0` -LQ$$$$BB -L M$5 ESp`AlhXP1 RS0C>>03 RS0C>>030$u0p00 00 `S0!Z ABAABV0BS  gL!`j  BB.A.A B^`"Q a00WpRh L AVh(K -LMpRP` Җ@P X㆖qOK&.KH wPpP#   "lppm0S Vv< 0 (08 0,0 000040 004 04$0D0(0`+0 p | p d X LVB  8 kp<  kp 2 Kkp) 㺎8pPaGS!4"":: #6)01X\X rx%0*|%0 0* *B*00` p(Kd@edA.7HTfzzd@ -LCM M@`B.Kp@; B`pP E>K @0C3@iTL$T4 P4,  K -LM~KM pGP`@(^ jPt=^ : S*/0P+  rR( K0d @L#@RpK@#(N UKKAP kPNP@ SN Po00 KVA ` n jPt=: S ^KPE>`"pG `^ P@ Swji P`@-biP@TjjPeV0KA SR000 biPTU00> `KAPH 0#~P>.K B@jP 0S4>i`K0!@oK @i@P#Y K@PPj^K PE EjPjP (P 9X% P@(P /U ljTh(K FF F@00S 4 / s(00S`8 8#4`#/ s( -p1L M0`00 14 00@_ 0ᕪ 0ᎪP 000@T` 0~A  P00@BAQ1ABS=d@l000 R#X000R )00``p00S d\{PT0 %4 0%(Kq(xq(p(r(r(s( 00S/@ s( -送L$MP@ `D0 @K#K0I 0K0 ?P00P 00K0@#K>000P000S 70K0 0p?^pD00p#KPPp8 000@(KQxq(q(r(r(2r(!s( 00- L @.  PQ 0S 0# 9> 00# 0S0PTIP\i:> C0(0xq(^Fr('CXR/ -L Mp  @PP` 0@P0 00`@U `&`p!D P(K -LM@P `x Y0 &08#8#48#8Y`Tp`\` p!0be ?$K :F^^F: -@LP`     -`@PL ((X0Uc(#("$c4"X0@-a 0SRAQPSR QP"P00@-P40@00 P UT00 -L M 8X`0 0 K pP\0 @p@pdPX   "PAg ђ   P "@P 0T0@P@(Knԯ1 0 -3ASL l0l lla@^ P@ dP S0l@P@PT0@P@nd  -L@P40Ua00P 80SX0X X0C800S   0P80S0 彼  ,0 S0-L@0\00  P,0,0080S $0$ $$囼0K0hp(  ,0 S0-L@ ,0, ,,兼TP K0h  -LlMh Xp`P (88S80P P4PE2PE1PESPE50  00 0Mi X0#03?aᨋ^U@E` +PPOX5Q P3iOPGT 0 XR P(00,0H0$,%KL! 0@(0#p$K# `$K0 $$K0 4$%KdK0I`Pp 0Cd40  %Kl $K $Kh,0800RXSS` ,4,$,,`V:0 0!0V#`F%K0 34`c`0 ,0KacL0 #KKQP #K,L0` `PP,`3QT 0Q 0CQ0p ?'K0U 0R3 d0 0$KD d0S5'KԄK#K%K 0P YX2"%K!%K!4000!R 80080L  Z$K 0Pp 02pK0UT0XZ$K 0P 80S1մ!մX0C800S   0uPp 0܃KPpS T#KP$PP cTP0S P+TPU !tQPP T!k0PPPh 4 K#KKQP0 ^OPU :^Ph0@ (P(Kp(,LBAWf0A NBAWT f  -LM0,0@S0 徺`p40W00QU ! #K40K L`P  v`PP p (Kx"  -Pp0U,0LS`@d0d d ᴅQ L0@ HH{ 0P@eT< 7=  -LMp0PS,0S`@0  ᅅQ 0t ||L 0P`@epT ! "K,0K P $KM 7O X0 p-P@L M0P ` 000 g` Kpp(r(MX0 p-P@L M0P ` 000 f` Kpp(Dq(~0 -LQP P plP e(P`@0P T   T0,! f@$s(Lv(p( 0-0@LP0,0S )000Lv( -4LMP ,\  > KLv( 0-L@Pp00Sh00XdS`8 8#4`#0@006.4 Q= SR00s( s(xq(2 0-LM0S S2+, R0 ELn `Q#  uPd 5B< 50d3*˾h2^\20S p82 @GaQ Q7.Bp#@x3%FP A 5*< 50d30a3圾1/10S A0 00@  Ŝ  0TP D P 1 d3S5 S'aQ Q-S+ P @0d3a3*U000S `0 @ dp8Pd Hv0K0r(p(xq(8s(q( s(1Lv(Mo -0LMP @-K,K,K`0 K0 0 x#;p lP tP bP K' K K 0K KK p2 PV Kn0P K0V,K` `-K0 QPK -Kܐ.K؀,K/KP P0Y HjY Pp PI} p:P Wvn p+P PP0U:P0U .KR0 $$0Ka.K /K `Pt 0 .K /K `PD%D Kb  0 R0X" $ 8np. . KpI  0 R0X" $ 8Up 0Kx KJ h  0K D (Kv(%&[% - 0LPp@`P U  P# # # # $Kk} -0LkMP@`1 1 1 1 $:p LP AP0cP iPiKgKK pP40T D @4: S 0kK mK@  K^p 1Ss%K$ĕmK %KkK C>C !$0K@P ᤁ堑aP  P 0 \ 0V1 L 0/S 0(#(fKi P01 aV  $pP1p']`P!&veK^p I?K SnR n?!  n/\$1P !d \DM=\"+1S1@ 0PS( 1!p`VT 0S60S3  X R" p$`G0p 0$ p T 69 p*Y XY00W00S ` m0e/K$8eK fPmK QPkK SRl dT (K%&,%zd@ "ELf  -PL,M,K@p`P*," a9p PP APfP pP ` _pP00S000 10W V``0Kj P V00``N\ P2 0 0 e 0 pp 0`P ,q ?o #K00 0 ` 0p p`#KP 0 QP p U`p``(KS%&D%YoU -LPp` !8p@ fT rT`00W $Kk  XPop! X $$ ep@p `&W``V@ $$ Rp@$o%&\% -L =ov( -@PL`pP 4܀d `bT  HHb 8wU ,$ Khyb KhMsH,& -LM `R0@%P (KѽP0( 0S 0SS0S  `q'` BS0S $KrP"K KL., P 00#01"$#/A-@@T ^@pPU8*`>6 X ?7 ^`QS%  Q ^*!S?]%] P\S!ልPᨍ !à? ?P0 0A-Lq@@0P U ^ R0@ೀ000 ^@ 0 ^@ + ^@ @ ($^! ?P ^C%TPU*`$@N`0`p0k&k00U\ 0UP20:P @P0@P -L MP$d/@P i0p'0 0WV N ZP(K -LM$$ b@r'@P 0WV  YP404$K --L M 0 K --LM0@0 {a 0K -P-L M 4 ` 7 n` KMs -MLP`px@P1  嚧P X 4S  0\P0T$   $PP 0Sx 4S $r X0P4 Se $`Sڠ1WV!` WV000 0  @ 0yP WV$ jP WVp 4T`嗦&P pP0W:" 0 R04S 0 K" KJ" `7P 00 =;(Kx|FjB> -`C$$00 009`E؀E$T0  P0`p 0$4S `P 0 0$p 0p 00 0p  V0pp W$Kd@d@(D -L M4@  KDXp 4u4 YWKd@m 0-LPP@p P@ T 4PS 904 0$ - @P0TLP p'` `X!p@0 p@@>T$$  Q R "( / 0T 00 /$4 0T0 / $4 0T0 / -LM`P@p P&V|P` 0 `PP00000]V* 1 00P0\D0P]`U 1 040$]P(KJlvH,&1 C-$$L0AP p-@LM `RPX$KބP <"KR 0 oKpL. -L|M!PR0_o`@R(0S 00S"R0oU ZP 00 PUN 0SIpWF (0SWBP0 QP:P0 QP2pG,00SP m0 K$8K0P գP 9/p  9/p 40 P(K -LM"K0S@ $p 0K0 "Kt 00 00T0 0$K: -pL M 0 0PI+`Z 0  4 00 aP 004 0S P ~`<-+@ 0 (KL.Un -0PL`@0 0>\@T -逐L` pPp@ 0  00 <0P8 nz jz@TJ -LMPQ@#K`  00!P P0U  0E,< < P  !KcK`pKp #KԃKc 0p   (K p-L M0`SPL@ KJ 00oSP KpL. -L iR sR aR +Bup` 0-LP@0P $0hP00L.+ -@LT`P,00yPL.< bR0-0L LR aR -sR tR iR'(0Sڔc!0000p`0B @P ,00@0NL.` -LM@ \$Kp`l P0$0K00Z$0[S $KZ ZKШJyb -QLM@` QB^pA^ Pp $P t00 0 ` 0P $ (KU|+ -L,M@#K P <P 0 0 p`0  V0#K$<08S,\P p`yQ `p`p#K 00b V`Rp0STy Rp`WV4p `V 0phpi $EPPa 0000 P` 0vP~P4 Pᗿ80\0 048 !#K"4  0"#K R0#K R0# p2 Ĕ$ $&7##, RP P0T0P0Y*p 뀀p Z(#Kp 4 0 000`#K"P| 4$$  A 4  !4 "4 $40(K!?Y~x|0 0-LM0@S 0C^ E$Y$$0E 0P  @t Y"d#\80T K KDYP<YK0%&t%=Qdv0$ 8 -؁LLMP`p8 dKh 崑100 !/p N fR lRDhKCh0SOd IP T Y@P @r?A TPh h0 !\Y @0 [ T p Δp0h @@h vP@h^|0T ὔdKp h0S d VX dKHLhA(KL.+&O7L<%&% -L`p(@PP 0`@00 0 0$0 0-@PL0$0S K0h  -L,M PDT `#K 0X@4  RK D@``#K #K SR00WV00S0 S US 4 0  0 0P 00$0S SU    S!!!U111 WP  nPPK 0 00Y$0 X#K 0@S0P#KTP #KcK 0WV 0@S0PP KP`p` 0 X00>P ``K 0`؀p#K` X0 00P0@SP5( 8(K8G0. -L0M@"KT0% 0K90 K 01 "K(0!0(0  0&0  0  0!00Xg Pb R#K0]"K0 "KcKR0X"K R0T0 0K0 K 01!$0KRK"K#K `0 #K V0R0,#K V0pR0`$ 0T0 0ȿ0  0`!p`00 00K0#K` 0 $K -LMԀ@P `pEJJTq0S 0 `p  `p0`00SP^ 0w 1,(0V ( 0 DR ` p``V l#KQP2#Kb L0  0  E`9!p؀V 0&T` Q  X0P  TP@7  R0 ,X0)T Q V 0P kP  V0 0 0000SP`(K(IcP/0S//P/0S/C-Đ܁\ @`pR\    0V0RT -L(M@P@`phP8 `( <KUP 0 4K} -\PLtT@3 H0@P@@@V88 0w@TSTTgH,&f R-L R R R R(@ R0-0L@P R +:R R0R R 0R R 000000S8 10 @,uU$0  00_dv(d - LM0PPl0!S R ^(`pP *0S 0R0`p4S 0$$$0˽q`K8V4*4S ڠ0S1 @U0  :/p 8 H00($Ӿ0P 0  KR 0" 0 R0"@`(KWEV_dv( -L4M,pK0@P`0'< 8 "_+p fP APpP sP0<0 080 Zp20U tWP0PKkP 0 4P 0pH0 $KF0 QPD 4 PH0ro0Vᰀ0L0 0P0 4S0V S100  R!@qT1   VR R- R R <0S@1810P 0P80S P18 H0 0"P0L P(  R00%EpW`p p H0o_P@ $K zpPP@(K%&%_v(6R -QLM@ Q A^PĀ` A^P尀` zpp  xP d\P5pP <Q0 (iP K+U| -L@`/pP; V VBn 4Аp An ` 4崐p -P" $$ ]0 P ! " $pP 4 0 P+U| -LM@`p")pP rU 20V $KkI`pPt   $R 4S{4SPN R ЂYX 6r CS P 4S 4  V0p1P 0S PP`J  0S  07p 0 0 0  0Pa`$,п ?o  0PO00 0  0 \"p`LK@Y`$K7%&%&=poU p-LKK3Kβ3[H0 4[3K0L0 L0[40K0 @P P [3 K< K S0sS 0lS'@0㓤) <K X0 EX0P p2@T긐@㚔( <K/P p-0[x $0.0[ 0/0[000[010[020[0P0 0L00H00T000L@T(K -LDMPp<@K 0S ፹60 000 00 00 00 0 0 000000 0Cy P40[ R 0S pP0㓥&@0 Ƕ@0PPU (K -,@L`P0 LPU@ -8@L@$P`U Kh -LM4` @ 0440 00 ,0 (0 'EppP4K* pE P R0PUzEwE2[4K:#:92K,0[@0<<,0K K;2H -7wLAMP` 1 l'j"p@ oT0 1 @70U 4spP $ P mP @T{ 00CStTxP P  P  MP 0KKs_ 0US@ a`P K?K P 87P U Pz -Pu U Pp #Pk U Pf Pa U P\ PW U PR PM U PH `PC U P> <P9 U P4 P/ U P* P% U P P U{ P P q P XvP PP  `PV PUP $80KK  P P P- P P  P 7P Ps P0,1 $$ 01#UX*`Pe ,  P` d#0KK PT X"0K|K PH L PA EP<  =P4  P0 4P+ m0G/K$8 1[S  P ,1P0,1 GK P P P   P@  9K?K KK 0 PSRX0 P& @|@P  刴P$ 4 KPP ! X1U   P Q =(KOL.%&%*7FOZguH }kL+& -0[0LM@`p+_ p FP iPP:0V fC>`C$|P XsPnP Xt 00L\:PE0P0 D @P4 w$$0rPPP P (0|PXP -$  4 έQ|P ,KPP 6 0 P0-K00 0 0/K-K R0.K R0.KP 0P0  P K⇐P )P, P K`sPP  `Pp P} \p` Pu .KR0K00V 0S  $HPP 00 QP K0Y0$$$B$4P$,<, 0խ0 QP0T` H$$B$4P`0V3`P /P &j%P P0#80  `Pr P ZpP SrP JlP CTP <P 5 Py .Pr 'Pk  pPc q?P[ r1S K R00-[r? á/[ ೲ ñs?s? PPA <P: s +%?  0`%0 QP$$WA$4P pP0Ks$4@ Kྭ`PR KqPlK>P bP  3P VxRP K\JP KBP K:P 0K$ 80P s0S* 4&$t0 `妬0 QPw$ @Pp$`,<, 0፬0 QP^$ @W$ e \/80 0!-K8" 0".K\#0K  0$0P00T0 X$$0`P0 QP!$$@$4P-K! 0".K`$$`,<, 0-0 QP $$`@$4P`(KOL.%&%&4Vv(qH k*7FOZguU}(Lhx| -LRM`pt K⾳0K 1 1 1 1 0 0 0 0! 0 0.K0 0! 0 0-K0 |0! 0 t0 .KNK @P 0  A @ P 啳 ᑳ.KKi@8iD!iP -LM@ $K| $KF `8 8#4`#K 0-LM@ PKg KX K-p@ @k K4PAp(k0K0\'ih 1p-ML M`1V0``SP` B.KH0x1P h!hBKHBK\FPG 0`0?o@ TB 04 dP= @0 0B.K00`0P BK#BKiFtsbF0 0B.K00`t0pP d dBKBKdMF 0 T K'^KDCF@4>FKp|(|(Jx+ p-L MDPP k KP  k  @`T  P  00S]V  E@ JKpr&0 R !W -LM@D Ppp`# P#j 吪 匪P m@ P f/ KP /0[ShQ @ G@pxodpP LpL0P D/ K Ph08 00<0 /[0 80 0<0 @. KDp! "[ R R RY    Y ZjX (ud0PW LJjW 0eHQ L 40R !<0S @ h?P@ `?p&01S l 80S @@@ `?pd p0S 3/p\ \J 8 X?p\ <A(K\C?7M -L`@PPU pP 6 P*@BPT | -LM KP K0 -LMPp K@P00p`P KQ KV K4E?p *[0  Ki 0-L@p K0h0 -LP`pPq0P@j?00#  d -LP`pPQ0P@:J?00 é d -0LM KP/00 Kю -LBM M@BK  @ӰB.K Bp/ $R, 700AK? @XANK@D0S $D᛬@$700AK? H @XANK@D0S ( Dᄬ@KiTx/ 04 8 Kh3@? p-L$M@`P 8K8 K,bKRK-p@@%Kpil -DL M K@P(0( $I [Kw2M -DL M K@rP(0( $0 [K 2Y 0-LMP ":@P|% P^KPE+9P<t%8[S8[S1iS9K0 -\L M K@P@0@ @@![Ipp$dK:2eA -\L M K@P@0@ M<Ȓ![ Op dK2o -LMM@KXK @=,PE0(K7E B0LlP7EjP4}d7U(K B00'S`@ 0Kp`c( 0R p@PT@'V 8K0C@(K 0 B0:(K0: B0: 0:0:0:0 :d?(@K !0!@ f8  `?L0CS 0     @$@ :\) 0C\L@⭨!9\  0  /9G0CQ% 9\LL␨N L@  0l^00R 9E90Ip0c0C0P0 S0@B0A/0 8P|(K B0p` 8K0C>!0(K@"0 B08K0C0S.0$hS; S :SK 0Ss *S[ 2S S] 0S  K0 p@8Kp0C > R 'S`>뀇`p0dV0h' 0\>X0S 0 <8>@`pX>4>0S P0  Be> a>p`0S X>pW|0$( ,Rl4E>0S 0L=>d  ,5>0 `d6p(K BW0 R8K0CpG !>5q1(K B 0I05pZ  $( P% %P% ||şPx% K@0@=8K0CJ,0(K B `aBV1q1=k R9 #S2 S. S* (S% # S! S !S "S 'S %S  )S 5:S Sx t  (K0 B 0K cA @ X=(K B 0P0c(K B00'S(ʻW43 ̀\0S{ S{=0S 0$s=ol= 0 `"dhKF8&hA Y (K B 0X8K0CI R=2(K B08K0C0!pGdhKF(@KA  0H&h0pY  $( P" p"P " hŸP" K@0=8K0CpI0KA!0KA1A0S҅1؇$=0SX  <S<0SM <먁`p   0"  0l!l <pW`_0S-  8((Kii# $w(w(|("(;J1UNE8XbiPty j\,'B7LT|ndsPPx 0-`LM KPEp@@! 9[,QaF@K0i p-L M`P$ Kp@@P0 O$@Pl3aG PD P LP$ 8#atKp2xx -L,M@( <KⲨ< K0p $0 K6i( -4L0SMR ; KJ2? p-LM0(0 $0 0 ( K`|6p (@PP`|( K$@ P k6pl (0$ @R$0 $0bTT ;0;@ ;9xi )Bh p-L M@`PP  Kp `~9 -L MpPy00 `ᤵPPt 0 `pTi`@8 KD(@ $` P Ip(f`᷹K i - L -LM K@P|0| ||Y Ktp *KR[  r0*K )K8 Kp`K2.ii -`LM K@PD0D @(0 K40 p K2i  -`LM K@PD0D DD0 K80 p$h K2i 0-L@8  P,0, ,,(1 `0# 0-LM KP@p` `_X PH08 DD1[<80 `K0# 0-LM KP@ph h_1[Tz_L P<0( 4厍$ `K0 -L$M@ 0K 00 K( 0 ; pX_Ki p-L$M`P@|P < K` S 0@0舫% -L"p0|( 0`0S R0/ራ% -<LK 0C C:p8&@m T@zPT` ' \a>K 0CCP]>K 0C0CD6 a>K 0C 0C$V0 < H6 P PU Dv DI  R]>K 0C886S06Sa @P 006 (60S6Z R[ R\ 0S]<60<6 5pW[Up4v  4 c ppV%\  bKIb.Kx  "2pP5P0S  K @xI,5P-K$ B 2KK Ip5%Q\\cP  {  w s 2Pn<6S 7|(dH&P4$X H6BK 0 @$ @OB.K B(87UK @(IU.K B1pUKADQ "7UK @IU.K B1p DQ 7_K I6 Ip0#ta d3X,:BK L# @JBK I0S (6 f:00_>K 0C!BK " @JBK I0S 6 NZ.  2/ ڰ0P@6  R@6b.K6  K1pX P6@!0S&46SQ 46 03/ r p"% & # ' x' 6p#o% & \\d$ H@]$ <$V "60PpW 03/p0`pWl 0 3/pH00S 6{y$l4Qr&0Pw(|(\i|(-}(iiE9+&qi ~i(0%> # , ,6 A Y d  -L(MpP)`P *@P( DK☢D Kpܢ0S hZ LDP400@ @Z0 (ZKL#|(6i(V#Hc## -L@P0 ͈`@0@#~aP lSP  EpPP  @N @@##[.#|(: p-L M@PPq00,@7S`P H@ KDPᾳu Kp$|(GG p-L M@RPP0 |b@S`P T@ KDPᏳu( Kp$#h#|(GG -L@!VP0 1|`0@#^pRpP sDp8 wN@@P##t#|( $H,&$ -L M@ KHP808 884 028>0K^$2}#|( 0-LMPP @0K0@@@ f Kh@ pTYLP<P,PK0P#|(5ih$$$# -L M@ C`4 CP D4KC P ,4(@! 4Ku$U~$ -L,MP@PX" "p6pP4"4bY( LK LKaFL K.py ,P@# r@PIYL K(@ .p <CN4<<00 R E40|)3 340' `Q`a`q`64P < H1 \ P^04   0Q 4Q4 3m;P P pD`,0V00UWBp33|F 3` P U Ki- K\6i(I]V#$\kn(J$F$$$ 0-@LP  K0h] -PL@p`0U" 0S 8ʭP$P F 40S040 0S 0S(0p(P8`$P 0S$0(Pѱ P-LP`@P VT  `P`H 00 -LMPpP@` 0K #  K-P.0KO0P& 00  p 0 `P0K -L M@PP ( 0Kx0 `PpQP00Z 0"S0!V0"R0"00P 00 , lp 0 @0(K -LM0 00 0pS Ÿ00FQ Q 0P90P40 KjPPP KVUv U UU UPP ,K⬀ 娌`x4@V`T /p@P00@ K100 00 0K0P 0 0K KP0 R% g00!0 0 P00KT00K嬠K "10#Z I00 T` K0S` 0SV1"00ᎰUZ a`@0K0 K0K^P 2BQ0AS00S00K0K3#<4:KK Kⷞ0C 0PK@T 0CS},0K0 xC00K Kx:T0CSo,0K0xC 0aD\W@DAD\7@D@0@D@ T[S0 SSR0xRMZK PPPE `  <P PU3 0 :p, 0ST!  NPP` 0 V@T   PU\ dV0p 0 00֯`㬠K(KюU(%%% -L,M@`KH @ L0 p PX. P W'0 HL0P 00p0 HL0P,R ? Kh'` p-LM@P` K➙ K` Kp -SMLM`P! pp!Q=K0CCp\!d  KF/@v K @┑81HEX0QPT@ ˖P9 0S5 0R =K0C %945 0-K1 B05 I'p  45#70S0 0S000B.K000 Bd0廿P(4[S B.K B@,@H$K`\n&}&i&|(@ p-LM`@9pPY0+S"`Q K K_> 0KR #ő KD&p ;01S 70/S  [Kpe i&,0 0-SL Kh@,|(& -L`@pT P*P @ 0SP H,&& -PL@` 㧘*pP  d巐PX0 000V8P $p`.'0&&:i -L,M (K@p P8 K P  8(K⎐800S 4 KdpP401K00 ( K4p PKx\4'&9i& -LM(@K p [(0[QS S  +K '' -L$M (K@upl l{P4 K`*Pe00 40( K41KfpdPK''&9i&0 /ᐲ%/ -0-L M000 0PK@0%00 P0 P00 (@ $@ @ @ 0 UK0 --LM  , , K -L@+w%X' 0-SL0}( --LM  ++ Kx0 -LM0S@ 00 00  0K #  $ KKIp@$@K0}(i' p-LtMP2P0P S 0P@ 040 000 000K0 04KIp h@PL KdKdP `@ \@ X@ T@ P@ *U4 KdK&UPP #%P2@ tKt@ p@ l@ h@ #1 |0 x@ V|K OVGw"%u N IqP LKT Nt1ta@@ |K9qpa0S DW@U | 0R0C?o20S Is#0S @T LKT 4KT0 |0SS  Q  R S0t0 p0 l0 h0 tK5#d LKT 4KT@Kp0}('( ((G,֍r((%(()0B -p-L M@0P` 0 0 0 S 0C>S`!031Kp -<@LH4 P_*  X*"(H,&)7** 0-ML 0K HPP `T@P DNPP0KHP020K0蔲%٣8}(I]忓P@- 0@` @,PPp#.\@0 .ƌ S$0000)))P@-tl4  ::0 0.T<0#0.6\ 0000)))P@-/]/e/O һ -LSMCmK KK 0CCdpㅞK@79SK(H4S   uP Q 0P$$[&44SP= t@P< K@⥀P2 0JSʊ %9p0S -S<0S4S( ΎKHQPPE = PP`0U0 0S Kl@SK 4APK A {lp$1 \%TP 1UP t& y0S0S KAcp iK@gP(Kp/]/lz(~/M/@}(//p+-///ȵU/2//%i0+&K0 Q0-LP@A Q bP 000o00~( P-L0nS0oS0  !CPP0E `V ,VO@PPpD v ,BPPQ`p~(2I] -LC |%F#4H,& -haL Mpt P@D埑@!0,K00)000$!1p* e@ P+\ZZhZZZtZZZZZZZZZ000000000 0 4PI400000 0PcU! PDA0000000p0(K%&L.H.424 0-LJK^KA=KBMPE@D0CB-K80C BP@t00B=K0Cx \Up0 HIx0  K? $ @l<K@" 4T4 0-L@PYP8 +P0履K0h謥+5@5i5 -LC $"4H,& -PL M0p@ `00 ߐ뤠 00000 rp oP0 lI4P\ I740@cTQ A0(Ko;%&L.H.54 -LMNKA>KM@D0C.K B0@0D00>K 0C(hp0S SH ِ$80,00(H"X77'7V7 0-L@PEYP8H +၈P0K0h+5@5i5 -LqB $!4H,& -PL M0p@ `00 A뤠 00000 p oP0 l3P\H30@cTQ A0(Ko;%&L.H.l74 -LMNKA>KM@D0C.K B0@0D00>K 0C(hpB0S SH ; $80,00(2Hw!X77'7V7 0-L@PXP8+P0uK0hp+5@5i5 -L N!H,&$: - aLP@0p0 Dp oP0 3PG 300@cTa  !!+ ᩇUXP TG@+ᏇP,!($KkL.$94%&45X:i5 p-LM>KA^KM 0C PE (@>K`@0 ( up G #q: -L[A # <H,& -r`LM@ ` P0 )` x" pN lP) MP3 9P|0% GPI0UP! gPC00 tsP mP oP 5tP( uP1p|00|0|000|0 0Px0 d]2PT4GK2Q`010 Q  *x   %  x P!p0 (00P%0#0P Kp FX0p00S0t0Y0;;0x0VKzK$00|00|000(KL.{<:4%&< 0-LNK^KM@DPE>K0C.K@P900,>Kxp0 dF< $,ANK?@D < 9<K0<@0!4;< 0-LM PK@  0 b/o"S ? 0 FK0< 0-L@PK0h0Q 0-L@}!PK0h0 -L M K@0T 000?  PFK< 0-L@PVP8+P0嗢K0h蒢+5@5i5 -LM?404 0000,00(00$0 !d@g@@@@2@H,& -L@ ``P ẍ`P>PP0 FPAKhS ~(2 -鸗LM@H `p( 啍H _|'+p 2@FPkXkXqXqXqXqXqXqXqXqXqXqXqXqXqXqXqllXqXqXqXqlXqXqjXqXqXqhoXqoXq(p4qXqXq$qXqXqXqXqXqXqXqXqkkltlXqXqXqXqlXqXqlXqXqltoXkop4pXqXqpp<60S 0E(6 60S6 0<_U ,K,0000? 08:N%00000F00CU ,K,0 P00R0S TME0@9-0;* U ,K,0 P00R0S 0(80@008(0K T0PP+E(0       +  @  B 0$ R|($  $ Rs# , @ (     )          /3(0  /000$(0 /000 (0 \/080$(0 8/0:0<(0 /0:08(0 ~/090@(0 t/000,(0 j/00000(0 /09m09j R ,K,0 P00R0S ,&(2Q ,K,0 P00R0S 0$0C00@0 0wlQ ,K,0 P00R0S 0,0)Q ,K,0 P00R0S 80 0P ,K,0 P00R0S 000070700400`cVQ +ރ $Kt%(%&BH(A@(L.2AL(IA`A<4vD(|wA}AAAAAAAx%AAAB%& -ЁLJKRM$@D[KQ=KM`D(PE$0CQ-K00C`P0 BHpQ=Kp00Cp$xp0KS 04  RQ K< p0@040 Cp 0$nK?`F 6HP 0 DQ=K$0C,PC.KP0 B˱P KD4 A 4`$04<$ 04@04X040 40$4 0(40,4044 K@(4l?OBB_B 0-L@PSP8+P0実K0h詟+5@5i5 - LR R;ChC -LM@0P`p 0 b000 PP0P00 0Kp0 C0P <K -LM0p$0 0/@`P$KKQKP0 K`8 8#4`#/ p-L M`P@ۊ00   P `00PPPP  廊 KpP(C(0P0'0P0&0P0%0P02P0/ -@LCMP% $ 40 00 0 00K000$0K0 0 P X4뀊H00KhoK蠆C -LM`p@ PpE 8#<0 00 D00  $$ # < Dd00 80440< \0Y,V00(0t0@E0@ 0bp P @CP?Pe $D"H00(KP(tuC -L$MpD `@ @ 0P#KKR,T0<00DD@0 3/X0p#K P0R 0; 0@ PV  @P#K#K @03/pɉP `K 0K R0K T0K (K蠆C -LMKP`/^A P@1L#d8$8#4d4# K@(2 @D0 0@?K0@p0 xpPHBTd$ d  4K K襆~( -L4Mp[ P<@:`P :G`Pp帝e@ @LK 0L KD0 |\0KဵP  \墝O0L 0T0 \0@,K`@`,0*XP V>0S;\0@X0 `   xp   cP X00X0 @0S0!X0!D0D0X0V 0 000 @b8"8#4b4#0@ 000<0(K~(CD~( -L: ]'pEH,& -LM K0 0"0@0K0yP $@KD"NEKEE -HsL`M( f #@00@0 #@ 0@ @ @ @ " p g@P񟗒Xhhhhhphhhh400 500 @K*CpD2P ] ,K 0 4+P$y@+P /PPK u0S Q EP $ P"PKu0S Q h :@EP H 1@<EP(MI K KBp0 &@,K!o00 i0 0cXQ +Kp | 0S0000S0000S@ @(KL.H.%&FE@D4FFJFyF~FFBFG 0-LMNKA^K>KMPE0C@D.K B0P 0D(00>K 0C@(p ?@8# <  $P$(0l`  P (0D80K0<G#G0G@GQGaGoGGG 0-LM PK@ 0 b/o"S ? 0 s?K0< 0-L@PK0h0Q 0-L@kPK0h0 -L M K@0T 000?  >?K< 0-L@POP8+~P0兛K0h耛+5@5i5`8 8#4`#/ "44 0-0"44 04"40 @4"40LP $0 ($(i XXeddhhllpptt0 "44 0-0"44P0L@ ңϣ̣DDƣ@@HHảLLPPTTX|X\y` \`p` p  K0h 0-"!LP@T `@0 0-@LPᇣᄣၣ~0 - @PL@A`@R->Cl->?n}C4X1X\.\+9>Y9>:>CT:>CFP?>CC>HC>mGCF@E~EnF;G8 XJXQ}m  $$((,S>,S>GFHHLLPPTTXX\\ -PL@P` !"44!1"44 1 $$((, ,00V\%1R L5sP pЀ08# #4\0Xp ,$qmTiT`XeX\a\`^`d[dhXhplTlpQptNtxKxz0Z B`?<p p$5R3 \%l0Rp `R# P5P@ R TU `8 8#4`#/; P 8#8B@ / p-MLM@R0 ANK4 @D8 PC?T00T,U~\0 0\zK$pG*0 | Q P0S X 01\0*k K((؃(ȃ((((H -УLMP@ `ḃd p= S00S  80 x3R p圾0  B D#Q\ ?0!.0S  P d =0  R2 00C0,0 ?WV: 0 wP2\%R080  ?O Ÿ 1,K00000 8 ?O00ß?K,.04̟ 04圀 K8 ?Ox ?O` o=0d ßK g=p0 0LKV0X!\PQx ?O0SS e$$`Tp WT``@T yWldO0ST hph`mVp@fT,y7P 00 K(Koi؃(̃((U Să( TT(T -$vL$M@@ d L <0 50S  7 0Si Re @KK ?P0G0 S``` KD0 o`<D0K4 Z ($ܝ4`Ao"44Q44@44 HQ0K80Kx`S`0Z ؞Ğ40000130B003B1 031 0$5S00CK/ @0P!.CKl@QT0@T @@0 D@`p00C0 A@RP83@A00C0L0  0?00 @P@00020SLd K&< ?{2 RT0T00  B 0P SXԐZ+d K< ?{$K0 K0K{ _B1,#KKP{. 0#Ky{_, ?q{00C000@ xQRtAp10SF  A4@0AOZ80A· ` 00 08 L`L$0$800`a40040cK`080P/0 S`00!. 1R0 X 0`( pP d ;0 <8<1(K؃(̃((U S6TH,&ST}Tă(|%T0 -@`TLKL PAT00S000008#80$B0a0|(|% -LXKM,PEKMLEp,6 R 60<Syp 8K>C d60  8K>C 0?E0S00,&C0 d :(K.B 04  0T4K0 @0 0#p R (K.B K L 0R(K.B 02(K8#8O/B0(K0M/BXK0,PE(K0Q/B0YU  3`0S9 p3t0 0008K>C0& 0KRA 08K=C` p8KQ?Cv8KR?C0S 8KR?C0KRA 08KN?CX(K8KO/B R?C0`S`a 8K=Cp,}$2 $2\Q?/000 ? P 1 `pL ? $+  d l1 0d 00000 ?!0 0!`pL04;040 1 00d 9 0KMA ?`p\0 r018KM?C0(K0M/B0Y(K|%(A%̶%؃(t((T - oMLM| CK @4 # >0S= >pW9>@0- C @0P0 p> .P@ 0 D> . x  0 > E.p@@,=T@ Ev^P@ n=P <}<0S ,%(50 Sx0<0(500= 0,%S00 5|<x<Q04d P0QH HC00!#4t x0P?>C4p*G0  ?w8@D ?w `?yVvVt-K B`#` 000`ᓁH h,,-K B`@$ ` N@$  ?KNЀD@4H$n2"`00 pS΅]` E@_Rp~d7h0S xA3VKA ? p$7@A x0TŸCT 7080 0!w=K0C=K0C 0K 0A PK= C8 A 0`l4 l4K`V ?A I=K0C P SR ?v P0KA x0DT4 ßT$@4D"T,0SR 0 sI=K0C0$E-00d4 d4TDa`0t4 T$@4D"T,0=K⠁ 0C⁎ᡑ0/ `p1>1d4 0T`p=K 0C` 60/ !.100t$t b V\4 0B`p 0IP(-K BH4?G>K0CD4l @4#D4j p?GKA`HX*P1#KA0QD4P1K A`H`p 0GvJ ? AvKAB Q=K0C  R0 ἐ 0Hd4 TB 1 BT0`0Y3  B11 \4SK c A`! bB`?  vKA0 H T0d$B!BQT ` S"B!!\ PT@` AS2 0B0QA\$ Tb@p`PxQT0⼐KA i N D4l P H R? N0$%-00pBpQ00B1Rq,0YU00B!1@ŔL pp000|1P0S|0հՓ ըՄE>C4  0 00 0+pD'g (((%%TT`(h(UDUpUUUUd(/VGVVVV((Wă((ԃ(Ѓ(܃(%\((p(t((^F#W>^Wȃ((T(W((W(Ix((((W+&ht@+&TW|(FX؃(̃(|%U 04 y@0H$ 0 P04 R0 0@5PTV.L0TT0 S:h01XT0S<0(1S0SX081S0T\0H1T0T00 TPP0<4HU0叐1p@40 CPD4 S- B8PK A ,0\4 =K 0C E R?T a\RF>K0C`  <50FK A T4 SF>K 0C ?΄R=K+  0CBT4  Z2j  l4 ?0`pA>`C\4 S0EK A ;T 0 F>K0C ̈́ R? <0Ą84^ H4 000\4( Ā0``3`S R 5#< 5x330S:=K 0C95`Dy=l>> 3@D4 0000=K 0Cd `p4 0| 3@4]=뼀`Y=L>= 44@00`p8>S 0`, Dlthd0 \ * ! $ R$\P #0 0 Ą00 4'*블p0 R07& ^x0S]$u R4  : DeP0 `pw : zGL$ D4 RL$p RD4 50S 0 C>K 0CBK @p )`Q RB>K 0C+&BK A |?P BK+ @xd6 RB>K 0C+uV.p60S 660=S,w0S嵴0S0ӈ4 0&\Q,  Bb `p d 3P'  d7BnK `Fp  P0P0t4 0S 0St40Ct4 0St484 0d4 0,FRd EKا0 A 0D4 T4T$\4 0,0R$%hpGK@ A ? T4x$L4 P4Tl4 T4K#ğ L0AP KḺ\TdX\8a,d  XT4P\$@00 C!00e@\4S40AQ<X@ ?  GK @```GK AR0 (0y 'wp90\4 040e0$%R` S2p090S C>K 0C (0t0x0 0Sx0x Ũ001=S,0\$0CR(<40010T0010X0 0\0 00B\ 1`0$%R  B Q1 Ch * Rh0h00 h $501l0 `R! B Q1d0d 0R@ 啳%H;0  \$Rl+Q\ ?0  0  B +P\ ?0  00C 0kjڌ4p Pe04 4Sa,0 ,P` ` <<0$5SL< l01p<000<0S9`dQ0,ST0T000SPUX0RPP5PPS|4 d'먐  $ P0 $ $'0$# '|P0000p8080C % 0b14P48bQ0 R` ?0T  1! BB.A.A B" @$00$00``TfH08 \d d`R`  @0$5Sڜ>V 0l 0!10CB>A>A0B30>000>0S8pdsP0/ST0T00! !4/0SPUX0RPPPPXdQ'먐0 4 RP |4 4D' |42 ?'CP0000`80@T$5SM8l0h P0 @+ d14 ȟ 4 0 T R` ?0T  1! BB.A.A B" @$00$0`0 `VP@p`T S $uS0qpq0S $S07@@70070T70S t74 d'\G000 d4 0$704 u0g0@V TJ m60S  j600 P&x0`UPF `pX 0\5S*`%|HT6X&0\Q  lL .LAP \lLD$LD@_d 0븅%0 0@5\%R 50Sa508`iOO`0xQIO` 4Sڄ4@0fDUWp @ҋ0@  T: \PlL_!L@GK @@xx \ _ Ll!L@ PGK L8 04 00$ O$G>K 0Cd @ r04 `d4S40SD4d$0D4 D4ST.hD48CD$3RC@0#\Q  lL .Lap \lLT%LT`d 00$$wD40D4 t4S20S0\$,00b0Sd4 20S _dNd 0D4 E>K0C EK 0A JD4S P20S C^K PE P,20S$A C 20S30304040p40spgVW*+|QV.xl`\V.GVs0S `=S,sX1?n F?@o0 04qS 04 I`E>d C/04 `00S0S 004 3t 000 d4 0d0A04<(KSv{̃(U Ѓ(ԃ((܃(((؃(TTȃ((((\kJdX(mX|%X(ă( -LMpRP` +@P Xy+qOK&.KH jPpP#   pp`s0S v< 0 (08 0,0 000040 004 04$0D0(0`0 pr | pᮯ d᪯ X᦯ L᢯VB  8 p<  p %+ rKp) #8pPaGS!4"":: #6)01XOX rx%0*|%0 0* *B*00S jp(Kd@edA.7HTfzzd@ -LCM M@`B.Kp@; BSpP E>K @0C3@TL$T4 P4,  K 0-L@P+;P8.+gjP0K0h+5@5i5R/ -L Mp  @@PP` 0y@@P0 00`@U `&`p!D P(K -LM@P `r Y0 &08#8#48#8Y`Tp`\` p!0be ?$K :F^^F: -@LP`     -`@PL ((X0Uc(#("$c4"X0@-a 0SRAQPSR QP"P0 -L$M#K `Pq0 0K0 `0 0S Q 0 -SS GS BS "KS MS kS bS gS mS sSV@@@ @@ @@ @@V000)  a-`pq0"S  K-YX 0 t#KV0#K\ ` 0 R0 4 0 `i)(K0IOIrIII -4@L##, IFH,&[aJXP- Q\00R0S Q\00R0Sh0 -L`(FVL@P d0 P 6V0 @ \0<@@) 0- 0  @ Li 0 -0v`L tplP@`FZ *000000P cBOB㖀 ᴐ@)( 0P-L  C  ( co`X[\ p-@T MLPᐅ<0唐)`@V P@ ( Kp )ȇ)^[\ -`hL MpQLG@0P, P@DyX p` ( K,) )ȇ)c[\l1 -LM0@ PSPHHPD8aPVH$Qp l1 P0`90 00T :H0T/ l0L0$B>K0C+P $0K04 R c(#("$c4"0^ $0K04lB>K0C+$K,)ȇ)@) )0)(h[ -鈂L$Mp6`<0 >}@PPX"X (W V9 V0#K( 0K=,6倒 R`"'0< 0)400 1> FR`!! ,60&0/,6 00C000C0(&0WV8:4!@`' V0#Kp` 0K=,6 0K0K=$&?=cK&`pp+0&`p$&K?=0 ᰐL0SY)%  h0: S$ $`0 r0&d(Ko؀R@)[\]+]I]ܸ% -\QL,p0S+ FT(:|`P$ 0 0 !0S@S d1 Q R @ᗀ1 S x x0'21,60&0၀,& 00C0$0,&101 00C 0@)[m] -LAMP K@?D@@P?@0D 1  lh? 0B X&P?pR01D5: T*8; & T8 T0 ?PU> Ro 0@0 !a? 0D0 6F @>p㰀 ` Ip> T$ `jP0 0`4& c*a~ iF %k0D  k0! S 00180b S-505=01  k0D 1 k1UC1  ! $1!P   a R 10i1 1jj 0!MBj1! 0016jK @0C3@_TL$T4 P4,  K`8 8#4`#/ -@L0` 0c- <01Tw% 0 w0eA00P/    0",P /p)-@=B' -L [%aH,& -@L` Pp~hP)P W0L0   P  PPl0; `0 0S D 0 aW ,Koi`0*T.|bb -L QPI@5 304H应L  ,pK'0$' P 00?0 0H$MPL0 C00P0 $0P P0H0 3lS4L0\#  p?zPpTPPUPpẔ8PPQ%400P 0 0<Up  W0 HyU2  "R009:P hP",RZN'm ~0N/$2 #0P@0  , a!1 #P@ > #K0h )0  -+X;Ѐ0 @0X  P1e6 0SX 7h{<#K 0X;0SX;!! X+' 0#P> #P  0h X XQ 0 t00X;L0 L0 (K0*p)ddd@*p*eeH,&%(*𿚙ɚ;*6e* -PL$ML@`@p I@Z&0S  HK][ 3l Q1>0$YY L0@ % @ (K0*2e -PL M0 @` L00 '0  ~T zwL |00S l0 + 0LeL ?o27 0(KoV(K0*Eeceie@@qeH,&@0@ @<0 T-L@@0 jT*JnH,& -`@LXP  D 8 , IH,&\oo p`pp 0-LP0@ S S 0 RS00! \R 0S@0 pp@ձ'R"R@ P0@R0 Q$G@00H,&rs 0-L@j P l00S\ 0@ !0R3 @00SP P99000l*H+|* -P@ 0L `@? 0S P 0C^SB0c1 0S 0 0C!0R3^0 KP 0*0 00 Rx`hHxHhHHXH`HpXX @0 =0 #0%0rP/0 00|*l*H+"sH,&K` -P`L@ P 0 SR 0S T0B0Q3 0@0    N|*l*H+*H0  BR R R  /+&H,& -L@PP`P  <ZP,0/S? 0Q /Q00/P 0Rp/SB0S& P` 0/RR`0eS0.SP` eRLqZP 0ES s/R`@/J -`LJKSM,@D0 M<484@0(48?[K40?,PE4(?E4 ?4 4R=K0C@R=K0CR-KP B40E0"P R=K0C0<4S.03.0 R-K B 0<4R-K B 84R=K 0C x.03R=K0C084S3S:D>O`@^ <0^R g00 s=3 S ]@@ 0T S S00 0=NK#R=K0C0D0S=R=K0C0CR=K0C0CN\=O 0S?D3/SR=K0C0CR=K 0C K0 @0@0 PP 0C0KCKLKIR=K0C0KCR-K BL :K00C$Pu  ůR=K0C044S2 RKA <$84 uD  u8 4 R=K0C0R-K8DR=K0C0 B 44$$0dR=K0C0CR-K B 0DS84R-K B <4R=K 0C' 0<[hS aS ?S DS dS\ eSw cS9sS pSV qSl lSwS xSj vSpK] K4YPR=K0C0C@P0 QP:  :0S:RKA0 0A>R=K0C0C[K\| K YP{R=K0C0C0 g R=K0C0P C4n CR=K0C0C.K\  KXP] K0@ P 0R=K0C0 CQ  K0@: K\ KX@P@g 90S$9 HK\T KXP*@9@)<0<9<8089400900,9,0(9(0$9$0 9 090909090 9 09090908GWK^\ KXPR=K0C0Cj @PH d80S(0 0C!0R3; 80S0S4  K0@ `P@(R-K K B0@R=K0C0C,\@ K0@(\R=K0C0L4dPR=K0C0Pm :K00C R=K0C0P\R=K0C0L}P P@s m@PR R=K0C0CS `P *K0 B`C^KK+0Ap[R=K 0C@p$60S &0 0C!0R3 P360S 0S  B]P  =]P ,0K 0$C 0 S;0 0TR=K 0C0R=K 0C mR=K 0Cp W 5 GR=KRMK 0Cp@D`0G"R=K$0C R=K0CR=K0CR=K$0C0 S QP1 01X1R-K0\ B SR=K 0C 0\R-K B SR=K 0C R=K0C0SR=K0C0S4PUP  P P:R-K0( B0Q4\P@9R=K,0Cp 0R=K00C R=K,0C0SU0R-KG) B003 R  4   R=K0C0S i  dR=K0C0 S [  R=K00C0R=K$0C0 S op R=K(0C0 S R=K40C >R=K40C R=K0C0R-K0 B00XV R=K 0C0PCT PE BpKZ KVPYR=K0C04SS\ R=K0C0H CKKZ8 KZ( KVP<DKZ KVPP3A0S' "KZ KVP#sKzZ KVPiKpZ KVPP@|0S `ìPXT忬000R@.K<=MK⿿%(Kz(PII***H,&CsL+IsfsvwsRs*<%|)ass* l* 1ts&tsKtgttttt u@(Kd*|*+++&zzz p-L M@P`RP @TZ TT/  0K0$K?PT@ + fKpzH,& 0-HLapP 0me@P0P0m00F% 3 -L]M0`S ``\s\S0X#00LH#00RS0C 0(#00 ep"(  &?S"V$ 0"0000RS x2"00h20|<pl"pT%HPjP`@" 0@R41 MK0.1K00-1Kȸ 002P00S : S z&mPW )V k&%PS|P㰯fpPt eK /0%V1q0e?K " e?K 嵣W0ᘑ`000X |K0 EK<0xSiS@P 0@4'KSR (10S P'K o0S!|0K`|0K(, 0 4 00S (00 0400,0I(000@ `A($$K|*+&|p*@+{X+F%F% }7M}H,&X}#}t**r}x*} -MLM@pP@ 0|!|WPP hh`zE,UP DHK 0C !KA 4 QP I>K 0C C4 QP !-K B>K 0Cc tx| \00hTU T400RS D40S`, `P)9S)404$040 41.>BK  @`00 ,4[ S BK @S`PdVLBK @`9S6 B.Kl0 B BKX @ ` V Ģ0V9 fi  p-i4>BK  @00 0D8 BK @JP,4[ S BK A Ԯ fID8[5 $lR \( Lx4"45X9 A;K,0CCX  CAKA;K,H@0C03/0 4(K,L 4SAK,N N P0  NAKA;K,H@0C03/0 4AK,L L P0 LA;KD0C03/A K,@ @@+R0R @00T00S@PA;K,0C CR0K,@ 4S0S 00S 0 9P fA;K,0C  CA;K@0C03/d0Sx3 P@L0 t$ 0UA K,@P(K@+Tو**,*H%l*p+ +&0  ]p+ 0-@L0SS0@+ -LLƟ0M0"8(K<0@0 #P*K0 K  *KK&K@ t d Pp* R`y  Rv  R  R R0  R  R 0 [50S  ttOh% R :P 0 <. % R   60000S40S%   40S  #P*K0 |K)K& }}\40S `L0 r# R  | $Y# R  :0 ?PG 0|**K0 |KK ^^P30SB P \L`0 620S  $;3YU20S T PG} 0@*K0 |KK ""`20S t0 `cyu10S  10S 10 Y-1Pp iG; 0lS0S 1003/0S00S <tX0K  d0 2/#Y 0 a0 000*KḐ0 |KpKp pp00S `0 L0ppI (Kp+>H,&|*Y+&<%l*t^^+*x*t*ى*/h*+*_taK2 -LM( 0, , ( !S0  1 1R1t4S|P\!,t4hQ0t4S00p@000S `P 01HP,0S,0`;C,0 0V, 00R0S ,00PqtP0S05,0 (,0006V00(@,0( @0(0 x( !0 0  QP $0HPH3 0 t$ K@+p+Tو**Yk`+ -cLM0S HCS 4S  $R0 _0S8F (#(0$,3s 0|54S620S2xR00|5 4%S (P F lM; ;0 \2\@x0@%S ) 8n0(rP|5"0C|590C990C9000PV Γ4S 1!1Q09090 `0 S 10b90Sx10tSnh1Cd1`1\1XKGPEx< 40+C? R0 0B 0SsP 00S )dbM0S \xy@00S 000K|*+&*H%*`H,&*\+`*Ҋ@+d*.GkTIp*+P++@+/nl*gԋH+++ - -LM  4 KH,&0 0-LM0@SP P .E0 D@ 800S ,,0 K0hK0t*H,&|*(+&0 0-@LTP 0PE <08|000S   s@0t*9H,&|*a+& -\`L@P UT *mP 0S 0@P`+ 0-L@PUT SP 0S 0@TP00 0-@L᳥  0  xh 0 dP0 P80 < 0@ ( 0,+vu~-+ -L`)P 0P@ @ 0C 0Q3 @P H+H,& -`LP 4p00CS0P@0 @ TyTnTyDo00CS0: P0 0 S 00  L+<H,& -`-L M  D00S 8P@(P2TKH,&* -RLMp`P0@T"=PC0 R0@TGPCt0 hX\@ P00S DU@ p 044E@Kt*ӌH,&1|*ŌΌJ+& 0- L@/ ) #P   P  P  p $P p P`0Q\ \ 0 L 8K0hMaH,&pwz^ԍ 0-LM@PPPPP0 $ 0P  K0,+ -MLM0@  d0 00YAK@4r>KAK@K# 0-0LS@ \9|00SPl#P 0@00CH 0@K0h|400S0(( K0hrCt*WH,&|*h+& -L M/PP @@p/0S /Sp`P 0 00D`000 K 0-0LS@  0S 0 000p00S@ {P BwH 0@K0h400S0(( K0hvt*WH,&|*+& 0-0LS@ 0 000l00S@ P rBDD 0<K0h000S0$$ K0h꽎t*WH,&|*Ԏ+& 0-0LS@ 0 000pl00S@ P @BD 0<K0h000S0$$ K0ht*H,&|*$+& -XALM0`.SpP0/SS  !0 U 0    v  p  j  dp  x^X  dX 00@ @$Kx*8]JeUls| -L뜏 -鄀L MP`@0d0Sp %KP%0[ S000 K``MJ,+ p-LBMCNKM @DP`<4[E CRAK @V A.K B*sAP⠄<4[FSd0  AS <P0P S00@,⇄Kp,+ -LP@`<<0 Mp<W }Kh,+ p-,RLM$@P8 1 0S3P  dP0`P 1@PP 001 E0SP _S-S XWU>P 0 0001000\PERU4 1PK0`5 S:$0 $0;0%$0 S``0 +PK00% `0" `0 `0x pP$0;C$0 Kp,+2VC/J0&Wm4+\+ 0-LBM@P0, EKN 0  EK 4K0v,+ 0-$@L R0&000,+~v -t L M0`<K) <KPPP@Dp T  duP@K聐,+ p-\ L$M0`P<K<K;4@<K E AKp膐,+ -0 LXM0\KP \K K苐B -QLBM0 CK CK K蓐&`8 8#4`#/ 0-PLU@ U  D7 0= 0 K0h10ғē+&P 7P P / // -LpP0`V@ 0000!S pl  h?0 `0T   d0 Do ,,E 0-L0P0@00* P $P #P P  P* P*@P:P1:P*B 4S 8 @@Dl@]P W0 PPSCRo#Q00b0000,H0`  BR` pR RMX X/+&+& 0-PPLK0h#0CU30 P<,@ P0@S 0 RP0>K0h+&U  -LDM@Qp I/ Ktp P T2H`K01 RR00uq0PS0C000p Rd0KpAT1 W(0S% U U dKz> dKD7.0 K dKl> dK67`0L .@k880(p W+&Sp,,23 -LTM0@S Q hKh X314QHH@00CSllĪlĪĪĪĪĪĪĪĪĪĪĪ dĪĪĪ<<<"y  o  fd0ASꤨȨШPLUD@<8L ,H  D @ 0SKhz4K61g0CSC``\/[20[0[3 [1[4[2'[20[(([3 [$)[4[ *[+[,[-[.[ /[0[1[,1jS!K "KQ Q Khp( xKhK,`MsJ4ɔ۔ؔ[ ݚ!DÕ6 -rbL@DM,PKX @%@H0K0 0 @$0D0 "0@0 @@P0K DK<@ 8@ 4 0@ _\p P8PPPp JpPg@@P0K DKIPPPP0S y0S HaPPc @T4*0S  L00(|10X 0# 0S y ST10S00\0 "p=07S =-00S 0@cN%0P]QQ ]x0 `0  x`0P@T RLHby(K, ,I] ,/S,,,h P-L #Q0 :빖x͖H,& -P3L M `R#0P0p0 P P@ P P P  @ @ @@@0 09PW W W"0000 00Z< "Z> <P0`F 0Lp W aL^WLAL^7L\  R Ȱذ0  0 0 U0d0ax]Y0K/ 0P0W0 S d10 Sxp bp  g1</00_wP W00S`JP& @pP P W <ʨP0 00   f' 4(K ,%,5,E 0-,@LPP 8P@0\% -0LS R  R R Kh KhC0  Pٚ,<0 -4ML 0(0 0 0 KP P P  " -T L80K,M\S@3@#* 0@ jK脒8 0-PLM    K@PQ t .PP 0?8P,2 K05,, 0-LM0PQX@ 0@Hd8$8#4dD3d@Oo@e8%8#4eT300T00S! "U  R P Q,2+T%<@ "T%(  @ tT%   @T @  P @P( zK05,IFC@p@-t0Ql@Q "L .`P!` bQR000p,,0 p-L M @R`  RP .P ,J20 !0S,x?2PU U Kph0Kph0(  Kp%,,5O -L M@T TKhKh0 KW,"! Q 0-L@P  TDK0h6 ,K0h.0 K0h'' -L\Mt0 0@h0 "0p d0 \ p@@l0K hK`@ X T@ PlP G`P@@l0K hKPlPPP`UvVZ xx@TQ*0p  JY y YEx   @y0P x ;y#x  P1PK01 0!S0C000  QPP p0 Hg 0Lpat0(x x`00CS`0\ X0 X 0@(KoJ(Kay%+&O+& -LM003 K -LM0  ( K -@L MpPaU64 0 -\0 4P P P p@@Q@@PEQE[0S@p(K葛 -0LM@ 0K K0 K -L JXH,& -LZM떜 -1aAMLMp0W 0 0@P0qaBK0|!|@BKp@0P(4 0T B(a@q008!0 1,B/0R03  (7!R (4G'<T0 <U<T00 ( 0(M@P )((0 0R K(.,ŜJޜ2?+Oq,ȿ -L6,$0 6-SL , 0-L(((|(m/pdh@P0" \KX E @A830 ;K0hgꑝ,qq, -L h떟H,&- p0 0 00@ 0R (0CS@ C0& -@PL00S8PU``840#U*`PAIX 0rX0X00P4080 6I0X0 -0- LM0@P 0 v0PS* 0` 0K0 -L`MPP tKa7PE@`KT. p |0:0K'0K 0 &pK^K!t nK0 Tt0K  00  $ K.0 W0BtKtP tK/7@t0[ S tKs$K0&Ԣ?٢ -L@M`KpP@&"!023 U 0 |s lsp` ` H P@T 0S84P  $H K[J -L(ML0L$0H00D00@0 0<0  $$0bH\eoyH,& -0-l@LMP\ P0 R D0D0y  $ 000K0 %Ms|,8,p, 0-@PPL 60S S S*S+S-S0S00S06p lK0h0SH00S 60 0U0$00S0<,@,,`|, -LM` @ (0Kp K( p CPP pp(0K zp|00Sp0 h(0`2@`(0 (0V*@@ ` @0 A KiGȣl, %J8 0 R ( 000/  7,p, %, 1-JML M0pS&%=P0 P@KK@5 04 c?4 40K>K0CK.K`C BKKP`01 BA\Zp 10S;X}KpG`; 4 5A74 $ K0A1$KK$  $B.K@0 B@,D p5l l4SLT L00S@00SA.K B( Kx,,|,?\,l,` -pp1L0SP@T10SH! R T0! RT 1 $Kk$S T0 T`0ST q$KkS0  0eW0S |Q 0S` PTD$Kk $KkF,l,t,+& %Ms,?u.7 -@1LM0`SpPq10S! R Ug ! RU 1  Ki-$S Up1p QU\LX1XU  Kif`0S$ S S/ 0K-X0  0 )  1K-X1[     ,Kt-X"K t  hhU\ Ki Ki K,l,t,+& %Ms,}7 -p(2L$M@ `RP T< ' 1P$PK 1 e@4 8K 80TK 0S]0S40S@,PK P@P<0K4 KpoCU 10S=1 @R 00S#KSR 0004 K0 000 0U 0S x00SK1 QP 00, K000 0u K|,4,t,, -bLM0PS@  T㠠 p4 ,Kd)4 0 Kpppp0 0Y 0SuIp 2 30S @`K `@`0K KpoUV \10SOP1@ R<1 R 000 K0lpK 巕0K 0 dKy000 K0V# 0S00S 00 K0DK0 0 0 吕0K00H 0dKR00 K0(K|,,t,,ۤ -P1L0`S@l1 pR\10S P10SD10S88KhQ,10S! R U RU 0 Kh?"S U0 bU\0SU KhwTPDP@p0fTXEU D? Kh,,t,<,@,,l,+& %Ms? -2MLM0pS@ YK,PEjT`D PH"HJK,@D 2 $ڔ `V, 2 ᘀp0 V  )K8 B29K80C0 "R P S !031d媔`:00@0E poAT 10S;1 `R10S 00* !P$.000 0CT 0S00S K0*,A  K,@@.00 0C(K|,U#4,t,, -L(M @0K #  , K?pZ600S  @00S00S 0 ,K!00SG @P, 0`$p 0( 0 0,KJ,t,l,Msd -LM`` K{*W00 0 $ K00"00K"P01k0 @?PPb$0K|@#@@@  pP 0R  D0W4000 @0  10Sq 0T@p0 Kp@00!0KKJ$00S00S 000S|`E@0T T \ P@ _$KkB$KtJ<,X%1,t,l,Ms| -L@M`PV20S $ K0 0"00<KtU"P<0( 0<0 0<0 (0D0 Dp}>@P]< @p rp(  pp@0K 0pKX<`D0v(  0b@ S  +v`p㔑<( 0(^("L 0 "L 0 !L 0!!L 0! L 0"W 0G00 8K8K00S 0( f<0(`s p< r00W0S$Kk8Bt00Sh00SX"P!!!! $K<,tJX%1,t,l,Ms 0-LM P0K #   Kp+ 0S  00S00S 0 K h0 @RX0 P0S*KP l!K K0J,t,l, %ƥ 0-L(M @0K #  $ KSpn.00S  T 0$(0 0, 0S00S 0 $Kd00S X0,KP孽 0@QS0L $HK0J,t,l, % tΥ! -LM pRP 0t! RW h! RSS1 T10S) @@@40K p# 4Z &=`P ,0K# @@ p 4 00R CA 0[(Ko:A00SX  00CSH@84(K<,@,,,,t,٥,V~ -L$M @0K #  ( Kp$,0S  |00Sp00S 0 (KL00S<0 00$0 (0KJ,t,l,Ms0 -PL,M8p0 0S0/  Pd Ki贐`e @HK'$0K`HK,$F娐$奐TP K %,,z( -qLXM@*PbQ1 0S ᩱP @0d K(d0K 0000 t0K|0P'K0&KS R S @0d K  0d0KP@`$K,ަ -\JML M@x*tlp t r* W0 c`f$ ooc/b`V g 4 $ P lT) U 1UIK0+;JK0@P0S [ KZ0IK @0+; A0 @0 KZ @0+;JK0@xKx+p; TRT X;0S (H +8  HR,;,1$ X 0 0 0 4 @ 0jTpp Pj ,,jPp0pS , ,x xjpP ,X ,\H HjP  ,( ,0 j\  , , i\  , , i[  , , i[  ,h z,X vXiZ  ,8 n,T( j(iZ  , b,(^hY  ,V,RhY ,J,FhXU BK0(  @,`8BK, AL3@(xHQ h(` XL8$0S  RV 080XSQ XQ3mK `F`p; 4 QJM-44 1B.K4 010F B  p`$tW 0,$R(0($R:`P  BK%41X0@s>X`@7 0?o2R0SX00Cs 60ShzX0@siXU`0S``VN XPP 0S- +ㄾ 0u 0 0X,0 S >0t PdP4 40U*000  R R 0     P`` =KB.K 0C B  mp000Nh =KB.K 0C B  ^p000?YBnK,pK; `F`4' 0  KpPO,0 SP |9PP@ 0  8pS00 4lU33,0KP`B.K`d# BPP  pP0 B.K BtL9@P2P!咿P=KPP 0C  p0$}^= 00 010L 404 ,404 4SD 80`p7'4Q* 0R 00C0 0( 0R R  $ 8P $ H$XP(K,H,J/X%`%,l,Ms/8,:UCMV^hpz~_Sd,<,ħ@,ۧ % p?-LqM =P*@P U#*0T?S00D00@/pP0.080>9p80 S: R7T=00D@ +#P0=S .8 R0 0P>0Sxd ` K*00 SK0 币 *c?K,ᬁ 封 ǁKP 0`p1 V =P01 00 @A7(P  Ta  ,0P 1 01 &(P&Z l=l z\- X=0Sm7T * mKx1Tp  0S*0S'PZp'P,Ty 'P 'P01  |'P01  `'P P'P01  4'P   ' PTG ! *!mK Wx1T   0S*0Sv ' P$T) ! *!mK mw?KT X oQo*Qw?K0!QP10 Kv'P=T &A 1 R< aBQ'p ꀐ    ! 01   aXT W 0HS񟗢 * mK 1T`p l 0S)0S0!QP >K0 1` Sa 0% u) mK 1T`p 0S)0SWV 01Kq?K0C0 1` SQ01 NaV@  E%VD*D <% ;) mKcoK 1T 0S)0S `  +K1S0 LX WW p X 1Sd;  01   0H06X& SX0S AT T0H?o20ST0H?o20ST0H?o20SXX*1sXp0  0p01 ម%P 0.080%09018@ @0K nOKP  1U01 1S&1 0 ! c/! 4 5k/KSK@2M48 1 p 1Z ! , K1  ! `01 00K0 K0SKp(塼 40So40SkHX4$"a  P` 0=S #8 R 0X 0P30Sp 0 GKS( 01 c?jK1 pl4i/KGKLp3x30 S@K`` 5(, K0A1 GK  P0 ጀ a ipn(@ dh30S\30S 000CS<#<#1"Dv@3  0 P 0=S P"8 R  = @P 2por!b0S 0002_oK1 01 c?1 40q?K0o?K0-K|2 YLpX !TPPW 21@00@W1@1@c q0S 00S ~U( P X-㭻 ` 0hq 01P01 0408/003PEU/      1000@, %jx,*@K|,pI{#18# Ĩ,m$Cn +Pq,l,ܪ0-D,Bd,K`%aH,`,0SQ S㘡 šKơKi' eKᬋ0 QPF ]'0"S Y'+ D0 SP1T R x00S# S S0! 1 0Cs! "  $"b01 g/KK qK0001Kq/K01  BA0 KaK1 f?K p X'~'0Sy@@T T Tq00g/K0@0.K@q/K0 B@0q/K0 B0 00 K0P00a/K0lIr"Q@PY 03pP>K p X&0S 00 1000 0L(Ko810000!1smh(K -@LVP   x l ` T H < 0㮷H,&6WeӰ|0 0-@LTP`g# P  p@0О@  [0 ,U ( -LMM @AK@P (1AK@PgK p-LIM M PAK` @Pᖞ0KKAKA @➳P4 [:4 U:@0S0S AK @0ST 0 -0S AK AヲPKpGl , -LMM @AK@vPLM <0 R AK A]PK , -LM M@.K@; B +pP K HI I '-K BApE i9V`p 09V 25@P5 I i "P p`9W:"BK`1! @+Y-K t1BK  @HP +B.K BL BK @P B.K B$o69S8'-K BP1p'MK@D`8V**0S$a009BK0 0 @0Y-0K BK  @ P B.K B\ BK @KP B.K B43`@G(K|d› ,edAݱ -L0M@K`0$0 |pP  "2p0 PHP KhD6,ӆP 0K\k -L3MpNKM@DNPP vPn 0(8K  !``PP Y !P PP I P2  Ύ `P: 2P x!P ,+PP00 wU,00P`40S 8vX K 2 " P@-K@^PP 8K@1!@P3KAPޜ\`ZZE_oRT10S H< Y!0s <XS!PPjX P  0  H&0p 執MP  50p 匷(8[S K@P d8p4V2 ]5/WY@O ,@ -:@mH,& -LtM | @x0 ~PP`V`B00P`0 @  ` mP$U   8T T T;L0 7W\0 6L0 7W\0 1L0 7W\0 0SLKHK7\0 P0L0 W7\0 00 $H 0x 00R0Sd0 0T0  `0@` 0T0 @T:T0BnS01T0 7P07' 07T060H0傶`00pl0 X:0S 0| Sl0 `0l0 d0@Sp 0 S?'K3L p?H0 THVL0Kd?Ġ'K?'K 00t @P 0 5 tD 0@xUp0P4$DKpx?? 4P$;<Kp 0d  P$4K;p D0K 0TH000V@PR 0a 4i4 K<KBix0S7 0 S?ǟk%Kt 4D P @ 4<K[p P004$;DKQp D K<KL@P0_ 0 0\0 /0SS0 S?%K( TC?4 P @$;DK!pr P004$;<Kph g?40$;4K p] 40K< KDKzL@P0_ 0? 0\0 g0? 0`\0\ 00hUwl0St0 S?%K ?&K< h0A4D`K P @$;p X004$;<Kp 0g4K$0;p ~@ Pz 0 H1<0K0`H0P!TH-fL@_ ` 0 o 0w  g?Ġ07X0 0/h0 0'H0 Tܴ`3(KI]ճܳJ_h>qwE|Y@UӴOUo -L_ ز댵H,& - QL M00 Sp P@2`@`F▄$PV)YK0h040 |40PW@@Y0h040 k40PWPPKND^E`F@DPE(K4,M 0-MLMQ@4KAP6 KK A@ǮP8: S0  S; .KK B@P& NK@DA^KPE 8ҳ00X S08 >K0CC!0S 卙0=px僙.KK B@a@PKADI5.KK B@TPK0ǵ4,gѵ 0-@LPQ P @0 |@x0 0 R 0S PK%DG%P0 00( 0$ 00%l[-3_- +c-$-P- -L5800S ,0 0$p  4`[-l[- @,\0 -@L@d5@00S(,0 $0R  (I-X[-I-c--Q -DqMLM`@p@(Q0 ҳAKB>K+ A?P0@@ $0&0$[000nS ?S aS"0@@ pS qSx0@@ |p0 h n 嘳0 D味KFl[-T+&5-e0&I-u-$00S 00S/-I-l0 -RL P00S DPD@0p`0p`P 005-`[--I- -RLtM@% Ue \ R   Q@ğ@  R @ @@  S|$" 0pTSdddt@D0\ ^ \ Q  0`S 0 R @ 0S 0H K0 S3 ^( \% $\ \\\0P0U`^ 1E$K $Pl P$PV^$K H 0\ $0K0$0Ÿ#00 0PU [U \Up $Uq` Q  ,QP $R " PP 0RPD RL  $pK1 B!$pW lHp`C R a09]V- \VP`V,V#$V PPP 0RPD R  $PK1 B!$PU lPHp`C R e0`0VD PE]Q, \QQ P Q5``` 0Q PDQ $PK1A$PU lPHp`CQe0P0 ^P0S@0\ \0]Q e404l K0&0&t-p_-p[-E-l[-tP -@@P@TL C/P `@@20S ph X0`XlX0 P 00@ <ӱ,0@Khx%\kl[-2_-c- -`P0@@TL0P0p00|0 R  T 0 X+TH Q 8","P@pP-T-d-%c- + P-L.0 Kh+_-θ P-L.0 Kh_-J P-L.0 Kh _-ո P0-,@L .0 P000_-l[--۸ P0-,@L .0 <000_-l[-(- P0-,@L .0 (000_-l[-5- Pp-AML0M  4 0@0 4@S$ b.S 4SA>K 0C0!CC\=P A>K 0C!CCS=P 4S$4@PP0 0$4T00aS` 0 `0V``T 0 0 00R 0 AK @ u$4U0 00S0j(.KpT__-J-OEI-D[- -1ML MX P\ - L4~P>K0C8$CC<P $4@ @2` 庺P40S@[ Sc\< 0S00 \ 7@PK0S 0S \<P x3x#0K0l3 0@ X3X P3PT@300?o2'Q30S 3 @ \<P0002@b0S 2PUG20S @X<T`1X2 K\<P @2\0K042 0@ 2 Q 2P\<R100?o2'Q10S 1 ` \<nP0001`, K\ >K QPP<S\<X0@@\ qU< Q9 0S6 0S \<BP 0BK0 000@d0 0PR000?o2U'Q00S p0 \<P000D0Kb_-k5- @,X[-I-D[-c-I--EO-`[-l!-w -KMPLM4 0 4 0@04@S ,2 pS 4SK K! A@;PK K! A@;P 4S4>PP T 1 10  00Q0 BK @Z`0 41 pW(1(i<KK HH;ZpP 0S  (0P 4g70 QP #R0p4 Y000S0`4 (H0p,(K_-_Tc-D[-I--l[-J-ù0 0 00 NJ-ȹw0 0 00 CJ-ȹ -KML M P ,2 P=K0C"CC;P l2@@d2X04 43P <2 0SD ,2, i 0 峸PK^KPE`E 4 0S 1 1 5@P[10S |10S 7Pl1 ^4P \1\!0BK0P1 0@4Sp dP&   M0 0 00T   /o" '(@0Q00S 0p4P000t0p/0@ K_-˹5-J-ع-l[- @,X[-I-t-߹D[-c-I-ùȹ-`[- -PLAM@ @+ pP0 0 A^K PE `E /|0` t`0p0`0+9P 4[S P0 AK7l[-_-۹J-ȹ0 P/- P0-4@L*0 0 圭000_-l[-(3 P-L@P 0U/o" &  S00P`3P0U0\)PU*(0$0 $`00l[--C -0L 0KI-_- P-L*00 $00S0 Khg_-d-l[-U -0L 0艺 -_- P-QL`!0?o20 P i*@˨P ƨP0 g7P0ʤ0 0x0 l@p0p`Q\ l 0S D0P @]g0S4 0_-E--T[-l[-Ϻ$J- -0L 6 0d-_- -0L * 0I-_- 0-,@,0 L 00S0  0$J-_-E- -0L 0-_-P00 P0-0qL MS` )0AAP0Q?oѣ2P 7P 2P <:0开,000Q R Rxf00 P00\80H00Q( < I00 K_--@[--h!-D,l[--&d -0L 0臻l!-_- -0L 0萻l-_-P00P0 S-PLp h)P`@ǧP0   ῧP b6P 0x0l 0?o20X@` 0S4S4  40S000_-l[-T--I-ƻP00 P0-SLM   )0 'P KK8P 0Ph00}Sd00S X0X"f0LP<0 4 00, 0 K_-d-l[-\[-h-4[-0 P0-L P000 P K0h(+;@P0pX傐4L 0SD0 <i00(eK0hA)_-h-#t-l[-4MP00 P0-SLM   ( L0P@ KK7P 0(SP0 K_-_r\[- p-LM P$ z(P1 OPEM(J-]|5-c-z(J -!ML M048 >K@ 0C P8H K (p \8S 0S @HT 0S8P@ 0S= ;&!`P9 pP kP fP@R t00048 b*@@ 帹P @@8\8 (5@W*@ :@嬹P 00N*8 @HT0S 8HT 0S / T 4(R K@^K@PE PP 0P0@@P48T0C?o20S 04`V 480C0Up pW =xppT` `V 2x```pᴣ3 Q h( ih( nBK H+s@8<(P8 0RL8 H8 L3L(  KAl( h8 T +h8l( 0S<(3@R PSX(\@)P Y Y KA[ KA f 0"c0'U00Sp/ 48SP/PP00 48S 0S + K0AL8 0T P 0S 0S10}S$VUTO 0SL W K+ @K+L @⇹K+ @₹NK @D+X 0T PH L( z(J-z(l!-I-H-j\[-a_-H,&;۹J--عI- -cML M(  t ` $       VKK L   x  |     d h l   5     @% +pP^0]K0[>K 0C (.pS (l |(h x(tE!V>K 0CT`E !d P 0S 哖P(xP 0S T Tt>0S(d$( D>0S5  /#P}( z(>5S 50St5S( M 0 0 SK A AK A =0S ]K PEᦔP' t5SDh=h-h * 5S MK* @D។P=K 0C=L 0 *00 P0 V<0S< R* +M%J|< = T>%R %RS\  SP  K20P 50S =K 尡စ0P> 0S; ' P=K 0C @C]Kp@`P& 0S :Y0PY :   @6 T@60S 50S P `P@@U @F 6St5S(  6S ,: 0` U%P E%ʶP , p:, K0 " B1P5 T5 X5 0[>Kp L50X5S 0S PET 0S P  \UK@BU0P5 (9'P  K8UKNK00w8 S屙610  9@RUT0@UH 舟NNK p 0 @D0p@0C.K+Pd80S h CK 50S P N>K 0CC.KP# .@PN.K BCK$'~70 S00?o2%P‘@PP 0F 6S|%ZtG P<\{) +SP<O70SeFT8(&4֘6@T =K10'5Ș@x%(VK A x%(K 0C 0C 0K0[>K 0C0-K=K 0C B(6P P P j#5 RP45  50|S x  ǧ 5S\45 P}a5SOS>K 0C SR (P0S>K 0CC0 QP2 SR Ÿ@T020S1 4PR,2@00  00 S>K 0C p`SRhŸ QP%(@8Η 5Sp35  ' # 2 R$ 2"?2R P v1B7%220c>K0C6s 06 Y>K 0C0C86 @=K 0C0C<6 FT 8R%(P [ 0K A0X}0&R@M 0"0C?o2?  "0b0W|6 R06  ;R Pj d.6 R R 06 -q{I-J-I-J-I-7d-J-)4g]J<[-~TWxz(j*s E-ȹCmR^pp!-S@(4.HһO+&1]kwL s mL[--D,:Z\E-|$J-T[-l[-I-I-T HP `0S R? 08徐[K L L6S L?T L[K A A00SH6Sa[>K 0CCP ^C R C5Q'P&Pt [K 0 L L RL%0pwx'(,v  p,&  ,D6 D6pH6 H6 R #RpW0Y ^10SqcKA R0 # 2c.K B042@iT0S <;Y>K0CZ>K0C P50SZX=9 =X = c T600T0SP @@6S6S4S%'PuPhXPdT p30S]&`P {U30S3P03 ?P03 3#i%4R!]K PE SR RNK @Dŏ e !53/e pp4@m ᱕4 R040 6 |%$6s 6s$  6s 6s 5S )&6s 35S 5S 53/5%0R 5S H05  K.VK @+[K @[K5S 705 6S 006 5S )05 5S "05 (K p-L MP @P  P `P  P 0 d㟹U 0S S0P KpTP 0S  ,0PP Kph6EI>] -AMLMAK(LA-K0 BAKJK,L0,@D`A-K` B4@P P_  ,D4z,0 R` `5000@O PPL PI P:K,0C4"JKp,@DA=K(0CA-K$ BPP&80S A K@0@P 4D0 4P0P400S A K@0PD A Kl@P 00*S0 AK AP0,0-SAK A0P0 P0,00000 /R0 *R0 ,DP0,000000Sx3 0lA-KA K4 B\@0fP A=K40C00PA K, @gA K@;Py 0 00StA K@⃎A=K00C0lA K@DP 0!pbA K@:P A K@4P SA K@+Ply0 000CA KH@P A K4@PP6A K@P/P 00!%VKVVP V B1V 0V<p1 0AW 0S|7t!0S`2D1VP10S @1 <奓0 00A K,@0 j S 0 咓S 0 X j gP PXXP PZW VP(K0&I-J- 3BLθ_1D,9d-l[-Yl~ -LM0, ( l 0 $0 sP T10S 0S$00 0 A}  aQ @T.$0, S*$0( :FP# 0( S00$0@p@T P 0|S 00 0S$00 0 $00$0 400S K 0s 5,Z-I- X D,(J-I-O -L$M@@K`P 3000 0(0 ,0 4@ pD 0P/S:S4 X@j  D  HD嬰" 8 DP/4@ @P:pP@0@k /0, 0e , 00PPDK>@PUPp04K00 e|0@@DcT@@ 4K0@ 0@0CcSPATDS,P O Kz(z_-PP00/ 0-L,0 @  000@0I-D-|0 - L `00S T0 0Lp 8 0000( 00 0XI-`[-l[- 8-4-5-D- h0-LhM @ d DpKk<0pK00s8 # 3I-l[-@-00CS0 S0 S0 / 0-LhM@@P 00 00 0rS sSd pld pK*d \pKT0pK00s8 #N,(CI-5-D-I-l[-@- -RLLM@` T?&K%K ? 0p t &KT LK⚋&Kp%Kp%KR0IK0 P %Kp%P0S 0#SNL  0 %K R0%Kt pP0S 0#S4gX0S 4K R0 #S%KK 0%K0T <KB$KKPD 400SZP=9 =P = c a0SP h0 R KT@R0# xP w(KI-l[- 0-LM@PP 0s8#8$0 KU 0Ks8#8000@?$KP T[@U 0KA0T00K0 0-LX|0 @ =h00S \0 0Tp O@ 000400S $9@0I-`[-l[- D-P,4- 0-L,@d00S X0 0Pp &< 000000S  @0`[-l[- <-P,4- 6-BML@M@6@ @58D 44 0D K 0C 0ChD >'0P SюV&0 8Y43 x4,Q3#xDE~K 4 T 0 P0Pp2C.K!P "CK 0嘢S x40S 0C.K@ KPP CK\Es 0S00?o 2P@  #0x0&0 P4 1@4 xD 4pp s1pKP$ 0S004 00 C>K؇h`a``Ap{0PS <P *P &0 0S 4 0ӍHPF>K@ 0C0C @4 壇4@,ᝇ4 s  t(0 x %(KH-$-<[-_-T,d-5-jl[-7I-c-* -JML0M4 J>K0C∇G`WVK>Kp4   l 則PHrQ@70 00 K>K$I0S;7g0S/ w0S+6 Q4 $ k$4R P 0S6&C0S 600CS|6GZ. 00lH0S  P= T6`V ߅00Q60J>K0C0F>K 0C00F>K 0C00F>K 0C  CP1 5G04 C>K00C>K00C>K0C.KP04[/$[R.4[S-$[R d48#,#40d0 xtP5`V 包0000A404cPqX 0xtS h40Sb0 0S Z0s\4 p 3 8d R  p L 坆PqWd 30S 4hZp <PP430 00 4D $ J.K BVp8eqOԒ0S JKPIK 0 [2C.KJKPC.K04 t20S00 0L4S0 P 0S828"8%0SuZ00lZnW,2  0S e04 00 K>K[p彄00v1vFp0S04 00 K>KͅqZ81410`C V``S`V 1X0 4 4p$0d4[/$ qX0S a00BpP U 0S 00S;0 0K  00 03/00S 0S  \0R TL $K`[-l[-$5-+&vJ-c-;I-I-I- X 0-@PL(Ϥ P Ȥ0 -LMMOOKP5z%`41`VpSZ`V= p & 470 Q?K4ЀX0 0PP` p  Q?K R`p`$YXX40H4`pD$ KK 0,$4Q?K$@O P  ṝ3#Y KK  0#d@ᥝY KKd 0# @<K?K<dH ᑝH1X#  ~0@<P  S  R &%+GŠ` p0K/K"S01" 0 10Rd R0 0 0d)/ ?  00"%+ /? ` 0p&5;G% 0D" ~U@i 1`V0dQK 0៪P] 1ЀX0X1 0X0QXGBQ?K Y 0 TQ?K L렲`p K?K`!`ds~W@ KKd0!j~@<K?K<pd 0!Y~O?K`! V0@4`Q R0R0K?Kd C~@K?K d=~U x00p KKyw(KP -.AI-2?JI-Q$/I-J-CKU l[- 0-D@L0sw,00p tK0`o0%l[-00S000/vd-$J- 0-L0X0 R0@D00S 80 00p 'w@0I-`[-l[-  -L M 0KK ,K w K -L0M0< $ K<K80 40 00 ,0 (0 zP$ K -VLOMpfbx "OOKYxd6 `pS?K`!PQ?K 410bS P0QK ƟSK"R0 `S?K QK" 0 " RQK?R0tD1%00KKb}5KK00s8 #vH=0@ES0S z$kZfu0S P} KKuK40S@ KK$'}@4`V08S?KԦ 4̦ 0 0d\$dP`d`KK0}<4p 4Wp-pG@P p`Wd#d # #0p`KKp|@S?K P࠳ࠣ\^ "Ce 0\  p#K?Kd|O?K` `Vp41@SZ`V= p u 3冲g0 gU?K2`V00`p 0㜨P PU?K g렦`p0P  S  R &%+GŠ` p0K/K0"d14" 0 10R R0 0 0dP(/܁?  00"%+ /? ` 0p&5;G%0 !N|P1`V0@1\dЀX0+UK 09P$S?K V0Q?K R0!0V`p ܥU?K  0U?K :0P`ڰ K?K|G0P) KK |(ំP -J-I-E-a,Z-$J- ˞J-I-Y@c-J8.A?~Zk l[-K?K {@l|dP<nK?K<`a0h {@ZK?Kd {@0 0KKp t(K 0-L@@0 -BLd00` p ,P P00 @R0S d00CS00 "P(Qd`d00CS0÷pG0 "PA \P d00CS0p50 `VPc`d00CS0p0 0@S P,P \P d00CS0p0 `V000S@@ P P@ x - y -% -vLoM1 0PS& {EPdF0S `K0.00K堕PK01Kט5P01 01 x50S dNP P 7P1SG0p PLwP= 5pEwP5 3.ᦘ`P 9wP 4`g 1 BP10S .ᐘ`P #wPLt`e -P0S P p P P PP @P񟗡(   P P P d0sKp ]uP1? x tp P 0S(d0sKp AuP1? hpe P 10S1ꁶp P P d00CS00 p P|2| L2 R`2d 0TbpL"0 pdAQ! 1 S1!pg@Sp00 P d00CS05pK0 HOpdE0TSX!   Cc l&   # `(1Vp, d  BR 1 1p  P  ! W   VP pG p  FX0tH0h4(Kt!-7x -#L-JX[-5-^3\l[--0&t%-t5-*0 0-L@0SuP0  000@ Px0  0puPT0 0PuP00  00uP0  00&M-RJ^00CS0 S0 Sz0 /1 0-QS0L`0PFV iP ڄ100.S @th1py dP\AP  P4P0<S8!8!0001 ( V 0!y0S0   0V P04@0000 000p000 P0p0S0000`T-d-c_-_-l[-hX[-C,θc--$-c--- 0 0-PL@  00| 00t 0p Q0d0 \ 00T @0L PP 80@0S, 00c-I--c-(J- J-0[-d[--X[-L-X0 - L <00S 00 0(p q?I-`[-l[- ,Z- -ALP`m0S p0S p q900pPqq00000S tp0S p q0000<0lU  JD`I-c- J-c- 2-BBMLM0pSP2 " R  R$ @P2 x2D.0S 4S4 $ R@2$4Ss42BK+ @,0K4P/S BK+ @pBK+ @kBK @UOPBK A]g'q`0!`04 0f00< 44 1@$ D4 8 X x1oVh1Z BK ADB@1<100CcS``V$10X 1o8<40$BK @44$ D48$ @ @xBK @Gr4SU00XP$'PW /P00 (K5- -l!-I-I-z( d-E-$J-X[-w_-_-70(1 - AL M QRp0`00SQ3 0S2.P P$ (K;(0 R 0000@ P|00}S0s00X 0S4P<&2 ` KT-d--l[-Py_-0&_- -rL  @TC*@  R410S1 1 0S00C R% mV.R" T)*@ 00S0000C R T*@ T*`@T*0% W @`#@@@@00(KI-4[-h-JO5--/ -p`L P@#P0  T  T  `000@ R   `FPx`00CS0 `F PpTL000`000 0 ST00+& -PLMp0@P` . s 00`$0K*a`#pPd0( `|sQ,L L0 0 P0 $K5-l[-+&c-J- -ML MnKP8 @`F 0.K0@`|3 B  P K\#\@ LD3pW+  0Q 0Sp  mp@0C.K BP00002P CK"@oCKAP X kpp.K0 BddX@ kp@K A0X(NK0 @D0D0tX Sl  ?  kp<[0$SBK II0 8SQ0AS @Z K AW@S ld I P,QZ=  R ( 呹(/0DD8 Jk8p'0S0S  Lkp@@$.K0 BWP <00 0x8 @D>K@ 0Cl lclp |8S |8 00(Kjc- :E-*` 0-L@PK0h+lj 0-L@P0 ۖo -L۽Pі 0-L@p0 Ŗ P-L㲖렏P㶖 -0LlMPQ@0K|0 0 0  T  40S P 00  P 00  |0K KKPs3 ztK P0 Spc lq`q@$0KT@#P tKDP83x 4q3 30S @@d ` ᦏ ᢏP ` P@@0S 収@P@Kf  \P@ T#|0S $r@P@KI|  |0SU@@|@P UT|Q uP#1|1@T"p1 ed1dqP`Tt!PP *@@81001@h!00!0@P 00 PU > UP 00 |PU / F|P  K(J-^TX-_-l[-0?+&-0<DOWKa-X[-I-L--nX5-c-J-h-4[- 0-LM P 5 Q0S 1 1p1 cPʜ!KK'0 CR @R pS `S 0R D1P 0S,20P8 0S 10S 0 0p@ @0 @0@0 @0 @0 @0 00S 0 IK0I-5-^l[-_- G-h!-c-@[-d-Jc-$-P-(-x5--I-5-P[-A$c- J-H-0 -L4M0@S, @Ku@0K P@0S8@KF00@@K>Kl!-w --LhM @|K |0S 00pQx0 0t S` @K;`Kj&K ?&K0r 0K@q0S- 0*0pK 0i'KKPh X0K0SH0 UZP=9 =H0 K%KR0X<0U0P K0 @ KchpJ0S E0 xK0FhP< 00 70S 30#St0@P@|0`t0 x0x KE-/(/ -LM$0S  0K #ii K 0-L$hPP 0@P0P$00h00 p-LM@`0 @ PP  `$@h00+ 0K8iKp 0-@PL h-+)0 -,cLlMP0S@p|K5iK0K @T  W@1  ) 0pd0d 0000嘢W  gp0#S 0S ppP0,00(00S 0S*&P @  @@@k`0 0 L0K0 0"10 0v00 ,0Ka 0  0 00S.lKhK&KQPtd\R\ 0@00 n)<00#Pd t0K0bST0 P=9 =KT0  00 R\0K0 0 gP0S 0(0p`@^`(KE-l[-a -L MP`Up@ P;0C (0S PI,0S Q 0PPcUPG O00 0P PP1 0 00 0%KP (0S,0S 0Sv0 %[0X RPP 000(0 %0[ S K -LMp` P@P,0S T00T000(0 0@ R   `FP 0KP 0[ ST,000(0T00K/ -Lxc-40!R/P 0<18/Ym10/c-,%3 p-LCM0$1 0 1 30S3@TrCpwP L@#1S8!0R< 03/ 3 CPQ  P @@2TA $! @RR@( $10S $$10S $10,S$10$1 $10S$1 $!   103/P 10 1 ᄨ 1St oRNm@P RlmF1 $1GK $! 1Pa GoK P $a $1= $1P0$1  0 SJ\A$1- $1P0$1 0 S: 1$$10S $10,S $10 S$10$1 $1`0S$1 $!   1 03/P ( 10 1 801 03/ d d0PKppp-|p-o-P8 c-8,%|o-@%o-p-7]=Msp-T. 0p- -L 0 < lo- -La 0v$o-e-H0`  BR` pR RmX X/+&+& -@L`M,PKe N l18 p0080 N d80G0S  0kpW  . (Kp-,%lo-Lf- -L MB,) (p@& P KvT .K X0/LA Pᣧ00&,&㑐ci,%H,&Znz 0p-@L M {d1|`8 P0S  md Hid@0 Kvd0[nS ukKppo-,%(o- p- -dLTMP dK P H00S@0\A d@K:ePSkK0p-,%kH0 -@LIdT ;kk aio-L0 |A-TL 0S  0 dȷ,%p-L0 0-LMLA/P00 0PK0,% @-@0S S S0 0\ \ \R \ @0 RR -ࠟLMP@a 080K ! 0 @T`tj@T:1, K QT4 R0 R Qs00 j(Ko `%i -BLAM MB^K PE`8 <$ 0T  h2 `2 \ocT2 P|c 0 E14K 0E@4  @pc22$[0S000 S!DtBNK @DDPO`pᘡ0S1 Lc10S24[  0 24KRP0DBK A@T1 )<P24[S S 0$ S0 01<18 'j 04圠0dZ 8cZ 0 0D  8bT t0<18 O P0t#p ۔d0 0bK8c(Kp-$o-po-p-p-o-K0CC`P[L$aAK$4!@f`PPp1LAh1T@__;`__A>KP0C0!Oau4L__6_+_@_BKqU 4[S S 4 00 !TL$$  T$$lft X 10D0 S B/o" R0C K0,%֍f-H,&e- -LAMGP Plkl lj_h@PHXbf ,EKHP `00< EKKp-0o-%,% 0-LMP yP#60@S0P%l@%.d d-_PPT'f AKH 5@eAK4 @{K0p-j-e-$=I 0-LP hh?PP0TTxfP<DK0he8@ L^l180 0K0h&3o-7K,%p- p-MLMP P'0@S0;P%%xl@`AfPP`eX0AKl18H H 5 @[eA.K B4Kpp-]j-e-d7K,%| -L { cH,& -PL$Mp8 00%050` ~P@``4` @ < 00 4$8H9p0 RO  ceS FS2 0S9SES" aSQ cST PS9nS hSl lSQ fSy PpS? ksS[ tSp0$00($ $04P3 PP]  PY #PV  3@PR PI |PF xP3@ 00<3 X3 040 <00S< 3/ P<0r Km22g2 cT T 00C 6&`2`VX20SR/OPMPKPI@G@E@Cd"b pW W4 QD804 4 P40!201pp1 00 0!6dwPg pd ;:T T8 t( /uX1 U ! R   R  ! " AnP  H1HQ\0@<PHTI 0000S]P \00@Kl0l@0@ KS80980 L S^H0K|] @j-xp-Dj-o-p- t -ULMp@WZP@Pト P 0/S ,]l5 h%  X(K_PP`@H7De0S 45 05 @(5 $5 5 R-  5+ 0/S@]P x x xa!0S(_`Qld0S l(}`p=0DdT (u`p;0d0S00: (]؃ R  0S 3Q 30S : (\3p3 R T3Qp 0S orp$3: \(@\PPL3  : (\8P,3 l!: (\P 3  : (\P2  : (\P2 !: (\P2 ,!: (\P2  l0p-˞Lk- 㩌Dp- 㤌p- 0-LM 0@0 1(    $ aBlP 0 $00S#0`o0( @P00CS0rp0 0 P 0S*000 K00p-f Lk-+&Aq 0S S///0p@-^L?P\` R cQڀ^ R ` R@  0R 0 P0 pLl-D0PP  Å"ÅP^ @"? "/Lk-Lm- -@LxatPt` 0TS 0T 0SlDa T 0T* 0  ` @%,% o-  0-@L0MP@K@K).@K).80<,8 R<80 |0 "(80@ 880 <00<0 40=040 0 0K00K18r.<@ @ K@0 K0p-o-,%x0 00-SL YP0 P@\ 000200SSK0hFo-Lk- 0 0-LMl00K00CS0n @ 0 0P0S0@@ @0S T0 [8dj`03/ R P0[S 00 KK0,%+&o-x% o-p- -4AL1`S 0S 1PP ~A.0P PP#P  P  P P  ttq`l< PP@00#0 00Q,%Lk-U o-I+2.H,&Om-%00 1-8L 0P ^,% o- 0-000@L X0 K0hXp-p-o- p-@LCMGK AXGoKP1[ S@0018  K eRGK0 AX0P NU01y0 \`L0Pn01Ky01K01(0GK AyXKpo-,% o-wp- 0?o2 0/,% -lbAML MͼʼHǼ<ļ4"@K04$002($  ,4 [XPڶ0 (4Q MXP 0SS WS BSct0Z ,4AK+A6XpP  tA0SIk41A.K0 BS44C< R504:AK AX18/ P0S+ RA~KpG AK @ܺ  0@^S|PYW00CS0 S00 P0S 0 _,%@n po-p-p-o- o- 0-P@LPP P P P @00,%10 -L7Xo -L@PP" p00CS.s t 8t s 8t 8t 8t $t `V PP`|P0 P00XKh 0S P 0 !0S00 R 0000 H0`  BR` pR RP_X X/+&+& -lAL0P0C!S`0000CS?`u &KX@ (0&KT `0S(x\RP\%   ʟd` ` PPXppd p1Rp00PP&KX@  0&KZ8T0 dKP( $ 0/dKP "(, ((  ($   %,0 %(%T P P XP  pQP p|&K 0&K86t0S&K  (K^?T%1@Rc -LMKfS0: S M> K K -P1LM@ R` h&0000 0`p`QP ,K QQP$QP(` 9`p 0`X 00b  V0RP0b pf`0 }?@d0d ,KX$ K$K0@0 S @.  C4, K0X(hX KT%l+&0 p-LM0S KRP00$K| PK@` =Qp P @TP0dsL S <4  K  Kpq-ino0 R R /00@-\ R@ SaPNU APNU @S AL^ T000h0hP @P-@ L@ q0S 000S 8F Vl-r-@- -LPw9 0-L@E%0 000/(r- p-LM@P" 0S`P U P P P HK>0P0,,Kv%,K%,KKp!(r-! 0-L@P K0h 00SK0h芾0(r- 0-L@PP000S0K0h迾(r- -L` P@P000 P 0S00J 0-L@yP P0P000S0K0h(r-0 0S0 nꔯ-0q (r- -0LS@0Sd0SD`K0CPCP d4d P3tLtdP3xxd440S (40S| 0|44|4Sd3|d4SP3dP 0S00`0S  P 0S00 `lP 0S00H34@<3P R  d| 3I. P``40402P 4J.0402P40402P mP14P 24t_P 0S TVaP0S (h{"(h/( !a8P0S 1 (h B\"(h( 匑 q`pPt0\弔PH 0PS U40S1  $K (r-F--J!-!-!6-ά--p------<-r-2.9-r-!awqqt->v-!9Cv-Mv-Hv- HWMH!dx-˞=I{- 0-`@L4S0P00SD0D xh800S 0 _040(r-@-x-0q d- 0 R(r-0q 0  0Jx-0q (r- 0 B(r-0q 0 ;(r-0q 0 00-SL0 0|,x00S\0\ X0t"T00S@4P 0T 4@0 $0d-x-0q (r-@-$-/,0 - Lr  Kh(r-0q 00S/ 0 (r-x-0q 00Sb4-0  0x-0q (r- 0 ض(r-0q 0-@L4 x ˶4 X0X ö4 808 延4 0 島040(r-0q 00@`/% 0-p@LP \ 噶 D 哶 , 卶  凶T0(r-0q T0 00-SL 3800DTK0hK0h-(r- 0-L@ 04 00K0h(r- -L `o 0 J(r-0q R -`LP@p50 QPT*KPp PTPPEUTtlP8/p VP PPU*T  $Kk/"$$KkY4!!"%" ?" 0 0A.0 00S/v- p0-(@LP 0s  :4P0%S" -`@0PB> Cᴠ/? 0 0&L⃉Ö@PpT 0Q !UT UK 4p@Pv-h%h"`00S T R $ <0/=C///v-- -LM@T C\ N!QP04 S05": N,K0?`R0prX ! KQP0$0@RB*T !SR$ 0S 4 30S $SP 4 0 40!0000 00 P0 0,K! 0  @0 p p,$(4&)6 0 K0 Ke,KPPPR0PPUB> C KQP 4? P0P0 QPB3mh2 K0B>C\2 q   0TP 40 00*b1ppM P3p10S 1W0?0S  NJ1B @ ? @0W000,K Ap10S% Tv7,K!P73D10S81KKP 1+KSR 1,KSR 0 )@00S0 X      "  04 S05:6p(Kv-,-% ""`-h%-4- r-ȯ-Я-د--800S ($,ē04//v- 0-X@L0S0p 000$R C.@B@P@B 0$0v- -@L0S𫝸|0Q I00`0 p-؀B`YX 0 2(Pp 0 h%v-r-"- -L@XP, 2T0000P 00S4 B>`CUT ?0"0ˆ ^ !QPd C>C0@P0DT0<`0B> CR0tp 0 v-- 0-LP0P0 0S AT 0 RAC@A000v-0 0-@LT04  MD0 QP0@ K0hz1p 0 0v--0@-0S 0$R BC΃LP $ `P?  p"^ AWV PL0$@v-P00  ?P/  /% 0-LM0PS4 $@=C* T@M 0DB @C @004=@C @P@C404@@ 0C0 QPK0h31K0v-" -0ML 00, K00-B>CB/v- -PL`p@P!\ 0 AC A04 00 At P 4040$rd$Kkq r-v-0 -PLU`4 @ P  0  0j@ Du4 7HT 04X0@0Kh~v- r- 0P/v- -@PL`P 00S D 0S 0C^S0S *Sn0S 0Sn flP@@0*S L0kR  dR  sR  uR  @ @v-% B- R 0?0^2:!P* C 0-@LL P0S& 9S0S*.S bS cS 00C<,0d0S:H*0 c^ 0R4:0w-""x- -@PL`% PPPQ [P@lPQ RP0S PV$/L%%" 0-xLNlkPIXe0P 0S |@39IP: V@PR@P N@P0 0 @PP PP P  @P0`v\X XTP PK0hJ" ###%#0&w-*#0#6#;#@#G#R#x-[#i#x-0/v- - L0 Qhd  SXCS @#0 0 C! @Mv-Jqs#w#x- 0S 0S 0S 0S P////// 0- L0S@ P0PR0`30R 00 R R dP00 0- L@@P  < l 00 ?00.?"(#?000 ?)?00? 00 ?0,9??60 ?/,?0 0?09?&0?00|1p@-0PSQ00p Q!3?*= #= 0DQ!&*-- 4Q!*.$q!L !?@@!`!`P?@?? ,, ?0<<00 pv-0 -@PLP QT5@2TT@DQ0`R:6@ S@ T0CQ @)@@v-H2P: /%06P: /%% 0Q 0/v- P0-L@$$1DPQ00 @0    !00KK1P0! T0@T0  T03:T03:T03:t00d S,,A c,0S ?$C,1@,A0s#(x-v-w#0X;P: 1/%(%8 0\\ 0 S// -L MR( `P@TUp1{TUp, TP U00VP 8UTl (KP UT0  U PT 00 KHx- -LM`p, @Pp0 l KHx- 0-p@LMP(8XR KK 0 CS p8 0b8 808K0Hx-P P\B/X-j p-L M @P 0S EP|>P Kphn\p `P 0S  PW000 00@JKp'O' 0-L@tPO Pd'P 0 R Q@0 R cK@0' ( p-L M@P`o K 00 d0Kp p-@L M`Q8P R" K$K$0 80 S$08+8 08@8 R K$K$0 0S$08+8SKpHx-- -ALM8S00 900S( K,K0K,0S,(0 R (` Pp$ (00b?U$0S K$K 0PX0d 800, 880b8(0 CS( lKHx-- p-@LM 8`0P(0 (00b?U(00S K(KQ 0P$K K 0 J$0S 0(0 (0 R(00d 8HQKpHx-- 0-@LM8 R+ KK0 )8  00RP0CR80S0 8808+@P80S KK0S+08K0Hx-- -t@LXUA8 cPUP@0  $`8S0S Hx-%(0 8-0LS Hx- 0-H@L0S P X:8 P 0 00Hx-% -@L`P%l0 R0 Ȕ S%'0C"*0\0404:0 [Hx-% p-L M@PK@%` @P   d@P Kp(0 ( (( (8 0 /Hx-%0 (( ( 0 /Hx-% -pL M@˱`0S-  (K(@ P(0T* *0S0( (( (P:P +40(P (( Kv-Hx- p-P@L M`K@&勱P@ 00S  aPKpHx-0P$/Hx- -0LSP`@P P  @0P00 @@00 0-$@L$P0$8  0Hx-`7 -XGLM0PS(`, Q(g008(X 8 0S0S  0S08 Q00((&P p0 80 h 8x|W08!0F?o2P0S $8S @S PPT P0? PW Pp48qSP$ Pi48LPF Pg P_48 8qaP  P0\ AnPi PKP3 ePO F48 )4880 80 S@488S:0S S}0S S2 x8S-04880S' 48#48LPp048pD488S0S S 8S0S S 0S S 8S484880 S80 S80 08$Y48 3` R( a H U`Y `vP`3X`<34H80S 48 cUSD8P 088c4 #80hV2h80 dV5 0 R 2t 08 <0  J000 @ V$S0Z V  4D0 %D0P@00 0 R  8 R <R R 0  `V' @P88 z88aQ UD 048 D(<8PR%DP4@P! 048uPDP 8S S`00RT5 P0P048$(KoCp(Kv-Hx-p-%%J(z(0 p-L M`@P $0 $0 0 B Q $0 !@_$0 0.S K$K%KpHx-/Hx-0$P00 /Hx- 0-MLMZ@PL K A-APG8: SCGPU; K @P2 K @AP@*K @P# >K0C R R R00Kp@uPd@ K\@nPP@ 8["ST >K0Cm K07(2(%:(% 0-LM,0Q0S/ PP, F@T% Kp @P 0: Sp ?X XFP HF@< ,F0ȁK0%(T2(%:(% 0-@L0 700000  0  |0  l0 \0  L0 @8840K0hꐀ-A(L(X(d(n(y(z(j -P@0L@`@px0@/00gp 0S kW @gV V,(_Khꐀ-O|( -P00`L@o?HKhꐀ- -@Lp 0[`  U _ P0;0 P /0 pP    5 ? P ('U $KkR $Kk ꐀ-( -L,' Kh& -aL0PS@S SH S S S %SZ #S. $S1 /S! 7S Kh!Khx.0P S+S@ (AP a0S0G0 q#000 0 Kh00S Kh10!S P 5 \00S LPHKh00PU$ Kh}&ꐀ-$r-`-(J( -L(P 0P@QP  KhP0QD D0Qp`P@ p`P-د-$-- -L@ e;AT0娐Pp   `0S T V0 00$00S T82---0PP/᐀- 0-LM K0!% K$%( -@L(0S 0(01P |'P 0S S S ,PKh"3P`,Pv?o2(0g萀- 0-@LI0, @,( 0萀- 0-LPᑬ@@T:T0 -N0L,M0>~0؞0?0eP0 0 !0S />0S2{,0SK&T>F#P  P >P >0S P p>P 譟0S\80S b $.=8)-P $X 0S:o$K$<=0SeU@`ᬍ=0SP0 eU0쬟S S S S /S 7S S 00F.V SdP<P000SLP @0_V !V V@ "  +V -V0 S00S000{ ثRF V V  6 0SP0 0V9 H<0V5 <<0V0`P, e4K@ @Ka BR   P "P A40@0 @0P 0Sa0@S @@P @00Q?,K!   V_ P+ V[ D+ VW  RT~"P,K!| $0D@0S aFQ0T*7!P 0 /fP,V V V V#!V V: *V @V 90S07S< 90S07S;07S0 V V=P 0#0CS*rP'0S P gP HKH`KG0K,K00!PDP UUF 0EcSM t L  t    x X  t ( t 8  ` 8  @ 4 t @ p $  0 TePj!R6 !R0660S  a!R6 !R046y =!R0 6ñn460S!R05 :!R05ñX !R05ñM50S!!R0T5!R0<5ñ: 1!R0<5-050S P!R 40S  ePn!R   V .)!R04ñ!R00 !0<0!eR00d !0<0<P0<!R0l3ñ3 ',K!l30SD0S97 @ 3 P 000!R02ñ200<0!R0p2ñIsP000P000<0!R0 0!l/PXo(VPSa2 P@ @KH20S2! N$20S)P;1 堪P  10S A"!0 3p1$}W/PL!R00ñBP P P j !R 00,K00!4/P!R0D0ñ+P $0,K!R< 0x000!ꐀ-x-H--l--ܯ-(2((Jr- V`-H- &!)O)-5)8-`)m)(|))))-) r-))-`-()-|-)-l---د-\kL-!R000ñ.P !R0d0ñ.P| P(.0 QP 0 B!R00ñP u aq41P P eP e c00000 0g0  a10S<! X0I ^10P`? 10P; 10P7 P P4 20 ,F820P`' <20P# H20P P P *+20S &! %%0P` 20P 20P P P.`0P" %$` `]0 P0$3 R43 բ/ ?!H!\0 p3ñ0 cP03 R3 բ/ ?!#0003 0S 0 rP30S080v< 0#00S/v- 0-L@'0 S!00 -SLMP@`PiPp0` 4@ 0UK40 0K80 <0 4 T # 3P R 4 AT4 0* QQQ,Q R %0 R0  0  0 U0 P0 < k<P ᢛ4KZ80f d4 Wp10W  #1  W RpG Y@d @(Kp@-PP6 HPV-@^^$0S0 gS$ 0dS T ^g\\0\  \A0fSd000p0   / -L M`p 0 -P@ܐ3 00 R( R R @ 4 PPP 4 R PPE R   Z $* @  R ` (K) Q-LP KhԀ-) Q-LP Kh~؀- * 0 FԀ- 0 @Ԁ- 0-h@LMP K5P P  0S K 'PK0Ԁ-\2 -LM@T @dP6ݻXP0`pᆹPP 0@20 QPû6e v66W V ᳻W0S0 MR +R GR  SR 0SSD_A SER= SnR:0SdS70Y P,`KP&00 0 0eS cS&P0> vS xS P0C00 PP  0 P(0  0 @(K`-܀-/* 0-PLM@P ;PU 1P@ MPK@!5K0l* 0-P@Lqq 0 $$  K0h%*****1 -LM0PSp4P 6 00P2 00P0`K/ 0P4K0P@\ 0@Sd@ 0DSd@ T04 d@dT U PEi4P tK萯--|- p-PLM,KK0 QP ,K`@5`V  媺00(0 00  Kp r--Я-ȯ- -L M@p̠0 Ǥ`*P0FP T *XV R  040 ޠ40P@ U  PPRPQP RP@(K%% 0-@QPL ዤ P*0Q S1#00Q 0QA0 AR SSQS0C//(0 0-PL@ H0 r-P/A -Lp  Kh} 0-LM@PI@4P410SK@!aP DP2 OP AP "oP qP dP&ie0 4P0 00?0 QP 400<000SK@! "ᾹK0r-*h%*:+ -sLM0@S 0SP X0S`  PI 3PTt|0, K0"K`3P0S[2P200 R )P00 J x!P00 B P  KDZY u R NLU p 4P M,K!10S VPP ,K`!| YP 3U 81P01  @6,.$1  T A1P 0S K :5P+K ,K 0P P pY000S r"0Wt00S,K`!,8Ը(K r-r-O-O+&!D-g+P-h-@-r-ȯ-Я-$r- r-- P-L 0 Kh r-<0 -LP  h Kh-+O -hpL@`X'-`VPJUP0@ 蜰- 0 r- 0  r- 0 r- 0  r- 0-LP@@P sPK0h0 -L@0`PPVU  P P -萟LM@@P`4K4K@P 0p,K~,KP TUP!P U 8p0S6$K r- 0-L 00S@ K0h r- 0-,@L0SP000-++ 0-L@% W0P 0sS@00 -Lpdd@P00CS0Qup P`0 ` V 0d HS z9ᓷ ɡ @P`00 -Lu 0P+j -L@ᱡX0 0R`@P0S R0S@0@0Pᓡp0S W ờP@0@000%% -LMP`E@q1!pQ @P` P`8 40 0 C0fV408 P W@X V$N@X`@ p h0 0 PX e8BVP  @0@0DX(K%%+ -LM@`P 0S PPKhH@ @L0L 0P0p'8Ŷ H@ῶK @7 -LMp`P% 0S" PPX@P h0d 0p07PU1Pᑶ@f1ጶTKz( t -@@P@Lp`@0S #S %SW* VR  R %S #SP t똠@@;렀堐`@0S #S %SW* UR  R %S #S P Oo@0@0 r-r- -LM`YP2@ 0@ᅜ0 QP G_K,0pKQ'`P 1V  0S 0S   1VPTP@TKX- -LMd10S@YcpVd1 RPF L`PDa 81R`PPPY) 00 00 000P7ᴵ@`V  ߟ `឵V P3H0Sᒵᐵ፵ድ$K`-O,+% ,%#,F0 0-SL`@R0X P6{@`pP`@][`-+,1 -L M0`Sp 10S^3P 0 @`|R0 -R LP ]P(A ^P[P0 y6 (` V T P uX%X-K/P GT00P0S 0000\-[D`P.@G0S (K0-`-W)O/,O+0 -L M0pS`-R lGPP% Pڔ Ki'@@@@0 p6@᬴T  KiBG K`-I,S, 0-LMKP0P@JIDOo@BK0 0-LM 0 @RP P ᵞ\@K0P~@@T@0: S ᚞*A@ `WK0D-y%% -LMK@0PK00 0ᩚK/ 0-L@oP P0@/R0000SE8-p0 0-SL p`QP QP@P rUT- -LPwQP0 R/ - -L M@P`p T 20S |20SUd200CU @P20S 8200CUi@WVpP@l0Z00 JYY`p&0 QP`pX PQP Z3o4vPX1AoPT410S(10S 0 WV 00S 00S00S 0 0 0T c0 (Ko WV { D0P p@(0@T@, }x-(-$-%r--ԡ--ܯ-n,H00S <0P/000S $0@///--$-x-' -L`p@P@T 0@V@@PUJ0YspU T PT  00S,KoS x-- -LMPP P @NP< A0 SR,U00S ""KAP"KP 0@`p@ 0 QP 0 $Kkg $K-x- -L Mp`0 QP@PV KiI0 @ 0Q K0PP/%0PP/% -L P Kh 0-@PL0 p0T0 P  00S  B 0( 00C00K0h, r-%-0/- -`L@pPT НP@T#0@0 "000 0\0UP0(0@0@000S   0 000%-P// / /00//0// / / -LM@P0 UT D30S83 43 0S000 0P20SP`p2Ģ0Mp Pq`VpX00] 0 0P00 ]00Xß0S:00 $00RHp@ P P0t T'Y@P5ڬ10S11P- @T_* T P0R0PX!YL! R0p Pp1@P 00 00@P_ @PM00S 00 P0P *3|00SX P P0 0p (Ko(K<-----P--- - -L4MK#KR0+20S2#KR0 #K R0Pt20S00#K#K R0$KP020S @[Z T T V P P0 p u0aG P\ 0#KpUKKPK|CKxDKVpp 00P0 $K 0 P$K P)0S&0S#p, P0jpP0S 0 0S5@@T:DK@T_$KKR0PKPCKVL00S 00K$KP *T(K蜰-<--- -P---0 Q P-L@P 7Pp P P@P404`@@PP6 0@x%Hp% -LM@P(PjZ Y00000 0 T M0 0j820S (Ko0P (Ko40 2`p. r  T0 R40ᴁ9 `p 0 #K#KQP@P ` VXQ D!00j000 0@   f 00 0@/00CZ0 QP@P P0 0  0 l00SvL0``,0 00`0@#(KH-~,x--د-$- -LM`p30 QP@P OP x00S `0 &V0 @P,0  K`ajKH--,, -LMK K K -LP KhM- d@`p0 QP  BKh@MWVKh,x- -L@P`Px P p@P400S  KhH- -L`p 0 QPlH.0 QP@PDKh0 P0T0 Kh,-- -L0<0 ,00 0000蜯-p--- -L0<0 ,00 0000訯---- -@L MpPPU``P 4U 0 K0 00 E00!  p(K-<1 P-0L@`PS P<SPP P P@@R 9P00SP0 0S_@:P Ro0000SP v-- 0-|Lt@P 0S\00XP 0S<00  ;00/--'@-Q-P/<0 4   $ ( , 0  R 4 /-- -QLM0`Spp1pA0S 0 T1 V ࠣ࠳   ,1 V00@ 0 00 00S4 K%4K↗40KPP P 0  0lR00040  4 04P ` c pS`0p\ 0K ---x%p% P-L0ML- P0-L@ P0:L00- -TcLM4P0p e 0@0eR0S0<0 <0W d 0 T"0 R  R @T P P 8 P4 00 8K @Pp" D20S+ 0Y4  0 4 0P" 080 ^804 P0L4 P _P 10S ?Plo᪢0 00 U 0Q0Y 40 0ҷ 40480 P 8P  Y 84P 4 Y8<0 gZa p0 @Y TPP@PPP0 P0g00pp(K<00gS p P-X-v-0 - -BLM`0$00 0K00PP U < R   `@Pr0S,0 000  00R$* 0S P `P) PP&0 000   00 S0b 0SP0S0S  00 00  ``P0SX0K `Pp0p0PP$ p0 0CR0 H0 5P QAP0Z p`PP p`(K--X-- -鐀L M`pXPᕕt0 @@@ =@L00P@E` 2PP K%-- -TPL`p@8@0T  0P 0@d@- -PLM`pK|4@T p 04 S \  R0   0T` T ,`K00&  Pp 4 R0R000S000 0a 0 0 0P0`0 p00 0PS @T&D3000 0 0+ 0 @X _X@@h$0S@@@b_X@@_P@@ P $@ 0_P@ XCX20SSSE  804  b0SCDRD `cJ Pa 0CDR0S*QHPPb  HH10PZ`! =PSPEUMP1 RX5P 810S S0S` 1 0.0S& 00S" xP X@P @@ @00PHP ` P `@@@@(Kp--v-%-\kX-% -@BP0LP`p %> CP0 0~ U1Y(0QS% 000`H)(0P@0hꨡQ 0 (儁Q0p@08P 070S 0S %(`0Ca0S@0 Q0@ 8P8%^P E 8fH@0(0 %>@0@00P(0 p0X Q \00?\ 0  aoY 0S @0-p-v--- 0-,@L(0S%>0(000- -AL`p0P 0P0V0S %> C`!0Sc7HQ0S <1 0R$m_H P 0 0nPQ 00S V 00S0S  0  0 0t00SW 0   0 0 0   --X--i---0 0@ /-d0, R X00S P00~/@0P0 / 0 /--0 ,  /- -`0pQ PL@PtpP 刀u UZ000CT7P NP0PY@P0 0W 0V@-- P-L M`0p=PPP䀟@0@D P 0 p T 0 0 P  000CB0PQC@@b0@D 0WVA@d@(K--0 0@-P00S0 @ R0!0X- 0 R g -m-د- -L@L 0S𨝸0dS `$P ` PU𨝨 0 0X--h -`0 c Q( *8 800䀃-X-P-`- -pL`V @TAUT`@P\ `P &R0^ ЁP P  0\&6 0 X-P- 2 -L M 0sR@PA P0؁`lV R0` UTe m Vp$ #K  T0#K R0P0+zP D؁`0 QP CV0 0 0`p &.0  eT0(X'KNP0唠 ؁p`T00 0QPK XK 0 = (K -X-- P-0LP^ U !R 0PYX  U ! X0P R0P @a@ PV 000  000 r  0@P`pPa@删 PX00 <000 r  0@P`Vp 0X-- -pL` @P0Vs0V ` @P0 UT@ P UTPx-00CS0 S0 S)0 / -LM0@-S@    0 Y!p !T PO!@P" R RPP Q`N`P 0 i'U0SP ! BY P8 pT80 0 (KoꞢ  @-د- -L`p@PD@7PP0" @DFJ"}  SRp=8 㱄dl0 +p 0P `pcp p Zz-/ د- -LMp`0 "KQP "KQP@P@P .W T 0͡ 0 0 QP 0l$Ka @ R-L<0 A0@S 0'@  舜-- 'P0-L5 $P #.P ^P0, P0,  B%t $X@ X004P0P0@0U T0(P00舜-,x- r---h-(0@-50@P0S,@0舜- -Lo 0-LMPP $@K  000K0 r- -LMh$@K K0 QP 0 0$Kp- r-- -LtP0N.PO.@Bp`UT@P@BT ă$@`0P KhP 舜- r-- -LGP 00 0R  r--0 00@-0@P\@0S0舜-0 0-LM@PT#P P P0Ptp00Sh?H0T <00S(0400K0!K0`-.r-).h%=.X.d.0 r-40 0-SL l0%x-@B- -PL$M0 % P PB00 .R0$ K0K00 0$0S)/$ K0K$0S0 0 0 R0K0|0!$@Kp1 P0K00@HK@!0@ 0RKr.%t..-...40 0-SL l0%-@Bl- -PL$M0 % P PB00 .R0$ K0K00 `0$0S)/$ K0Kd$0S0 0 0 R0K0|0!$@Kp ውP0K00@HK@!0@ 0RK2%./l-/.6/ -L M@P?P K@!Kl* P-L P 000S Kht`P Kh0 QP@P  0 Kh꘡-`-Z/- -PLM P P<0 $00 K00!; K %x/ P-L,0  l00S Khdԡ-ء-z( 0-PLMP, P P00hS =S MS sS wS mSP@x@P h@PPX@PP@L@P吢{00K 0$10!K0萰-%%%8-P P/0U-P/d 0-@PL 0T0K0h\0 X ,P*L(H&D$@"< 840 r-/$%n////0D0y0 -PLM@, P PRLa@0 0 B \## D!S1@P0,S T0@0D@D!10b 0,T* _K0 `Rp0T T|2!h@f *P%,0< Y K,dR FKD-%%0U00 -PLM P P" R0 0  0S Q`TS0 @ 0 80<0 K0K 000K00K0K0! K%%00P /P/ 0 /0D-0P 00/`-x- -LMP@Up`K !$궋]pPQ 000\Q0S 0S@ $Q00V @P 00K1x- -LM0 S0*, ," *  " K*1-/1 0-@L0  0ơ-+1P/0S/P 0  //j 04/ᜡ-,0 -LM4 K! o K蜡-1 p-L MP@`0-S0 00C  S0 ` T00V K`!HL 0A ^ 0@T00R`Kp:1 -PL$MH c4P 00S S 03/j40 @HK0405DnD 5E<440S: 0 QP!3 P  PP' P4!0 QP P00 P00  P 4P@`V ,K00!B`F@H6V d Ѓ 0 Ą X 4 @ ܃ h |  p  0 QP D KDK2tcP02 RʉM0 QP 0aPWP082 vP B?ւ#2b1f1ZK P L @1<+0W  0SRP+P0LP+I0 P'{%8p`000P 00S6 0`p0,  0SR&0P zSA P Q0R0 P\0P t@q0PS Y Si 0(K-- r-O -h-x-d-@'-J0G%p0 00-S`0L@OoBL D0D0<00a400cA,$0 0ء-8---%--h-(0( 0a00c0A꬯---%0@-@^ T0\ !R 0^  A T 0!@!T00@0\ p-L M@QP`@ P0P ˗0T0 c`PK@%@ 0T -vP  80R ,  P00Kp--0  -Lo -L$MpK RQN <`@ PZ0@g1Pg K0A U"jo^Q K8 K U8 1 K  @TV @0 000 0000 0dmP(K-%0      /- -0L0`S @V PU0 000S`|0 pQP w +`  BV P--t-x-, -LMЀ0 YX?  @ 0CK0S(Ko00S ̠P@  BT"@0 QP0`p80  5#KV0 r  X0 R OP8@U (Kof(Kx%p%t--x- 0-@@LP,K0h 0?o2 0K0hb-= 0-@LP P{00-%% -L@P800S `UT 0% -ēLDM%K0@P40 00 K30P T0K000T 00R0S) 0< KS0C 0080K $K0K $K 0$K $K0K $K R0$Kp`Dp@`K0 QP0S@20S D0@dT@d T$KK-P DK0SD2@T @0S@ S @T@@20S,0K 3@X0 \0 ~㰿P ~@X0< 0@ $P 0 00000K040K080P ㍿$Kp `!0,P6 0 00000K040K0 80P' T 00040 080HXʤ00S  00040 080p n0Sp`g eq@@(K-- -p-X--%-<-@-\^p@`UT `P~T@^"`p^ AP@SR @T@\00D00S 0S,0 0S -x%p%%<--P0 0-RL@4  0 P 0 0K0h!--- 0-@LP~T 0S D0@P 0,0  0 0--د- -L Kh-- -bLK 0CpBK  @Pa ,4[!S BK A HxP,0K04S S S r4 0S 40  RQ44 48 _84 0S B>K 0CC.KC0Q ? 44 4$  ^Q044 444RP \P044 44044  S$R0C44 44  0J0@0000N (0R    (K%7(- -`Q`P`LCMVPpCFU`#3S 9 NP 0S PEU񟗐 ̡ ԡ ܡ tSpSlShSPz{`w{ t{ ``0 `Y -#P'UX r KKPD `V 2UV #SKKK{P ,0K@1P Sa@  Pp`2KK 0Q$ @ `Q @/ 0@00`Q000 0Q%1U p#P 0000SX!0S000JHF@ `Q@ Q @ 0@Q,1[ S 0S 0S ZPV ??00 0 000S(K(->%+& >72?SJ>-0&0 0-@L|P0|P  |P p|P `|P  P 00000%'>->4>:>O 0-L@P!P P P$ 0K0hz@>M>f>p! -L$M0D SP a0 K0P@K00A0 KR#K0 #K 0#K0 YXJ +00S  0KD0`0H0 z00@0 H0 p9vP P @0S @00S S:(K(--w> -h0p@-d` P^ Q @T PNURp(-%h0p@-d` P^ Q @T LPNURp(-%0/(-0/(-00S /(- - L 0P -/ -P@L M K p P 0[S00KP[K蠰- -L0\\\1!0  \ @Q 1!0 5[P<[\T ^^00]Q0 Q ]QJ0G P]Q [Q 0p.GQ5 p`W]X0 ^"\P`[^0 \0 n^@0 \^ R0\ A00 0 d-`->>> 0-P@L0 R R  @@P 8 8 0嘑@e@, K0hh0&d-`-?0 p-L MPQ`P @P L0PD0`8 045(0 R Kp-`-d-4?- 0-M0LM00P/S $S& +S00% /9S"\S+K A@P0 0 #0IS8[@S0 K@00000KS00 Az0 0 4K0d-`-J?s? -,,LM@ TB 0rS aS bS 7tS {S3/000+`V Fp`% 0S2p0QU 0W 000 y00P   P0S0808 `40 i4č@(K--d-`-? -Le-KeM0 BM0?e-K BZK0,PEe-K0E, B0e-K>K B0 @Pe=K0C0S ?/0 r0@S  @T #S ;S@T ? Te=K0C0e=K0C0p000 0,P: @P  @0S 00@@P > 0@S  00@p>0Q=-0 3-^ \ t=t-0 3^H=H-PT0 3 RW` Ĵ L |  ` Զ < X о @ @ R @ !   @ @ R @e-K B 0 e-K B00Se=K0CpA   e-K B R<,0 $e-K Be K @ pe K@ @ @ R @0;S }S S ;+0 @ @ R @ \R 4;4+P0 n@ @ R @@T :*0 Y 슟`e=K0C P! e=K0C0 \ \\\ \0`Q@ 0d S`005@ @ R @0S9)0 h90S00q)pj  R @0S lIW  R @0S0(G @ @ R @(0S @`|8|(0 0S2` AT 0V 0vwP8(h0 @K 1 @ `@\TT@@7'0 $TK 8AXPx7x'0 n (U`R   K8@ `0( 0Ye-K$ B00S ' 0 e=K0Ce-K B 70e=K0C0e-K( B00@\ Qb \Q Z-ZZIT e=K00C  *e=K00C P 0L^ Q6&|0 (@\5.\Z&Z @)e=K$0C0S0S 08S e=K0C 6P00e=K(0C0ce=K0C 9 QH5H%0 @De=K(0C0@ce=K 0C00h Se=K 0C0e-K B00e=K0Ce=K0Ce=K0C RPm4$0 e=K$0C`00 09S4!I0;S S S 1 CR(~iS" IS gS vpS wS7 q00@  ))0SX 3#0 s00`00]X'yeK A @y0"S T3#0 U9@0C9A@T3I>K@ 00@  ))0S)Q Q   S `2`"0 ()|20S l"lp 0I 0!1 0p909a 8U`S0  K8@T @2 @0S 00@0;S# jB0110`\SS010!0 e=K,0C P0 0 |e=K0C @Ph1p 0 0 <00@ p 0@Se=K,0C0K9,A0 A p e=K0C0eK90  p2e0\--d-`-???(%D@<@R@@@@ Al- A!A0i(A-=A[AAGA-A%B\BBBB CTCCC/&0&d-`-CX 0 0 8_<00S000 S9Q& )09)S񟗖       D         0                  x        h  T      \,0T|Q:00 ` 0 p0(00$00S`<940ShP2(0S/$PU ` E QcP0(0" f b$ ^00 \H 0< 84 00 (( 0$  p;V 0z0 $00 H; :R<000s e0P 0S u: KP<[S<000S`:  K q`0S~ 0K K0P00 0S0 0K0 q00 ̐ Y0`V:,: :$# : `M aP b0 R:9t `9 0``5Y Wp , "P 0S:X9 п`8 c8` ,9L00 R:9廿`Ԁ 00 8 70S `0 00 00b0 }0`V:88坿|8$廿l8 巿\800@6 8@q0S q` 0)80S (0Sg0$ o` 㓿LPG 0(00 4 P8(0Slg$ 0 N` r(0S$ ` H bpP 0f$00$ 7` [W0$060S (0LSF$ 0 "` Fls&0vQ:00 "` 0 p`l`0 ` R  R  Q 0 50($000 P 00$00pW Wc `Hu00 0S0 QP 0 0 0 QP X`0P 00 0 -K0-K` 0X0X0 0=0 60P  /004  QP XX0`b0 PZ pWs 0a 0 0 ;00 ax K``$NpN0pK0$N0` 000S E"FEx-d-E-- J/&H--t-p-0 (0`Vp<K``pL0pK0`X0L00 0P00S (0S@0$ E^ i(K<0 0R Q 0{Q  0~\-J4- -L@`PT# 0wS {S sS0p [P0  0Pp PP  $'P@ -Lp`0|PV@00'01P R  PdPWMMXPP0=S !S <S >S @S  0  &0 00 00 00 0:S 0S :RP 000BSձ0S U00 000 0W 0Sp$KkI]-*F1F0 -@0L`PT- P kP$ 0S ,  4 00f?o20S00 0S0S000V00S @-4. 0- LMPh@P XO&AK+AW PAKA?p?&gK0NFH0  BR R R, /+&H,&D0 0CS0S 0 /+& 0-4AL`0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0K0h+-0-01S ^00So^ P0P0S0\ SS0 000S QQ 0S RR   D.-0@-  \Ğ\ @ T\    %R    -D. -\AL0 5S( <0S (00!0<c aP0U00\P mP c0 0cP0 R  (P | zc0  ,P X qc0  4PP S?]KhLD. -H,&Uk- 0-@L0`TP  Y |xP000ST\\ĺP]< 8PT( ٺ00+&-^FH,&sF -L M@P_Pn @P/㌄P@P  @0?SP@ Kmp0S SPL{l0Swl00$K FFF -L4 FH,&0 00-@0LTQ0 T00 0001S T0S TltK0h0T`L@0$ K0hT0@ <  K0h--G  GH,&D.GG(G;GEG -L YGH,& 0-LM@Pl K Y0S 0@T k00 k0"S p`K0 -L M@1P Kp #K;H@-hPD R"`@0S$pP0\ 2D0V%@D@% $02  /&$0 R   0R0C0/-(0;#(0/(00#(0/(0 0#(0/(0@0#(0/(00#(0/(0<#(0/(0<#(0/0S00/00// 0 /$. 0 /$., ,0 0*R0 S/00/$..00// 0 /. 0 /X.00/֍00/TM00/]M00/᳗00/fM00/uM00/00/ 0 /֍P. 0 /TMP. 0 /]MP.0 41?o241/$.00/00/00/xM00/M00/M00/M00/M00/M00/M00/M00/M00/M00/M00/M00/U 00/00/X00/M0/H. 0 /H.00// 0-HP L @N R QL0 &0$. -L$0 00xN$.0 -LP$.0 -LCQ$. -\` 0L@ P0#LPvP$6SP6W  HN$. 0 -L P$. 0 -L P$. 0 -L P$. 0-dPL8M@ @ND0 ]98 LKi0H0 0LK@0 yIK0$.$.80 0-@L @M0 ?90$.$.40 0-@L @M0@.90$.$. 0 0-@@L1P0$. -L8>90- ti$. -LL ji(0 0-"@L@C 00.0.00 0-* 0L! 3 0$..0.80 0-LC0# 0$..0.L J eH dF `D _B ^@ [= Z; -{L.0. -0ML 0 g K -L . -L 0v".x . -L 8.1 -L x . -L M -L 0.. -L . -L . -L . -L< . -L< ~ . -L< t . -L j . -L ` . -L V . -L fLX. -L ]B. -L ]8b. -L ].D. -L $ . -L v. -L  0.. -L . -L .0 0-@L@M0- 0 0-L@@C 0- 0-@L@'0 0-@L@'0 0-@L@&0 0-@L@&(0 0-L@g(0 0-L@((0 0-L@'0 0-L@~0 0-L@A0/ 0-L@70 0-L@)0 -L+ -L+ -L+ -L+ - L N - L֍ - LN -L0 - L WO. -L5, -L9 -L -L -L 04 c0?o0cs0  S00/ 0#6 c0?o0cs0  S00/ -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L i2 -L `2 -L W2 -L N2 -L E2 0 SP l      X t | 0 (00000000/ -p0P0L  S@`0(8(<0(800(Ux  U0a wRb ( dFV@0S  3/(p  80U(Kh<O\k+N -LM0@  "(``0 PP P0 40 40(pP c  8W 0S0 PP(:>0 0 QfIpS000b 0b 00PQ  0 0P0b?ñ 00e40 40pP00 Q0S 000 $0 000Q000  Qp400 0@ 0W 0S L0 (7  (S P (a[((KoQ0N 0-(@LLP I0$. -L@`b P_  0KhvJN 0-L@Q/ $ 0 < !  bP  d 2S/ 3  T L D0{ R  (K0h0x .8.1v"./".#. .. 0-L@Q+ 4 @   | tlzbPh  H 2S/  <  0(K0hy0.. ../ ..M 0-L@Q7 < H T ' $ !  8bP  d 2S/   X P H0{ R  (K0h00.. . ../.. ..Q Q Q$  /  ( . . .Q  , 8 D <  4 , $  (/.X. . . .Q Q Q$  /  (b. . .Q    D  <0 0 (0{ R  (/D.. ..QL X d p 0 (   (/v. . . . -L& Kh"]g -LL <03S  " "..]g -LL <03S  " "#.x .]g -LL <03S  " "..]g -@L<3aP ,\0 /v".".J -@L<aP ,\0 /. .J -@L<aP ,\0 /..J//00//00/00//00/00//00/00//////00/00/00/00/00/00/0 0-@L@x0-0 0-@L@n0- 0 -LI$.0S00/ -L . -L . -L . -L . -L . -{L(0. -L . -L . -L . -{L^(0. 0-(@LBP F0$.0@-Pp@\$`    R\ 2D0u%@D@P(UD0% -L Kh 0- @LK0hA 0- @LK0h= 0- @LK0hB -L 厰H,&VN -@L`V`1P`- `'(SP S oU3Pg:f: X@0 0oPP` ,b00D"!0(S00- .% -L,M@4 P T: T0AT 0 !0 S00)P =D80S 43/(0S0 R  ``000 00 P p 0S0  80 80P j S 0` ]80SP``ꜙ U  "8 Pe8 UP 0S00 0L9 0efP PDfP`_ef  Q@ Q 0 K)8 `0 00P 0 M`0e0fS 0 ZW p 0Z $0 CP B]Wp0088 0Z )$8 0 000xjȀ 0  SjU7 P PfP`_P0 ?P( (000 Pp 0|VRP ((/20 0 ?,aC,Q 7? 0SR$ 0C"  0S`4(Pf"<P` PY  P PV PP P P P d6P ?P 0CP? >PP =,6P 0P6?@ 0C "S񟗒 H ( l 4  0 0 SSQ  0 S0a0$ 00PU0(e8p80 ?P B 4?4t+YP` 0`SY  S  420 2 U^LT-" PT40Հ(BQ0S  0a a/? 0( C0 BS `0 ^ RxP  R00)pzP`PxP@a@(PcJ0S`$020[B,@!vPr 3000]KP-0P( ,P (>(-A0U0< 2$0R0 ' 0Spw43/P ``(i ,P (v>,.,`(A(.0(010A40 (N ,P ([>(@<0S 43/(.,PP(PJ .,PG`\XxP * @ .1B%dP0S 000CPqP uP ԭ<PU |000CPcqP Y0A`>P APX0P0CP h0P N0CP(K-NOH,&0O.R .rO0&0&S -`L8Mp:SPU N@@ sC E8 TK_0TKP0 0H0 >K$. -`PL`:S0S N @@ JC E$. -tPL`:S0S N @@ -C xE0L 1#PF$. 001/- - aL Mp(@PT!0 n0 0P200 ^00P0P0QPDmP0@0$ 00R 0 000$800800p@00<0 0000040(K-O P0-L0D0 P00A00(P -D K0h^^- -BL MP0 OU0  0  P`XP R} @@@ppQ @ R R R `6P w! R q!      O R R F6P ]! Z!  9 T @5 fR@T@@)6 4 ,64 R '68X 4!@T: .! 2 W! B R"Q   `~ D@R 5P  !    I0(K-0& @ -xDL,MZS  R0P <0 @ pk`  10X0 0S @0 UR/O/L/I/WYpP58 50 500@c0@40 0D0 @00H0 3 0gSpDU404pc40(U00ӧ?0pU0 gQ pb4 0gR 0800 M/2~5W 20 8e/008 2 gR22Ix2 Po P P@HP PID2P3 0P AP@T@D0D0 2 D0STGD d HPE0p00@ IY 0p00@Y d H@iPd @0 X@P TX@PU@0JU1000  0D0 0 dDH0 HH0P@D0H0S 008 0 gt 0000<0S U@0 00 <<0XS T(Ko6n-P">Ą0&H,& -x@`PLp `4P4P0U i`PP (0P n`0000-0 -LM@Pp 04pT㸀p) P@@ 00 0STx` 0 0 @ Pu 8Y@P ➟  K&-P P-L@\`0PPs Hp P P 0P*0A&- 0-@L 00000-0@2-0O2- --LM00  { K --LM00  l K --LM  ` K 0-p-LM`@P00 0 0000Kp -頒LM< `8 Pp3@3V"0<00 q00 0S` 0S 00TaW``00`T`80 s@fO@080 WpU PgХ_P0Z80 Pg009@P 80h0P0 XNP0=9P 01 9u,O, 9G80 F0G008`P`Y,3,0<00 00 000 0aT Y  9 D*I<|?*=*(K-P. 0-0-LM0@P0 0 00008K0 0-p-LM`@P00 0 0000!Kp --LM00  ` K 0-@L2P20- -LB 0-@LMK9Ne)k"PU Ki `+K)00h@PU KYT PK)00000S$$彨K0.<.<-H,&д0 -L  -LMMK @⮻ELpPK @⦻=LpP @gP@gPU`@@ ' @@/QP9 04PKBK A @※BK @߻BK @PWP T108 j널P 08 jP `BK @I Q E @PPG@Tp* YipP% $ 0 ‡0T 0 0 00 0 p XzkT @Dukqkok@P  8@?p(K/6 #<0 0-SL 0P Kh.@.. -XL'MP P <M(,P Khz( 0-RLM@00@ & Pr %H&0S cAPK T0Sb OP_@QEP~(P^LZ 8oPO -10S: (P kEP>P, (P)P&0;P(PPP(P0U QP (@P>+)V K0.$.$. 0-LM@K+@ QK+@ KAK+A@PAK+@ K@'PP AK@'PP 0 @@@@ @@@@ PAKKA@&K0蝷 010-LM@@@ `P> _`P80P1(P.:P+P'PP#(P 0@D M DK n0S 0W RPO(PjhBK0.$.. . -L M@@ 'j P / P@P K <0S 0X PK -LM` 0 0X*0S ` 0f0 0 SS@@@Sp 0 S @S0S *pPP @P0Sj Q %SR0S dS& %S iS sSp200 /%Q0K RK R 820 R@ @ ;0QR5 Kϥ0T KP'@^ 0dP K0 @P 0 S T10@@Q0 @0 aR cR-  @R$R0PPR@ KᅥА Tn ,0K0S  0! S 0 O0 @S$SS0P @U:R0K3/PL 00`0 (K0& 0-@LMK*PU K sGH&00ppP `cKP ]GlW>, S3K0<.ʷշQ -(PL@T<0<0`P   0Kh<.. -hQL M@` 3["%C, ( -(!- (--(@TppWg(@gC. p0c{4@P||Db@HP   '' LB K .qqH,& -LMpPVK" `I2 0KV?KKp,6 0 VKaKF d0S  ]P R  Q0S  H눥P FxP Fwp@ P c00yB@5 0A tVKtaKx1B?a/Kx1 ^'P  %@DP  %00paSP`\SP# P  <# #0S #P # 5%3 zKU2,K"!0311`01   0K zKrK?K/K0 rK  1 P0SVYTSU0SP t2PU U ZP0 KT U $ jKON\2P jKFjK 2  hSR  2P F$2 "0B0[iSRc 60\ꐑP,0K"!!03N KK PG D,0K0UCKKx1KKP,1[S @0 KKaK'K?K 00R0SQ TE0S 02 ]&2P0&@P UR(KE@.x&ptbtVf@.<.YgTav .y.Z 0-@LMKPU K \E#00$PP K }HEl00S TT ST8 4g1K0.wԸ8.[.H,& 0-(ML000@00 000 00 @@@@0 PP DD嶢@0Q ,尢`K0h|&D H,&. -- LM0p IK1 NXoKIK5P 00+IKLA%PP TJIKPPJ aP`@p ᘿp pT@00@X.#d$K7W --L8M@ 8K@ <@ 4@ 岐8PU` 2I 0 e ἐT%PW0 %0'Sp0W*S+ ǵ@PpWi 'WP Ppp  c`PP & %Q  @Q c B*S/ k0P   H0 EH0S/  D D0S O0@L0 0iP0 DJP 0.S 0L  H0 KP1Y@01T0 cT0`P CH0P 00 0E1Y *eD9q0 Kp3[S03K2[SP02K  B /?0<0 0K8e< 3[0C3K40K0800 K00<K@H勾<0T?o20S @0K8H< <PR n+Q<l+0< Rp  F%T <0 W0b?o20S $I)4$p_)S A)$W)+M?T @ w <0P :+@HW $$4?00CS0000;"(?2I<P P0P "40S  {I.?8zdPP udrdT  W(K=.n\kYqht@ .+&  0-tLBMFKPP1[S .FKPKP FK4 @P FKJ JK0P-O- -鴀L@pPB`AT!*Y W /o"/Y R 000 `P @dQ 0 s@000&x -`LP .p@ MR , APN- -PLN@Np `hSJ0S fQ0Q.SP $ (  P-M-/O- p-,LMKPP  %JKPP  J p@' ( KQ K⫲ KPdU@K$# `P\IM`P  < ,(PKp!iN-%il-N-6i($-U -MML,MXZ^K- AMPl=Q ` \\ _=K 0CP p`0SX,K B0 c|FpPV (KP-.H,&ҹJ&0& JN-z(-5  'U \k,-$.O-%N--l-ȼ0MXglٽ, -L!Mp@`hKP2S$2K ?KP 0PKd:0 00P\@00PI_K00 0QP 0P/S/00 0 /S 00 00??K004 $K/FMU p-LCMP`lKPd@B\ T0T@@G GK40`0 G?K$$Kp/Jb0.fx .. -LM K00!P @ @0 8 0/Q00$ 0 Ki . .<. 0-LMK0!@0 \P t t0tP p0D@0` /S0000H[04 /S@@0$QK0j . .. .$. -L#M#=KM0CCtP#=K0CJ@P FE BE0K8 8S@h0h h@PX0 (0H ($08  K . . .$. .v.}T. p-dbLCMX6S P \64P 20S  2 "GKGKGPP fG?K 1:4S !\@QU MG?K T1:4S l1t00C C\1\ C@DD@P) .4 ( 0S ! 0S 8 h ~1P8U k<KpP- $.N-ƾ׾U-gl-w58O-SN-k$To-|0@-S7 @ T\0C0R.  C@ T\ N\@ PB_UQ @ "#0  @ 8 !0  @  0  @ \RQ P  Q   ~000* RP0//00 L0aaAI$. -L RMJK00M$@Dp0`0P 3p" *0 @ Y\5d dSS=S0 \3R 0 4PP0 $KHTT!= Q-LMaPPR`@p-  KL P' YP .] HP  W0P `PX@ ]00S 0 {P KSXa Q-L@ HP x0Ph @`P 0@ HPP OP z(XXJP00P//J -LMP0P, KY<pp- ,X@P( , KP0K<( KecPP x`V F @ CPU =<ᝬ( K \ KdK&\kw P1-LQL$MpL0|pS4 `@ 1 Gp 0 GPp  Gp@ P(0 0V-BV, V+~406(`y@0@ < 0 0 (K$.-.PPJh 0-LM0PS *R N/ 0, ,R@PQ4K0$.u -DdLlMM0Zx0 Ut0 p0 - 0$P  PP  (W   pKpQ P#PP pT3 @ p[Pp1p#0SlK10P3  Y @iPLL0@H"0 S 2 0 S tK⻆`a0tKⵆt R pK⯆p0S 0x0 ,000 0S? SA0p(0l0 $@  P@8xK⍆0 (0  2 2,01 " S S0$0!S xKv1 ,01 0 0xKi1 ,011 ,01000(0 x R t0|{ 00 x4[X p0[t.[P20 (00#(010S"0(0 0,0S 000 90p 0,0@P tTs Qp[t[PpZtZ8(K$.Xz(sp J H/5=. -kML MPV pp@d X X6`VP D6D00 T 'Q O v: 5PjV| `B.K`; BpPn O.K BP NK K A @8FK K A@3`dVY -K B\ PB.K KP; B@V V ppF i.K Bp06  f6V 06VXPPV f `V FPPOK @P`P U `z=KO.K0C BBK @Q,2P,7ZU O.K B `40S3P`a~phZP Z0 S jK(a0jK#&R 0刃S306 |30W S&܀ |      T  8  <36 03P(36 $E0P  0STy22` d K0  市0  6 & E&6PxdŸ |Ÿ pŸdŸ XŸ@(06@Ÿ 8 006, $0 6  0S 10S _LpgUb1  Vy a0      tB^K PE  , K04"00H8P SR (!( usqom P BY)8 (Km.$.zd@0|dG..JI =Xz(NeRW_fov(.8Z2gg 0-LMP1   1@ 0RZ`P PV0 0)HP0D "4P Kx P T01  0< @XK0.$.XJm&Q0 -LM@pR@aP `V PqUL@0 8 K⪃ ` XV K$. 0-L@P PK0h0 - LM4 PP?BN9T`P9   pPP/ BP@@0 pW%:;HC  80 !P800  C!Ph0$T000 $TR40SP }pPBHBND,X(K›0&D-0  RR000tKJ p-LGMP0G/K, ( 1`P&K/KLp $ 1Q 0(1T,?VP , (A Q P ,0 $Kp|d|p -LKMPP T QKD1S@p` TTD1 4#l@DW0P"SKPӋ8L@,=P@H ~ KKHp@ P`RKS3P1 0S V w@P V oV gpVWpp 0CP ` +CP P &CP KKy`000 0S KKCPP1@ < P@KK CP P1 <  @0P@AW L0T1-KPOK@KKL@1S ` h@`V OK⇟@P `yL&W(K JTO|K -@L0zW6-PRo-\Ep00S :Sb%@-R_ >:S9KhC$.. -;ML0 M> D:0wNK> 4: > .0S. J p> F=:PP BodzBoedPePP>e S00R"0)  K A PP TP$>E0S :E0S e0S P;.KpP .K Bp K @:BoobWVePU<.Kh0<l0<p0<t0<x0P;PP,dD>K 0C `C D0$>K88P> <>  ?  (^ > pY >[SV70)#0a?o277'S7UUPP0U67` 'S, K (QmB0 'S ,K'RA,K mB (\0^K PE0B Q S0, K0 -Ct x0nK `F 0CP`0&FRUJ ^K?D PEK⬎ ` 㴀 @7D0>KJ0>K>K 0=KJ0= T6.K= 0= B00< m =Kp. =[S+0K !nK.K `F B0 A.K BK0 @ t x0PE 0` |%0F q0S7Z|@pW,5DP0 RPw~K^ cZ >K|p`PwK,0 P `PZ 00R ,K2D @ < h8 0 00000 0/0pP KA0S> S3   S  ? v#`Y @Pn00>|p0 P> > S 0S>| wnKc&  4! +4#4*"* s; 2n; j;0> +"P > P$od >R  *  *e R*)xt hl0*ʉp * <C CR%Q"(P 0 3  ] P 0 @0: 0:-B*::~0S X1&T1pQU 0//? TP1K 0C Bͼ2 ; ,0KA6(K.&zd@X-Q-NEFXJ#'Q`/ .+& . :.F$...>.P H,& 0co/bC-`ԀԐp P@'D  (TpPP  @)T (T^@N  S 0 @00 0$ $0 0 -ܣ $0(! ),!01 0/-00/? 0-DPL(1$@) c ?:0,1 001 0- 0-LM02.KK00 0d0@00 0T0@@@41K0 00@0 .2KPwK0贘 -  -0(R`L80 : ,0K*#* K+-K B@@@K AK`PT:: ST@+K Al6PT@ |p6 ||l6`T>K 0C'K 0C`J; Kc0 H @X K @p 0+: )P:S pW>K 0C0 ; 8W0S R Sr0K;  a0p @; ! K @kpo ;0% ,K B.K B+s S; K 0C K+ A ;p0; *  ; 90P; >K 0C K+0 A ,([;R>KK 0C A (: }:  R*,0K 0:B0 -;S; ᾷ>K 0C ⸷ W a0 ᰷@TtPpp` VDTB T DlϞP`Gc m4>Ka4 0C tpPb  R @ 00 00000 000 0 0ap@`bbK@*P0t1!tV'K0A9 19S oob(K .-M . .$.d@edA~b. J -t`LP@T U  PP %P`U X& 0-pLM d@ `PEK5 EKRP@00 08,A/K0-%. P0-L@P 0P0 K0h<. --L M  K -`-\L M00 + @P J <   Kwg -`-\L M00 @P * <   Kw(gpH 0-L@W8P@ o00, 0-8L@9P  0P0 0蓚 . .8. 0-8L@9P  0P0 0蓚 .$.<. -aLBM0PS  @1!0@0IK/0Sp IK`AP 0IK0|0( 03/P C0X000 S S *S X 0SI/K6MX 0IK0 0 0S l00S I/K\ P000000$K . .0.u%.oyz(~.-Q -PppP`1`#WL@ >-P (B(A.  'Kh' .8. p-ML M`/P  No,P@  ' BK(PP AK+ @3PPAK+p @PAK+ @PAK @'PLLKpG, Vz( -8LP P  0-LM@P @p;B 0 K0H,& -MLtA pqoK)-3)6(C)0D! 8  ,,ݳFKvp堉PKU( P0+<0 00 0 H0 PPP0  pPR+9h IK\ 2IKJ K/-%.X-=jȶ D k -@LMPP  $0yb7P `P% >L)0i `0(1 ttg00fPKeP0Ip`FV(4 0K-qX-=%.j -L< Kh -LM0 K0 I K -LWMpl1 h! 3Q 傈C 8:3ß 'Q ^ Q 0LDSP0 `1 `'V^ 0SY 0SV`1SM 34&* 0 Y"0K 0p1 `!唢Rp1 R000000-R` )R (R0 'R SC 0Q`QR lh1 h1 kPPE` P 0!S Q} 00~0000  W8A 0 4PC9P xur 0 `WIWOKgPBKaP,KQP {P Q|ptIhv T(K<.%.(&-. . .2z(NSr| -LM0 K0 2 K -LMMJK,@DP`|PPp DuP P JH< DuP, DuP P JE嬣P pP 墣PdKP sE Wx4 0P  0=SP O|P U'  cP ^PP pPP PPP  PE  DJBJ@J(KȹT -LMM@`A.Kp@; BOPP lP8`8`K rdA edA(00#(0/(00#(0/(0:(0/ 00/000/ -XQL|M pr@808 00 F 00 c0s"`@0`@T 0 0 00 0 0 |0 H=p0L @0L@C$xK(0:(00( L xK(K& X-$ , $. -L@P$1$09<00cC1a0$S  2 R SBo \ (  ( #B \`Coob`V R(  ( C\( SBo \S B/o" R0 S$.k( -0MPL`@ 0PP`0  p W D4P0/W  T#/0#`0KU  p-` L$M(@K`$0 iP 0 0 0@@Pϡ$Kp豢 -L`Pp5@4U050 k0 0S$SS  Q  0LR00 07@2 2  *02L 0.$.8 -LP` @ `0S 0C ^4#0@C R GRE MRT00cS800:0 sS00$. -RLlM0+;`0d0 븒帢T`0`0 ,0K(0C0l0 23눂"0TK0 0`000 0@0K0l0J0 00F0TK@K3p Pv ?0[S @0[` R`S#a0CL # 6@Kzpd00g\0 0X0 0X0 @0[SLYX K\K@KnPX0\`0 F3p@ `0S 0`0J# 83 0`  <C0&K P0X00&K 0T0@d0` 0bS*d0T@10P0p0@0g00 30 0@0K 00 F0 2|W@g@t0J0@cT@@ @(K$. .0.0 Q- LL 6 -PML0`p@p20Z2N3 0 Q* $K$.$0 20-LP@ Q 0S(< Q񟗊x  ( D X T P(0A1@@:(P j ; <(Kh  =(PB{(0`(P$P@Aq$ N(P>l 0 G(P?e B(PC`(0`Z 7(`DT n(0 (h(0  (b(0@ (\(0 (V(0  (P(0  p(J(0 \(KhB(PE! Kh9CPPQXaht| -dLdMP`PBVTK00 `ph0 1$"0 2 0@00 0h0@@K0 00F0Kpp@Za2P^ ?0[S @0[W`S#!a0CL #& 60dxph10;\0 0X0 0X0 @0[SL8X K\KPX@\11p T l0 *B d 1d l0 ̌ \ P&K0&K R0R0&K P0R0d0\0 L\0P01@`0S  0S030f 0`(K. 0.$. -LA\ S R ^ ^ SR LPQLpPX@T L`V P@WYZ`W@#@3W@#T a af(00 0( S/ A00 0 0 00 S<3:} S;3:s;:0/ 0-PLQ@PQ 0 0- 0@LPPPP 0 -QL0S010 40 40P0 00 0W <0 8 !18 <0PU0P:0L U0S 0 P CP(KX-&t 0 $..<-z( -pL M`p B R ?( *㺍 P  ruE'D74F'8G'PP   8*0 8L@P  C0$T  K@. 0-RLMPa00 @8K nQ   @BK0 -d@L4S04p TU `040$ B0T@. 0-@LP 0K0h 0-L@P @6o0   -Lo -Lo -Lo 0/@.&/00S/ H.t1 p-LM0S/)RPAZUL@}&P0!$0C$P@ P `(!dP00K:0 K PPf/K` m/K卾p[/KU  0! xAʃ|PP*ʃ <C@CKpH.$..+6b֓5H,&edAD-x0 -PL  PT00\00SL(_ =H.$. 0-XPL0JT 0<H 0'P ? 0$..//x0 0-LhM@T\0\ dxKxKPP x K<u @K0H..ao -Lu3 Kh////0 00-SL@P o?/0  Q 0R@@T ,$f00H.(! -@LT010K; T9!  R  @1!!p(!!(V ! * \ `"da"ha"la da ha la`a!`0` @Kh"H.$.,0 0-*0L! C 0$..0.40 0-L 0#1 0$..0. p-L@AM FKA >/0G/Kh|1[S XTPT00`&V 88G?KG/K( KpP.]M.+ -LM0`1P@g01P|!|!  ttatappPT@B/ S  C,IKȐI?K* P&P  IKYrP0=SIK*$0K P@I?KPKPUP  P 0 lM P /KLyDK$K27T. -LMOKP` .pK r $B 2S0 1# n dP|0 GKGKphlW2[S  TPL} [0G/1 K ..&.)[j:. 0-LP@3K0 1  0%.(0 - L P D-1 -`L@(@P 0 Kh#0 0-@PL0(1 P0 1 07 0-LP@P $01P   070 p-LM,0 *0(0 0`$0 P0 0 N@P,K@T0X 1 PwP08 1 T 0G/1 Kp蓚3 -LWMP Rr@` |2xmPQPT T TA<20$0DP C?#P "0("0)080/P !GK0!GK1X  R) 03J)?Zd1d1L0P PH1H10@TP4!44< G?K@p0PVoK ! @ 0P> "6 K? 00 & F 0 0 00  S@(K&P..%.?`. ..&.. .  -$qLMP a@P@T  帥 X{ _P 0 (Kkcp (K0cL뭺P (0 P,0M <($o K.%N~ -m0L@P`L408 R \p''3g)40048PUS00S0S00// -L MpWP@ 80# 4    $0`00   R,00r0 0p`0W1Q,  R)  0(0S! Q 00$0 2 00 .,\ 00 08 㓢"04  00S p  p(K, p(.$0 0R /S00/'. 0 /'. -4LPiKGM@M`F< 08pP ' K@ @70S8 0T 000000  0GK 0 0A0 AppGK0CCd-T@@Ӣ?80$K!|:1l&R4'0' B B4'0'0'  ,'L K4(. 0-M/L@E+00; 1<10 10$1P0(10 0-( L@1+0 08'<7@70  -鼀L(M0p`@0T 0S   T0@ [@ 0D DKPU DKb(P _@$K. 0 B?"#N((. 0-L@Q'  $ 8 L (P (Pp< (P`D (Pf@ (P<4 (P,8 K0h0 p-LAMP`@ GK" V{  $ < T | $ L j(Pw ((Pr #(Pm(0`V(Pg,0`Pk(Pa00S0 `HLIP0S@!GK}(@02,(PMT <X0S !GKm(@"(P=\0`&`0S GK](@d0Sڬ GKS(@h0Sp GKI(@|G/K m(Pl0`S )KpSH3 p-LCMP4`@ GK/"VAH  <`K0@1K0S G?K` 8`V(@#(P  (0Sڌ GK(@,0Sd GK(@T00SD GKۼ(@4G/KKpS -0LBM`@1KQ_  | ]KP p@0S 0SG?Kp(!᥼Up(@]KP p@0S 0S G?Kp ᎼUp(@^G/K#(PWD'(PR,'(P]M0'(PdH4' (PTC8'(PD><'(P^9@'SKqrsuvw -L,M @PTp`VP06#\ @@03/`P .20 `M(0E S 0"00 G/  ( 0 3P|7/Р(Ki -鰅M@L MPBP 00 p R40Z08p,6K,3K`  0 S  P   Pf0$0 000?KỻV000(0S0b>K 0C$ᬻ00,0S0b>K 0C|$pᠻ0000S0b>K 0CP$@ᔻ0/K 0b.K0 B(fP)p0p`00; R&pWY0 0  88 PQ+< 0p PtSp3L@Tg(K,0 Sy0n00b>K 0C,&K,#I0 #00=0Sy0n00b>K 0C:000;(0"Sb>K  0C "*0"00=,0tSy0n00b>K 0C0k0` 0S b>K 0C $P" p0 ; 000S b>K 0C" p0##0=0S0b>K 0C!0p`00=0S0b>K 0C!\ܺ0``m0S0b>K 0Cl!(κ p0##0= 0S0b>K 0C4!Ὼ0p`00=$0S0b>K 0C 寺0``m(0S0b>K 0C t᡺0p 07#X;0 0b>K 0Cᔺ0b.K00 Bth '.o=y l7#,5>GU^gpy 000S/ #$.. p-L$M`P<K@ᜈV|\ t    < t   a(P (P1S` 1S 1!<K6(@U|(P1S`  J1S 1S$!0<K(@b61S 1S1 <K (@(1S 1S 1 <K(@1S 1S$1l <K(@p 1S 1S(14 <K߹(@c< KKpO 0-p L@&;0@0h0复dR K0hʠ 0-L L@&000(0,0000匍d: K0h負ꐧ -LM@ TUh      $   8 D P h | 0 000 |@ta;(0?o2(0,0?o2,0@MD00@ 00 @@P@no T@aX@`\0?o2\0`@`d@ooh00 S0h0l0?o2l0@@@`VTPP@ GK0p 30 0 0pwiPi@K -taLJM0@sP  0 .@T"     6P@0 0PP@0 2)(Pio ,P`0P`@@P`VU@@@ GK0d ʸ0 0 0p-iP)iK& -aL0PM@0 $0Ps@  0 ($P U7h   81 $ oD1 $ @K!e@0SD7P6 ]sN`sN@_osN@` sN @`M`PP`@VTPPP PW/K0x7P0 0 ,q0A000MoMV#(K0(..t|J61R -@LTP7}p`L0S 9)?o2P0S0`S@WT D7S ` T h h \ \ Hg@DHG, ,0S00T(.%80!" -L!M40P0C @SQ  h  0 L    0S0S 41SY:(PS2pN?` 0` )0d Lpa.  $IK⹴0 (P7'P6S|txp`0 `L 6&@t@0I/K`L0p<a. Qa V  R 006Z0#IK{L0C#(PP&Rs;pL F&a>0x#0IK20f(P,`-0I/K40$1K R m{` p R IK IK0WS(P H70I?K0D7 #0S 0(PSxt s1 `S X0 yH 100 p0Sq 0S(@V 00D0"0IK<0e(` 0PL0%%pI?K L`$bK$aK0SI 0!K00 00R0  0S0C0(K.p(.$.'.y  ., .,.MM'..@M_T! (' PQ -4e0L0GM01 0005U@T3 0S. 0S P% P  :S P P 6PPPұO4TP 4K @T@P`t0#00KKKK˱`P K/K嬱3@P K/K失K/K  47007,'xp0  LP lQ'"@ 41 41p0W p0  LP lQ '" 41 41p0W  D70@70<78'0K/K00lhPl0T00 ^Pv040 VPn00 NPf0 0 -; 0QSVP P HPUV,Q+ P t @= ` D00<000040@ P 0(0 0 P `00      ' P P P P01S >P (K$...9t(.`@(.RdH,&g*=Vw p-0L$M 0 0` 8 "P400CS @T 0S V|Pr 00V@08 S#4  BRa- - - $. <. . l. . . T K :S 㗺 㔺L0K0!㎺TG PE ?@K@!ぺ;  0 0 00  0 0 00 $" 0  0 0 00    0p 000d00`0KpT(.d x  (. ( T '.  , x(.  X ` -L04M`@ 0 D0K>PP!0 00CP S D < 20!TH RW lPP!\ 00 B`Q RDpK 0,!0 20  p!4MoMVM?/ PPP(0 0@9`0Q  P=0 ^ ^SD'20 D Ů R K˗(.0Vb0(.#%t(.? Q-LP` @p pW@d1> R U 0 QVJ 0 0(|DHS1 Z>F, 0 EZC L T qU pQV. !00' 0R; 0S00ʃ ̌ ^ 8@U \@QV8   R8<0\(.Jt(.'. -LKCM M,J# ,"`P0@UA pS S S3&R&R-P&R) C,K B0 dCF0C8 B0r=K80CD _n=KKr K 0C,A@@<Z? 04P04nK04P0R0 0K000P0 A h|p@ U{K,A/ὸ5S(40S R 3  =P ?C#0K 0C!pC+  P:|BK JT" .P,0K@,4[/S1\ "0Ȩ/-P TP @T0:   @/R K>K 0C CPZPP4: S pW>0>+   SբP@]K PEBK+ @  P(*P2 0/SP,4[_oPRS QpBK @M0%00 PU+ P*BK+ A P:?00 ȢP@ˡ@Ợá@(K/z( -LMK@P  㒡@P K⇡ P ꟡0#((R c# c 0("S K  -LM`pP4 V V /@ P% 0S P  P0 0KQpp庍0P V@ VP00 8 0{&(K0@ -8MLM PKA PKAP KK A@⍢PPYKK A@™PP ^+K@ KK A@@PPhO.K B\P0i.KH BK8@ڡK,@+K@ KK A@ޡ@P K@ .K BP0E"+K@x .K B9P yF>K0C"1PK|@+K@` K\@.K B$0K8@+K@M K@.K B0 K@ @PK@ @P+K@( K@.K BD0`P+K@ K,@ K@(@K@ ɿ`P+K@ K@yp1BK0>K0C @զBK@P B.K0 BH㦿` VU Cη 㬱 K&%@&C-pj@cPW ˑČȌ̌ S ̑́  #3S#X0 S* c T @!PUT Q0R@$.Q0AQ20n/2S 2!R !!!! !/ -LM K   04 8 <0 S0 2 K -L MK QQ@AOoB0$0 "^"R      /o"^P Q( ( ^  H (  H X Q  X K0@- O@@T? @?A @ @  @?A @ P @ @ @DPH @ 0!"?0"0R000R -PP``bULT0@pRO0<0S 0U 0V*L L@$. p-@L,M0`sPx0 0p00h000 060 00 0⚳p 02OKpt&t S 0-@L(Mt Pr0P 0h0 00 00 D 00 0 ittp !K0t&\.,g (l -LMxp1p1@l1h1  A? 0@@ DA`<:01S0`01}P4< 4A0P  0R0Q0@@PE Z U04q4 00 !004 P 0*  41@@cDB$0@ @gP@044 PE@(K0.$..\.hV p-LM⓵P㐵` @   `P T00@@@0 Kp -L\Mr,K "W 0 `@d08`l, K00" 04 8 pPP0 PlK؟l KP0ϱlK?P0@S@d00 <`CH0P ?e ?b?W 0VK(..$.4. 0-o_L@PQ 22B@  V01x0t0 C 0`X4 o8 Q`Q#    Y   屮 J\  0 48<8^  QP .B 0\ɯ~ůүMPpV Pih崯?PP P(K$...r W .(. -0L Dxp P |  xt&N. -LM`,K pWp0 0@SRU30PP V1 (E; P0 4 PX 0<RPH1 0 00   (P 0iRa   Ā Ȍ ̌0 \ P I   00q rP,@P  eW 0S p00(0 ((KJ.[. -pRL M`1pS`( 㷮`㴮d$K00f@X񟗃Pu xu u @v v v (P墮`: ry(P嘮0( ` 4 8 <8(`劮 P0( 4 PX 0<RPp1 0p 00 n@j010 `(Pf0( ` 4 8 < 0    K00 h!(`F0S`!d!z(p< 04 8 <( "0 "S0S`! d!E K\..0. h4-AML M @LR `*P 4$0P P $<10 <CP0;<1/ B.K;P B0P44 p0T 0+ $ ,484 5d P!h3$RooY`8484!RQ !R QR!R!RWppRr"P2僯?p84 Q   04 8 < QR   Y  $(,0$ 4p84 S`YQ 04W084 1SJ a1!4a8al20ad!h!l`84 V5 PPE !?bs s? <4 =L!q< f<4 arⲠ!Ƞ*`iఠ01&41&81&<184a`f&4a1 &8&l1aR"PW "0S YpPP @444S᱕zo@ % U01U01 (K(.$..4.\.UU -bMLM0<& B.K0P; B0P46 ೀU{ 2bK, @86 86S BT 1SsEK @P1堡1GNK@006 0px 080000005<6S2 08@6  `0cD6 D6 V `!0`&a?`0`?0`@6`ppG `pc V `!p`&a?`p`?p``06@0S06 \ C>K 8&bK;$ 0, A4bPRP4 (K(..U14 `o/U -lCLoTMd0 0`0 T3p 0l *ʓRP?\Q ` #0A?`p Pl0p0 d0`p<0K0L0K0T KP0K`VPpW#KL R?#K`40K0@0K0H KD0K APaCK@0P@T_80h0 Dh?##<?.*HP0KhT`?#  ?,$CKP0X \0@000 00SP. 0KA0( 0K;p@ "h? 810 < C%K ?PpK 0`1#%KSR`Y<0K0L0K0T KP0K`PT0 SP ## !" L0#KQP X(0l V`0p0@d0(K$.> -|@LMpMd:*囫0K K$K@P!K$ , 垫$K K$.. -@LDM0P00@0 @R.(@7 Q5"$KX4 T?$K080K E>dK$K`p 8KD$K(K0*?`pKX4T00Y%$K+@! @80K P0P@ 0 (K$.  -QL M0@S pT`a L0##6S L0 @ TCt `6S @LX; 0L <0`  WH* 9P0H0# 0Pa^P X +LPP400400 /SPP0K{C 0(000(0](K.$.֗ -(QΏLM@0P P R00H4S 0*En Đ0 00 PR0/a ?p*H4 0|00000R` ?vD0`f`0 00Fk00hA(Ko茧 .0. -L\M0P0 H4` S@"0' `0S "%K0\Xt$t \ H0( ㅪ0S h0# %KP00P0 `00s%K"b X4( T0X40+S R %KXD0 x10*KR K?R%K%KKeKSR0,0%KE`Vp `p%K`"0%K 0H40H4`00s(/ d0'"0H40CH4Y0fYڔ0V0I f` %K 0 V"u(K.9.J$0.y$. -LTM$KK8@;SVt( `0/ -p;$+`A`wUsp`΄PaTWkP[VLk `k(`kf`˄kt)`km@`p㺞+`Iu`knr;+Fv `p;+`A\7,h ,\>o *0,`>e 0,d>h^G&'ک0+RV+ R& R & R  0 IP  A< 0 A@-m ~#K G᲎$KK#Kp 0 \6PP 40tcp˔ ?%K?.%H K0P 0KP0$K #K 0L;>p?K>C ?#K0SB b0 WV U  ?$K8 I2" ? @0i1!p!SRb U KI081!0  ?@01!)0! A0`Rp`A>`CD0 V0:NCP <0 ? < R R0 D0C@j0F0 ΄P`L?Q0P0- 0V L30S 30S 0- 0p?H P -=`PZ`p` L R0 LZ0 `? S0Q`L `- 0`?0C`?P 00S 202 0 F0R0 ⸤0 ;S`?S0** b@>`CV0p?S*?V0^>Ђ U r *? V0 A0PExN0SU X1b0p/TZş 0A 1!%`( 0pR ?R`pPu1``p- 0+ V000U00S00 U V00P 0`#K`P 0 tYP00  0#K`#K0@ 0#K(K$. ... 1 (.%˗ -EOML MƧ`VP :SWNK- @ N ̆0 L R0 N L0 N 0 L 5P ` L``N`r0 ,Q.K B.B,K B$`V<KA ?@W?.$㢦 〠0**(`- }a> 0RL0LC L0 p#X &* &;6;604 ;S 87; <7`7D'0`7  t30S#0 @SS HP T@T@0L T L, < LPH1L! bH!@0E4 04 4bsP 4L`6SCT1S@ H!R= P0C0.p! p!$T(T!VT1TpMcR L K NnF``p\p` V $S $ 4L # R40C4 10S 4QK0KP@T1*K J 0YJ700%48 @0( 48P@ 0(@ R` U ` pH )0S %0#S 0 0R (K(. 0-LM@P 0$0 0 0 0 0 0$K 0 p 0S$ 0#S n0 S   00S 0(00 00 00@0 @S0  K0 0-.L@Pp00D U 0 p 0 0萬  # 0 0-L@q2 `ۇ`AQfoP` ̇`t2PPP`V 0 S   0 嵇  p-|PLtM0 K 0 +p@ 0KK ᓇp`ᑇ@ 0R Kp(. -PAMLM0Q@p00 `=7008 8  XC>K`@V CK/0 0R (K(. -@LP`pP \0 dP \7000P P0P` pP00  ( 0-@Lp00000 l0-@LP`pT T 0S V P @ Kh\0 Q0-P@La6rCd$0U JK0h>G 0- P@LQ,<,08, ;0ddA- 0 0 8  D #0(00K0h &/ -@P#L:#l000`V 0S 08 B  B  0 -`p0LP@  @PlKh8  @H, 00@L^p D 0 D 0-0LM0 0Pl0@T- 0S( 0  R Q H R00 2cP000 jpP QpP000 0S h1S P000 @ K P0  0l0@T 0S 4,p @K0 D0 S-L@ D0SH 1C D00CD0H 0H0L0S L0SP 1C L00CL0P 0P0\0S \0S` 1C \00C\0` 0`0PU aV 1,P0C1 `$QU (aV (1,P0C(1$ $a,QU 0aV 01,P0C01, ,aPU`V s0,P0C0 ` -LM@}0  PP @0 0<09c0(080CCip C C C#KhlK0 #0(00-L@0H+08,0&00D0S0 SK0h+A7 0 S0-L@008,0&0 D0s0M08, 0! SRqK0hۂ -LMpPh@4 D* D$ D  ! D D   D D .00 D+ D 0s@0 D+": D D !9 DD0!0 2  0 D 0S؀D 0 0 0# 00 8 0D(9 D 801Y i8)8#4i#,K!=Q % 8 P0 8Z  j    ,Kb8"8#4b4#0!  D8 D\X@Pp+ D 00) 0S& gPX  \&   X (KoX0S X6 0 @\6T:(K@ 0 S-LP;08l 0$00 :0 V 0 P@@@@ 0$00 :0 w^ 0 P@ P@$00 :S@$ -CL$:0$l0`V $:0 MVPDZ$90 G^PDY$:0`$00  :0@Y0  0-0LM0K#@ $ x0 0l0PU k$P P@2 < 0 P$P P2< w# 20  l0!# b)00^  KFp pP P 7`d Kא P @H a K-p Vp  0pP  ;#)#5 Kp`x *h #0#fK0IMg< ~ 0-@L@ #K0hA$#K0h-/ -aLTM0@(0 l0PS 0$I0@hK-p 0h0K p0h KfP ; UpP @ pf hF U㰀  @00<0( 0R  K(. -LM@Q`p` R  P0^|0 0 WV  $Kk$K, 0-@L 0S0 0K0h -PRL(Mp `l( b @P 0S 8، 0y 0Sv VH0S$pI2`P $p$0A0AS`v $0)D0s\ S  $0x00D0($ :>Sk( 0RE$Kk@( 0R=$KkV3D0S0  H0D`S l`Ip 0 HK[!2l0V HKP 0@ <pdn(Hk_( 0R$Kk ( 0R /$K(.V7g -4LM`0xP00 E @ # Dq Q  9 1P$0A0AS 0,K2@0 K2 0$ .+ 00 0d0S P 0h Kd&, E+ 00 E 00f .`0 K   U\6Y*X0㙃# EP 0 K0 0  0d 8`p 4 E 0 E E 00' 0SI^ E0!0 m E 70 8 0S E 60*p x, 00 0SiUP Q00 0R Y(K(.|( 0 #0(00-L@ 08, 70 A p K0h -@LPT` pVP00U0V0S&` 0SY 0x8l3' . 0N U V   D@ 0-PLMP@( P PK PM`!``< T00c0@0lHP P) P8! P!P  P 0$! l0@T @ l8pxK0hlK0h`K0hK0hqK0r)$ +4<JRc 0$   Q0-L@0  0S0K0h -qLMpP@( "l@P00z 0S Q,;,0 Sl   0a(0K ,K Ptr@P00O l`P 0S   $0$0= = =0S! ))0 S   000l0 00@l0 0S 0@ <:@U, K 0S P 0 S   0d$K -LM@ S_T//pTTL0 l0 `R Pp>P 6 PЀАU# lp-P0 S   000l0 00Pl0 0S P 0Plt( Kl8l|$K x 0-L@1p007SK0h0 S 0VS0K0h  -`LDM@0l(0 pPP' TP T70 0k@=0)`S P <0d KP  <2=@ ( 0R  K(. -L$M`ppPs0P \ XlP 0,@ 0 *@\@P0# ]P`@P`` `@ .@V`@U0P` Z @0 <  <p@g 0p0@D`@0@@F$<0 <0,K` 2`p@@*@@ <0 1! Xp nP0@0  NP@ kP`pPj xPz :0, <00U 0hN,00  0#K00U%lP 0S  N#K0 0* N 00000 T <00Ul0@ 00 00U@T @lP 000H<0 0@0C0l 0@(K<FL\ lu%&X -"4L4@KM`0dp P(0 42KW@iP0 K`8 8#4`#! @= )=eK耼 -DrLM0`00 d0PSv KpP P0d0l!(0S SP@ V@;S$ K 030@ 4Kyp` K   0-@PL0P 0 S   0 P 0 S   0P 0 S   0$P 0 S (  0DyK0h 0-LM$KzpP@P P0P0000 P00P 00$P(00L0zpDK0 -PPLHM0H0 1!h,0S , 03/H R :@T4 \KzeK WVTQRQ 0 S   003/00(00@(@T R`0Q$KD  R0$K00D0 0SL'L@K0 0@<0KD yp0S `P 8 R<0@<3/$0R  R 2/Ksʚ; -,@L M 0 底 :KH,& -Pp L@` P ڢ30#P00SP00"3 0 ,$0  Kh臀&H,& --L M  K -x@ML M0pP(0 0 `BK@*JB.K B(0( 0R  K(. --LM  K --LM  K --LM  K --LM  y K --LM  K --LM  a K --LM  K --LM  I K0@& P-L,0 V00& -\`LPp@T`0P @ 0-@PL0mHRNwaaUK0h! 0-@Lp w0S0'K0h 0-p@LM0P K0 W Kv0 K0Jy p9[$00R !K0(.i -`LM0@ PK 0 4ppb0  KI0P K<ZKyp :[$0 0R K(.i 0-@LT MOY@0 0-@LT MQY@00Q  R0 # R//R -L M@PPG 0SD  P> ` P7:ᵛpP 0K0!0 0  9 0S@G40  000040@@ 0 P@0:S 0@000 0K0!0 0   0S0000K0&0 p-LDM @PP ` Q@ XKpU HK P @T0S00 0R (Kp(. -L$M@p`T6 0S1 P, P0S S $ R P0 `P #L0S 00S ` `000 OP `P00  +U@*@(K P-L P 0Q?00l0P $0// p-|@LM0`P K 0  K0@U K8P w 0pR Kp(.i~i p-L Ml0`S 0S Q  K" $P$0    l0@T  R0 $PU 0R:D D0Rʌ0S  R H R 0Sx Qu H0Sr R0S  R H0So*`P&`P  `P `PV `PQ_P`P _PM0S h1S0SsP 0S4 h1S1 sP,h1S0S ysP HP h1S lsP @ @0R*p $ R 0 l0$   0P00@@@ZPd 0P0@@ @ QKp -\QL M0(0 0 Sp@`6T5 0 S 0S!R DK@`)S0.S /S $R <K,` ?o2R0S 0 00 Q@`l0@T 0S @00( 0R u$K(.ov 0-L@$p0 !p`0 -L]M1 5`0PF/SK00 u9<1 pPD'p;@ !p \5\%Z ! Y' 0S 0SaKfPPU ]K P PZz&1]KP @PnTt40 0R 1]KPZPP PZP# 20PP@L0TP0 ]K筝PL0TP@ @X0 ]K矝P @T0TT0  T RP@H0 ]K狝P @D0TD0 S@cOoB@TP  RS]K&PP]K}$P]K13/ ` ]K0$0 0S1 e  SK < P MKℷ9<1 1S/K0181 ups <1 p 1001 RR6*R 5R R/R 0- R R0( 0S#D0S U 0P1 Z1P0S D0S! !PP U ht0(01 = 0)*=)P(0P=S 0SD0SPP#0 0R0S ]#pO$00@0# Pp0H0@0d0@0UDP #D0000@@@(K(.* 8 i3d@P/ 0 S S S//P0/0 S S0S//@-84SLpe0084A 0E80L -LM4 @`P_=㤗pP llLPP 08 ZR `P6 R0 8 0<0 <0P&T Η@P( 08@0lpPh0{P 00P A0 @P  :M@P0 1 a 40@(K? -RLMp0@00 8 ,0T 0:\13K0  4KP00 P3K30[S. T,  2K_ @ 02KP0A\ 0SP20[S T   |_PT 0@T0@P`TpGorpW00<00 0R tWm p(K(.0& -PLph  @hP$! (!h6 0 l60 00 =000 9000J@@ yP,! 0!p6 0 t60 900 :00 9000J@@  !`6 0 d60 00 000 P000p@@ -L$MRP` 0S U00000V9 K/@PC (0K 00 p0  (0S V FCPU @ P TW@ /00DV 048 DC 40 8 0U K p-L$M$0K 00 ` 0P \J$@T `8 8#4`#K! s0 JP@ P@@ P@@ @Kp -@L 6`P,p 0e U*P*$`P,p PP(0e U*P$0(0$0 -L\M\0 0``0 h>p0P00 \010CzS6 %33%3%3333333333dLd| $hT3d x$$3p%3333333<T8Xt3l'&((4(33|(43(((&4&'((()3)p01111 211%&822p22L(d(33((3@3\3t3`po,%,T <P v0 oPPQ uT `5 ,GP`9 `<` pPw)0D"St  x, 0,, , T102P02 P 02 vP tqP T<, ,,",0hT3  00p@,C',,",,&,,+,,(,(.1?^z9 U "*FOjv!KcKU*pBKdz"-18?9 QJTS @0K0D0K0H0K0L0K 080K0P0K 0T K<0KL0P0P 80<@0TsP  7H00P 0<80TdP00D0@0P 80<TXP| T @0K0D0K0H0K0L0K 080K0P0K 0T K<0KH0P0P 80<@0T8P VL00P 0<80T)PD0P0080P <TP@00P 0<80TP8 T =P+ P0S P ,, , PP  l P P P  P  P  P7 pP. @KDKnp  8Khp U `P 00DK @K$ 8K@ 00` 0` 0TR P! DK<p ) `P ,pK' $ DK@ 00 ``* l^P  WP80K0-0 0/  D80Sh b <PP$/   @PP@MPPT00 80K0 0 0 D80S= |7 1 @KDKP/ݏD P0H@0 EP D6D H! @0D&0 @KDKP/ᾏ< P0@@0 EPv <6D @! @0<&0T QP LP,2,, 00,,0 0,z,0,t,0,n, 0,h, 0,b `PpDK`MPHL PFEP! L6P L&D !|@TT; @0K0D0K0H0K0L0K 080K0P0K 0T K<0K00P 80<@TZP~ 0S  sT TsPTk f T Q ^^p S,8,,!,,!,,0,,5,,5,,0,,';,T",9,Ak♏&n-Ak⛏o)Ak❏'nAo⢏` 0V00 `0X` Z T` t VX$`(  ` 000T \0S' P | P80K09C80Sd  8 e@PT ]0d0 :pP00paPP 80K!00 0  C8YX ;=GPPXP X lP a@RPpP8 {!DlPPN@?PpX |lP @Z@0Pp ZlP .V@Pp HlP \@ Pp06<lPP PylPY~ dslP; tnlP ilPSn clPPg\lPPa VlPP[ PlPPU JlP PO DlP@PI >lPXC (8lPT\;D0lPU *lPU \. |#lPU hlP\" TlPW @lPW , lP\ lP\ kPV QX0S <X0    80S~\?o2= wWt.a@RXP00kPRp ~pP \0S0<0 @ <0RdPRQ 0<0 ,@T d0Y(X0`0 p    P <  e \00CS@D'3 R@7 `0@T  `P0080K00 0 `A8XpW@P 0 p` 0S< :LP} 0 s<@  |BPn 6< &!|xvT 606, 0,|,8,v, 0,m,7,gT_ !mP00^<Y, ,S,7,MTE P P P,#,6,#,1,4,+,3,%, 4,,2,T 00 p9 TTm\Z30 0 R 6`TorpW C,<, P pT /PP004KP0p,P40[\X0 30[1p[\0 20[`0 0S$ T X&#" R$X #S  X Z Z X\\\ `\  R XAPd0\&T0\604 [pX` 30[@020[`010[0000US@@ 0S 00j/v P@~Hph xX 0S80K0x 0 0 @80S 00;, +AP~.0,@$ 0 0 0$0(0!(KvCV^gGG@?. H$$q:dk(.[K -LM` 0P@ 0 P 80 4 n4 80P PbUT0@$QW8 0,0 (Ko&(K8DF -LPD@P '8 Bpf`p`B`pk`pl Ɠcƃ 00Ѐ Bcp0BBx -L MpS`P@7 0 Q 8,K# 30(0K0 0 @p0   |    P  U 8 cK`p $K%&XL. -`QLpH1SP 1PP 0SP 0PP  <1P P@T`Vd6S d6,P0Cd6`hVl6S l6,P0Cl6hpVt6S t6,P0Ct6p|V6S 6P0C6|V6S i6,P0C6XKh -LMP 0 `P Hp G 0 G00 0 p0S# 30,$P0`d6,P0hl6\,P0pt64P "P 7l0ȠK0 0 PH t0 R  0P 0 +0K0 B0TK0 P } 0S 0K000 0;0 <0 @0P 0 S S0P\S  @`60d61h6`d$1l6(1p6,1t6016hlpt060<,l0P0 , 0 8 D)F@7Th:3K,eP(K 0@?o2@ @ 0  KKBp)  0 \ \ \\  #\ ;\ R@ \  P \P  "P! #PQ  Yؐ ,K5P 0S 0( G@:$ G00 0 0 @0P 0 S S0P\S  @ PPV 0S\ `m>P `\@҈`01S@\@A@>H P 0S6 P3 @p 0P S% P" @P_]00Z0S  PQ XN0K00K00 0 0+B@?W   Z R 00 0S G$: GP(K 0-L@P 0 S   001 -LM PP@0 0 1!O Q1!Pr0`K< $0  @lpK<  ~\|X 40 P0 p0 /fP bP Y   0 Y|0  0`000 l 0p0`\00X 00 0R (K(.7VkJ 0p t00x |00 0/ Q0-L0P0 { 0Q0@x0p |pR R AR 0S0\@00 P/0S/\0 0-@PL,0, (崼pxK0h P0-Ll0l h埼@T 0 S   0@P K 0 P-L,0,  Q0 u\ 0-@PL,0, (ePP 0 P-LP0P  \00S800 0I0 0 \00 -`P@Lp \0PV0U0t00PPxP\0PV0U0|00P P-LP0  Q@`$p l0d dP @T |0 |0$P P0-LL0L BH߻\0@xP00 S |  0K0ht -@PLP1!\0 `R 08, 00 1U'U #P $P UxPPI |0 |0$\ \0R0. 0+\ \0R'`P"|0 |0 @@UP $$OP 0R pB0S tp70S Lhp(A .= -,aL(M0Qp(0  1 !F0\0PxY@" Y.P 0 S |  0p@P 0 S t  0HK0| gHK P \pP ]|0@0p|p( 0R a$K(.L -LMP,`K,pK@0U0&0'8` 0p  UB3P <Yd 0U@0  A UZ PU\ pP+ >  PB\\P@@PaQP``uPQt 3 xqP \\ P@@ZP  P R8 0 0 0 0 @p X8 0U A0U/0Y0t00>P\00S8,#:* S R p 0S 0S |I00儀 pa40S t 040t 4  000p t0R(K[ P-LD0D 9@ 0S S/00do P-LD0D O@0S S/00do P-L0 cֹ0S S S /000 8P 0SQodo -LPx0x t妹P P P0p 0⎭ol/00d+o< P-L0 }P P P0l0coP  0SQ@o9/00dLo -PQL@`0 H0S Q 0 Kh"0 KhA0( ep[Uoٚ 0-PPL@0  Q0 0S 0S 0P c0%P !P 00 S 1P P  BR # BR #K0hfvwo -QL$M0`P(0 1![ pW W;00@H8 d8$8dD#4$@c@Oo@T. $ dS) 0# S @n*0Q 000S PS P' R* Q Ao/00ꌀQ0 DK0DKCpKDKYP D08 @@v( 0R ܂ K(.dm(.o -0LS`p S00倀00 //00WPPA@DBNANA@B-Q0 `RôT@d0_D 0g @S01bSHP@T 00@W $0$ R @(.yo P-L`0` ` QT0H L0000 04 8 <0#80do P-LD0D  Q40, 00߷00 00 Kh7do -@LTp P@`@P ;@P` pW - ` -LMPp@@`P$VP0 2dK -SL$M< ] 0CP00 00`V00 Q =@4 f0@0 0D0 D0T( 40  80 0H0 4 H0  p PH0 _R@ P  `PP 8080`@0S00 p`P @AP8o@`pP<0(K -L$M0`@p < 80 P W p0S6]GPP4 P2PP, v0P6S# P P P |P lP \P LPPPP0#0!00 000 0P4  0@0 6 P @0*Tc*4 P 0* Gc0#0!04Pz .^L*0 4c4P n D0S: *S00 *"c4P\ @0)c4PR H0)c4|PH $0)c4rP= p)0 b0l0Y 40 @0 V@0P  0Jl00S  @0  0 0@000ItP 4`808,0 0$5 @ P P P P4`X0E?o20S 0SW0E?o20S p0SU8FP 4`峀$ U8Pp4`姀$l夀(40$ R ( R H'! R 04 p 00000 $P 0`4P 4000 & 0Hb$P0l0` V o$P`$Y 0`4Pn 4000 X& 0&b80,0 0 0`4PX 000 40V0p0S p0D0 4 0`@ v@ PA 4 0 D0% aH0S' l0I0$ 0.p` 004 D0 @ V@ D0P  4 0400 l0$0 000000 X0E?o20SW0E?o20S)I R @ 0p P04P 0@4 0 T p 000 00$0K4Kkpx0S |   lZP04uP |004 0 x0 YZp 000 X`Eoob`V(  Rh @0GP04NP 0@4 0  5p 000 80"800K4KpCU 7PQ04'Pu 004  7%U)0S= h1S: gXP6 t0 0p0YP-04PQ t004 0 p0 YpF 000 U DP04P2 004  D80h1S 0C @ T04P4  10PPP 4p401S @0P 400 !40< 0 4@T@D P U4R(KA7&/%2<FENCP\ju~ 0-LMP Kp K00! p@ 0@PPEP K0 0-@LQ `0D0 s-L`@s!S! !0pSP`  R H R pP6P pPCP CP l pP0S h1S VWP 0h!pP7 -LdM 0(0 |0 1PS`0P K*p@ (!R 0 p0 0t b P`3P@ PTpP 40P 0#_ }01S V 뀀@ p0P `2"_0@\Kp`6op8 儢0\K[ol h d ` 0X*10C>S00",K!@03@0lK\KLo\KNo t0Kt `0xK\0KBY`\KoV `x`vt v%V# |Kdp0S @df0|0 |0#40 t 8 4!SP t`S` 0[0\0 |0 0`V 0 \0S \Kp@ 9 0 \5p0|0 X,`|0S\PPEP T {[(K .G,9Ax\Gd{ - aLZ`   0K`(K豢 -LMp0 Pp= 000 P3Z @ @W @00@S# t00P` Z 0l 00Y0T YXp 00 0p(K* -`LPM @0Tp(0  R R 00H0@KS0K -00Kl0#0I0<W8 @  0 Y( 0R sw$K(. -L,M@ 0D S`(PU000 0 00UPPP0# V3 pv 0S70P0tA P =WPP0P@0 $v@PW 0#0000KY0"EY@` pP 0XH*p V0"0 0PV0S0 0@"0L0 E0  k V @ 0PP V0!0 0 0 0 00,p0i0(0 SR$P (0X9*040 0 p00K0p0p4 KDQp, 0R ftKp(.A0p/P 0-@L0M0P( @K0 r @K⑻0@ KHeQp (0  0R 7tK0(.6i(0 0-I @ LLp0ll0l0@0I00 p-`L4M0@P( HK 0 8 HKWH Kh,Qp 0 ,00S  p 0R sKp(.6i( -PLM0`K@  0  0 pK K` ! K0P 0P [R sK(.:i l3-SML M PQ@0 `5 D3D#DDK\0RnK `F0#0*5K0@005 |0 $5 0)EK 5 T@T/$~$%0$5 50 5 @ P \0`00 50 5 9P 5 0 5 T$5 0$5 $5Z<0$5 0$5;$5 R 50 5 0#$5U~K 5@0 5 \0 pG d5 d50\EK@ [%K0 =xYT 5@D@@@x @! Z 0@0 K @G5[S\0 K@!H[K A!YI @ 5 $ $0S0C000@ 5 \%[\5[S0C000@ 5  ` `0S0C000@@f("(@qN`50 0pR` r(K(. -\aLM0pxP(0 00 "0@0 00 @@0K K@ P @ 1tp@2P@. cP @@0K Ktp@@P@ KP,0 0K,0 0@T*00U00f@T@( 0R r K(. p-PLLM0@`@ `K 0  `K⿹ L 0VO KP0K/ K00K, Q? K@0K< 080V` K,~O 0R YrKp(.ii@ -`LMP0@00 0 K⌀h K⇹H0K00KpPK⣠KpK&dK 0Y<0 $0kK80 40lpK K,?O0 0R r(K(.kii p-@LKM0`P.QK 0 , QKK031KKKMK0Q/K0,O 0p4R qKp(.Ii - QLJM0@.QK 0  QK!031KH0KK0MK0Q/K00Np (N9O?Ka $  P ```$` 0 0 P `$b b`Vpb 0R qK(.ji -K, WR 0R !pKp(.| -L_pe -LV 0PQ -LK 0P: \0 -L MK00  0K# K Pqp  K -xQLM0@ 0 0H 0`pcK cKc/K0Lp0h!8 0(0*000R c/Kh1 Lp08,0!0 .QKȾ QKQ/KLp0VS dQ/K\Lp0VS < 0R oK(.liHWiHPi Oi  0/0S// 0-@LTP0q00 000000 -@L0PS 0` 00`pKh" -LM0P00 0h`K0000K00 0K0@ 0 0?00 80Zp h/P)dP[c[ 000fP!:0l0p0W' = R )0 勘0P p8[[ 8RP- 6[[8S( PPU'U% 000p00 ܍0 ׍K0 эK0 .ˍ00S K3/00 0R n(K(. -aLPM0=(0 (0p46K05K<5K08SPh l \K[pK%`0K@)00 ◍8Y@ hK }8Y@ 㨽@8T  lKo@`0K< 700( 0R ln$K(. -L$M 0@0SP 0 0(#Km a#K4  0P1e6 Q4 < 8 @00 #K040 0@< K<K XKz`4p l0' 0 00 0@ , ap `(Kʚ;ɚ;(eA p-L M$0P0S@$0 ` ʭK000$0 |K00$0 \ 1p@00$4 00Q0 0iKp7n -`L0PsHp@ 00 0 <@Զ̦ 0-L@p`K0h0`p80 0PHK P K0h# -LPp$Kk0Ԁ0l0`V* 0S@`T@T 0R0$ R 0pDP pK p $`$`$Kk>0 -L@M `Q P@ \ K=<0wp(J 0@(J @ $} 0R mK(.0 S-0L S  $ ( ,\ P 0n00l0 0-@LPT P 0 @0P K0hR0 -@LTP`tP00@ 0Q P,C@P VP  ⦴0  @ @lp -LP Kh 0 R 0-@PL0P0 F0 S   00S 3/IK0h P0-LP0P@ P00 0-@LK0h0 0-SPL@  0`RUPU0 0S 3/ 0S 3/(P/ -\QLM0`pDD(0 p Gp@A K(p 2Ip7 <[S<[Sc.8/P) K# KB KIp KIp p`P 0W P p$ K00"XHpG( 0R k K(.@qB@lBfB@pB -L,M@H0 L P p0@00 `V L8G0S+ `P0 @KT0 哳8`尃[   RP H0PiUP!T0  P倳`` 0X0%0#% %0%u (K -LM   KH KgB -@L(Mp0P 0 (0`S @ <  0 )*K00 2KK00K%$$@0 0"K<0 0 @K40 8p F 0R FkK(.0  F -qLuM  (0SyKh P _K=0)#QPPE `  PPPP 0E01 z?K0C@1 VL 1U{70@0LV zK@ + a(!("$a$" 张P %V  ܲ1H + $!$("( 张P P +   ἠPPEP`b@0;```@g@AP0 ARc @ =0 0  00H`*00S C C@ Cd$ C!d!C `CP@ 0Z700=@01 00   0 0PX@*`P 0T000000C CCh((("$h$"CC PC` g!(K( -qLsM@- (0S&wK,mK!a *K `0*K ;K)K0) wK0K0K0 0K0K0K0K0 0K0K0 ꂹ00K`8 8#4`#/@-0 c \@SS0Č 0AQ0$8#8"8#88# #  -LM<0 1pQ MV0`000 @0P4` Pl  0 0 Q* R R 0 P.00I R `S5 ;P,l  8 0 P:4RZUPP<RT  RS0`D0 @ P D0@ 0 !S14 u4 0 `8@4 T004 d(KcSc -LM@ 0K00xP 0S T00K -LM@ 0K00_P 0S 4K -LM@ 0K00GP 0S  KT K0 80-TL@K0h0 8,0"00-PL@ =Q %`0l0 R R 0S ``0Q 08 0J` 0=0S K0h6= -pL`KPWP@  04 8 <0X0 004 8 <@ 0 0 ᥰ@00KcSc -QL$M0p !(0 -p@+ $PK0`0% `0aEp8D`0 UEp  8K⥷070KW;3K 0t0S040  8K=Ep ( 0R jh K(. -L MPR@p1!&   G,`Q .00 R 0R00 &P 000(1!$$00 0p00 0p0 000300 0  P0 0:000 P00;000 P006000P00 KUc -L(MP0 `pK 0S 0 (0'y@P# 0T 00000 0 0T0 0 @KN@0K@ K0 @KD]E  Kl0 -LM@y`pV$1PuX%X0S y yCpP` T!(J (y0Sy |(K(V@  CT(.T` #0!0500( 0)K(00 K+& -L@^ P T0 ``0@c^"0000S @T0, 0 8,0 00-L@ $)P (0 0  ?00 N p-LM 0K080`P PU P @P  ή00Kp -tRLMM`0pD1 0T@00 O@Q P P! űL H XHL1PP n0, 0 x P 4 TDgPP\P600 0MK=40MK0 0A @ p051K,0S Z 51["@0K0!,0 U4%D0 #D0 008/Z D1`041 `U4 D0 8/D0 `h8/@10 0R(Ko@10 0R 8f(K(.b%@ugyq -PL@pQ HP`,P,1,EV*0S , Q 0, \H ]`,PPU`,@ , HPM0 -SLMpP`080 @0W$@8 VE* ZG0⩑8 ``R*="005#U670S ` PE`Y 0 00 0K0㺄0gC|  0Gd GP` 0K┭0SC4 `0 G0P`Wg(K2 -QLM6PApQ Q .0 sP+`@P( 0 h#%ab`0(0 @P  (KS(CdiD p0GPUPH00$K$ -LM 80SQS00K00 EP 0S K[4   K -L4M0SP@" x@@ `0D0 0@0 _0 @0o0Y <0K0D y0pP04<0K0D 0 pP4B@P> 0W80 4p  0 8K j 4  0Kˬ008 pS  S S 408Ks0|0G4K$D0K@A0000@H0@0H0 L0S Z00@0T0 @Y<0K0D !0P <@  ZJ  8K⇬ 0K⃬00S pP@008S  S S000 040 iP41S 2S01 00V4 408Ks0|04K$0K@000@0pp@0PU<0K0D 0XpPL <8 4 ZF[`P  0K%8K4K$0K@000p0@``P0 <0S0L0 0`gpqL 00R *"0_000 040 ;H@tX @0h,0#0` 0x0P  $ F# F(KJ -LM@Px` `0 X ,K4%ba\2 i`2pQbKS`kVP PUPPl0S Q2[P,0S Q2[P0ؕ`p1W'*0X"!P !Xȁ`dƜ R S ,Q/K \"P D2 0@ 0#Pp,`X2`fd6X*0X"p!P w/K \"P D2 04`0 0P,``2V@2  `VA AX$0 Kv00 \2KpL @$0 KdL#0KpE?K# KX00 \2Kp LH @#0 KEL2P @#0 K;l0S Q2[ 00,l0HK?K<# K),0S Q2[ @00#,0Ko?K" K0`p,0v 1V*`0`8`v,0v 8d6V*`0`p,0v V*}``,`,0Fd2 1YO*,0X"!P !DXȁ`dƜ R S ,Q7/K \"pP0 D2 01p0d2 0@02@2,0@ }SD2S K↪<< iP D2p0C 0D2 1p @0 @2@ ,`X2Đ`fpd6W*0X"!P !/K \"yP D2 0@@ 0 @2@ p,`@`2c@00 0R Ib(K(._  @ 0-@LTP0hq 0 h0h0l00l0pq 0 p=0p0 0%0 -L M@` 0pSᰀP$H` 000 0 0 `00`00 , ` $?R 00004 ,00 $? 0003H0_@0S3H000s8040${? OS 000800Su l3x8 S :u H3x 8440S0u 3x՝4 8 S 0u 2xʝ 4t0S $0P x03?00 $+?00 |#0(0 dH(KoSH0S0S x   0R<0S 0S110S11H000s8040 14 0P018 0P010 0P0804 p:00@0S,0.0y 4(i/$<p`[ <<x p0s 0S  0R 1sBpp(Ko6x 0(Koh(K>Ebiq??,IPW\ ]H<0 #0(00-L@ K0hP 0 -@LH PR`  P P PLHKhR   PKh -@LTPp \0 Kh808, ,00 \ 0y0z=D0S0S <0S $>  C #` 0 ` ``000` 0`Hp 0`8 `$` ? -LWM0@00 0h t1 0RPx1 D0SX, 40 > R h P 0.t1`0Rt1%   0AR@ 0tWoK%t1@% R0  (T  0Y1e6D0QT SgX, 40 =PU hR 0]k` ps t=w 0vt1 P `00l1 ppP  Pp  _l1h` F 40KEP t0S h! BRh!R ( Q  R l,Qx 0 000(0S0 S= ) X F0"0 0Sh1SS00h1SS SK 6<> C P0D0 aQD  R0 ;0D1 SR8#<0$0ȁ ȑ`$ F 40l1Ko8p1 0E;L1 050000h1[081S 0 i0 S=008  8! $0SC D*Q?h!R RIt R x Sw 0iS2000 $0|1 ٦< Q bR|16  0 <ʦh1 S<0Sf 0iS 60 0<⹦ [h1SW h1S 0iS80 0 d妦h1S h1S00#0(0 l10 0iS 0P    F0,0 0iSu20 0 | F0+0 0iSet00000h1h!0RSLu 0iST90PE08 #< YKTPVp173S 0 iS?M p!l7#0 Bp!7 p12S 0 iS(p< "0 .p! p195S 0 iS^ p!l9%@0 p!9 h1S p10S 0iS300p1  ,K !l!KK&l1X2Sp P 0 iSQ0W02 0 000 0W00  00"9  0i R` 0   84S 0 iS+ l 8$0A 8ᯥ8 6S0 0iS|0 0 x,K` !⛥|Vl1 Px6V* 0bQ0P00S {0  健0000`  0iSg `7000 p, Q*(,lQQP  hP,:@P SE ,0C, l!X`&p, dP$*S,R ^(,l  hQ,:AQ S ,0C,   b B  0 `hK/VÔ`v s Zt1 p#0(0 000` 0 0H00 `0`b0l00l0x0P"f0[S 0 ;if0[S7 S0 S 0 0Sp00 00 P0P 000  L `0 P  L 0Y%0W 婹xP  p  张 @ 0傹 q6  k6  t00 0R X(K(."@8 jb Tx D!3 D Ta R0-PL@56 00K0hֻ DR@ K0h -d]ML M0P00 l0^~K0 pG0`@Gl0 lsl00 =hp 0Sf 噻 _PlP P  3P# "!Q"0Z*70U*KUKZQPPUKP % %Z 00偧 P0S5 c G5 N$  t0S 0 S W4"$("(0G B^PU Ul00l05  850 0R W(K(.  -錑ML,M0JK,@D00 ;K,0CDPpC ; @\8`x٦D @Ԧ ;K,0C<`C0T8=K,0C 0CP80L8 ;K,0CU0CH80-Kp=K,0C0C B0=K0C XhDX4p@ں +K, B0, BU=K0C ᬽPP 0S <冺0 0 0R hW(K(.- -PL`G 0l0@pT 0S R `0W= R)̀P  M 0 D@W 0-P@0 LPy34 0%08,0&0 D0S0K0h p-L MPQ@` R; 1 8S S328R.( 0(0y408,0 0@ R P rC0 吷x0P0 0\t R 1 8S (0w0S "KphKpT 0- @LD08, 40 P0K0hez -` P@Lx巹s0# 0%08, 40 ep$$ ùKhP0@-\0Q0LPN t\ \ 0.000 00S00@ -8LQM`0hp00 G 00@`  P1s0q00S t'娵PU 㡴0P Ph0p0*P00h7 H00%y0d1  0yV밐Р J0,0 y 38Ƕ081P ⑲P8S # / J+ +00 0h|P8> 81  8 ⿝08h d= dP8& ( 81) 8= ⨝, '00 8 K0   =Q K0)  嬸 SPJs2 0% ZG0 00 00,00=0SX   巸0 *+0!  0S 0,K01! 4 \ G 40 Q 0 0 00 Rb $p00@00S( P pбP  0t0x00x0k 3 R 0 000, 40+00s( WKy2P#0 QP G?K0 X0p\0   0 00$0`408 `0``0408 0S 2RPU 0S `0h 0p0% G DQ X~ w,00 $c2  ׷$j,0 0S 1R`$O2  ÷ =P$ #0(00l0 R T Q 00CS %$0$4&8'<Q  W < 0# G @Q@0,000@0,g x0\ G 40 Q`10 0R 8T(K(.HAcSc5|Rnt   -PL㢲P@ 0y`h0 0dm0S 0< S 0Q(HKh(H 0-@LPT 年巴 嵴8峴ᱴ@l0S0 S R R00U0q dp/01唴010 -LM@PH, 00l P 0SB= 0R(   R ( pg TapB( R R( (ap 8 `t , 3000K劺#K@,  0T1CeH6LQ$K4 0 h,@ F_`pHg \0Yk 0?j 0< aP,0 M K ʚ;ɚ;eA  0-P@L0@ U0x0S0tK0h+  -LMPp@T} \z Pt0Qu 0 :0t0}(KoPf0c,  \VY 00U 0SR忳0 0 0SF $01H0H,0,06 000<0tp*`V! ! 03  0 00 0Q0 b @R" 00   `0K80 囚80  ``V(Ko(K>`8 8`#4 MS0Ѝ/ @ R-0LP00`a@`F@@@@ ᖡ Pe PU\ePP/`8 8`#0Z1S P///P/P Q 0 4 8 <\R/0 4 8 < \//P8 / b8"8#4b4##88S/P/l0 0-@LPT P0@0l0 R 0S P 0 4 8 < 0# // P/x0St// o\00S*?o2RP%/0P SSxx   P/S < QP/bo////cSc4 -L\M `0 l tK@0 T 0S@PU 0Sx0S t0S4$B$ t p  0S pP 0t 00 0,K0L0* t0  0$x0 At0S0ppp tp 08pW @ 0P0  $0:9PU >Vp 0儠0 pp W p>00 TpP6 0,KL0($t@t`0S0ppp`tpW 0t 00`pt0S  0t0  p00x?$0PVUT 0S3P/ @pP)X' U JP D (0,Q  " Q X $0Ȍ 50 044P00 0RC Px0L< lK  , x 5 LlK<   ӳpP |0D0|00 $t0 0 @t0 0t`0P00pp(K(.% 7_ -@ LP op`ğ01S 0S 0S 0S  吳T#P 0 @T 0Q0 PSP 0U t0T0x0t0@5 0t-P 8Lpl @P  0S / -@LT`㒬PP(90@ @@@B -L MPpP!e08, 00 P  0@4 8 < R S  ]@P` 4Q@P  `㙗`  ┗ ␗048 P H-0 $( 01048 1- 0p匲p 0S <D弲<V0000@@(KP -@LTP0S08,:* S R x0S 2$EHKhgKh$`  P (0Q,0Q 6 ,0( =P1 0 x t `P Khg0t0S  $0R 0x0t`t0SHKhɦW0S 0S/0S   / -LM`0R00 0  p40 l R50kP P+00  ^V@ VN xP4M@P(Ko ⒖  ⎖    @@  $(, R  w $( 0, $( 0 0Wp  Y000000P(  0$(, 0R0 S   0 04 8 <0Cs4 V(Ko(K] -LM0PS@  T 0p `lD+00 0@0 @0 8@(K P0-L0@T0P 0 S   0ʮǮK0hî -pQMLM0@\ 0 呟`PHP0S ,!,,)1?S @wP@012Q@p+BK A$ PⵕU0PP )p ;B.K 0pkpW PL LLU k,*01 0R MK(.lT -LM KvK Kh -MLM8 0xR8 0 8 0 8 p2( 000 ڜ08 0C0PPB 0少@0Q@@Y@@ TŜ700p >K08 0 Y8 008 08 .K0e8 B 0c08 ; KK 0C SR#3SR \  Z 000 0R L8(000(K(.| -L M@P0K cᵔK -LM `@Pp!@ R000WQ P#!,@ P? R0)KL\0 @ 0-L@@P\  ` dƯU 0U0H ⍯00S \   H HR 0K0h( 0-QLU@ 0P P1 100 -L,M`@1pSP 0$K0 0) ! # l  I  =  P(007p K Q0-LP@000 ;0!SP0/010l -8aLM0PR@p 0  0Sh002 0S \0  0l00 S* $ 0 @@P Wx0 0z0K0K$t\0,|0\0|0A  @g`Hd 0R KK(.t F -@L`pT 0S@ RPU  P 00000P -@LpT7 0 S|`1V 0S  mP 00000`l0S PP x0\0L$ @0`000X0P0P0@ @-Q  \00PC 0SS P  ^ P  -LM#K0A8S0H8S}0;Q7#K000 #K 0@4P 0CK@0p` ($(P@0C $$,P@0C "$.P@0C !$/@P0CT 0C lR@"004K0. X@P @X ?\@PKU@PK hUK  @ hKU@PCK 0#K KcK`pK 0  0(K Q0-L@P\HH@o0 P0 HtPU \0000 -LP`p @$?o2 oR00STP 0@@0P1! 0-@Lp %0 0ש0 0K0h -` LP Qp01S 0S 0S 0S t^0Hp`@T  Hs0P S   0@Kh u 0-L@L Pg#00 -@LT`P @T VH0SI00S HUsPU X0 -xSLMP@ 08lpc0 0K#0 0Tp @R0  `P00 ႑P00T0 0K -LM\P@@pH P@P\P#$`0 ` P@0S0 vx- W<KK&000 X0\009\0H0S0I R STY 4SH0S3/# 00KI00SX0Y 0 S   00 3/ &# 00 .V0 S   0'    ! V(Ko04   E@Cp0$0 (080000@@(K -PLU`p<P@T 0S 0S @㧡P,P 0` p@0  -逃L$M$0P00  0S P08, Dq #00(0S=@0D )` UnPg  OnP`-V0|pWpPv  @KՓ2@ @0 @K0@Pi 0D0 0`8,0#0$` ` H D0K 0 0@pD0`02]q  y(0S= R)0P0*0Q0+0S`R00T0,0U0-0V0.0W0 R)P^:דV00KP00#P0 /̓0``V$  H mPX0 08,0#0D00D0 믓100`"` z룓00F .0` *0`0@@8 P 13`0 0R D(K(.   -BLDM0P00 0pH0P`K@K 0`@ ! !0SX0K0@d0 ( ( smP P  P ϋv  dmPC00a  XK⿋ ,d廋8 X00H 0H0 4 T00D 0D0 0l0Y 0S 0S H h0 9mh0P@T00: 1 0XX00@0808( s0c$0P$$0 u 0S 0 $0S S00@0000@@`00 0R `C(K(.(.V -LM` @ <c$K2 $K=P $K 咦K  0-LM\0@  00S0\ ≦$K $KPP00(pU 8K0 & -LM0PĀ00@ 080 T[ \p T $`VQ  8lPKZ80`80`cVCGp\p\00\0$0S ##$`p cKb ?!P#KR08 b$$0$0# `p cKb8 ?cKV0 08` 0f80 $0SY00@ @(K0 0-@LPT \ 00 S @00S/0S Q\    \ / -LM0PS@  T \0p 0`00 l00H@0@0  @(K -LMl0`P@U 0SpP\ 00S  :P00pW$0K@Pc p lvp lpp 0 $K`8 8#4`#/1 -LMP0`00 0@0 t0K 0 % s K l K k K  ]KpXK(  \p  K 0 0 0KK┐ 吀 ` 0 嘠 ȀX. D0S+)0T0 .0P0 K$0X0 xp HKp` t`Kؤ0 Kp 00S0 㶍\0@00 ?y0000 0R A(K(. ;|[0 -@L`P M0 0FV 0 S   0 |LFKhB -|@LP`T \0 R@ H|P\0@0\0\0@x e`@\08, 00@@pT Vh00Kh!l0 S0-L@00 S0 PM0S0 0\000帻K0h;;!U! 0-LP\ @^@@^%@%*h000$1(Q @T 0,0\ 0 -LC  P 9P0pp0P t l0S000|0S\  \ 0K(KKA0HM/B0t8(Q 8KN?C 8KM?C0S 8KM?C0S@ K1A 0 8KKM?CA0S15:030 8KJ?C0$8KJ?C0(0S \0,8KQ>C 0plhRW R` RbP8 `K,NtN@0(KQ/B00(K.B08KQ?C0S8KN?C03/Ad0NN0^S S0^0S8KR?C8KS?C8KR?C0SL|`V (KQ/B0 SK A jgP: `5P x*0SPą8K=C0(K8KM?C-B 00b(KM/B0>8KJ?C0$!8KJ?C0(, P 01=001 8K>C0 $Z  Z1` V 0@ 0@0R*0`00@@h h Y``100@1@0#0(0 Pᔿ|8KO?Cu`P0 0 08, 70 &h0R8KK?C0S @8KK?C0 S pTwS @5#0(0 10F PK. AR0 | (K0K/B008K>C0@ 0圂08, 50(KQ/BK0 A`P 8K0C (K0Q/B04280X0(00`8KQ?C0`S  HP oᨂ8K>C0\00\08KS?C0 08KR?C0$0\0  P X P\080\0X0$0S 8PݟZ (K0.B p0 x孟(KO/BX0000 0R v<(K(.d!!"("b""""v$I"x  "#68 '#8#O#q#####$/$B$g$w$ u$ -$QL@p,P`,(1,EV*0S , Q 0, T `,PPU`,@ ,Pv -H0LS0@pHrl0`V 0S D RPU  HeP 04!嶜 0S X00TS@P`T`00=0S0000cPP$Kk&w00 00 HP000=0S 00=0)00010= 嬃00凜P0 o$Kk|[ -rLXM0@(0 \0`@ @\ k 0`P0 0 L՞08,0#0[ 0ST  嫞(p 01S 0S  $0KHL # 0 0p岞Zp0X K0\0H00\0.0U0P`0  . P! 0D&K^0 P10 * 7#/KY/K; 0!GO</0`z K0c03>e! PK R `gV ` P0!45 0$ ` V! ` 0!50 0d0? !V0; 0 0!a; 0F </0z K0 c 0=/KP  V00iS 044`Rpa0i  04Y 4`p0a 0D0S` !~;` pC 3G 0wF 0 00000 0ᒒd;` pfC X3wG 0]F 0g.`P 030#Q,d(0S (`0P bD0S0K d`e`P@ =[S ~009pĀK* ,0Sp% KPK`Q  X0,K200 ԌK)X0, (Xd!9#"0R  4 ,K a wK lKXP K+~X0K0 (0`0 )0T0 .0P0 K$0X0 x` HK\` `0 p 0S p@ C0 K p ,, 0 S,  8R0#03PppW P0 ͎H`V P0  |00 0R .(K(.#l.(;(O(ʚ;ɚ;6eF(Y@@@@BeAq((|'(((p|ꈩ - pPL少@00(0 0#%`$0 ,`8`2pBp`t`p$$ Kh贑Kh)xP 0-LMP@p0S 08,0 0 s0 00, (08 0VpHH K0h|,0@0 0嶎K04)`6X3d0p 0-@LTP000CS00p 0 00,0(080p$$ K0h;K0hQ| - P0L嚎@ `0Sxp000,080(0 0#/0$p,, Kh Kh"pV)|) -XaL0M0P #(0 1p@8 $`K0$0&00 0e p- p DK|0C0K0U4KDpK D0K Hvu00,0  DKH p 0H0 00$ 0)@ p U @0X H崐t ( 0R Y-$K(."x -LM@P0P \ ggQ  t 6/0 Sh! 000C SyدL\h1S6h1h1tS6 h1p<0K$P #[R 6tP%*?000000Lh1Sx6h1h1Sl6h1h1S`6h1h1ST6h1h1SH6h10Sp  W \00  Q` pX pp0Sp @ 5Ch0S p @%5Ch|5h1 0% s20KS 1P #[R0K r0P2 < @R0 %8 0% _00 0gpr0 P8086h 0 EaY0 Ml0W h宊}Phx%M hqlp0SA0S0 < R \0Q S   0` ݌#0(0 0 f0 , ( 8 H p xxތo 4(KZ+++++DQ,9,S,m,,,,, - <3-MLMHK0,@D\D(pP00 8 `D0`~xK0A 0Dvx8K0C0(K00D0002W BK0 xD A℠唀倐pd兌4D.0 -Z 8兌WpK ARpP 0D ,P )Th0RdR0P  P X0T S  l0@TM 0S `0S 0 @Q `0T PT P T0R l0 TPT0TU P `P ^^ P P  Ћp 0  Q ` P ⻋8K0C00 0R ((K(.->-+^---#0 0-@LPP0 U0K0h# -LM@PpW4克02`vh&h`  yp` K{ppo0$Kp0)# 0Wp0t t0SD0#0!0RXPL ;0 QP K K,K R0( R0(0t pp 0s. R+ `p'KmKlK`Vp-KR0 08, 40 pjpʈ0p0t00#0!00S $K+&5 -L M`@ 1Ps#0(0 p  0$#N9 * P!Q R  " !)`X"R   ,, R   (Ko7 Hp0``00 (\V+*XVV%0S R  R R R R S  ;}P  To090000尀`0PQ Xƒ,\0Ѓ >0#0: ,07 pv0S. )P' 0(    P, 8 F:ppd (Ko`P0@0 0嚇(Kos(Kp L-\ - @0L嬇 PD08, 40 `VH\08,0!0 P Kh9Kh|.6. -,QL@p,P`,01,EV*0S , Q 0, T2  `,PPU`,@ ,# P`.w00S \ H R 0//0 S-@LP` P@Tl0 -PL`pU 0S@P P@T/ -PLP QJ 0S?<08, 705 0B RS/Q08, 70㜄P" .0%%0 00`la `0V @P ,  $h.D0S/[/0S SP 0 S-LP 8lcP 0 ㇆@Tb Q003 Y8 0f Q  R1 D0Q0C?o20Q00S$ Q000,0(080H0p88 $Kkz0S $Kk xQt p0| SYx0p t zj W V Xx;`9h7500@l0S0 S R0U q 0 1o.. f0 S0-L@0 cK0hT. 0-H @0L0S@0T @0D P-PL@X0 0S#0(0 08l`w0 0sGQ 0 $Kk5 -LK 0CB~K 0 pGD4 0 S XV p0: D p@X:SV@`\S S S`:S``084 R:pe{@eҁP~<4S Q084  PV 0 S@ {0#SS "P@2P~ 0H4 C>KX4 = Pu 0 `R0 :R `0@D4 c0L$0 XBK 0 @,40pP w<4S .wW w:00`0H4 Ht  @$ Q :Q@$ @$0cc00S:S:0084j0dZ84peD4 p{0e84 Q@e`e84P<4S ,( 0@`P8$ D4 D4 fp] @D], @GH <4S T$e0A084T *PPɂfq 00P4PH4 ἂ`` pI(K).& -0LM  0K K 0-,@L P ?0 00). -RL0M,8 0pS 0S`pB0h PK A J40P ,( B,(R#000"S Q1 Pq0@@?0 @@ T c |! "# :P #P R R 0Q\S0 Q\R  ,( RBNK@D0C R :R0 0 \R K A NJ뼐0P& P# P@Pr? PP,8 S>K0C R :R|R  0 A0S@O ,( B$K).\0& 0-L@P:K0hE -LP= g@P d}`Pd p: fp 00wTS@ 0pP^ 0:SS ^S 0S:S00Pf@AX`@0G\S@D0S:S   0C\0@ 0 B T13 0 BR.ES% BS CS" #NS RS FSfS cS eS bSrS tS nS 0 0 0 0000fdP `dP`M` -L`= pP2 d }PpG@d0o 00"0SP   :RR PddrP P@d0dSPA eP@@ 0-L@# P 00S 00XS@ 00B ^a0BSW0BA0BS70BQ<,00 0-<@0LP0 Q00).74< -aLMPʯ8 q ⌲@PU00j P00CS0L> Pp0 0 S,@K$LO\00XU<0 ( ElPA\,<\P 0KڼP0  R@80@X@@0SP4 R  ?4'4,\P  @ T \P00 P4R4 00(K).s\0  0-RL@ R WPgP00).@0. 0-L@DP08G0). 0- @PLPP0v=P0). 0-LP*P H0@QP 5P87SU00).@0. 0-LP@S P@0 0 0-LPP H0 @RPP87SU00).@0. -L MPUp``Ӗ@nP 0Y  B P 4 00 \k004 PT  PS T1`@t@(K////// 0-<@0LP0 00X0.7?< -HL MpP 2PW2   P100CS0< Pp0 0 S0,@K0 0$mZ``XW jPTZHZP 0K|P000SX``Z``VZP 0KeP000S ZP ZP0 ZP0 dZP LZP 4ZP$z :4Pu(KX0.s Vt0 -L M @R R BP ;0,0000CMPKX0.0.`0. -P|0L M `Rp@ R 0/0P0S0` KX0. 0-L@P08D0X0. 0- @PLPP0;P0X0. -LM@PpP X`QP 0 P84OoBSUP$KX0. 0 -LM0K0B0;P K0. -LM@PpP X `RP 0P84OoBSUP$KX0. 0 -LM0K0B0;P K0./&/&Q P00////////0S  R0// -`LpP@0 P @U*0Q 0R* /0//&X P0-L0PMLP@T@@Hl0 K0JĄR<H,&PQ 0P///&00P05057%/H: .&<00P05057%/4 %&</// 0-T@LH=P l,  K0hE\H,&'b --L M  K -- LM  K -L -- LM  K /// -LM  K -L -LM  K 0--L M  K ////// // // 00-0@4L0PS P0bP 0.H0 0-LM PR@ U@KP K0. 0-@PL 0S f@P/00 00 0/ / 00 0 0 0///// 0P-L  P <4..P P/ / -L,M PU0 `p_ e@d  @ YX00U00S 08WV4*  7#hp 0 0  8U`p(  d 08 08K( 0P8 @ 0 !0CK @0~ (K 08L `0 o (K@dᘙ\(\dFF -LMQ@ \00 `VR ``n KЫ 0L0  x0b-00 KЫ`vpR `LR 0 r0`0K p-0LM@`0K#PK-PK6PK  sSi   (KphPK w L <  $    7RM` QPK '< QPK  ]p X X QH L8Kp ?  :  PK QPK QKphPKDTDxDDCCCCClC4CC(CBCBBB\B@B4B(BBA -䄟`QL0M0R000,PK0%4p080 4@0<0 40@0 40D0 {VP 0S nSl a0CSpVnmBkjihgfedce&`_^\8 UfPY T000V000 DfPbY T070V070x 3fP4Y T000V0008 "fP#Y,T000V000 fP&Yd T080V0800oS| eP (K ePYV000T000jP ePY7 0 eP  eP  ePaYM T080V080D< ePi @ eP D ePNY< T000V000*V080T080!V000T000V000T000V070T0700 (KV080T080V000T000l geP gT `eP `A AAAlA0@??l??>>>>>== -0@LSPd < `  \ X t@ p@ l@ h@ 5$ K@ 03`K@0 tK!p- TpK  %p@ Xp@  dKp@`g pw%gpg PgP$Kg00$K@ -LŸ1M M 1MK` d h,  @DPDP" l< p`* .K B Bmp! 4H08BK A` h,@d R0 X< X<l,R X< %X< R L@(K.KK@D B A;@ BAT<SK D1p 0X< 81p0\< ,a00`tH,KKK  PP" 0S K|KG (P )P@ P(K0-Co0P @00, 0 @* 00 R0 y <4Y8@(K-Co0S0  r0 @(K@@K-K00.SP \*@0[S t 00000S@bP00$bP aP00aP p`Pp P8 pb2`0#m\P 0S W aP |HbH`JnaP Q aPi b`0S aP `=0[.S0=0Kpa`P`Y aP ``p@0sS a`l0S aP `\a`P`0S aP `?0[S0@ [00 A@L0S oaP @s00 0 R .R 0Q A@@JN0S LaP @ꨍ  `  AA@a@\a8@$@ a``T``t_0 S-L@ S P0SP1`0`fsFqP `As P 0Eq1p P 02P''x- t=-L@ MKK @ @ @ @ 0pKp 0  @p@ l@ h@ d@ `@ \@ p l0` h0 \ @<`00 < 00 <00 <00 <@ 00 帐 RCZC,1 $AT @Tx, 0=S \0S'0S 0008̟h0l\  l0C$Q\ AUH Q P B:`t`t(K1H"Z'0 0^\@U0e1K B1RMn"DK A@"zT!)5!`N2&n 0%HL0AS!DS R00 00Ss Q 0$0h0h0A ?AD`h \@ (Kh Z\ Z `B1P 0Tod0Q<*(Kh `\ 0!,0SIZ7 $Dɟ PH RgA H"Z#hd0Q*ɟ\ @g@(KTh `\ !00C0 l`4p h\@$0SD"x$0S` "ˆ x }$\z`!!<0 "&0x0i( ,0 0( ,0_000^\ d h0 Rt'\ @gK!h `0\0 00 POl"DdR"&!D% #.!D& D r0% r0#! D%D#P0 & % D#!D%!D# & D% #00 $0S< ˆ& x 00 $' r0'(0S  R $ R epV KJlKd 0E]#d 0?]d 0<]%T%06]$0S"x D ! 0 D! 0 ! D# # #"D$!D$ Dh% `pc 0lK\#D$"D$!Dh%5`H`LX\0AS"Dh$% 00 0! XK|K'KfP D0H v>L 0P ?&T ?%X ?# ?$ ?$ ?%\@000 0#%DdR  0&$D%#D#"D$!D$ %(00(0!D# D% r0&$0S"x,00,0( ,0 0( ,0000 0$%LQC Dh$ 0000 $00$0p h0Lp h #l' K0dP (0- 0$0h0 0$z؆|x+h+PKH+0K+j**h'%'lDQ P\c bS R00 00PlKd 0[d 0[$ 0& 0%# 0$$%A ` -LMP` D`0,2 A`0U0 V 02c gK? }K m@P 0 v> 0 ?& ?% ?#K 0 4 $$% | x t p PDtQAp1S>ʄ!R;|1S8  H 1S&@"P#@TPFT0IdT0@PF _$HK P0cX42 802 ?K`qrK4Q, `@( 0 @r vND @D |_?K`0W V? (A UQ4`pAKU PPQ2PPq 1 Q i _ F0 QPL $<! 0 @2S 1T1W1"R1U1("R10"R0Y Xx QQ&ڨ2P0>C 0C2 @0 'PQ@x0S ^_'Kp00`0J"x P 0Q@0|1S qW D_,"0  (K@2S S01  rKK$ jP9 1!v> 001` 0Z 0v@ @(  {ZSR0! " ( 00Q1 _00$0 QP`p  0J+0 QP`p^0S 0`p^0S (0dϠld0 ^0<v> 0?c> 0n?o2ំl(:Q^0  (K^#00^0Sbx9xЀQ5"b!"b!XŸX}NPX 01 b0}K2 @PA VgKb^@?K@!oKrK@PpP=  T0Y ! 0?K@T0 @T,P5.0@P 0 @0 QP _K0 M^0S ?K@,>.0A^0SꟆQ: 0-L@ Lp0)&#T0W0at T00 R PQ R  /  4)$)\00DP H0  " /0P/ /((H00 P/A>  " /0P/x0@-0@TP E>0 P0, P -@LP`p @P@0% P PP0 0;0 0@ -L`pP PpP`E^@pdP  t0p0@Y@nY X X  Hh$ -`PLQp @Q tP 0@fDB(000S  ,( + -QLMpP`P( ] K  00S@]0"S!1Ds0P000S0 5/K\0"S `0PX000S K4 1Dsklx d+$ * 0-@L4n 2nK0h.n -L MP`Up4  PP2SiPC  P@G kPP P h1000 `p0嗾@P, 0nS8 p== P00PPQ Q P 40 R f 0A W Q 0000j@P(K000S mm(K0oS@p000mm T  ( -BMLM@pC\x 084 YP P/U`  T(K0@4 @W\i0P<4 ^ SBK J@@!P`J0@@ p 0Fi0PD4 @@0D$pT DRbP`@PR@PM  SP 0{ ,p ps AK A<XP,:BnK `F P pO [<4D4 084 SpDm<m[840(K[P 084 S@ 0 2p ,Q ✼[ DD 084 dS[ 084 [S <4  >084 x[0S=^s0@4 @n[X 0  8 (((@',zd@D'&d&\&%%%t% -LM 0K  #  KK  ; P K -LM 0K  #>  KK  $ P K -LM 0K  #? K K  P K <-LM K0"0KKP K$00 P0$00 00 /  $c` 0-LPRU@ Z, , ?0P 5/0H|# 0-LP> U@ Z, , ?0P 5/0P# 0-L @P 00003/04# 0-Lr @P 00003/0@" 0-LPgU?o20S@ 0 0 03/0" -LP@iTUPQ`$ @04/l8" 0-LP jU?o20S@ 0 0 03/0" -LP`7I@P;Z,0  @Kh/! 0-LP@P 0 0 0 03/0T! --LM0 0 lp@ K 0 003/K:62.*&" x/p/h/`/X/P/H/@/8/0/(/ /////////////////////X H 4 $   pXH4  xhXD -LLM@`T00PP Sp S S X 0 (KX?0@0 0S pG @ 0P00 W0G` T0SY-T <0<0 00@4 8 C 0  X HP X XX`<0<S0@  0W00 >00ƅ` 0S00 0000(KY``V) \40 c@b 8P0PW> @ ̅W L0 00 ` @ d&L00@@W <̇SO <0@<SP8P4W0΅ 4 8P P X4Y) Z'\40 c@b08P``W>0@0̅W 0 <0 d @ <000V@ < 0< c@W΅ P X,0< V00@W ΅00(K;0@0 ;0@0 <0<0 0@&K 0 0CD0 0\ X 8 4p X- :H,P]=0 a A>  PP Y\0 c@b4 080 40XP PR>0@0ɅQ 00  @ dA040@@S 0<0ɇ8Ql 0@0ɅQ 0 h0 d @ h0040@@S 0<0ɇ8Q8dQ 8`4p PQ8` 4p $<@<\ PXP\\ 4 PÅ0XP FXH 8 4p0 `P PX0 V DPQ\0 c@b0XPW>0@0W 0 40 d @ 40Y@ 0e@W  X0P 8Q4p 4@Q`= Å0K@ 4d80 f80P4  @R 0Q# 2X4,8 < DQY\0 c@b4 04XPR>0@0ɅQ 00 ` @ d70 X@04@Q`= Å0@WÅ 0p4p 8 <0 < =X  P08`4p )DP,Q\0 c@b0XP`W>0@0W 0 40 d @ 40V@ 0@W Å0`PXq Z@WÅ 0<8` 4p 0 < .<@<PQXP\\ 4 QÅ0XP 4p P `0 PX0 V4 DP1Q\0 c@b0XPW>0@0W 0 40 d @ 40Y@ 0@W  X0P,4p 8 < @WÅ 04p 8 <0 < `4p8` 4p P8 ,< Q1 DQ.Y\0 c@b4 080 40XR>0@0ɅQ 00 P @ dF8`0V@0b4p@W m= P0 J4p@W H=` P 00 ;DQ.Y\0 c@b4 0080 40XPR>0@0ɅQ 00  @ d80 P@04@Q '#,< 0K4@Q #8 ,0< >`  P04p 0<< P  8`4p ,< 8&8`04p ` 0-LM@0@0K0 p-L M@`P 0  4/Kp -LMpRP@Z  S)`P)/ra`P L1 0(0p 0(K0S 1 0 P0pT0S 0(K輠 T0S 0 ` 0|0`0 P0pT0ST 0 {T 0 DI  Թ\L   -$L M@ KH - @Lppp` 0/S /8lP g0 SP 0 S ? L -LJM@AKp @PP+ /lJK AA`p $* RV   t P0e KP 0 KSO0@0@S0@0$   -LJM@AKp @`P" /kPP 0rSJK AAxp) 4: S U   `0f K0rS S@00K< 0 xKSO0@0@( E -LM 0K  #  KK  P K80Q 0 080/ -pRLP@` pT p-L M|0@SP`  b|CKp( 00 P0|X -000-LM  0 KD --L M0 0 K -- LMH4P(0  0 K$D 0--LM@KHP0 0 K0 Q0-0L 8p 8@ 8 080880088  00<cI 808800Cp/ 0-@0@0L0S x00p0 X# d PP aP00>+<0000FP0B$@<0< 00-0L0 @>P80@0800B 0-L@>P80@0800 -LM0   o K -LM0    K -?LmM0@Q1 p` P ,CP\?!K͌Y CP?!QKK͌X  CP~>!KʌjόW BPg>!GKʌjόV BPPD>!KʌU BP9=!Kʌ0S BP!=!|KʌBό0S BP d=!TKʌl14-0 R@ @ QH0D̟H 0\ l ̟ \̟ \ D ̟ \p̟ \ H P0̟ \  Q˟ \ P˟| \  |Qd˟T \' | 8 ( P780A1 T0 Q0@t  1 d1p1 01 pB`P` ,1嘑A1-0x! P qpP  bX, 00000U ?e PVʆ`Q`0wsK<11 A,`0 1P0`1 0 0P%]UQ @0E1 10Qx1 r | 堑刡PpQ0 P  `BbV|1,0 x\? e tpQ PHB  D6,00x]=p1 ,00` 0 P?33`00wsp1S!,0@1APa , H0 ?3P!3R 0 @D,00x+=p(K輑|1S% 1SQ,0q0` , H0 ?3`3 U I0D,0pG0  x=p 1PS1!0S1 01 At0 1 0P0@|1 A01 P x! AL0 1 0P0P1 @q0eP1 0P01 @P``0f R1 00 T1 l| 0 崑1!p1 =! 1 V" ,ppAP0 0P  peaW,p000000 U? ?#e- PV @1!Rp!p p! 021 `( TK_H( |KZH( KUH( KPH( GKKH( KFH ( QKAHp( [K p@00 RPp@0PU0 T0 ]XP W@0 @p@px0pD0T Pw\@U`0 ?3Q HQ@   0?33H02XpP @xp$,( 0 0# 0-`SL@P` ;P\0 ?3Q DQ<   0H0t",( 0 0P"H 0@- ?00S p@p0 0 Sx0D S R 0 S $",( 0 0! P0-LP T@r0S@0T0 0 0 /, -B2L@$M0P`00 V| t2t*h2`\‚0T80 ‚@24 8r 0< (Ÿ  2 H0 0"$0 @ TpXppD \p H0p`pphp pip0pjp0zP嘂8吒4 <hiT0 j4 $@XD\`0[4 [ 1 0 %0  0 0 W(Kp|px| t8p l4 d< d0X @ 0D0 H0H0D0 400  4 < X( -prLMP`p TX@P D2Z0 # ``"" bbbdbhb``c ````ccc#`VPV c| pQ p|L 0p RR `b0``` &P: ```0 &P/  p+ !p' ``0 &P  %N.K`000S :3S ]$K|$ZZ$Kh0S a<Pj4\ 0-ZL$@|}5`Z^Z(0( 00 T  K0hRZ4 -XX1L M`PL+ 0O S:|>p<0 0v1#00'111-01_111|0^1o*0㴀:!1Rf0㄁1 Q 81 Q 0S KQ  000 >h0 U  K8( (0 h0A  S/ -鈔4 L M[pP@`+(@0p,`(T/4EP 3P $ 4&0$5  ß8 ! !#599 ß/*0H 8NJ||ß@lllC$`ß8p@DA LßN `Ÿ%<1(40‚ŸPx2Z@->C2 0Â@h3:|@ R 0S 1810 S \(KQ  20 =|1 @`{`F?hP( 1@ (@T (0(K>J<^v8# :0'# #H#p--`_|opryz{@|h}#H@!+0,-!.%%!!%%% %no&qs##%%,%$%#e"`"8P@ @0  -@L_k( @?T(P$ -Lǟ $M 4 8  0 '7 < '0 L 'J D 'r`0 H SXA  p Vp PP} p:0S S SX80SY@0@Pc  $`0R06 0004 0 $ ?>  0cS 44Z &6 0(Kp PP? 40p&P4 0000a 400P !Pp0S%0 ;0 TQPaPaU 00  ;0 4p@ @0SE4 @ @ P?>PP0c4 4$RPD%00 0(KS 5 00 ?c pb 0@P8  l 1 pV 0 h40 P0ϠΠ l ;04pz P p 40 04 0 $ ?000a 44Ĕ/. b0 RP$j#0 0dX80, S 300 ?c p U0@Px8   p 0$4R"< Rk P?>PPPc0T0S|30@PV 2 $`0Q0 2 0 ,0PR40 00 ;04p4$L0    a0$4?>0c4 40D00$0H0P0    `Co$100 ?c p 0@P. `000`00ĔT?000nS4 4 L,1004 00100 ?c p^ 0@PY 000B0000! 0-4@0s4 40 04 0 $ ?>  0c 44@ |p4 QA|@@0 0-P@ 0L PD TT T0耫 -3 LLMP80@$0S`p8 PT0:Ó\?Q A䃃300Sux(Kh30h0 X X300S 802 X0`:2S P 1Y (KTPK@ \K 0\ X  |` `TpK@ \ \K 0X  p  `K p j0`PP00AP0S  BL98# `K`0@ D0S0:3S XX00;0 :#0`00 <0 #  A<J 0 0 0-LP@ 9p0K0h-  0  0-L@@P p@P R?PNLQ P0S3 R  v;P P000@mS S00S 1 CR @P- ;P00@ SP0; C/o@"@P00@S0@P mP00@ ;P SP0@P0000L0 -4eLM0SP`J|P L0} 80S`0S   5:Pp 0D0| 4|l0|h0|4|0|<5|20p|2$ 0!1x20t2|200S0X0K?T0L%R44S 4S-0?o2*0 r("( 0B|2S < H5S1S0$ < 0 00D0 0$  T X| hp  ` lT pH t< x0|K$< 48 80 0Q $0X 0/0D -L M\`pP@T 0S"!0S S0WX0T0(K 0  -LNP ,0 S02  -aLMP`P2A$K p `•AR  R  0 @@ 10 0-0( (  pq,0 ( P( ,0P ,0 ( RN( ,0P   QpG\p@Q$0,0 0/G@l|4 -L@<pP W`G`PH0 x0"00V"1@pG 0 h 2@  -`\LP@T 0S1 RT0S@R0@S RKhR -lL`@pT 0S"Q0S S0YpT 0S 0 -@ LM0P`P @ K~jBK0嘀p@PPPI@W 0|" QU ;P< *8@  VW$K8p,0` `0 - LM 0 R  * K0  ~ KH`0 Q0-0L@D00S :T 0k00 0  -`L0PS) :#RQ# # @O0pP :#sC#:# B{+0:#!BQ##l\\0 -L M 00S : K0   K8 80 0Q $0T 0/0 0-@LPὪ@p00@ ?0ST0P0:3S < <0 00 :# 00< -ࣟ#L M3 0S*`3B0<0 3崓P08 0 p40 P&W[ p p P@W 2p  ?#  0n @00@0/"1 RC P\ \w \W00f S 8 200 ?cp v0@@Z0  |t-/,< ?#  0n L/o @00"Vp P@0`00(K R` ! 0 R    (K4`0 0RG 00?|#> 0c!S 00000(KS0@@ `00@ ?#N  0dS @0  i8 000 ?c6p 0@@zp 0}[(K`008P0P0 0t-p Q@ -R2P`@P0Lp 80$0SK / Pd0:#RR#R h B#0QSj<2Y ,200So G80E  0-L@2p0K0h10 0  - ,01@0 A`)aYLP `F@I0A0 #Y@IP pNW 0R I ≐ T q* @5 T p:Vp#:Dpx)p0 @?330V*0 0C0 00T 0-L@c2p0K0h0 0 < <0 0- L(M0<@KPK0 0-L(M@P92p <@KK0-  0 H 0-L0(M<@KPK0 -LM 0 KKK K -L\p`P   Pi@A@W UV T0 0 ᰠ -L MPU@0)Pp+P[-P%100 `pW! PdO-P ( << 0 05(K( -<W100  (K(K( <0 x 0-0 L@ Q?C@ @ 00( 4?C@ @@0 -LM, @ 0  K 0KK @  6K 0 0 0-LP@N1p0K0h-  0 000 00:3S x/|0 -qPJ3lp00` L2.pP 0p .P<3΄`s``&0o`Äi0hτ贂o0Fɒ2Yn2-p? 0p` rb#2(0 # 00 0( 0-H@H0@PLp0 (0h 0i 0 0( 0-@0@PL:#Rxx - ^# 0p X0J:0, 0-@0@PL :QppÓ\0- p #*0 :t 0-@0@PL:#Rx Ó \ "R-- ( p #0:0T0T 0 0-@L0:#R#R"#00:h0h 0 0-@L0:#R #R0#|""}#00:0 0 0-@L :QQ }| #p P0 :0<0 0 0-@L:#R#R """"|#}# #p qP0b:0 0 0-PL @:QQ |} p Ã#@P01 :]0 0-XP0@SL@P p p $0 00:#000 0 0-@L :QQ }| #p 0 :Q0 0-P0P@L:#R Ó \0#R  P#--  p #0:p0: 0-<@<0@0L0:3S 0 0 0  0-<@<0@0L0:3S 0 0 0 0 0 -@L :Q#Q& BR“\`#bp@B\ @\`# RƒbB#\N :Qt -@0@PL :Q%Q( "Rb\Ó`," \R`P`b\ÃR p #  :Q -@0@PL `:PP! hVh“h ƒ p # :P 0 0 0 0 p-aLM@Z)`Q% 3 U|0 ` 0 .| 00 .080 | 0< .03Kp` `0 0 00 S*03# 0 E 0P0T8< 0 000:/4(0( 0-0L0^\0\ 0-0L:3S 0p 0+`0` 0-0L :3S 0- p /\$0$ 000:#Ro/$0$ 000:#Rq/0 00 00:#Ro#00 /( (0 00:#Rq30/H0 000:/ p-@0L M@`P0$ K0p p 2[S|000 SC q R 3/Kp0 :#Kp"[R $$00 ht@v<, -L(0 0 Hv -L@LHM@0  ,K0 (0 $0 0 0 , 0 0Kv -T@LM@, K0, R0 0 K 0 0u1 -AL M00@Sh 10 0Sa 1, KP00p p 2[S3d!d1 pX1`0XA  c4100X4  Z030p  * 03, p ,O" Kr[W  S0p00W0:p0S0SYHLu4uht@<000S/8ds 0-(@L@0S0O'000pP 0 0 p@ 08 @B(KP  P c/ -jLP R3S@P4PB30@SKhB 0-L@ J 0s3$ PSP"0M@P |2 $R 02S P03K |20"1#4003000G0P :3S// -,Q@PLP$ 0S  0T0UB,SB0|00 T   T   T  P >B4:BT `TT *2S T0P T  BX< <0 0P @0?30Q0@ 080/ X X0 0 T@0|78@0Q Q0@0/йQ@0?30R@0080/T0 :-|bL0PT!@RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ &  (!R 1S   08!R 1S X  R T@0|78@0Q0@0@!R@  @ 0 0 n  0 0 dT0 :|2-0DaT1`SLP@/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  X00S L00001S@078@0  [ꤶp0 0 L 0 0 $D D0  0-0L@P $ 0 -Lp@ 0P`o$GH -  0 H R 0- LP@J 0T @0*|"7 8!@0R   R0@0/@/0 0000TP P R  R ! R! R! R (!R !R 8!R !R  R/L1S/tp0 0000TP$ P R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/ᰲpT @0*|"7 8!@0R/  R0@0/ 0-L@* 0 0 K0hH 0-PL@* K0h -RL M@ 0P \ S aKh ) Kh 0 0 X -LP@``#p Kh -80L4M 0  K -LM K -4L0M 00  Kp -LP0 @Q` (  R R D R XP   !T" R H  AR     l(K0HSa:]\H '( 000(K00C?00(KT0`X`00JaX<H` 0X001 0  `p00 000 00   o P 0S00 , X10 \0 ``008 0  000 000000. -LP@`p00 0Kh -4L0M 00  K` -LM KX X P0 0 08Q Q @0<@0/6Sp8 8 00 0 01S@0<@0/ᔠpL L0 0008!R !R @0<@0/6SHp, ,0 0001S@0<@0/pX0X 00 T0:|20(Q Q @0<@0/6S갟 0 00@/HT0:|20(!R !R @0<@0/6S0@0/D D0 0P0  Q `RLP// 80-P L@`P! Qp Lfe <000T $00PT( 0 0ꠝQ 0S0aSLP //,0, 0000P//Dp,0, 0000P//p $ 4 - L M0@`V 300SH0c``QL0\u0lQ00H40 4 j \! Q q   !!I YPE, 0000X00,0I YPEL 0 S00 -00qQP0?33Z0,0D 0 `q,  x Pp(K00pG0C S00 40 S4P 00C <0PEUP P0\40 4000lQ0L0aZd000 pj00QaZq Q   !2!ZP ,0   ^ , Z 0P00Sq&QPZ, D0  0`,0000 ?## x Pp~00SpP00S`0 0CPVP Z0җڕĜ,0P0/ 0ꔘ0Q /p@-PPp`@Tf (, ,0A00T00PPpP  R 0`//P  R 0 `///// /// -L M,0` !X A0@A00 40 僀VHp@?sppX$ P800DS x}p 0?330 @X PD B0Z?#W Rws00C0  (KL Y0 @0 @0 00ؕT ?o2 R0S P/,00!//D66-(,^0R0S Q!R0bS(1 - AL0$M40 1@0 0R80 ,2蠟0 ` @P00 0S# S#G0080`0g`` P  (0R0 (0008000g00 80 T04  03/p 0PS@$00(Kh5<<5p4(0 S-$L`pP4@PS@Q Qa *ppQ(0PS@ p (0(0p(0 S-L`,@P (0PS@H0@-0\ 0 @ Q@ R083 -@pLPWT``BpWn 0p0b(0@0pP0@0Spq`%, 0S@V0 @?3300 S `D`x)p ~0S RY ,$6P d,06P 0X# 00b `(0,0 0,0c10X 0`0D@045P 00` aG4,14 T  0 0Dn@UQ! 0 0PC $ 0`0VRA@U 0 PB  0S `Q ` R 0-\^c$0 S^0a  -d`PLp  R: 0@0T@C@00Q"X @ 0 P0UPC P 0 0SW P ph 1 $p00V= 0d@T@ 0ePUPT100V7 D100V2 4100V- $1@00T@  S2Q 0@0 P0 U0P 00R)W0Ѹ ePUP0 Pp 0 $pl l0 0@PX@T@WPUP 0d@T@0萎<H PQ00 0 $ P / 00S0/  -8QPQPL`pC10$ P: 1 0p7 0 0p/ w0 0` p$ $` p0 B`0Tp @T 80@Tp` 0Q贋< -P0P`L ʂPQp$0P X00@T  0Q1TP0@-+ 0S(  \#@ T8 @ƌ^t p8 ,0P0P@R 0@0T00 S00 Q-LP,T$@0S00â?# 0\@0 T`cpl 0Q0`V 0R 0pW  `g@0 0 0 M@U80Q@0@080/ - ` 0`cQL(`0P0,  Q,  l!`Sa ` p  @T @T0pS ` QP(`8@-@ E?@080   R\8 \0 0 R80  R^ ꤆< -LMRQ0 40 ` pAڀ0@P= | 0P,p i0PP0m 0S4. IP4H 00?##T00W` $` H 800@0x0L0< !X0\0`0d0h0l08 (K(K(K 0P49 8 08 P= 00@*0P0夢 0 ,Q4 W 0  ``pY Pʟ R4~4|40 w4u4s40 n4l4j4h4  -0ApQPLMcR`    n  S@3 ^0 X+ P&ʤ@@&@P 0H D000QH D p$`0@P R0$K$K -L MP ^@ 0 K -L MP ^@@0  K -LMP \r K -ALMPp@ sJ Q `PX0 \W`cP 0PP^ 1 D 00SH0200PS0 $p(00$01@40 ,0 qR00V00 @ D埵0?33 V  400S(K000H040 0 0 `40X0 0 0PW c `f0 `,``e`(K,(<x x 0-p0M L@0 P do  0 @_PP 9K0~ -@@L<M@ 00  BKL~ -PQPLM00 ,@  0 (K}8 / p-LM 0 `PLN 0c bKp -LDMRb S` P0c00X hP0`P@`l\ cAPpY P@ `  h\b@ XE01`d0 1\0 T0Kh X0 `0\ ,00@d0@h0` @25&*W   @ D  L R0T P0 LK 0 R0P XV @* 0S\00\0 &(K| -LTMpTp \ P8 Xp X R \   aRࠣ^ a\  p@  d RR\ d ^ @~8 8,8 8l0  8 8 C8  (B(d (dh BQIPGp0  8C8(B(t0 0x H0 hH0!L X8#(,P  (Bgl, ,ȠC7 PXT @0 EX0  X0( 0 S @\8@0 t"0lS p8#8 08C8@00 0l8C8 S@0( 000l08C80@` @ T,P` h (0C0b8#80<0 \04` :8 D0 `<0SQ 880X4 %H080 C80@lH DH@ Y EX Dd  @  DrZ D 0?330x p 8 @0PD!0?330x p(K4` ` 0P000 ` 00 ` 00`0( 000bP0`0 0( @00bT080 @0P0( 0@00bT0`( 000@0@ 0000b\0`800 80  0 (0 R 00(0 R 00S( QS000L0P T0 00d(8BQC8\ H  H  S(K8 @(0@0\ 00P0t8C800 x0 @ d i08C88 @ 8 8@ 8 x@WR 8(PU%,`  (B( ,j , h R@W" -LM  0P KG-$P (p?/@̯ `c@h j^`iPc@\ `U pjW (`$@0 G -QPLP 100 01S1`0@0 S )A@@@T@9p100S@@TKh81@`0@0 !$1 00L @08@0 0 00@0 0@00@@@T@0@ 0 00Tx0 0@00@0@ L0 0080 0@00@0`rp~, -L@pP`sTW!0000 $Kk0- S\00#0 SR \S\ P 0 SRSR -?LptM0L0 0*#R/P  \   \080@80@N @ ?0SH/?@0 0D2L00 R \@ 80 @0h 80R00  L0 P?\ 0Sl0 :,0!0 8C8S>00S l R00CQl0S%\0,L0 L000S .  h R0 \00S0  bL0 P \0S#,=00 0P0 0 l0 40K0 \0P@0,01l@Pp0 1d0 0,0` 1`00 R` 00P- 0<0 Pop ~4,4\ld0 @_ 08 0zp@(KL@< 0, 0 0000cC1L  0H0 8@ Xp40 03K˥PZL0 00 .DPH`Xp@<080L000S 0#=0CS@T @T<0L  0AP U 0Ct0 P0+<0L  0AP 0C0P00,20Q L0 \080 e\@0 , 0  L00 p`(KP \0 ,\  RQ8p ,0A0$ 0SP `pp pW  pW0`S P  HX8p0  80 @0 803-L00<L 0 0CP0 0Z0@  x$@0 R(l$@0  D7<0 L0 @0U(8 hP @`P ,0?33X0 @L0 \00S00 7 4h@8% ! R  @0l50p0 0h0 0S@0 h0,0D0 0H0 080 .0C 80 0D0ST<0VV0,0H0 R PU p0EqX |G@@D,T|G0 E X  b |!H000 0C d0P0 R0,0 000h0V0`,0h` 1T0 `0P 0S`0 0TP,@P0D0V 00Cp吐D0S 0@ 0d80 0`a0V0P p R $R <P >@P 0 P80 0p 0PP 00PPW w | p0 0 0 B0k p PP0 P0 0pc 80 P0@Px0 0UX0 D l pPX0pW @P0@ P l P)X0x$X 6H0 @P lHP $ V 00$R D</o"Q Rp P  RH%RDf< /o"T 0080< b005@ P0Pf0 @0 0<M00$R_   80@ w< /o"QQD 0080P *00Pu p Rr $RY P <4@P 0 8P0 0p 0P< 00P f  00p 0  P B  0<P PP { V 00Q 00< 082P@0P0 a Vj$R < R  Q Rp P  RL5SP@0PP0 0800P p   R P f'1@ * 0 < 00P f1  80 <9P V l1@` @  @00@0 00PJ V 1@  ` 00LP: p0P 00S4V 0@` @  @00@0 00LVC L  0`0:H5S  R 00P 08$00P@0P0 H V  p-P0PLM`@0 R   ;80  00  0 n0l/? 00  Kp80t p  PP@H0 00hG 0-LM @@PdPX\ `0hl\PPP K080 800  0 n0l/? 0K0G -pRL@P `` @ PPV 0-@PL0@T04!41 - L M0`0SH0?S 0 0, 0p!p@qT P2: D x/p! 0?330 @W P D 0Z?#R R00  S0  (KF0 00D -PPL`! @`0P`U0@ T| P 00@P`UTP P$@UP @$T P0-L0@$T0 R-Lp0,S`P P @n$T0`S P RQ 0"2"#,,Q/  00C0/00 00-SL  -)ȉ9L $M@ 0`pp40 0P80  0<0 ^P40S40@cLY80P lR b @Rʌ S@@@Y@T )  <0( @ @@^ ( PϠΠ U  l(` Rf( Ra e P T ^Ѹ\ P8PXPxPPH000 0Pp @0 P R' R  R  lP R# PP70 R4  8  (K/^@Q@ eWPe40S@@A\h @h  R e Pvfp`T @D]P0@0xP o@P0S @PP hf`ppGl R\ \ ,& K<0  B^@ ;&  PC4@2%0 @P40aQ@@% )  Q % 8tUtEP@0 0P\ 0 SC<0 Rv@`5U0<0 5 uP000 0p`@P 0S @4@0P@30TRU00P @|4  ,0@110? ^ 00P E<0@000S S00Q l#4@0<0 #=S@0CS S@ T@ 3 0 , @0 b@0@l3`@ dRP3P#0D0 D#D3 < <#0 H 0 pu<0`00p@PU U  lON@d @d @T "00PD0 0S lP t" Hl  X"  RW D0` gRUH@  PJ " )! `!qQ pP@T 0@D0@xP @` T  RT ^ R 0S <1@ 80S9?m@` hPP R x ^`Bp(0p<xX4lXTdDp|`t4 < -S3LP M|C0@p`00 W {000n4pVT$$3p` 0@T$ C R  0@DS00T" 00lP  R " X20 0 Q0hP hB@ @`P 00 00CSZ j  PU 20  (KP @  1` 00S&T ڐ1 @T Ph  PH   l8P @T,10 $1 0 0p0 S!C lj @ i0 00S00h0S0 0 0 Z  @LL0U0S`00 B 8<pH4LXH$x -L 0  -L 0 1!0G- | *⤂X``!0P U, U. 0S',ppG`@\  \ 00^0 000P 0P  \0`SX@TP,`aA0U0 < 0 ^P TX30 00 0Q 2S0l%R h%R //!R!RtP//2p 0 000 0/|1p -ULPP 5p0q  l%2` Qs8 PP%@8H#8S 1Q $0P\`  5 0P 4 $0 :l"@ 0@ l%R h%R 0h20 2d"s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d20S0\ RʀfngΌS4 RʀgΌo`S) RS% RS! RS RS R~S R[-ªϠòS ڃ0Y͌[=.0  0 S0ʀ@ S@@p" ڃ1̓=,,0  0\lŸl2 d"0 #7@:/@pb0V0, $2$Bp@0P! 100P H0 0YH0㈠ X ,01 0 78 00Q ^`V@1 0 Z̀o`pʀkΌ``xʀjΌ``lʀi~jΌo`_ʀiΌ``S!R 0h2l0 0 !R 0h2%R t5S 0h2@1p Xh1 P0-0LDP P?P08 Q8\6 00ʃhœ\ 1:p“ @T pƒ 0^pƒ 0A\ B\  0    d+X 01P-0F 00` P@ʀ :h“0\0 @P)#0000CS 00000000000000000) 0-@LMPP@$\U Y͌#3 P |P 00  ,0 K0K0(pXP- H\ P Y͌# ' 0-4410L :h2S! 10@@ 00S 0 0#'*?pB00 R 000@S0AS l'X0 000:d/& 0-x@x0@0L0P:h2S SL0000P040 ( @000@000%p -Q1P`!L@. R!Ap@0夈ʃh"R R=1:?QE0SA|20 $1 0刁Q$*|20t1:?Q 0S|20l 0 0刁Q:|20h |0 @780@0z0!Qʃq0!Qʃ<%/\ \0 0000CS0 0/ S Rp#00CS0 0/ S R0 000U"R??@- R Q,@     00 0 " 0-@LP0 P  0 na@P0p@-1`P0000 0P@\@@1000C10.U @*T /T pRp@ 0@D0@*Tp! -rL$MSp`80 Pc 8K 80@T@ M  F(D L H  5/8 8 @T: $T <R\!  "! ".P  R>< 岺< P ,K 0 D80 mY00S H P00 R0SL0?N@P 5/@TY 0F(@0S00 R0S (KL0`0@0/@P 5/@T(Kp  4 p-LM@ QP` !^ "R Q  HP0TKp0 00 - LM0 KP -H0LDDM 0@0 ,KpT0TT -0ML@@  0P KP0@-000\SM ^Sk " %@@ , {cS28""0  "C@R@!! L0 !!!0C0000}  0' C R1" { S @T# 00DS8110\S# '  00 0000 0 @%@ + {0@00 0 P@R100C00 B cQ! -LM0K J`0 !1P!1"b2c0c b ,0#/02b!1c K赁NH g -LM 0K J `0 0PB 0 0c b L L$0?1c2cKkL > -LM0K J <2 `0b 4"aP 1ca1c0c a )9(0 a` K-?L *S0%  0p  00 / -L$M8  K' P 8000 8 6 0   `S@  nΊm @ < @p,St 0080 @808 0SS  Qn%S080 P+EGPKIH0FEDA@?>=<;:9865420/.-,+*)('&%$#"!      lT0 S\R 0S0\S 0 S000 Y `i0@ T00$ 0 00< 0  0g0 /0000 00> 0 00 (K8 0` "!.S *S8 0`B 0 SR00PK 8KD0 0 %0 0 +0 0 D00 0 @@c000 80 @pgp60 S@0 00@0 000800 0 S k 00@0 000800 0 S| <0l0 0PK000008 KD    0 |o @H 0U0 D 0 oH0 @P0H00@000  800 SJRP 00dU% 0 00@ 0 P00d @0 pg @80 p0 S-R= 00% 0 00c @0 pg @80 p00%0 00iU0 P% pg80@p0T 00\0 @m 00(K0K30PK.00K)@80n  p-@0@L MP`0S PS 0  00 K0"^Pt00 R  QT00H0@0x 0 Kp Kp|pX<t -LM0 S 0K00KKP0S pKL$P0 `V$@PU @ 0PfSPKKD`A`P0 7K`pX -LM0 S 0K00KKP0S pKM+ P0 `V$@PU @ 0PnSPPKL`A`P 48 0PKDp< -`!L M0pSL(0K0'0K&KP0S@ (`K 1P7AtP-0< X& PU $@PQ @U 0sS[ @PUXW @T :fPPP K@ K@ Kp t 0  -LLMX lpD@P P0Kd0 X0KP$ `0 0:R0K PP 3#0p0 > 0l0 >t h0 \@ 0SO  R T0KS KZ~ #Z =Z =ᄵP ` 00`XXP^  YbV \0 0SS|p\i0P\0 \0S\00,  eV@ eZ @J :` PPP hRd`PP0K,VP  Rp 0 0e =0 P@@0e V@\00(K,0K 0$0 TPK$P arP `|   `PrT`K Ph0倁WP- `P^T`K0PC븀PP`GZ (Kl0倁/Pp0< [t04i\ \@ g l , H 400 0 S0-L@*,0QP P2,P,0P0Q 0-PLP@P040, 4P0 -L00 -0L Mp`@PP %P0 pP sP lP0@TTW 0 0 0P(K 01BQ 0@BUPD0000 00 -8LsMQ` Y P\ 00S040e yOK$ ( }KH @T 0zK  0\ T}K01 0g K1 Q %Q cP  Q, 40,(KP@%U K!.?Qi 0EXSWTC'zP gP@0lP \ X 1!0E]Sfdcba~^]zyZwXuVUTSRQPONMLKhgfGFcDCBA@?>=<;:98U#543210/--,+*)F'&%$! 78  ( QP \  01K^ -00 gx@:0000{ 00E:Ph01K!ug a10A R0 ORTP (KI@`VLP` 00040CP, 0000X, 0H, K!ऀ00 !U  ~UOS ,K!0⤀00 0PU  0E, K!R00 P Q Q %Q0 0?R ;RP; @a0A Rx0 OR^,K1 0,K1 0 b1S101 1SVx10x1 T0PU ,0K1XPEP0P 0 20OU ,K!P00P 90 R ,0K1X BY0 + X!P}PO 4 , 0 0p 400400PUy 0E, K!P00 a0A R, K1 Q0PUc  E,0K1P0 X LP 4 ,0 p 40P40X> H,0K10 X] H,0K 100 &PEVU~}|{zyxwvutsr00OS ,K!000 0'SS 0S'S'Sl`00S 0C, K! 00 RRQ_ QX %Q0 0?R ;RK PeRP 0 Pfx@4 ` L ht@ d 0R - L MKG@P K -LPpV`PPP |S@P0e V P;V o -PLU`p@ = P T 0 -L M@RP`j 0Sg%  p; 0! p4 0$p- 0DQ P#  p.`K B[p@ p2[@S@@0 2[@S@@0 2[S 2[pS@ 2[@S r[WX$ pP j$p0(K 0 (K {뾂[@X p r ᾢ[m2[ @S AY  qH(@ Z"[R 0opBx 'w0p`ᨂP  G B[C"[ @ W 0P` 3r[ 0@W $ 0 p$0 0$ pu 0S  $p"[@∀A0nS0@M sS9 fS0/o"S R0000@00 0 *Z :h 2[@S@ 0C8#800 @T2[ Y Q‡T+ 0000 2[@S@Y   @00 "[@?Y00S000 00  p -XAPT!LM@0 Տ,qpPDf>`P? 8@K4K0 >p 4 R@?(K80S 0vP@P Q P@\ \0 00 0KW 0 0m>P84   -ȀLMB~K M` pG0$ 44 0P:SS @T:T@@a R  Y R #,0K 0$44 DLuP P`0:S (K -\2LXŸM MpH0@`04 @P2 0/Sp hP~P@P 0 (K0P !B^K PE P 0 -@T | 0 d0P 0S/S /P  X P U AP Q# ^PBK @fp 0,@,s ^TZ 00$00(K 0 0 K0@<00$00d4  P x $ -LpPSP` d@d@ @ @P Y (0剐0 0$KkJ  --LM@00 00 K 0-L@TP0S P P0 -L M P`U@&0KfV@@PU  "[pR0 nV@ sV B[PU@@0op00 K -L M PpU&`KfSPU  @l2[P 0nS sS 2[PU>@00 K@ K -L M@`pAP:PU,*0<lP+ D0<,KPa D0<0 D0D <0P nWD p> sW' fWD0< DH00H0(K0 ,(K<|P0PZ 0 D0!<,K a RD0<0D0 JD0 0D0D0<,Kഀa >D00D0X 8 -L$MP@FX @P` :`p$04D 00 P0 ,K  休a    0,Kᾁa Q0  0,Kaa Q0  0`V0 ,K !a ,K aa0` 0(`V$,Kaa 8`V01,K`a H`V0>,K`a 0`(K,Kaa (`V0 $,K a ,K aa0p 8`0V 4p,K a ,K `a0` ,0H`V Dp,K a |,K `a0`u< q0 0 @- 000@R" 0S  Q \T  0S R@ \RES  :Q  Rx  00  0-@PL0   <    , K0h  -L,0KM,#l ,d0 :00 PP |s|P00@@"P00``LP 0<0 80 dP! V l0T l0,duP 0S l  !  "|   h  00 8C8st `0 ^ ` s,PX ,dHP{ 0Sx h .S  ROS@ = ƩPP# @P. P 2hFhvP  nwP @Kr@00S@P v PP $0,KRa x$00,K$0Ba o$ (0 0$ (00TSl0 @`4` r0p0 <K%P < 40儠 删0p\` `0 XP X] 0'\X00S= @XpP0004`cQㄠ4 *<0 Cr` r ,Py 40'[,,K"a 404 ,0,K"a40 40,0404 < 4 8040 4 80GW&\0%0S0^X0Sz PX ?X  \ `@60@ 00@ 00@0pH0S"0x0 @丅0 NR 0p |l }Ux0qS0pG@Wpppp`fE0H/S񏐨~vt}|{ne\l40000  0p l. @0@Sg @HtP ` fBP(P 0 ,KAa P 00P000 0 l| 0 l~<  (Kl  0 s0 ol 0p l0 00\ `p@ 00\ p`@ 0 0 0000@ W@Ht (B(r@Q PnP4P? $0,KAa $00 ,K$0!ag 0 lBP#;P l0 000 f0 (B( l  00 n0 < q(K u(B(r@' ,`s{PPaP 40,,KAa 40,0,K40 Qa4 80 04 80 0 l1 9@lX '2P$ p D t t p-L4M0H`KP2@P Kp>W0 00S  R2Kp -$Q$!P 1`pP0L@07 0$0R 0 "0 P,qPp|0QP`  cXQ  [X |0P0PE00pg0`P00 p 0-pP@PLP  $,(00 T 000p0 000/Xp$0$ 000P/ /4pk$P00// 0-@LMP 0K K8 0!1t!1"b2c b0c 00  4?@Bc1A@d0PK0gݵN\ P0`0K?// 0-LMPz 0K 8 0 0pB0  b0c 02"D@ 4?AcB@d1dKPK0kLh >$0P00?// 0-LM@; 0K 7  >2` 0b 4 Ra1c a1ca 0c?-B0 B PP 2H?Sc<0Pe0?PK0-?LT *S -销L M`p= 000s@P DP 0 P K00 0 -L M@PCK O0L@`KS1$ftN(C+F.<$]_eK!yO7{R:A){qM&iAGi?nM~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPp+0c\ D0 `+ =@ P`V<""KDK P0S 0!00,0( $K*0c\ D0 * <@ P0St<""KDK Pc0SP< 0 0!00,0( 0c\D0 `ʟ 0 "K@ 00sS200*,*0c\ D0 * ;@ P0Sx;""KDK P^0Sp; 0 0!00,0( )0c\ D0 ) ;@ 00Sw:""KDK P ,0( P)0c\ D0 @) :@ KP0S DKm P=0S :@@@A0 "00,0( ^(0c\ D0 ( :@ KP0S DKD P0S 9@@@hAL0 ]g"00,0( 5 (0c\ D0 ( p9@ KP0S DK P0S 89@@@?A0 4>"00,0(  '0c\ D0 x' 8@ KP0S DKP0S 8@@@A0  "00,0( &0c\ D0 & (8@ KP0SQ DKP]0S 7@@@@0 "00,0( X&0c\ D0 H& 7@ KP0SJ DKPg0S L7@@@@0 "00,0( 0c\D0 ʰ50@0 6VK00S DKuP ,0( x0c\D0 WPş 0 @ Yl6PK00S DKYPw ,0( \0c\D0 8ğ 0 @ 5KP0S DK@P0S50 0]g!00,0( 50c\D0 Pğ 0 @ \5KP0S} DKP0S050 06@!00,0( #0c\ D0 # 4@ P0SW4""KDKPs0S4t0 0!00,0( D#0c\ D0 4# @4@ P0S|4""KDKP]0S40 0!00,0( "0c\ D0 " 3@ 00S|3""KDKP ,0( h"0c\ D0 X" P3@ P0S5<3""KDKP0S30 0!00,0( !0c\ D0 ! 2@ P `0V"KDKnP20S20 0!00,0( cX!0c\ D0 H! (2@ P0S# 0"KDKIP0S10 0fp!00,0( > L H  $ ?\ X  h l d p h   |  d < L H ( T L $ @ ` X | , $ , \ T , , $ H L 4  T P d  G   | t @p !0c\ D0 ,! X0@ K00SG DKP ,0( p!0c\ D0 ! 0@ P@T0""K 0クP~DKP ,0( !0c\ D0 ! (1@ P0S <1""KDKuP0S`140 0!00,0( jd"0c\ D0 t" 1@ 00S1""KDKPPb ,0( S"0c\ D0 " 2@ 00S^H2""KDK9PQ ,0( <0c\D0  0 @ 2KP0S DK P0S2p0 0=G!00,0( 0\D0  \E 30@0 3PpW 0"KDKP0SL30 0!!00,0( 0$0c\ D0 @$ 3@ P0S-3""KDKPQ0S30 0!00,0( $0c\ D0 $ <4@ P0SP4""KDKP)0St40 0!00,0( @%0c\ D0 P% 4@ P0S4""KDKP40S50 0!00,0( %0c\ D0 % d5@ P0Stx5""KDKfP$0S5 0 0!00,0( &0c\ D0 `& 5@ 00S(6""KDKAPA ,0( D0 c\#KKD & `6@ KP0S DK'P0S6 0 0DN!00,0( <'0c\ D0 L' 6@ KP0SP DKP0S,70 0)!00,0( '0c\ D0 ' 7@ KP0Sq DKP0S70 0!00,0( L(0c\ D0 \( 8@ K00S DKP ,0( (0c\ D0 ( x8@ K00SDKP\ ,0( (0c\ D0 ) 8@ P`V8""KDKPK0S 9L 0 0!00,0( 0c\D0 ʌ 0 @ 3x9KP0S DKdP0S9 0 0!00,0( Y0\D0 B ~\ $:0@0 : P0`VU"KDK>P 0S<:l 0 0[e!00,0( 3*0c\ D0 * :@ 0@ T0U"P::"KDKP ,0( +0c\ D0 + ;@ P0SM ;""KDKP0SD;\ 0 0#!00,0( +0c\ D0 + ;@ P`V;""KDKPb0S; 0 0!00,0( ,0(  0ჶVK!00,0( S@< "K"00,0( x 3 0gVK!00,0( , aS< "KK"00,0( S< "K!00,0(  0@WKy!00,0( xP >SX= "K!00,0( jS= "K!00,0( _S= "K!00,0( TS= "K{"00,0( I 0VK5m!00,0( ;@ gSL> "KG_"00,0( -Sh> "KtT!00,0( "   S> "K@"00,0( > "K 0PTm0"00,0( S7 "K%!00,0( ᯵VK!00,0( S7 "K"00,0( d70MᕵVKZ!00,0( 긫 P77T"K"00,0( S6 "K!00,0( S6 "K!00,0( S6 "K"00,0( Sd6 "K"00,0( DKP> ,0( ,0( ,0( ,0( ,0( ,0( },0( z,0( w,0( t,0( q,0( n,0( k,0( h,0( e,0( b,0( _,0( \,0( Y,0( V,0( S,0( P,0( M,0( J,0( G,0( D,0( A,0( >,0( ;,0( 8,0( 5,0( 24 "KHP0ST!00,0( "40@0  6aP`$0 !T4 L40@0 ,0(  7"00,0( 1"00,0( +"00,0( %"00,0( "00,0( "00,0( "00,0(  "00,0( "00,0( "00,0( "00,0( ,30@0 30@0 p"00,0(  0wK!00,0( "00,0( "00,0( !00,0( "00,0( !00,0( !00,0( "00,0( !00,0( "00,0( {"00,0( u 01K!00,0( k"00,0( e"00,0( _"00,0( Yt1t0 0sK|!00,0( J81<0 0dn!00,0( < 1 `p 0P0 "K 0 `p 0Ԛ@PX0 "K t0 ܲ`p 0P@@0"@"K h ! @-DT п @ p ?0" -L  R@0P n QSAZ^ 4660?_EPE0@?P&P0`@Ѓ0Q?  pa  R0n0C b0pW?` ^  RP RX 0 056z`q@ 0 TP5SPEʠ   0 a<0Pb 0@ 0  0% 0' -LNL\ 0PpO`\.$Q 00` \aXU\0A0@ 0 03\ \( ANN1 aVn `p gހp'vXw 0ά 0 ʱ?赱к < /P 0S $0S 0S P /? @4@P/ -PL8p\`8 , R V *4f `V@1@! `V40,0 0S404`Q 0 ( 0"0V, 4000:b l,0004f 8c,04`00(@ 0 (3/P8 0-LP0tP R 0 S pTPʃIP  $ < @ @004? -Ll0P ,00040 Kh -L@ZPQP@a`Db/T`@0DTSpp8Q (0T $0(3/8p `(@$Kk -`RL@3 8S1R  -P/ 0 S ($ R 3/PP 0pP@08p`P($03/pH  $ <  (0 0؜4?0  0-L@PPQ0 Q @P ^ < @<0<@00/? - LTMT 0X0 000 0PH0  0S@0  0XD0 ' /0S-0 @/<` "-` @@S.DP &\ 8 d < P L ?"&   PR00@Ddh `&g-l0 U 0PEd@T<&&,<0,4pL `@0000S =L 00T00CS0STU 0PEd@ 0S S S <0"a@Dh$0S&$    0<@`0Ua 0PEd@T$0S`0  0<<@`0UL 0PEd@T$0S&$ 0  +K ` @`U1  PEd@T$ D`R`,  `@|+ ldhp\*X P" B010T :e0PEd01@P0[UL,0@ S80 0P<`@@< R 0H+ST  R S00S <08 @ b Pp:0,@<0P@dD0 Pe 0    0 ! 0$ X @S@00R0 pRR ,H T @TRH 0,0 PX00 0R(KP0S0 S d 0T9 06b@U 0PEd@T:zH ;@a6a H 808 Rt <H0 bR*0 bRz;S (P9L  0WT 8R0[ 80t88 UR00/X P z;0T :0PEd0@SU4LQND0z'; \0T 0T :K0PEd 0@S?U0  # D0Up1p!W $Q P  0c R c >   0D0Pg0gD0S0 D 0LP0 0 U  Hp$0pS Q D0S2D57YU0 1YPg0 D *'$Q$ C8Q AD 8 @6  @ 0LQ)  R=0 U 0PEd@Tp50c?o20s$0Q000 @5&,"(c0#22cR0S %5L  0i0 A$ RI Q' 0S#Ua 0PEd@T 0So $5L  0H0LP0 N QX40UE 0PEd@TLp8<  0 nR^0 0 0S@0b0 W L00\{ 0S&$<,&<0,4 0S x3#L000 8 < D0P# S 8U01Y p1p!W  @>D0@ 0g g D0Pg8 @ 0D0U 0PEd@T:zD+01@a6a0D0`l0Q|" "- TU PEd@0Ql0@DaS ` d0 8 S0l0\0X pPX0p0 t 0PP0 l ! 2L  00* U  Hp$0pS $Q (D0S2D57YU0  0YPgr0! 0@T6cd0PEd@T^U_0 R$ R40,00  L00 A@H D E?>?A?6?7?8?9?R?N?L? J?:?;?BȲ O?Ȳ C?l  ?R? 0-L@P0  $000L"L2 - LMP`0(0 rPp^u 0Sv @0< "0S@0< (C,K 0 S"$< 0 @ Q00cS R#2Q SQ0S0l0^P I R 00cS  Q # 2R  S@@R0S  l0S0a@d0@0( 0R $K@0Sl0Sꭑ~HS??? -LP0 Q@oA? -pLPWP@ 0 !(@3/`P: 8X (  0(3/P1 8 e aPSPp *S.0p Xa0p08`o=PTS.0a a T P(0 8#<($03/ -LuP0 :+ 0-L@hP0Q    00 -LXP<ʁ0+S(D S;D`C?L? -L<Pp0S`@G-xM8 0X@0SR 0P`0x0SUCP0tSPU 0@P 0 P0 xЍ0@0QY V`0@0tJVS 0U0P0Sx@0T`d08#8^0R 0C0x@Q@T`00bDRP P9Sx#(  4 , \#0  0 0C$00 @  00 `00Rp R00 b pӗ40`p0 08a0a1  Rp`00J 3 0S Cx0 4R0C8#8S4BZz 0 00᳠0Zk$0 0Sf 0X0 @h 10Z04*x\0lS 0nS@^0: 04 0(0\00S9,0%\00S30 A0 0  0 cB! 0 xxЍT@!Y 1"0 000@0 4009 @/o"( S  R @/o", %S  RF xЍ hO0040P @!`0 0100p ̘ G-P0, \p@M @ w4 lC`FpG 8a$ppp`p(pp`X0`00C0 0H:,< @PT0p4`0 PPP0`6P 001`S2&f@30C0a1S2!at  `0 V0ՅP 60C02&f0P$@Aap2'g` Q pQ ՅP'PqpGp(`a`fX2!f,`8V*QQ8`pSfp p0fp`D,0S  Q*0 a0"00 0[00$0S,  0$ 0S0   0S,0SQD: R ,0S  Q*0 a00g00,0S 0 Q|0S0 00  #4 00q00d0SG 0 a000 a00 0 Pt0P0 0 P ,0 S00R  $0Q\   S000  0 0 0 0#40 0  0  0 S0 S00P010 0  0S 0 0 0#40,0S0 E0 05P05000 7ꔥpZ4` t0%`pl 8R B^+ 6ƕ p!ƅ909t0l A`o0C t0l Q St0 SY S S`pl 8^^ `^`^`^`^`^|`^}` P`noob`V `^ l `S``051:Pƕ#0@``00 01I>  001&=  ƕ`t0l A0` lo`pt0l $3 0 0004Y Y 0  Y 0SU  0Szw*Y4`6 &R \ R80l0 b0 l0\000Ztpl 86` ᲀ!ƅ909&tpl0 BpG0Qtpl0 W4t0SY0 :Yv 6S \0l S8 c\ R8 b0 l0\000S 0000  00#400 03 0  0#400 0  000 DP1BhP0 0 0 0 0  0 S0 S00P0100  q  '0S0 j 00)\ R80l0 b0$ l0\0 00S9L D!B t0S*l0\06\0l S8 c -LP`pRPJu@D U00V0@0V {p8 0S8 0U S 0 1 0P |0`0  ! Qz&R R LDA 0B060PL D!B |  0-L@P'0PQ $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/qU0000 -`2LM0 80 0\Pp00  08Q1S00P| 0Q{ $0S xV`f0V`F00GQhFQRd0 R X`SFo᪢Z40 X @!(4/V `@Pm ! <40 <ɠ@00AX40B*0T0`,PL 0 0P(3/ 0 ,pwj8(3/ 0 L@(3/ 0 Dv(3/68!Q ( @ R% D PR!  00600 &儀0$(Ko(Kx080( 0$0S~\080$0y(K@ @0 8 000T< -LM 0 P 06 K -PL@?o2PPe8 ` 0!(3/@P`!@ 0 ,P(3/ 0 ,z8(3/ 0 L@(3/ 0 D(3/8P1 @0S. DYX( , 8 , @ @L D D  6 ` &̈́00 P 6$˄0[RC-  dß  0 R0#01 #R(3 0@ p ľ T P`\Ql (  ,P ,l\,q,h̀` l(Q P%%ľ% q%h\`Ql(  ,P ,l\,q,h̀` l(Q P%%ľ% q%h \`Ql(  ,P \,l,qa,X̀P \'Q  XpP\ Ġ| a qP̌    ` Tl | ȠP\a Q̌ @D  T k 0B0 0 RP@0@D 0 Ġ< l qa0̌ <1' T 0B00 R< 4 00#01Q # ] \ `Z Y RG-Mj1|0'P00\0|`M0Se @.0Y0SZ @.0 V0S; @.0 U P 0  0  0S! @.0 V P 0 0  ܍ U VY V /W 0Q /0Q /ji8RG-#8 H Q RR  0Q@"S"0R00V P@0 S0Ѵ000°0Ѵ0P@0G-鲀MXPPRQ 1J0+= 0k>00`p V0h?o20S3V:Ό0P98C800P0#406`VPcQ & 0἖cY C 0ʸ `VḐ6Wr W P0 0R0ЍXf X 1> VbUڼ0PA`` `P!P  BaS<8#80P b\1P8C8k`0` 00`P#4P 06 BcY )\㸐ƄoJ!P` 8C8k.000`P#4P 06WcQ0C6P V Tʲ0&cRڰ"(B(P P  P"$ 0C aY"(0"( 6 S{J!3P8C8 0 0 0P#406 cQ 0C6FPIP )k>\㸐Ƅ0J8#8 k>⸐&-0&cR]ڴ"(B(P P  P"$ 0C aY"(0"( 6 S8 J!3P8C8 0 0 0P#406 cQ 0C6058#800F!#0 6 0"("( 6o F!#0 6 0"("( 6G-J6 MS k>἖0 c R  0k.6 Ѝ3kn0 03003弖003P00300# 0 0b SPN00 0P#4 06BcQ!἖6PU*&06Q00 0 p<01 P e R 98C8000#406PEcR)P)( V0q1S tpc n Ƞ,ȠW%gp(B(   pP"$P PC n\  ȠP,( VAQ0003ӕӅ 0ಐ0iS0p0%(B(   0P#406IcW~x'἖0 #R{ `4bc! \Z0.἖i0.἖)( P"( V("(P VPkN`` P`,Ġ`0C`R,0 6 ЍLe  I>00 0@40 &M+@(+0M 0q?10S BR j60 0 1S0!\Y\%  0 G. 00R ,00R>+- 0 R0 0W0(KQP 6kΆ S! 06(˕ S< 8 /A!38C8k0 00#4 06cQ̠ Ƞ,Ƞ 0C68 S!38C8k0 00#4 06cQ! 0C6 S B("(38C8k000#406cR! 0C6 MkΆ 38C80 00#406cR! 0CX 6ڼ6 姟 S ʾ 3X0ἦ4< 88 4 .(Ko0 S030#Q0&MSI>@00 j6 SLk ("(#0 6 20N.V "0 Pr0Q ;SG;SD<SAI>00 E/Q= 0 S 0738C8000#406cQ  0C6k ("(38C8000#406cR! 0C 6I.00 ,0f H("(!0k.6/!0k6 <A Ƞ,ȠÀ Ƞ,Ƞ0k6I.00 \ Y X :Ɠ0@-V@Q@F   !I.AQ!ѕ"х&  &0B`o0) )U -LP`@" `0P X0PV0 @T 0 @e0@@yaratcid0 S-L@P`l0 Q C X0Q p=SW p5SVpyaratcid -L M K@P @oK -LP } -LM$PK`p( K@P m@K Sp (K]@(T 0- L@P M@o0yara -LP ? 0- Lw@P 4@o0tcid -LP & 0-LM@KP Rp  DV@P0K00@K0 0K0yara 0-LM@KP Rp  D6@P0K00@K00K0tcid -LM,@K`p0 KPP Rp 01 ` @P0 K0P K0@P0U0tcid 0-L@PP 0P 0P0tcid 0-L@P (0P0 0o00loob -PL`8@PP  P 0-LP@ X0P 00 P  QP P 0rbmn 0-LP@ X0P 00 P P0 P 0rbmn -PL`D @PP  P} -PL`= @PP  Pi 0-LPN@R `0P 00D P  4 0QP< Pm 0rbmn 0-LP+@/ X0P 00! PU P0 PZ 0rbmn -PL` @PP  2P -PL` @PP  P 0-LP@`0P 00 P  0!QP P 0rbmn 0-LP@X0P 00 P P0 P 0rbmn -PL`o @PP  P -PL`h @PP  P 0-LPy@}X0P 00o P  P0i @P 0rbmn 0-LPY@]X0P 00O P P0I @P 0rbmn -PL` @PP  `P@ -PL` @PP  LP, 0-L@P$0P 0B0gnts -PL`@PP  &P 0-L@P$0P 080gnts -PL`@PP  P 0-PRL @00 0-L@P  00 000 0-@L0P 0 P-L 0R P Q co ԛ 0 S-L@P T``PP Kh<Kh[p ( -LP@P ᬽp`AP  ጺ `V 0-LP}@P Pᏽ000 0 -@PL 0 0R ePP 0 00  00`P Q "`h -@PL t0 0R 6PP `P Q "`X P/0 0R / P/0 0R / 0-@PL L0 0R 0 0P Q t"0 P/,0 0RP///XD -LM@P ?o 2P0S0S K0 P 0  P`kpP 0 S  R L  S PPp 00  k L @ -LM@P 0 0R KQ" 0  嚼 PP`.pP 0 S d  S PPp J,00$0$ $0 j d xK XK K o0P- 8?o 2 ^0S0 S  P-L<0 0R P ɽo -LM$0@S`PU  K KP,0K P ,pP 00 (0KP (0, S 8P mP P ,0 0l 0 // R0-L@P 0S# R:   P0P0 ,0X0X X0 ^D0D D0 V000 00 NJ 4I J J I pJ J H PJ 0-@LQP P0Q0 0 S-LP`@ 0S @P<P QQ P>Kh 0-L@<P|P0/uP Q nP Q>fP  K0h_ 0 S-LP`@ 0S O@P<GP QQ <P/6P >1P  Kh* -`LQ@ 2>Q# &Q P Q' <QP&PQ  PhPPQ PS 0-S>3  0L0S<\ /S `(`  0B\203<00#/R>R  R `R  0B0S>300# 0/R>Rpp0aU0 P ᤘP0/Sg 0$00>Sk SW 0`S 0C0SC` 0A R103200#=Q00S Q P  @ R<"  " =P  R0f`00"S 0R 0 "R< R  "Q? Qx`FVu0Sr 0(0y 23  0A0SQb 0 0 <(0SV0$00`>SP0``000 0 0`u  >R?00c0@ B B @-P <P RQ RP <PG &P@aT lT gTtP4 @mT' pToPsP;P'tP;P<qTuPoPtP;P"@pT@;T;P>S0S Q-0L  ᣗo -LMMMK`P1OK0H1 N?KL1 QK=KP1 0A P@ H Q-  RဗPT$ D 0 3/P D1L@1 PAD<18Q5/P @1D1 00  0 P@(K@L<1@8Q5/ 0 @ 0P(K4@ D -L@,OPPP DaDqDD`p@@ 0B0S4<R6  #P#   P  P*  0SS  -S00-S0>S  0-S0>SSS @93@3@@@> > > $ -MLMPR`pcP5 @T2 M@Wz /R y/R 0AW Q/R 0CW /RW  C B/QW0A0g0SBK@1H  $0K@04DBKH.00 0 S*  &p@0  tHU gPHJa0P K[? 0  KT 0  KzHp HPH\PHp wHHp06P 00T<  -LMPKUI@P% ,=HpPD KIpE dKV?`p0 0`p P`om9Hp(  ;I$K0 `P\m&Hp  (I  `P0 Jmp 0 $KkI3$KH 0- @LIYIK0h -LyP 0 0 С7 T9 X8 -LIMMK@ KNK V 6/0 0  &PR @ATu 0 R 2/0P`x` P0 0 3/V@ 6/T xT T@AT8A . p0S2 03/P V 6/x81pS @0 R 2/0P`x P V 6/W3 003/(K 0 0C/Y 0 0C/P 0 0C/G 0 0 >| |0| 0 p5h h0h 0C/\,(5 7 |6 5 p7 X6 4 @7 46 4 7 6 4 6 5 6t4 6 5  -L@PP-  P $0SP  R @;lP P G@P 4 `P@5 $t P5 P0/ -LOMMKH @X! L HLT0 000 \D! @! -T! R/KmKQ_KNKOKSKP! T%`0 PP4 HL0@ 04/@PSoKR_K@HL003/@0 P(KT@D1L!HP <80 TSD @ H L (KX!R000 0 0K/dT1 3 2  0/0/ 0-@LK0h,, -L KhpkĊ (0-@L-p0訊 0-(@L@e0p00-0  @ UT:0/  RP00/P0-' 00#0  A T0!RUT0/T0 P00 UT0/ -`AL@up៯PP (P ᆯPP ӯX(0( (0 LЈpi0 0 0 ? p- L,M 0@ h  d`2030S<SD<P D D0D 0X 8          -LP`SPU@pP  Jp P 0-LP@9P0P0 @00 -@PL 0 0R %`P 0 00   pWɻPP  P00P/0 0R /l P-L0 0R PU `V ᜻@P  PT T0T 0x Hy0 000 0x $l8l < B8  F P-L`0 0R 0S P 8 808 0 WJPL 8 0P- 8?o 2 ^0S0 S ē P-L400\ 0Sol -LM$P@U`  R( x!0 PP 0SKح KPp$ @  0 P0"S !1 0 $0K P $PPpP 0 0 0KP $0R x P @P PUp $0 0@ꎭ0"SP    Bh / 0-8P8@P@L 0 00pX0S t P/?o8  2\0S0SP// 0-D@@L T(@@ @0@@P8WW 0-@PL (0 0R 0i00<P/0 0R/0P- 8?o 2 ^0S0 S Џ0 S0-L@P 0$0S 0  `P 0  XP pp d@@ @@LLL@ @808 80  60V`6Vt X  -`PL ϻPPp @@P@ݹ@Pp DPP;P 0,p0`4080<0< 0-L@ K0h P-LP@p- `0V+VP*  440Q`   V *000,0 10,0 10  `808 80 k$0$ $0 c  ` x  @ p-L M@P400 S<R,  R S 1CaV( P` 00 jP400C40`KpR 0 0 f+hg dKpS L L0L 0 u4 404 0 d   `    8  -@L`,PpP U 0 !S,p0`.,p0`0 S-L  Q< Q  4R ,010D D0D 0L 80 000 0L $ฑ똊X   B4   G40 S-L 0C40 0 0t  t ( -PLP x0`0V@ 0S R< 0 0Kh $ $0$ 0 ]t`$ d  0-PLP X0 0R @ vP 0 0  0 P봈  Z 0-LP8@P P P0 0 ZUP 00 0R< 0 00R< -LM`@P` 40S@ dP@T K ?o2S*1 0RpP 00S 0/0 03/@P  P  0 0CS 0@ 0@S YP `Khw@@, ,0, 0 4 <(  \ 400 S0-L@P8S 4 <0,04Q<00P0 0 0 & L -LMP`Up@$  ZP 0  P (0S p @@0 P00KK$ $0$ 0 W p  B -pL` 4dP 40S @,0Q], 40Q@T:8 408 s  -SLp@P$U `V 00Q NL00 S T` M V ; $Kks 0  0F/렃<  0P 00R /؂ 0P-L 000R P80080蠂 0-@PL <0 0R 00P 0@0L 0-@PL <0 0R 00P4@0 0-LM@P h0 0R K0K0P 00S@#:@ꐁ 0-P@LT ,0 0R@%@0 0-P@L80080K0h 0-PL@8@@@$0 -@PLP 0 0R `~40S,0AT u@ 0  0O/&4 L R p-L M@P 10P KpKpP$  K8040 $ S %,0aV $ <0, $0!<0#@.@+@D D0D 0S/8܎0 000 0S/ӎ $  0-LM@P T0 0R K0K0P @(~ p-L M@P 1 0R KpP  4 ^"80, 1aV# ^, 0^<0N04<0KphKphD D0D 0W/8l0 000 0W/$c} d   @ 0P- 8?o 2 ^0S0 S l| 0-LP@P P 0 03/P P P0i0 -L M0@S K  3P  $0SKh{ -L@PP u @P 5ϧ`.˧` 0-L@P $P0PP 011/ -LM@P P!\&„ 0 0K 0   ȴP 0 0 0 0K808 80 Aࠍ$0$ $0 B 8 0-L@\ ^ \)QRS  T000 0QL R S "  T € 0000 0 0 ZS X 0-LM0PK0! @ᥟ0K0a ⟟0K0a ♟ 0   S K0 0-L@0KMP た   |![  w![0    SK0 0-LM Pb8"8#4b4#K0! @Y K4"40a Q K4"40a I 0   S K0 p-L@ M `KP 1 b8"8#4b4#0 '"[4"40 [0$!$    SKp p-L,M@P`P5 0S2 R00$P Kp0-S  0   00 0 0 e P0 R 0S U00Kph U00 R 0-PL P S  Ro Khc Khc 0- @LեT000 0-@LV2pT00202@-<2 n0d@!  0c a bS@  B!0S0n P0$00 /@b``Q$I@-`0F \@lp0PF UPP^PU 0@LΎPS`*ST!:@ -L MRp0  X`BPPX @@ P00 P(KY  $1-LM0@ P`\p( 5 K00@)K00#30#Q0#02S \R00@("[000( 0R$Kx2P @ 02($ 2KU넍H -oLϟC 0C0@< Z50c0 8KD0S@< j  |68/2bd #80 0@00 08K808A!/A!b!b0b0@< *@00 Y@< ,K0 0!c0 80dD v>C 0CR80 @<   tş ` a080 B00D0 l@0  80h Y@< Y  @0 020 A@< Y 0 0 S@< 00Y 0< K?ad S#a00`?o2 K?ad S#a  b/o"<  MRm <@ \ @P 0 "#\  @ R @ R 00@ 80KX0 0L T0P 8L`.<0 @($  8 X 匐ಐy <0  SX0 B 8 Q00Qm QX1d0``0c;S80 2c1.1#\< TR R @<  CR R @w 1 0 @(0 $  @<@ xd? 3c 0c  K?ϠRldS#l b/o"08!0 1 B00 o80 DSd080 D Q:\P > S>^ 0c$0 ( <@; ABLB^^ P<Y@ bPA bNB Q$ M B<0 @$ (pQX $I L 0 nl' ,  Qdz H/o"<KPzX @<@ 000@8<0 4JRx  @ <0 0b$0(<T XS0P 8 Lb!<0 @($ !<X :P 8 ,1 0!0( 0c$0< @ 0 0 0z 0-L@T 0 0-L@T0000 0-0L0S ㆑|z000 0-0L0S v1000 0-0L0S 㩐w`o// -LM K"- Kvt -0LM K{-Pp Kwt@ -QLM Q Q  0  K  K\-0 Kt T-^t ($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ẞ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P,80000c 1 0#2 /UUUU3333R/  BP0P BrA0A/l!l1 - L,MP@0T`(0  pW ?o2T0S= ?o2T0S f( 0R4 K HK0@0*$K",@$RS $B R $K $Q  X0$K $Q   RfNpH    ": S S  Sc  Sw000  S  SU  S ? 0  r -   w0-000!-@RU K RZ ! Rs  0 r -   w0-000! R? , R4 Rs  0r -   w0-000p! R5 0: R* Rt  0   /d000s000R-  0R-  0S 0x 0x 0S 0T 0- 0x 0 S{ A000xc000tl000pb000lp000ha0-000b -AL M0 7@P4 <P/ 0}pp 1@ 9P =R Q@` P0Up1`@WP0 0(K0 0 llDL2 -0LM4Ÿ ^|Kt l lpKXN@-  0 X>,N@Q0  CU0 ?UQ;  :U -0LM 0KUP K0 R! / -pRLP`@ @T T !03/pWd / 0-@LPʦT 0K0h/0 -`QLp@P RP  0D  00ἀp$`,@(P R? 0 0 -L MP`pb@P 0U0hV \  W0P00LPP KoTT0 S0-L@ 㵇0 P @0P X0 0001 1 00㨇00 0 0-@L␇00CS00 P㎇0cP --L M0 0 3T K -- LM 0  S K 0-0PL M R4PK@0S%  S#  10/0  e0!   K040 L0 0,0 ( $@K4PK0 W0S 0000X   ( P 4000P$00///4$ت -%L$M P@4 Sn*%4  Rv kR R4Y- @0UZ>#R} Rp #&R R! R  R _ R Q R  R *T   _Q R(KR ap>#R wR R R@0 >30 QP < `P fT  nP<0@00p R@0RY R@  Rx  R T R  0>#0!> Qy >Y b @mQG  R5Q*T_Q^Q Rz R-  R {R~ R= Ru 00c>c`cK`0cKcK ` P0CK@^T ^ F R " N  RHT ^E  -#0C>cP0P>S P!>#"RPE P  0!P" > Q 01S@ >30c`A PP00C000 000A 0>c0c K0cK`K  P0 #K 0P0 0P>3000C00Y  H -%L$M P@4 Sn*%4  Rv kR R4Y- @0UZ>#R} Rp #&R R! R  R _ R Q R  R *T   _Q R(KR ap>#R wR R R@0 >30 QP < `P fT  lP<0@00p R@0RY R@  Rx  R T R  0>#0!> Qy >Y b @mQG  R5Q*T_Q^Q Rz R-  R {R~ R= Ru 00c>c`cK`0cKcK ` P0CK@^T ^ F R " N  RHT ^E  -#0C>cP0P>S P!>#"RPE P  0!P" > Q 01S@ >30c`A PP00C000 000A 0>c0c K0cK`K  P0 #K 0P0 0P>3000C00Y  BG-RM@ 4`8 @Ԃ\F pEQ>QA !Q DQw WQ QV SЍV>SR 0 Q`  Q ?&QK QV0 Q  Q Q Q >S  Q VQ Q>S < >  eB̠QPU0 "Q>S > Q  V0 W0    > ^ >>S U  qYn0 jQg  d -xCL3Sw S6 Sr S@t S S04  0@ 0P EY40 P 0 p0T:(K0@>3@1># R@004 8P  P0@ 0 JU8P0H>S4P1>SP1>3"SPE P0 Z0P  px>S@04  0@ 0Px EY4p 0iWP P  p0pE S S S p|  b>SR? sS  0 b>SR? hpSrG-RMP4p8 GNA>cVD %V MV eV VW SЍW>B 0  Vb  V E&VT VWV  V V V` @>@ @ @ V SV V` @>@ `n@@ TX  nV^"V` @>@@@`A>C T  WZ X} @@ @>C T@ >@>c V@ iQduV ` -L4Mp40@0 00(@H0 3Q0<0 0PQ0 D  \0 0A?0 0@@ 4 00 Q U  U @ Y`  Y T A0 @T0"V  U- <"   _U \  Y <P" _YQ U "<   _PE_oRR  R0A/F BR;@0P@`4\ 80 4 gD UP^ 80 H@00 00   0 P000@0z!V  Y  _Y RQ `0H0 w0``  Y  Y @` u Z Y,@d`Z Y PTX V `0 @d Q L U(`4(K$/ -LM`0PVp;*01>#Rv R5 Rq R@s R R0  0@ 0 HZ0`0 P 0 p`0T:(K@>3@1># R@0  0@ 0 IZ000 F0`>3 ` >1>3"SH0 0Y0  px`>R@0  0@n 0g HZ0`0@ @@p 0WWP P00@ p0pC` R R R `}p`z >3 b? `qR  >3 b? `fpRo -錯LMϟh0 ^@  (K 0 x0 L?Rx0(0x0`00p0 x00 V0 h0 0 0l 0 l0 S h0 0 0l 0 l0 Sx03 !/0 S0-L@ :0S000000 R [R.Q00C0 S*R .R 0S00(00000 ]R000D0 S0-L@P* 12!2"R 0S 004000000 uPP04 -`pRLP@P 0!~0pp 0-LM0@SP0S*  !K0 P 0  -L$MP 0@ @0 0 0:R040 ):q 210S  ,uP p%uP0 W @\ 1##2\d ̅@0 塑9)H 0 B2T0 Z p`0V } P&  } P WL %:9嘙0D0 9 080 90<0 |9000 W+*0]S" - S Q #R  -Sd [SQ%:0 S`*-Q  00000 P0p`W:0S008000(K0:S< =S R :0S00d80 000-S]S0S0048000= 0000DR*0V0=Sx 0S00 ` p0S 00X:0匇S000-S]Si `80<|  }P0S Z0S000S     000S`0Sp )۔0 JS ' 0 0pCᵀ0S ᯀ 0\0 0= 00S0000DR *0V0:S0]Spp0S00{0帅S00`0-S]S %4 0  ,  000  R `hr ]RH0@ "-00-00-00p0W*000]SQ'  0RJ4p  d  tdld `V 0Cs BL0S! 00SJ p` p `   c 0S * H0@ " 00 00 0C0 Rv H0@p b0 0 pSWg00  0S(Ko+0^S L  ]S -S@ pA᎕0S 002000(Kpp] 00]00]00p`)RP ]RM -\x V0S 00D000\<p`H0]S 000(Kpp- 00-00-00p`0 00 S**`0T0j?o20S R4 p000Q00S! P `Y00 cB"(Ko8`Q V 0L pi[Y0@00 0L0S!.0pL0 Xt xt xlT$t P|0Ht`8l$! 1-LM @`08p 0 P 0P00 0S 4040 0R K t 0S pP$0K0"0K0] 0$K# K"0KpP 03 H8` -`PL@  aH0D R % T \ !B d@@!n 0` -LMP@p`  UP 00$K0SW 1 W00V V0SxtLKJsrqpo"kjihgf<pG6pG`F  h0  h$Kk?p0 h  h40SP "-0SC  & `Fp  h0b 0P  h 0 PS "0SA } $Kk$K`0 000 $K  hg A a  h [\ -욟:L DMT 0 R\0 0@`00 0 S| 0H0 <0 0@0 :z0X0 :唊0`0 :p0D0 0P80  Sy* |R* Rt  $AXP񏐖~}|{yxwvutsrqponmlkjihgfedcba`_l\ZYXWVUTSRQPONMLKJIHGFEDCBA@?, 00\00 0R&(K0S0080000 S:80S0S00d8000@0S0S <0 c  R* (0000 0S 007000 S* *B?RQ{R PK R:0S0070 0000L 00* 40K010K0 ^0]40K3K010KP0 2KP0L 00S 006000 R:0S006000 D0 Z 0DQ 0 S*0)S T0)  Z 0!  R*00 )Rb 0PS005000N  0(0(0p t 0(,(,a0P0 0S 00D0+R00 ?R8 {R $P 0+R{ ?R, {RBs0 S* ,R0  S * 0}R0( 0}R S00S 00X0P00n0 S  e0 S "0S   S* *B?RQ {R Z  0PS 0008 \*L P 0Su 030000 Sw  e*Rp0 S  e0 Sk  e  L0 L0*R0 S  e0 ," 000<S Z0N R  `   F000 D8 RK @ 0R0 0S80H0 <0 E <0 cm0 S0B<0 H  "b0@0 H0  c0H0   e0   e0  A 4  e '  e0 0S 00$ c PH0 oE0CS^ 1x 0IR0 S00 0HR *Q R\Q 0 ` 0R0 D  f,0 S  f0l  fP0 `P\UF0S00D0000P3\U;0Ss t*U P0S 0030000  8Rh  f0/ 0 0  *  40K1K0^ 04K30K]0L 10K2KL  00S 0012U0S) * 0 R 0 d L0 L0x  0 O {RY000S *,P 0PP0 S:0S 00P` 0PQT00000=<R\PD R Q\P 0R }PR0S 00HH0 S)Q0000 70`(,  , (0 @0)S{L OL R0Q X}P00`. H4$)<{x} 0-SL|MP `p| vxh啊@P s 0000 o P   0KXK☀ @ `  Q( `0P40p `` `(`,`0`<`@`D`8pK|H` 00C 00 0 S* 0 S: 唀0AX$0I8PI0S R  0SQ0P  X, PXa *(K4p X0p40p ` R 0 P  P ^ 0p \0 0kPV P`0>#R ,R0 R R, @0P`@Rm >310>#R R "R (( 0>3S S0\>31SARP SQ(D 1L @ 0 P| R(0dD`!0 @ L0 @100 0 D>c 100  )0S00 000 0 ᙍ IV@` @pW( ( ZP<@( p0>#R0P 0R0 (,D( L00 @ SEe(Ė -LMn  K -P1LL!MM nK `F `Fp@ p10 8KP 0 0 R5(K!]K PE PE {,0K 0#T Px P\HT CKH P4TKl0 PPxP @T\\  2,H9 ! 1-A!MLM @00 |10 8K`PῡPD~K pG pG 41ᱡP6!]K PE PE "{,0K 0#T P X 圧P"\HT CnKP`F4TK0 P卡PfxP @T\H0S h I\壦0 0R (K\嚦,$00+H 08 O  -LğGMM ` 4 0V0 4 @ F^K PEEK 0E A0C.KA; pPx4S 0E PT 0 Pl40bPPAt!pPPpT hPl h EPx4~PlPwP*wP%x4$`0Sxb`/ធ `"4 P:22pT h rTt40 0R{(K/~PppT  9PZ Z0$0 $ 0 1!P0 2 $0 $ 0 T1T!P0 18a`Jx4,,  4 !0P4 1CPp ||*HM tB `B L L L L K L PL PL K dK K K K pK J K J K J K J K -01L,M `pK0@P (0 yT) T0U0KPK @Kl@P00:K8P[0$!$("( y/ 0 ( Q K0U0K  KK 0C K  ) C.K;0 P[9SX NK +m+I'%9p 9 ,9|] P@ #K J P8: S 8!81 0@0 uDz{90 0R8(K 0 0@0 ᘝ FP8S ) S 0 0@0t 0 0@08 L \0 0@09)0 0 U@%,Hl; H6 t: : : P: T: -L MpR @P` 0000 0 (KoE``P `0  P  CC (KtX84 9 -L4MD@KP`p t H0K< NPH@T@T 0 PPHg KHbP KP p-xLt,M @P`0K08 0,  0 ` ( $ 0PK/Kv 0RKpb%H p-tLp,M @P`0K08 0,  0 ` ( $ 0PK/K 0RKp?%pH -P@ EpLWt`P 0 00Ap W ࠑaA\WAAA\7A Q0 S AL\ 0 0 S$ 0d` fS 0ą 0R:0f0000 -\0@P?00@SL`P ?Sp1?p# @0C 0R ? S *: 0T: 00?0R*00T !*0ᨀp娐 p???p .` S*!  P* U0R*`Q S* }|l|@|<|8|4 4 -H@H0@PL`pV,00 @M 0-L@ML 0P ( @PP K08{3 -L,M0K 00K0 0K0$0K0, K(0K+3P  K4,@($@ 0K3 z -L4M0K@ 0|0K0 0K0$0K 0, K(0K3P $K,(00 Kps 0 2 !1 - L\M0  P@l0 0 !@P  @DK0 d l` dPPN TqT1p0@`LKh0 ᝄ0` r@P. JpPTKPP0K0hKX0K0TP XP X|P0SwA xP %MPAs00l00 0R(K#H`2 \, D2 82 82 !1 - LMM0P1 000 xnhH `pPPN PqP1p0@`MKL1 .0` @P. oPOK/PN?K0=K0<H1 LaP @8 @ 81SiA P oPYAr00P10 0R(K#H* 0 |0 0 0/0v 0 p- L$MP`Q0 0  0@Kឭ|0  @K!SB0 0 0R Kp8 !8`P "$H. 0-FML Mp]K0@(0 ' V`PBNK@D,+D Pʈ$ $r@[ r$R@( 0R K"TH -h0LddM P@K0p(0 ` {( 0R K"Hh/0.0`0 -0LM R@ K: 03 KYjP K- TZ 08P0/ ꀾY 8P/Y 0-D@DLM@PK %i 08K0s, `8 8`#0MSZ1S Ѝ/ 0 0- L M@PQ00  ,K|- K 0K!RC0(0 0R K00 )~0PP !딽H<, -LM M }K( pG`, 0 @lo`P@0@ X0 0  iP0;CK+0R0" T 5 MP ZT0@T_0#q@Zq@,(50 0R(K+q@H qX@ QNK @DDpF9!!ȼH - ML0 K -h0LddM P@K0p(0 `  B( 0R Kc!H/? -L M0@0 0@ pK00 Ci0   jl@0 p0P""` p P h`c# d8$ p})#4 <nql,ha)P%dD#,Ġ?`n,` ``a@(̠ | d'@ . l,`p@$jX* ,Ġ %T\@g,\jT%-a ᄐ 0Xd$ \(T~T@0a(P i) P&P0,ĠPb!P%p0 >d$i,P* P( P%n0`a! ͟d(`L@P")Pma)` 0% P ฀ p. 0  dH$PLfp$DmH0LiD$p' @ c8#H@D fq#4-`(!<d4#͟@.jX*ba%T  '\jT%@  @@P  "@a @< &i8) #4`!a! <@8P0a?`0?SP a$Kk8c@@f 1c`f W 0@W@ !1 - LM@0pK0`P (0 R00000113 R0 0圀~? S  0~? S V`F  "00113 R0( 0R K묡H8  0 0- L M@PQ00  ,K|- K 0K!RC0(0 0R K00 )[w0PP |H@ -LQMM mK0 `F`Fp4 0 @(pP@0@ X0 0 aP0;CK+0R0" T 5 P T0@T_0i@i@4050 0R(K+i@iX@ RNK @DkpGNF밟H - ML0 K -h0LdlM P@K0p(0 ` A( 0R KH؝0@-0000 00@PA 00艫#EgܺvT2 -LdM@@ lKa0X @p`n  P!p0 p0$ု4@| t` 0# l` h@ 0g|: P pmܼvmzNS i̅ `$b+ `3 `&P!pT@PgzdK`*` `&`xLfiDnj['c;,.  T*lˠ ! )  l舄ng{& \@a.-  .0h@0Tc< L` n@"@iP$`@b+zDmHvL @fk (@# @@$*Q<@ꨇPP@@qhc; )pa p. ,pPiˠ'p\[n @* @ @$Xb0@ngy`@!@@$``8@` DnIM@@ljzmva %逈fm 0' "@ (X2g{0Kh0&e[ 00#  "`;<`zmv fk⏔nn(  lP id h . p $p0  " ͅn dK )   "PgP8p#n  4`e]dnim`Hp!`$4  ia0 ,+ 0* 0`#0PXzflmn j{lˠ%v 逈c:*"D@Ĥ(b+ @#@@$T@` DnIe[&M@( @@ 4c; dM.nfk p p)p' ` < phpi '\pn+~G!sG ,wGdKpa+0p{l̃0*lP)+J╣J⫧JD` P%P]X`i;+nFcF gFꨀ,`\!hn H )g{+@`@mlˠ @ %@)j p !P@p +NDehPCD GD)@@0ؖT@V @3@0VP*  d$Kk [ - !LM P0`? @#|#(0K#4@ l &K!!'0K$K!4R l"K B#0K!K%pK(K T0F  ", @ S @ "$ @  @ 0R` Kh bHL Q % 00 R% xB@-d W@4  R  *4 8/ t0 S@- d;@ 4 *8 R РS /'PxB/808 0#R /Q//0  0c <c -LM,@Kp4`K $P0pp4 0 pO pp0,4 8 0 pB pp 0,4 8 0 p5 pp 0,4 8 0 p+ 8 R B   R :0 0CSR 010! R0*0̠+@4@ 0 8 p`(K(Ka0 Ss -1LM MPp0@.K(0 nK`Fp  >YT"( 0R" KKAA:Tp nK`FPT "YT"(@D@0*0>aH0}HtH@ 0-0@L@+PP0*a@P$1 -@ALhM@0pSE |@K6P$KP]|`t]l0 d]P@]|P`t]l0d{] KbP@00n]k]'}44@Bt - L`^X X0 0@PP`@@T 0S P `zL`0?P0T P0 !R 01 R@P///yL0@>S 00 00//yL p-LM4@K` P00PV E>R 1"! 00 0  Kp>RL 1"! 00 0 P`00L`00,y/ -p-@L MP @U ` `0 P a 0 X0X 08 R;0Kp0( ( Dx@1p 0v 0XQ -Q =QR-+R 00/+QoQ uQ gQR   +S -S =S000@/     000000 0@-0P XS oS; uS6 gS 0+S -S00PXS^ 08 !0P @@PSPQP@\     0 -"# I@ -LLM@TP <`K0 LKL0 H0 D0 @0 z@  r@l`PA 6p00000 X0 0\ 0``  `a0GSGEDCBA?>=<;:976543SX=WQX R:`@`↑ h d0 nP h d0 dI ` \  Z R*\0X0 X00 pW ,W4 +W@ 0-S1X0=W0X0  0PXA@ Q񏐸% II00X  <X  ;I?S R:`P`↑ h0 d ZnP d h0 eI ` \  =W: Z+0G?o20S R4*\0X0 X00 R:`P`↑ d -nPc d I e ` \0T0 0]0 ŵpC'=WX 10X0 `P`↑ d nP9 d I e ` `@`↑ d mP) d I d ` ,7^ PK0  P00S@o*^0"S1Ds >0e-+ @0 (K`` ^`@`ro^@(K`XP `+@-p +0B XR R```(K0+R XR  -R`` ` XpP@pQPppPz]00]`00(K]0`` 0 u  -0LM  K  p` K P-L 0 K]P/00/00/00/ 00// ///00/ // / -@LP`e P& + Pu 0 000PqjPP0 r"ux00Pp000p0+ Pp  ]@WU]0@ " , -L@r\P` +00p=80p0 `@+00p.d,0 0-@LTP`  @T0rS PKh P 0+SKh , -L0K$M #, K]H10 (0 0P$0 J 0100SQp@$ P Q 0$K0( 00S.$00K K @,0 +)\@Qh0( 00S d$mp\0@K,ݻ$0,j L -LK$M 0,, 0 K 4 $10 (0 0P$0 A 100S4Pp P 0$K&0( 00S($00K K:4 0,]&\|0( 00S@ d$|mRP\0@K, ~$0h`!`1 - LMp`0S581PU 0V90S P@T0S7[0P0*000S `K[0S   5pP *m PK$mKd1\0PUL)w*80 0@ $@g0(L'|'L -LLM0,PKl`K D0%00p@ pVp@[0S xPpp0S@#W l(Kp jpP 0  pp p .p@`[0SxP @ -LDM0 P  XD0@/#K0040 0z0D0@+#K 040 U`0 0 0QR00 Z0X0= R 0d0 @0 @0 L0 0_3@0H0 V0D0 0Z:0@VU cK0  aV@U00T0S@0##R00o 0l D00Z:r7L0_rep24 2@ @B!e?A1c1 B0 0H0 |"0 0(K\B0@+#K040 0/#K42040 |(20H0 D0 0cS0Cr d`p b0Csp2`VpX0@P PCK 0 UP0ZP @P (K@J@0#`40H2@d 0 @UL!? L<,0P @!(Kd0@0 0@L0 C x0P c 0h9#@ 0@0 0L0 0d0@0 0@L0 ((K@0#2`p@GzG d Qgfff t G-qM0 `P 0 Q:P0 0!S2  S3 S S+  VZ \ V Q*P0@!S  S S0S;P0S `Ѝ S0 R00 00 R @T R0 R0 SR R# 0 0P`]-*?!FR 0S0 0 R P/// -LM M PBNK@D@Dp`+( P0@( 0R K03/ `]H -@`P`` a V00!5LIP4 hpPH 0SG  p0S0 h@00kfP. T j  P 0  0  ! 0`V*ZGfpP T q 00S"qG0Y 0 @ -HLDŸKM M `@pP/0 T3 /T   @@T/T  U00 Qf(K^@/T<UU@0/T p   R0=K 0C4 @$0 P0   0S00/ 0W/S 4: S S 0 00 -00CNK+ P 0@P4: SW/ 303 101:nX/ 0@@ (03/[H -4L0şNMM 4 0㰠P@` p0 4 JXT'*0U@% @R0 R 40c?o$24 00RU4 0 S400E0&P04 04 4 4 40S 04 gCK +O 0@ I 4S 0@ $04 =K 0C4 0G4 :/P 0  ß R   Q .R VY R   WR: R YL4S[ 4S 4$=P4: S $P 4IQ/030I1 10040 0PF00K A$0P4: SX 40 0R(K  .R R .R V R  @% 03/Y$ 0L  NP 40I0 lPm 0$ .Rf w 41YV=YTW0S4 04P0 4"0S. CK +P. 0S + P@/W 4/P  0 3/  0 W0/ 00 0 XH*X < -5LşM 4M0`Q K@00@QKA~P 00 VD +K[K, BQK08PE LHQ-KD BQ K @ Q ?QM [QB *Q3  0 QQ=K0 S 0CRQ=KQ-K 0C B0 S P PPQ-K B 0QK0Ap4b0 Q=K0C00 0R (K 0R  R QK 4 0B 0!^ ^ 0 尀 0 PB 0P p]PW !^]Q0  -Q]\ Რ0]Q 0   o0  0BU 0R S0BU 0R S 0] 0LY 0 A 0p/SS` +K, BQK PB  R0p 0/SS;Qo K0,H0 4XSR`IPj R\ 0P \  R+ST  Q pR*0S0;RD 0Q-K B K AA @+PP70Q-K B0 0< S(Q=K0C sP$;K,0CQ-K PC0[0!^0 Q=K0K0C A0C.KA;P4S 0PP+S *EQ=K0K0C A0C.KA;P )H`S?-*0*[!]M -LM 0p P` 0S0 0'0{S @(K S 0{S@R `0 P 0 }R R O K( KUU00 -ML MQ჎Kp`  0Pi  Q 0@P{S }S! 0S [S0@S]S ]PPP @0S  (KP0UPER2&{QB }Q)UPE0Z 0 I0 S:0 00000C R  X 0S [Q ,QU 0S00(K 0]RR ]RRR0 P -L^KM PEM0     nK\@  P \   "K.K\ BnK@ B{Ɍ^ɎBR  \@ \\BK -`LP@PTQ PEP0S e@Te0000S [S \S ]SR 0S/*S ?S/Q0 S 00 @- R: 0 #R- @B RT 0R "R  P\R  R0\  "R0  BQ R 00  ,! (1-$AQM L MP@0 S`(  ᱷ( 0R1 K SK R.K B00$0KpB #p BK| HH0 pq\CP@;400  ,FH, 5 -eLM0$`P d500SR E0K@p0S %P @  0S @#S deS0 p0P$XSP (K u1`Kp  0@S 0 04 0  0S t帄帔 p  0#3Q0 |$ 0000@S  JP  JP 0#3Q0 # 000 JP 0#3Q0 # 000 JP 0#3Q0 \# 000H JP 0 JP 0#3Q0 " 0@00 0#3Q03 xJP2 0#3Q0) " 000v10[#S `20@ R 20Pc 8  (K0 S S0 S S! 000R >JP 0#3Q0% .JP=Q7  $JP=Q6 d1d!d0@ 0 f#D (K,! 0 00 0@S0 @CP  P000  P00 0xE|dp  ,ز  t ` T Ȱ  d  0-PTLNP N@P$PPP 000 ꬮ 0-0@L@P 0000 -DxL@ȟpM  R^`@0 P S 刀KDpZ \KPs0\ KP0 Hx d l \ P `8 @ -0MLˠ0 K 0-@LM@PQ  0ˠ0P K0@K0Flp  \P  t -@L@0S`'@@Q*pPpP0S `N@@}\ P ep ABdAT*`0000 Sp Kp (  -`L`|@፮t0@P@T `0`0@T@@~<P00r03\ -PLPp@`` @0@0S @@zJ V"@3*hNXP00N@@@@ꄿ2\0, -L~ 0 0,2\ -`TLMPApP9 0S,L0V " XU@ K (K0P (  Rā@!Rd T夁Lb0R @0pL00Q*G B&R&>$#"5 . 夀@b000 b00tF+dK&TA 0\ T x  t 4  %-5BML M 씟P$ $0 L$ H$  @$  0      +0H娊P08  4L0 4WP B^KCNK PE@D\ @ P 0S (400#S @d\  P 0S c3`0`\  P 0S c3`0`\  P 0S 3 0   \  0P 0S H30\  0P 0S 303@E0 +MEbr2,PK0`pD%D4 \  @P( 0S HPYY nJPD40S dcJP` TL2LL0 $aU420P RCNKP@D\ | PY 0S 100#S< \ m P 0S 1a0`\ _ PPE 0S a`P JP p PJ`! PX! T1TQ0P \ ? 0P 0S  10\ 2 0P 0S  0 P$0 Q(K0 0 00 00P0TL/H   Ğ l4 t 8 <  p0 l 8 $  x@ -l@0@LP 4 pD`D`"PP 0h ` D0 00-SL iP P 0-LPP 4@@rIP NP00@ 0-LPP 4@@[IP 7P00 0- @L@P0000 -SL,M80 6@04 0 (K%0`004p P<  0@ H0 U 0|  00?S [S \S<0S U @p \0o  i0SD0 X /S D0U0Pp ^S!SL0 00T0  L  @KsKcK@LpK6KD`KK2Kd0 4K  Xxp6 P [R 3 0qZ@;  X3K7K;K?KCKcp㔀 L X`ZdpP X  Sp㜀 P R H K@KXHp   HBꠀ h X@PlTI TW!1 0`I"\p0@㺘$KBK XC@K@@pP005T0lAl1@X00mWp00 0R(KX00X0(! ,00 X10p%[   hT fx Htt `  (  < g ` < X  | H \ 0 H  | L T @ L L , 4WEV -PPLB @T BA@0U /R> C B/QU0/T@/ PPP@P``; 00U&* CR0"  B/QU 0C C/R0U:` 0e@T@!LP@P@PPU:,P@PUtn dn m Ա -L MP@@PX 1@ 0 00   h! 0b0C SE<CBA@9>=<7:7$E0 0K040S`p! 00X 0SE0"S ? * l@WV0(KV0 QP0D 0 (KD" 0 p `   0-@PL? 0S m@@T 0/S0A 0C/RS0/S$ @@P;P J000T*0Q/S0A S  SC/R 0S< c@T@!$@@k pĮ xj 0-0L@M@D P4 KTKL0 @0 <0 EKEp 0KS K0 -L`Pdp@ P!p V U d |p` UROVJ@{  B1/R0 0b1/  BQ/R0 0bQ/  B/R 0b03/0C-$ Qo o@l\Ll,\2 \ AO@P@P$!/%1 0b $% Z`l8& @fpL$ F0G868) `gF 0:`L1F1W00G-2 O ! P0So o@aQPAQ; Q""ao`p  00"aoCq$00 pf`aq 0As 0a2sadeA@ Za:n n` NA:h2:~ ``:Ap33 0 00G-3 / P!Qo o@l5\L6\> 7\% AO@P AAQO Pd@ 5l\ LQ l0QL46!wl:I `iF7L `I:F0h:Y hi@PWL@1i1x@@P01#:?C@-@P@P SJ?RUT$p`3R7C,W0C# l0,4$4 b02 b0 B10 1"$1P;0-@P@P SJ?RRږC C2 a01##0/UT0/0/0b03!0/ P-L ` KhB00  -L`@P T 0-LP@ T0 -L`@PD xT  0-L@P; P 0P 0 -L8M0Q  (00 K0 KQ 0-0PL  vos -L1 0-PLMP P YQ@Tt$ D\00:K0 0 : @ ts h00 R zS808 0-LQFB Kh 4 -0L0M P0@p 0 LKD``LKD` Q Q Q A00 0RKL 8 }$ wTH<t,t,t,!?:0@P/ P b/ -`LVpP! A=@0JS  R@ D2-0JU R  RS0@0D@R-B0S0 0\ RN^0  S -qLML5pXPPM O6PH   5p`H <$!@ qW0@0  ZE60(K8 40 c5408 P8 40 D5@P# 8 400`P 00 %58 00@ 00 900=   90 A 0 60D -aLfM` M P p0 Y pM 00CSK:@GKY>K 0C @5 D D :O5^^K5 PEPETAXA\AT C>KE 5 5   pU  0 E E @P0P0&0 Q(KK AQp 6: S @O000@ 0 @ 0 4Hx- 0 ~d --L M0 0  K -- LM 0   K - rL MR`@p R00?`3p00 P @0P Q0 00P01 1003^VP5 0 K4KN1YP XI 40Y[VP0P0 i   0 002 (K4 AMP$ 0PhQ^VP`C0 PP 002(K4 Y MP  0` MP 40L -L ßKM M pp ` $ 0  G@ PRPcE V/YP ?00?@0040 0R(K R f R??00 UXRY2D 0 @F XRM>1W  D TDC>K4 04  c;0 V *0/S0IB 0C/R> V0hq =K 0Cp4 ԔY& -p'Z?0S4U ܔ0 S00S0 U PB?00D 4S Mp @0K0 A/00Pz4: S "?00rFP ?@@DOoBgHh @h -LM@1(0S@ $/0 # e 0S  0b`10 QP!K00 0`VS <0`VP P0(1/0 QP`p01`>T0`01>0`0 0 - L8M`0 0Kp@Kr8#@ H L0  1S0 1 pP LKPP DP -P@ 0R K> 0@0>U0@0,H 0-@LP/1P210 0-LM00@P !R ! !R R20Kp5 p# 0P  0 l0 K0B! K0 R A  0QB 0 00 K P    0@00 0-L@0P00 0 R0-L0 @T0l0 R0 0R00 XOP TOP PO<P LOK0hHOeE 0-8@L@PQ$ $0 w{K0hG{ 0-0@L@$P< 0Pp{K0h4,{d 0-8@L@,P)(0P|P!0z!1 C-0MP 0@0S0   XQ0 `S8)p@&  X 0@I0 X   A0a0 cB "T ^ #R.S@80CSЍ0"T0 ^0#S l@P@P 00 R00@ 4  R  *4 8/Q 0X\S 040:8 R РS /+xB -Lp`L L0 @DP X   G@Z -LP`@<0 @-TH @ \ /+-,+*'& P^"m QD7l0?Q000000#Š,\Q \%Ao &Ao =Ao#4P 006 0 0  00  0000 a 00E0d0W0C0 0-Q ^QL00#UL 00@ `;UPcTtup@dT4 1\  QQ,0 0SU1  <0@0t Uv =U Ur 0P0i00ES000100C0^00ES0100C0S000L U U 00E,̰@ ` 401 0`S40000   0070E3ȯ0mlPlܮHlD\ = -A`@ LPPg !2#3b!b bAqT@ 0S$ V2 10 R 1003/P= p$` 100@! R 2/(!T 000(F100@3/P TSU  00 R  R  T p0$` 10U0 0SzHP0 0 kj,j$j Z -PPL`o 4pPl 聟@Ti  00Rc<!"#b!0bqAWG X E6PXJ $00\10 R 0<1003/P00 $0 00!  R 2/ W 000(/FPp0003/P 00  00 Rt   R  0S@GP00 @ȫ/>34hPhgHg= -PPL`n W4pPk 䁟 @Th  00Rc<!#b!b0bqAWG X 5PXJ $00\10 R f0<1003/P00 $0 00! R 2/ W 000(EPp0003/P 00  00 Rt  R  $0S^GP0 $0 @ꌩTffxe|e SR-Lp`P4 000S 3/0Y @IO0S I T0 0 0 0 Y @IO0S lI TP0 0 D D0 0p`Pd<(d SR-Lp`P5 000S 3/00 Y @I0S 6I T0 0 0 0  Y @I0S #I TP0 0 D D0 0$ p`Pcԥc -@PLP Q P@`\ @P`V 70"SP:GpPp@H~70@0@ -MLMPP Q08  Q /Q P.00{ 2Pؕ؅@@>K 0C`0C/Qh 8 r/- Qp  /RR.Q'  e   hRl h/ h00]pL (* R  R/AoPn@/Q  hQ .PQU 0t/S0V8 L8傎K He0\!8 P  2  P2  s/8/Q0#8 /@hԘ600CHP(K@U/00@00(K6?0U0/00@00 CPP X U6?006>0060060060P0 -$a@PL`3 =2QP00CP5 0  0^ @:^0 S \S 0@ S @ 0:S@0L0P G< 0 00c6 0 Tp@-0P:P\\ 0@\ \:R^0@S\@^ :R^:^ 00/\A0-^  R:^|^^\ S C|S0 0:SS -LǟEMM h P4 0 ^l p T$ 0 X4 g^ `G@PU P  C`P T40S ' `$ \$ C.KH$ PP00 0-H$@p:Q9 \Qp Q Qpp pPU*`R @ Q W :Q +HPPH4@ Q@W PFpi L$ CEPiL$P PZ `Zp`j #QQ `X L$ OP\500S x5 0X4 =K`4 B>K 0C 0Cd4 0L t4 = XpP 0:R PR00p00`P4T$dGpGg8@P pP p 0:R@ @ Ra a 00S:S:0 0 j0fZ| 0 eH4   8FH4 `Cp]L$`HD`$00 0 PT4#0PP4 0\4 /\4@S$TZ@0 `P4 T$0ST$ JFP FF\4S 4 00Ph40 0R(KP P @ APt Ε0@`\4 Lt4 \4S3p$i0AV0&:l4t4PP PXL4c YDL4`cpcPcPD `pPL ot X:00`0t4 /L ADP 5 PP\4@S PLEP@EX4C~K@4 0pGmK< P0 5/p5 P. 84PU4$0 B@4 <$ E\4S&8ET4 0P0r/PE_oRp yA`P& 03/Pp4pl4`YP03/TPPh+4@ E'4@F$4P@E4@?03/4 0P07DH|K Z4 -0LM  0K K 0-8@L@ P 0 0000Ȗ -S3MLP Mp#0 D8 0\CS088 @00 0SH @ 0 ((C(s(c( @p`P  R K A A V P 8( B8Qi " "# :\ #\ RU RR00S\S00 Q}hb^KCNK PE` PEp0S6\S4 00S0 :S: 0 088 Sb04[KS Ah |S:Sh  A:S|S 00S 0@(AHb0S@AD800 QO(K P 880pC P\R    ~ 0S "PP  PP P P   P P ^#  80hP A A.K H`@T. 0+ 0-L@PK0h -L@= P d@`P d: p0:SS ^S! \S0% PPfdBP 0:SS`d0P0fPA sBPx 00S:S 00\:\ 00L^0L ^b10N ^1Y0B0L2SIFBF=8CBA@?>=,;:9%7543210/.-,+*)&"&#"!   00p 00| 00xur0mC00<2 0 z -LP= pP. da?P, pG`d0 :SS Q0@fdAdP  `Qf@A AP 0fC001 0 0-L@# P! 0R  <, 00B QaPBU70BABW0BQ^0 0XS 0 -<3L8ßBM M084 0\@`p00 v U-/< ZPP7 蒟P  100CS Uc C K0:S 1 00840 0R}(K $P CK0S:SR 0S:SYi 0i@4 0@$<  RD E D4 cD4@$^t Y0:S ZH10SD100UP R0 00 R!010@0M@) S0 0@$ C.KH$ ;@$@4H$, K0/<$C)D$,0K0 $CP00 0@$ HlY : D: : 9 <   0 00 D -00-L M@ 0R 0 P0 00\100M\    0S0,00  0RK0IHغD8 0-0@Lr@~0|7 x7 -LŸ4M @`pP0 h20 RA D0KdK S P T69T3RC 0 Ͼ0P- # # 3 3p]W 4` `pP 3@03 @ T  `P pP3#[ 3@03 # rP csc3 #0 # 尐 [P VP 3{33+& #0 #  BP> T0s #`@`F tV#0 # )P @3  0  TP T0F Sl#J?K `# R@3 # 0C  s pS S   EPRYhVd(U900CSP00V H P@Y %0NSp0AS`H. } v )U %_UoP 0s@DSP1*T T0@003@T; 33 K #0 # 000S 3#0bS303 3V`@ 03 3?K 3 0# C3 ?K3 P?K3 s 0\%VoP$sC 3S#00FaQ`S̃ pc/K0!P M0# # +@MQpnlk]\`_^]\[ZPONMLKSRQPONMLKJIHGFEDCA@?>=<;:0/.-,+3210/.-,+*)('&%$#  #SL` 00CS0 000PU  3 VM#``Vp̃c S XRs   h0#$V  #0 # #3 # #0b303 !VL`  M@ @@H``+ E   BRP V P@NU? :0U IUv  BRP V PY)4 0S 4 0S!0YY0CpSP0P  ]PV @]0`3 EQ  0`# 3S   BRP NV P p+Ej @0V  P@p#P 00CS0PP00CS0P0V  pP@03 3S $P#P3S3Sw 3[ BR0 m VW 0P@`  BR PVx Pp@ XRb 03 P pc ̃3PQh 3S #P^#P    BR P X 0Pp3 @R3(3@PC 0#P0#0C00 00`V0 0S P 3 3#@d # S 0o#P 0@ B0V 0 R gP `#0 # S 0` 0#!0C 3 23iU nU;  BRP f V P@^ḻU 0 s B0,0K0 P C 0 gpp P, p) RjP #0 # Wp   #0 # H Kdf#0 # dPP3S`F@pp0`0p3 PwPuUC @su 3P@D uTlL\P QPp@s0C p#SP C# SJ P C @TsD ,B0s@!0s0ss0-@> pLP P 3[ BR 02 Q p  BRP  V 0P@3 Us0 p@.3@0C0`@s003 P0@spPpP0p3 P -L@P`p0 }P- 0 H,2 p-0L`@x "00S7 0Pu 1S010_ S00pP1 0S@0P Py6PK 0  C0 P0@0`@000u': 3P0 ; BA@ ?#0 0R00 R* SW  80< 0 @B`0 FP00P07pp 0C 0 + 0-L@P ᖘP0 -L`pt0t 0Pl@ ĹV 3@0 - $ ⱹ{|@  P 05 -Ldǟ]M x Tǟ 0Z|1 0@00 0L D1 0p1 c z P!50Ph1  b`50Pp1 m 0SP1 01 l 91 @ MK %U' haPU`p T U 1 # 0=P0?0Sq PgP0@PU0p`h1PcEQ U P!D181 \!`40Pl1  0K t1 j%1S V 81l! BSl1  h% 0S 00S  <% 0S 00S 00 00 00 "00t@\000p0' U+ haplPU& 0 7/Pd%P00l6p6h66|10 0R(K1S@AVt p tppPPpCL1S\ 0ST1  $\1SP? p1 pX! 匑 TX X10d1  Q?K`q 1SOK_ CQOK@ c:@ PQK@P@RQ! R*X1qP@T1XQ U*\1p0S\1 P10P1 !0RQPl00@H6pF6hD6dTQ@u*SK`03 >1'&%$#"4   @p \Tc@@@@@TDO{]Hd D , [  x 40 , -L`p V@P  <00#:k0cS:5@V 0^ -HL|M`0@P D0 pF H` d K0-Sy0T0  H 0Sc 0Sl \  0C QP@T0PA0T0C H 0@0C QP h ERR\ 00 H`0H0 0+S -Spp0H0 00 C RH` =0SH  H 00S 1 CR1H p 0 C0H 00C \! H 00 B0C \pl̟ RP W b0 PQT  P`TQ!(K0T0 H M Z h0T0c @Z ``h0 VK `<01$C|K 0KUKZh0 `f`V>0 ,1 K0 dK`:0\0 d0 00l0Pt0  h 0RP0b0h l0 t@P   ! &40K@ KKOPD  cP @0\Sl h 4@p c0a00Ch lpS6@dcQ@a|``c1a0Ӏ0 \0W@@00T0Sc@cpcl0S P D90Pd0  Dd0D0 XDPD  h0S h~P T Py W Pr DOPPm 0@  @p0 .P q 1`pP p0S8 `98@ &KPy8pWd \000jW0S (8P `P␈p0S  0(K(K&K`0k60g`0 <K& 0K 0KmK8@8\ 0SR D  0\  ^-I0C%S)'&%$"!  } T ?<08 00 `(X7 =p0S`1| x0 'K&KP 7K K8@l0XS xS  H 00S S l \ p0pSO<0SL8 46SG60kSC0S0S= pYP8 4\0S@60 kS7SD{ y wtus5K0 00 )KK0 8Q:"00<08 PQ2 H`.Q4 \p0 ^0QTH 0 h 0C PP 0H0 hR h   JR!P!ZむZQ ZH0Ј H 0 0'KS<08@S46S 3P84 u1` 0 )K&K0s0p$08 <0 t@T D "00<08 ~#K5D<K)K8  0KH 0K$p3#K8@0Sj<3 R ,#08 <0 0pt0 0h @ RMV&bV#K p`  0Vp\80q56C80 K p2 ŸK8 0 S S4"0<0 5&08 8 \0 S 1 &Kᰁ`-1` 0 H`>0SH 00S 1 CRh 5F8@ C\H@KP~ H00(S 4!08 <0 $H@KPn H00CH0 x$!8 PH00H0 0<0 0 p0S`p5<0S246S. x0P D  t ZN?AP9|||  ?5?55< ?$< <0PX D0zP Ph0Sy h Rx0!0K0 D0 mPT0P@0D0K@ KHK0@^ SD0H` T0 X `f0 1 K0 KFb V!0 j0V\0 \q\0 #Kp  0`p\\0S 0KP 0pt0 0#KpTpD 4`KR Dp0@ <K\ <R 8" jR"*k b"R#xSr  ` < 8 DO M KtIG\0Sp0pSP80 $&R U$  p0\S<KE + 0K~K@3 D)Kp`%$&R <QH QP0<0 3pqhp%0jW3j@1 Krj1 n0 h0s$0c 10 KU0 0KH 0KAPZ8 `40#:k0cSGS$4S 0C< 37680 <V\0 #86C#:: 80 < n4 K!Pg004 4680 < O P< 3<0 H l 00Ch #K #K 0 0 E -LM 0K0 0K P 00CS  \01 K00 4%0;0C" 0 $  0 0 4DP0-!ʠL\J^@03^ 4n 06 n N37L0P /0-@PQ@0/0P /0P / R 0Q`@//0Q/0S S//0@-PP0@ S 0\\0 00@ -` BV"RLM 4 0 pnP@ P-To +T@P0? Ɵ 0 0Kp8 @ 0dK # ?0A PaAPWAAAP!7AT| SR ^Q q" 00T- V= p$K `48\Q r00Q) 0\E(KJ0 0R0, (K0P@40 00XS00 C R @ 2Pp$K` A BRVt 2p$K`zꙙ 0 0 0B?? -` BLMV"R< 8 =<;:9876543210/.-,+*)('&%$#"! Uk)@Xp:#Cu00 0 R?(K 0SntKtPKK0 SR[ B0 QPL |0P?  0S < 0 10-0C?o20S W 0S0 0 R  S`\,1Ϡl2H< ?"c"bl!Ad0##+  HK0S  1 W0S0 0 R S0$ S 0  W0S0 0 R W0p 000p0 00h00p0 00 0 ?3c 0cP@ `X| 0 @p @#/bdpS#b*0`S9PPʟ 00d,/L!b!b b B`pVVA1|?#c ` 0)r`dpRl)|` XY ȟR `|P3c 0b0 X(HPK0 " WLH0[S0H 0 R B S> XHPK1?0c01R@( 0  W.H0[S0* 0 R $ W 'HPK0  WH0[S0 0 R W 000p0 0d'HPK0 ɘ WH0[S0 0 R W000p0 00 0 b1? B1c&HPK 㝘 WH0[S0 0 R S 0R0 B  b1? B1c4&HPK { WH0[S0 0 R W 0  pk0 p Q~0S ? Ww0S0r 0 R l Wh0 S   W_0S0Z 0 R T WP0 S 0  WF0S0A 0 R ; W7,K0  0pH   t0S 0t  R 0$HPK 0  WH0[S0 0 R W#HPK 0 ԗ WH0[S0 0 R W0P#HPK0 㼗 WH0[S0 0 R S"HPK0 㥗 WH0[S0 0 R S dHPK1?0c01R" 0 ㇗ WH0[S0 0 R S0("HPK0 o WH0[S0 0 R S W 0  W  ʅ0 S00Ř Wx0S0s 0 R m Si 0  p=\tKHPKtK   WIH0[S0E 0 R ? S; W9 0  W  ʅ0HQX x  r r m *@ o T o  l} } ܝ  ` \  ln$Ių 0< SHPK0 Ӗ WH0[S0 0 R S000p0 0 HPK0 㯖 WH0[S0 0 R S,K0  0pH  t0S 0t  R 0 000p Q1 0 @p0V\E g\ 0p  b0? B1c@p0 0p00 spt"1Ϡl22 "n"bl!Ad0##"HPK /H0[S00U R Q WM"HPK  WEH0[S0A 0 R ; S7P`ճ -,LM`p$ K0`@0"0  (0SPV0d0$KnP 0 簀6Q ᕖ0# (0Q Q \  Q< ,  | @x t L D -$L M@ K -H@L M`pP,@0   K -L Mp@P`ɏp0 p K`0R@-0 P@0P R 0@0@0T c `A-P^` @T@0S^ p \ 0TU0S@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0 ^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S  @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R  0 R   S0 R0  00Q PvQ  0Q  S  0  Q0 0^_0 j00@-S  R 0 Ro  R| @P QJ  @0 PS0 0S0 0R 0S R S \ ^ @ @0 S 0 00\ ^ Q)  @^ P 0S0 0R \0\ S0 00Q0Q  S00 000 A-P^` @T@0S ^p   \ 0TU 0S@  U@@ S @ @\ 0 0SW@% @Q   R 0 \00 00 R QmQ ^ 0 ^ 0S\0^- 0S  R0 R(  R QQ  R  000S0  0S 0 0\  0 S  @Q   R 0 \00 00 ^p \{ 0Uv p0000S0  0S 0+ 0 \0 R P R  0 R  S0 R000Q PvQ 0 Q   S  0 Q0 0^_0 j0p@-S :Q :y  R 0 R R| 0  @P\J @0PS0  0S 0 0R 0S  R \ \ ^@@ 0S0p^ `V- ^ 0. @^P  \ 0 R00 0\ 0 \  ^0  0p@@`Q 0 Q  `V0  0 000 0A-P^` @T@0S^ p \ 0TU0S@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0 ^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S  @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R  0 R   S0 R0  00Q PvQ  0Q  S  0  Q0 0^_0 j0p@-S R 0SQo  R| @P QJ  @0 PS0 0S0 0R 0S R S \ ^ @ @0 S0 p^ `V- ^ 0.  @^ P \0 R00 0\0\ S0 0p @ @ `Q0Q `S0 0 000 0 -LM@< P A pjpG002 Z :`0z00 P00 2i180 e40  E liA002 \ :0  UU 4  R8  X P 1`1p1:<0 p`(K -L@`Pp | v p Khڈ -0@P@`L<\$00$PKh5\ R 0S/0S PQ0 Q  0-0( ,0<à 1Qa!0 $00Q  ^ 0N 01 $ $ 0$ 4-T L,MpP0 0R00 0 0R((KDd@`0 8/$0@ 4/10hS@X4X$020 SD4030S44004/($(4 4 0R@ 4 050S3#060 S# 3070S304/#3ß 05PK@80` 40KC1a10H0硁0Bx3x#x0 4/h#h3 0\<@8ß8P  4KC1a10D0A0B  0 PK 0CC8 0C@ܧ܇ `` ` @ H DD vp080'P 0`0?o0c,07@0T4 t70X4 h7t0\4 0ES SH70@T 0SW(7000S`407@0 $P$60 2$, D!>AQ `@@ B2$   .2 @t@013<0B00H (LP H0P0ݥ\H|0ԣ`Z hP  -L(@,@ Pd025Q3a p^0i0$5H100U0s; ,100W*q$0s) ` 0R0U0P5S3003 R( P H2 @p# 00C  /    $0偑0Pc p 0ₑaბH,Ko l -rLp(P@0PT , c1$P`U eR20Sp  Zf$T 0GebWk W020't0W00P20 PSR  ZHT K1WR0BT!@50@0 0S0) SF $KkSxSPU 0SPU dFTT = -HvL,MPQp@06050S0PTA f`(00T ,` c2&$Qƃ T@  a60`0U2S(0j:  P % ( X  >P :X% 4 R H 8K8@ 4P 0 <} (K 500S P}0UI*V* E0F 0"!#1""#2"$#4"(#8 0""#2bc 0/o?o b 0cRK 400S ptp(p OpOW P P U* 9 ! 2U#2QQ  eZZD UV030#V0S 3 0 00 30 2SVt 00V\302U#2Q70U00S%jP| 306`Vl  ]xN0S  R0S`xN.70U00S  fAT 0tD0 0@0 x0H0 xND0 < 00n|pd xN@xN2U#2QK  eZZ106`V 1@ߠ10 4/P  xq@0 pxsNp@0WpW  RT p,10p% 0fQ"(SN(Q N0(0 7 U  R  fH4>>mNA 0  -0L`\ڜpP@L0䗃Ï B(h0h##S1CP0X0X 00 P U1H@@T$==_ NA<<= 0-P@L@P HM0S 0000P$ K0h;M4<<< -q帑p L` @P(M @DR0a@110 0XPX?X*L!0 0p0, 0 0y00hC1100 0 0`   LX X 0 00p|0 0 0p<0\ 0 ?0p08 L;l<T;;:;::p:H:$: - LP `L@Q4 0@gA@d`F `B1100T" 0 ࠠ0 PTP h0 (pgqpaPP00 Q PwL0 qL9t:gfff(1 H99898 0-(@L@ @^LPZL08  -P`L P# @@X0U`P@E%`Jhp@pX XDH(Paa!L(OL(0IyZ_TaXa\aX@蜁00  D.P 0-<@L @@0cP00S0H< -Pp嘀Pp{^EX@LPEa}`0@aaK0OK00ZOTTaXa\aXP,0, (0 0 tx4L0 00-0L0S" PKP0SZ 0CsX@ RhK00SP OP@ P K0蜨6;|606!1 - LM`@Q0p00 PS U6 U) 0)  P00S0K0P0K P ZyP$P0K LyP Cy0SP  .0 000Q7(K 0P  U0KT  K=yP , K PK␀"1yp 0 @P[00 0KyP0밧H~ --LM00  K -L`pWL L0 @DP V  o Kh9l@ J8 0-$@L@J ! K0hu8 0-LP@| @v! `K0hx -LdM00K@P  00 \0 0 `t 0  ` 0 d 0p hp 0 l 0@ x@  0ğ  `P 0ሐ 0d8 ğDP lP pT X P` |  L \0@@ pD@DP 弓h`TXPPp < H0 H080  <0P 0#c(D0`080 @0!a0@0 ,H0lȠ`D` 0#8`pP%@`.@$dJP`c:H n!D` , "l̠ eZb,P  8 ` 8 @aD < 0#P8 @$LpP% H.<\`P0 , 0 "<b(T0  @ 80D!a`0H D0 P0lȠ0#@c:P%H`8` T`.neZ8` "!blD a<` `D` @ <` `H ` @` `D  p@$0#@ dJP% ,L l̠ p@$. RI@P RG  KpHA0S@!@@ Y PE(HP?0A0 Hv`q `k 0 ᩚp@  vp HTx@@ @H RN Kpv800H10h0// -L M K@( 0T KpHK /`"`2 - LM0 Q0 000 e @ 0T] 00 0Rl(KTPK @ 0TI pIppi`@K X`` ` `):`jZ&3?`O C S   j0@0S0 000 XH0 sV"0 @ pK p0K 0 I000 0  0 묠 0GGp0K 0 100S0 00 0 0 p0K 0  0 CH.T. -LM@`q `KpP F W000 U _KG (, 0-L @Y 0T0K0hG+ -L`P @F 0TKhG+ @-/ 0SAS/0-$(0@# A  A A A0/000/*Pp@- P^ 0S^ `@S 0TT0`0`pPPpp 0-@PL , 7@ (e 0"0 -2L 4M @ T 0P<  0(P$pH0 @ 00KXP 8 D 刂L P0 P @P P`@H0D <Uh j K 08R()8 b\(@R )@ bS(8 K -@ L?` @P`U(B " 0"(`e?VpP"@pG,0?W@P"@0F?0@0?`V ("a 0"?V(pP@ @I ?Y@P"a 0" R-L  H 0-@PL 0 @ ( 0"0 R-L j ) 0-@PL 4@  P 0$$0 -l3LCM@ `p@؂EKAKЃLKAK؃0 EK@GK0ЀBP=H IK! 1  40K4 ( ,1 -KGK ,KEK &KFK-K%KeKp,K `@IK P   ,=K$'$970 ;40 &ΠK %%)  ԌK+K " 0#ԆK   ԎK()K2ԍK0 &10 #K  !'0 ܅K̠'  K K܌K̠0   ܍K()CKGKK/KK܏K !(,K)KC?K "0#CK I?K K 0#KC?K EK 0ЀK #K 0(1Z$K _L0K400<0 0kKLKKK"(ט/BJi|  $K KԆKK K+KK ܃KDKLK/KFKK cK  00 p᠃lp @qL @!ᡎAT 倀 ԀL@pL dL@ O20 ,K &K  !KK܎K? 10 o,!>K20 )10 3` PL0 ܅K+K() 0܀Ä jKJK `&p'@ P@P 0MK@PKK@$P%`pMK@$P% 0OK@PlK`p@ P܅KP^K#0܃K cK`pDK!@dKkKPDKEK`peK"@cKP`p 0EKC KbFK"@ P܄KԄKԅK܅KC(K -@@LDQPU  0pRPQp bP`P`p 0P0H h@ dKhR Q bP`~  -@@LP ``VPd >!0SR$ 0$PPf0Ulap $ဠJ+0SR$$ 0$Z【0E00PU PQ0SU$ 0$UP`  k|  0QP`FV【$Q 0QU$$ 0$ R-L t -L M@P )PH8p,`KI KU@  K 0-@PL 4@  P 0$$0P R-L : -L M@P PH(p,`K KtU@  K-` a!`.4 a !  0-0L`M,Pd0 `  P 0 P fPm P ?P PE 0D @0 eCP -8P- 2P 5P j3P> 4P/8 0$ 00` KDKPU`g!P %P P EP` P 0D @0 4ZP ?HP WP0 !IP VP9 w 0 K0&Pr )Pm 'P (P 0D @0 .P] P P P 0D @0 000\ Kd0KDKCp \0S0yP 4ڤ8PV ?CP 0P 0D @0 000\ Kd0KDK#p \0K0=P :P 0;P <P 0$ 00` KDKUP`\P ]P ^P7@P?P B0D @0  0D @0 |0$ 00` KDK/P L0$ 00` KDK"P>  0D @0 R <0 D @ ` z 0D @0 uEPn FP GPH0J.P2 +0P;D?Po hP` P8 0D @0 xP Pd00 P* 0D @0 j P P P0D0 @0 _ #Pq j$Pb %P ,0D @0 Q 0 P P 0D @0 EP\ P 0D @0 l5P 0PX0$ 00` KDKP XP YP<*P +P D0D @0 P P &0D @0 6P 7P0$ 00` KDKxP 00AP# BP P0D @0   0D @0  0D @0  0D @0 DKunPD0 0D @0  0D @0  <0D @0  0D @0  0D @0  0D @0 0D0 @  E0D @0  @0 D  (0D @0 7n0X0$ 00` KDKP y 0D @0 0$ 00` KDKP f2P{0K P # \ KDKD @ 唒@20p\h C0D @0 = F0D @0 7 G0D @0 20$ 00` KDKPj 10$ 00` KDKP $0$ 00` KDKP  %0D @0 DKmPJ  0D @0  0D @0  0D @0 000 @d0K\ KDKd@ D @ ,p EK? .0 +0D @0  )0D @0  *0D @0 i,  ( P T > \ 0 0@T 03/@TlPP |00@T 03/@TX>0H00@T 03/@T$>0t  P    -`@LM@P K0K  # K  2pKi0c/ 0-P8LP@04 02P*T 00S84 0`@2T:v0800 -2LŸM P@R0p`00 Y 00Sx80S 00 Q(K4P  P8 `0 㔐K! 40 0 0`☠K8 Ġ0 0 ʐ R( P28XH <1,à040 ` n4`V 80P@  R88PX`08A@ `8 0`8 8 820"# Q0 0 R  0 P8 ` 0 l0P  8n 0 0l0 f`8b0`8bHxs84 -@LM@4ʟDB 82 @ 0T`H <" 0 02 < @T6 0 4SS90T. 01K1KM P0.0Q1K!K V 0S?KwK$2 *20SE?K0!QP<PPU= Z| oK c/Kuc/ q2!^KX 1l Z`k V 0S [ᑎP PfU> 0 ,0KP01E0 $0I?K2 2 0S 00SAP80S(2 1 40S,2 W (2@4 ,b B X``G U T   P,2@T4 5*(2@ZoKBCU 0"Rc/ 0!^KX 1 ZI820"SRg0BT <"R0 00w"00@20 0 R(K 820"SR0BT <2S[00 c/KƎ ' Pl820"SRc0BT 820"SR$0bV <2S H"R  !<2D2S D2PU @@ `  c/KoK`| 0S508 R 4@oK@0B ` 2 B 兯K!^K4`1 " 0 pߎp "R40)` )lh4@04@Y@T8   0RZ @PYX 20S"8\f PP 20S @820"SRc0BT wK:<2S?00  !Kp 80S(2 820"SRr0BT <2Sz00<2S<"00q00( (0R Y``B@)@ 2" "@`Q0 Sh ((\J P 20SX P@ wKYP 2 `0 R(PXPR @X`PU 00SxA @408pv@ `=D2P` ` 8PPPS44000080\S80 \P `0=Y P@ >820"SR 0BT l<2SV@ UpHt  -d@L@M`@P`p  ;0 0 0JP;(Kl -LM@QP4 @$ 0嘀嘠 p@4`0 0 Y`P` T00 0   ;n@P030#? 4 00(K(K P  -LM @#^K` <0 IP  Xp0 0RE(K P 0@0S# S/ 03^K  mP 0V: 0%  0| 3^K0 mP 00S3^KP0 P 00SꐋdH -LğIM4M @`PPp0 P 0S SJK  P0 0R (KJK Q:JK$ QU ( 0J-K0 B0J-K*oWV000 zb0S^0 pX h kP0V\ c 4"$("( 4 ,48#8 kPVh  }T 0 ki  0  kabH^H$  d -LKM P @p`0 ) 5 8#<txV'x= F0@S03K41KĠMK'Č0 KH /N/KO?K H L1 ]P81 S!*0 0R<(KV  P p 7P 0W4aK3aKH1 <L1 CL1SH1$!$("WY  R qH1P ۈXZH -@ 0PL`p0 o 0P 0-LMPK@;P"P 00S R Q R Py PK0@P@P@ 0-PLp H@00. AAS0C .S .RQ P _SQ P-S /S /p@-0 SV RR @\Q ^@ S@@Tc RL DPD0UPQ Uc 0S8 DPD U! R' @ @0R-"\\(^\ʔ 0 0 0R0b?o20S 0RpT R DPD@U pR 00- pR ^S PU 0S0S U 0S D`D V PU R0S 0Sd1A-#2 M``  P 00   0S  RplA ᶀhq( R  d1`#VP0000 Ѝ0 S0-LP0 0@o0@T  @K0hc p-L M0PS `@K`$ `$@0S  0S 0STKpKp -\3LXßM DM0PQKHA00K8A@00 3(K0P B0(K0L BK00J(KD B` p01(K< B0"1K0@A020S? 0PT x20Sr K<A1!k 01i0(000 p ```  (K8 B a P8K80C PI(K08 B 08KH0C000Qe(K 8 P0 K@A0 08 7 P 4!48C8 0(KD B0PU8KL0C0S8KD0C0S S! S$ I0 0 8KP0C(KL B 8#8(KL B0L0C H8KD0C0 0H0 0H0 0꓆HR @ - LAMM ` pQ0 P @P,BNK @D@D0p hP 0 0R(Khp0 RP @@ .RBK JJ  p,0K Pt@H00C,OH -0LS S0S2  R  R R R0 S 0/ 0 0S S S S S00 00S0 S000S00 00 p-LMPQ@`  R R Kp RRR Kp Kp00 K00PP8#<48#8V R R p `0  R R8, Ka P 0  A l 0-@L P0!1 - L$M@0 SP0 A S0 LK~`V( D[p,<0PC*,0S$  QDK; S  S0S P 0S PQ `V 0 0R"(K Rp`V < L `H D @ 8 4 8K K`KLK:K9K0 Rp7|KHP/ 00/p 5 0-L@0PS U@0 0-@L P  0 @ 00 -L`Pp@P  ` 0` 00 0  -LLHŸLM h @0 @p`0 D@ l PPP0S S! A@@@S P@h00 0Rc(KT S@ K p p P0 @@TA@@@@0K p0 Ap0P RQ P@D 2 0 pP(0 lpP 00SP0SQ jP@D  0 qpP0 lpP 9PP00SZHH043 -4L0ϟM 烟K ` 8 _K2 0 OKc _ [VZ20 0R1(KX) 0S p @pP "000S0S0S0;0SX0S2  >!0Sp 0K hb0 V?K2 K  0 pPrhm`=`02 PL=02 @= R P 0 Ă 帒 2 ?Kr0N 0n `C7^ N7L ``&^`Lh2S    "S RBd"R ; RQ8` PO `1 ``P\,Sh Q/o" R2d PP` S 2  xPhQ Q 2 @0Q  R0" 0S" ^p2 @SĂ帒 pp2"0K V0h2 U``2S l20j*`pW? 2 ?K̢Ē ̂ " ЀPr b PUU 8e 0ec 0E9c0 0 h2Sd2 S  RS`P  QPR?o20Sd" 00P0S` P2 ,R PR  2S  R 0S" "0h _P|^2  Peh"Rb R 2@R 0SWSU 0"S`\ %Ƃ0P2 V r0P2 A " g0"p 0P2 82`V4 2/K0p?K " @`V# 0S2P R9  R- R9 0 0 R(,"R% R"긒p> 12S pḒ3200" ` RP 帒p  Rprp2  S R̂Ē@ S{ X " P@PTU 122 0P2 : pf, K`?K@@hB, 2 qP,P(p2 R"  2S B50 ᰒ`"0'K 0 P003p2}P @@2 9P@,rH`pW *HFH 2H`W@0吢 :P^P 4b02 2p@U?K2 Q?K2 尒 S U@ ^pD|p(2SuKp0 $ 2 r 0"倠 2 w$ "(o^P"]P50D, Kl" 2 M^2PpD)2 2|0T S# SpP*0030 03P(2S \0SXDpqW0S:Q lrp  `P 2 0P2 r帒 `P  22` "2 "c? 0!1@0 K)M@PPM KJI02 ,P 02 02 ,RU0 7S "0 R PU* 0S0020P2 ppr.>"媟  ]PkD1x00x0e2@0,2"002 V^  2  [LFH`0\0D0@0 0-07t @8 | Ii ! bd^-l2 i Kp ,P ᴒ 0@P R   Bq bPD 0  RS R R R0 T@>P0LK p0KL KL Pp pZ 000 Zp0S 0PP0SY T P(K  -LXMPhK@cP0$Kpd`K @00lKpK h 0 cP H0S00A 0 p`PpI~hlKpK 0 cP p8DKpDK@ ?P H ``0S -2LŸM K @M0p=K,0C0S0 K*K, B(A K*K0 BA T"K A DbD"K $AP` K*@O Pm 0#SY =K 0C=PS =K$0CP=PK PH  RE @ P]P Z: R7 R R  =T @0P ]P'K ((L$J(0J$ J$ |P(X1X) 000 P =K(0C0(=K0C00a-K B P0r=K,0C00 0R(K=K(0C0(~H$2 t -L0,MD@K p`PH0 xxa$K$( 'P 0S@HP (P K -\L̟&MK,NMP&LK MK0@D(@NKNK4N K00@0 K$L` 0_0S 0!S8<-K0, B0=K0C0 P4"48S=K0CK0,J=K0CpJ* 0 `?-K: B0P=K0C00  0 SS00R0-K< BS0P=K<0C0&,K B04+&44 8#h0&,K B0;&,K0 B0;&,K0 B0: K&,K8@0 B0 K&@P=K0C00 E P PhX@P T& -K( B =K80C$&,K0 B S $E 4XB=K6 80C  0S XK(AQ Q 0@=K,0C03/Pw> 0 :RJ.@0 (5 0$ $ 4 @ %K=K&,K,A40C B@(A0 %_E&=K0C00 ? P@X00T0S--K( B0 &K `1 W800T1 P X0 P 4 @@0SW X0   pP 4\10 0R(K0h1 -0d1 0= @Tj d1 .T0@TY@R5.@D2Oo1B1S\ d! S:0  P<0p1 x0< 0t1 ]0<0p1 0t1 } DD@Q 0l1 d1 0 P0=S; <0S S" S t1Se p1sMd1SNl1S'2 0h100Sl10l1 0  Qd10d1 <.K 0P  PO`A^<00d!8   0 P;q<00Zk<0 0Sp1s c<p10_<00zDD@Qt1 0p1 0l1 d1 0p1 0 qPʑl d 0 gP=<00p1 DD@Q0t1 d0l1 d1 x`!H -LM@`TpP 30 S* W@P 0 K00 0 0 0 0000|0 x0 t0 p0 l0 0KSl S S S<00;0S S S (Kp(P d0K0 <28 00 (2儠K0 0 K K 0 K̠  R/ 0 i?0&P& 0 p\P   0!  GP 0S0S &X/ 00p 0 0 0 +dpK PeUHP  d1!H0S 0(K0p  p 0 |0 x0 0p  0 d1  h0SD< 8cl -LŸM ` @Pp0 7 "p1  P uP QQ iPW  bP0@S W 0@S0S@2 0 0Rb(K@ #>KD2  l1/K0K崗D2 @"?KD0 ?K P42@"D2 0S82Z@2 +0@"D0Z: 0S ppZ "H" % *Z 0S   Z:pYH"PD2@"%@20 SH2 @2 H2P Zx$H -@ 0PL`p\0 : 0PR-A00 .C RCCG-0@ PHM`pA00 V Ƞ40`<Q0 x0$p 0 0#p(p|0.` 0&`ȟ`fj0.0 0#l dž0' 00#La 0&00#p,(p茁0, 0 0#``fx `0!p 0 0#$p' 07 `( `(`&̧ b%) ,` !ǟ謂# ! 0ij)A "OI4!0hǟ07* 8 !H' a&  <, ( ,# , @`h!  D,6 Lj"0 0) 0Ėc5,  ! ꭃ # "4雊 *  " hh )  "00D&c6(   ! (0-# ,D Ɵ"  )䕟lɁ ! (0,0ĕc6,  (ਅꭃ # "雊 *  " l%(h) 0 ! Lş<0b&(  0! 0,=" ,  ş#  )8lɁ ! (  Фb& )00ค(c>,*4芃 "* lȈ# ) h  ()00L$c> @,) * !( 0j # ,<锊 " !00ßc>   *( *) ß ( h #* ,Ĉ" )0p8a  `D 0(0#  *0,@0#h 0!0#  Ĉ0 00#a0 0 0# r b+ 0p00#pbx0`00# ਂ8` Ň0 00#ba0`0 0# h0` b+ 000#pHb px0`00# ((` Ň0 00#bDa0`0 0# 聟 ` b+ 000#pa<px0`00# ਁ` Ň0 00#a4a00`` # d`b+ 000#pHa,px00`0# 0P@ P@HЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ-(((( 0 00䉫#EgܺvT2 -`p!0R00a?`0@@f>WLP0*` a$Kkf ``f >W 70@W@ 0 - LMP(`K0@p 0  p!? 7R8 bx b   0RX KhS.uh HH -X2LTŸM 0H"80 0 0`< 4K p1K$ 0SP ( ^ <,00LPA @%J@@^[ Y  0A a 0b ƒ08 CR800 0RV(K0 XR0PPSU 0j0S) S S <P* l8,8#4l#,,(,< 0Q00@\*40[̌\3 [40[2[(<4\*30[4 [8<.S\ W*`0 ~tH  -LMK\P K -,L(sM `p@0 g?K|K1 @ @ >#O9#1 TAXA\A}_K0 0P    0  \pP 1@kP 0 0R (KP 00 0P04tHB- 0  -- LM 0  K -,, -L M00  KL p-@L$M`  P$ @,K04 ,` 8 P 0 ( @X@8Ks`V Kp @ R-L Q0P:Q:0Q: Kh#s r-LRϠ#\ Kh]sD!D1 - LMp`0 !(0 Pp@ PK   Pp @O0( Q( K7OKP0X @@T PU 0SP@MT 0G 0 gsHi 0 0-PL@ 0P 000'(0P$(P,P 0h0PP 0P 00 00,,@VP 00 0Pꘐ i | 0 0-L@  Y 0 0 0 00 0 0 0 0-LM 0@P 0 00P 0   3P0K0C& 00 0K0 0-@PL U 0 0-@LP0PP0P((P,P0 -p0LP`c 1P] 0 S S @0 S S 10PL  PL@ PT8#<48#80? l@1P$ P@PD 0SA 8T% 0S" S S@ 0AU 0Ak10PP@@0000P 0 @` P@`PrP@ `@g@i x lh 8h -LMP `p@\,0Sl:( $T(pT &K"[@T4"$("4",("( E 00TA: 0 R;@c@T06 00T2:000P@c@D pB TG 00T!:0 !0 @c@T0p 00S0AS00P0 SH`@C@$K!00$K(0P (0,@ 00(^P 0-LM 0@P   p P K0 0 0$ $0K KP K0&p 0$00$00 :K0 -LeLLM@`PpK0\ @@ rP?P PP; @@0 rP0P \" 0`0\LQQ2 QR Y  ` ^ QpApppR  Rp A@ R ^ QR@   @QA@ 0\`0S b0PX0  X0` ` L K@ 0d P @ T* R RJ RY R  DHp `p^ P@Q  Qh lP pPWd Wi `p Wo R' RBW  ፸  R4   dh0 弐᯿`` D H` u  0 @ `0 i h0RB h0 4 Yh0y3X0 JS\  0(K\0@X@$(K   ;Q h dh00 lP0K\0@@(Kh s^ꀉ (M -'QLMp`e| ࡙P_<00PK @0p0 00   080 0p $$p0 YP( ,PĕYP3P!,P5,%W-ĕ!( `  j80S#QaPVVP PV `U80SAW(KW #3-5!- %)00@(K @00(KPWG %8X` `T`FR`FQ`FUJPF0 gU`4S 0:0PFP;P(KPS* %8X` `T`FR`FQ`FU.PF8 0bތU`0+ 080PFP9P 0gΌ:P48 0bŌ8P00 gẌ48 0bᰌ08P:P -LMJp@& KGLp dK!0R0 0 @oPJu 00p0 0@P0  KJ0 KJm 0 K0 / -L \!,\ \ \: ^ : a=00800 -LM$@\PK 00K( Y04,(!a:` c;2& i0g13f$06x2(1-` b a0cV0 , (0  V   00`80 g92# 2< a00$K  0 ݽ 0 0 S0-L@ 3/K0h. -LM8 @<S Q `'8  0` P ``f&Paf f`!```a!f&af f`!```aa&PaPfU% Bfe RG! 080R@nRRt  B0!0`l80R S`00K  0p0 P0  I@ pb`f&PdPfT%@f e&"`e`b"f&PbPfX% f e""`e`ba&PbPfU%@f@e Y0 G$80Y@ Y Y 0L 0H00K  Dྵ0 P๵00`Y8YL YH YJ 0 0KPਵ00` <1 B0 0DP`0e0d6# d c$"@c@bF$0b0d$6# d c("cb!0b0a1# a c%"cb! 0(KY Y Y Y 0`l0 B0 0P`0\0X0T8`0l0h0dy78| z y G6 -L`z00s !R !`Fp@T-V(V.P  yP Pj@e  &0 0_0@e  `Vp0 0NP ᪋P @ꂼ0 @0 0;W 4(!(1  -0PL `000 010 00Cd.R  P : R@ָP P h0 ,0 BL P 0 B!0APPdw ʚ;w ğ$ A-0 @ @0PB A@@.  @`' 0PB a`@  @P 0B QppP.R @ @  pp@P`E B2R񏐒}#~}|{zyxwvutsrfponmlkji]gfedba`BdabfQO`e2RQEONMLKJIH(FEDC#A@?3=<;:987654321%/.-,+*)(&%$#!   0 @ @  @0 BdabfQO Pd p0O 0 Bpd0F  0Hppp0 Bp0p07 -L M@0 $B@!p #1 B!00DH d‚ "@0a (00 KgfffLr Q(r -LAMM `pBNK@DP@Dp  0( 2-pP,4[S ( 0R K.RkH0, -LMP @P ` -pPDP0U K00S.SK B -p0LlAM P`ANK @D@Dp0 `P u 0RKkH0 S-L@P` @0S IPV 00V00 p-L M@P`P 0U0 R PP0@0P V00KpV 00KpK 0CX4 =K0CH4 d D4[XtDS?@HDU?P0  LH4 LPT$?o2R0S `40  d4 S44h LV VX40)S* \4H 0 P$L  ;P P  #0SPb\$P;0+0PP4 P 0 g< X4@!?"(0  `LT"2 x$ "0 t4 |$ 2"0 p$ d p| HLfHX34P 0`$Rd@, V t 5L  0L T 0 x垧82l$P@0@00  .Tf 0 p刧HXdJ̑ 0  {V 0 s|0S9 xJLx K40 0RAP(Ko @ 0 W0T P@  KU 0 TE0l$P@0@00  .^TT4SX`40   2Ll KhHrtl q`l d= k 8j j j j dj 0i i hh h lh g -ХLlM\@Kp ` P]LKP PLPKC  8[`!` [Rd [5[h 庄[ P %l0  A. ~l00 0IK`!R   ;`!R   0 ૦  P P P P P P P Pw`!RjYT R P_`0̒ J d0 J h0  J d0 J`!R   ~0 `u 0 `o@0 `i0 `cd `00h 00 (KQ P_向`0 nJ   Y  (K< 0Υ`!R 0 ĥG0 ཥL0 ඥQ0 ௥V0 ਥ 0ࡥ0 ꣶuJd J(K`0Lf xf (d d |d c c ,c b b b b |b db @b a 0-LM@ Tk TE Th 'TV TF5Ta T2 +TL T9p( T1  TE  T/L@T$ T>  T%(T+ T  T TTK003P@0( |tld\TDb a a la a La a ` ` 2OHpdNd'P#"Po0bf_Re 0hD0 B:dX"QH0 0 R Q3. 0 0 0`0(KP  R@ 0 W R .R  R R  R.R ϯ0 0 -P0LS@` ? 00d0 谯00 -LM<8 @p`4 P*Z3*0 T.:S, 0< 000 0@0 T- 0%`P@0 P  P0 Pn00800400(K <0 Pj(K<B P P @ R-LP0AS0`@`p@D`A0 q@DP t8 0dP0pO @O -|ML M @K$N@XjK]K ,`FPEHKD K@K A KA00@KNK@0A0@0KA^0@ p0 P? =K0C=K 0CP0S@P -K=K,0C B00C =K80C K 0P0p@P` H@PYH+ 0KA 0dH+ 0P-K+D;O @0 d  -K=K8 B0 PlD+0Dd  -K=K8 B0 PX-KD; B 0RD;-K BN-KP-K8 B@pD;0YD; 0 d i 0 P1-K, B4B z@PT\~Tp =K=K80CPe0Q00 P0PT0 P=W D+=0d ) -K=K8 B0 PD@TD% -K B 0R-K, B4pB0P`4000 0 ž 0H+H{ѡD TD00cH  0z =K0C0S-K=K8 B@P 0 RPnD D;MK0D;,@D4@DPDX<P02 D -K=K8 BpP0 /PKA0 D CP D;-K8 B=KKpP@0 DPrKA0 D (Pi D;-K 8 B=KP@0 DPYKA0 D PP D+=K-K8 B@P 0 DP?-K B@P =KK K0CA@0 ByP,D D+|:DD 0d K -K=K8 B0 P=K0C0D -K, B4B` 9T@PTyTp =K80CPe0Q=K00 P0PT=K0 PD 3D;MK0D;,@D4@Dp*D;0D;P$D9pP02 D-K=K8 BPp0 YP-K BPp =KK K0CA@0 BP\ 0H+DHKᠠD 00D8D0`Hd  -K=K8 B0 $PD;p0@ D;-K B R D+P W -K=K8 B0  Pc p 0d @-K=K8 B0 PRpG@PD;KA' 0cLD+=K-K8 B0 DP6WD =K0C0S -KK=K8 BA0 P#KAD;x& 0c"D mD; DPD+@gD;0D;p z 6d 0P@ p.-K=K8 B0 P=K 0CTD ED;E0D;@0d -K=K8 BPp0 vPD +D;0D;0d 0 cPD D50d D@0 OP-K B@p =KK K0CA@0 BP=K0C0D -K, B4B` $4P@P A 4tp=K=K80CPe0Q00 Pw0PTv0  Pj=K0-K0=K80C0 B0 =KK K0CA@0 BPSD =K0C RD3`!?C0 S(-K=K8 B0 P9 0H+D-HK5-K=K8 B0 P$rp@KAD;" 0c T|-K=K8 B0 P P-K=K8 B0 PMK,@D=K4@D 0C0 D CPS-K=K8 Bp0 PD;-K B0 Q@BD;P0 yP=KK K0CA@p 0PD;-K B R8-K=K8 B0 YPnD  D10d D-K=K8 B0 BPKAD;  0c 0H+D\D. . . l ,  T+   ) * ( <' & & L% $ 4% $ #  VUUU4" h !       |   L   X 0 | d \   8  \ 8  \ O l  x -K=K8 BDPp0 D@P?0@0d h0 @P0P0 BP' 0 pPD uHQDP0 D@P H>P H 0 Hlp0  P0 PD KD0 D@P HPH 0 Hlp0  P`0 nPD #RDP0 D@_P HPH 0 Hlp0  P0 DPD D0 D@7P H@PH  H x d0  #PPP0 Px0 P'oT$-K=K8 B0 Pa-K=K8 B0 PV( 0 0 -QL MP@`pv$0Q 1 0$, (0v(`Vi0Ve(0V1 0, $P, (VIʐ100gP\, 0\,0P   ,  U$ ,9 ^?: `(,` $$, 04 ^0,ć%, %*:(00(0 S0 0SQ $0 00( ,0, (0 K0c P,0(` , TPT굟 0 갟( 0 0 -QL MP@p`w$0Q 1 0$, (0w(pWj0Wf(0W1 0, $P, (WJ<̠00?P[, 0\,0O ,  U$!,9 ^?: ( , $ !, 04 ^1,%, %*:(00(0 S0 0SQ $0 00( ,0, (0 K0c P,0(p , QQQ& 0 !( 0 0QG-V@`P& %`SA$A Œa?PE qp@PP%c , XA?P a Œ$A/ @Q@Q QP @ S,:d@Q@ = =X*00 H 2 -鸢L0M00 2@040 2080 2r`0Q Pp<0 # h2000@=Qi 9OP` VN-5Y UU*0 0bP`@QVG(KYP U?*8 0b 2 X0ɇPP1P`Y/ U**<0`cYP U*4 0b 1 X0ɇPPP`Q @00@  R(K` V񏐬=R R @00@ 0SYU*0S  q   | @-0 Q0SP 00XS@0S8 T6*.C+SP` 0000  0Cp ^7ࠃ0ࠓ0nW0 ``  0N P70>`C0@SLo8 -LP@`DU0 x0 PTP 0" .`W` p0 @#2 S0ࠓ7ࠃ000p0 S0ࠓ7ࠃ00 W00 @ 0 0/8m< 0 o/m<///f -LDM p@0\K0`2 ( 0 RPO 0 Pe P( 0R KMlH -1LaLQ#8ŠNEArᗆM$Ibg8@ bf@n@aGq@ँ%R$APAd0 4 @dQL80T8U@VHW80PP0 Z0S  S  000 00000S0i(K40K0 KSyP 40K0 KW8pP40K0 KDfPU 40K0 KH\PV 40K0 KMRPE.ų%I$Mnk` -L`Pp>0S@4` T  D0.S0D0Ra S@D.PB T\PT S\P ` ` 0.0` `j(00 0 - LM`NK0 @D @Dpt  0 PA^K PEPEH P +o 0RKLhH 0--LM0@R0  .PTK KL 0-L@Ҏ 0`00K0hЎ -LM?  K 0 p- L MP$`K0@  0 x 0  Q0 0 0  k 0RKprLPgH -LMp0Qd" @P0 Q0 0(P P40`2 ?Kl2 <4pB 0t2 04 0 `@x2 hr `4 pP l2 "p`  P~ R 0S So0S Sj qhr`B @T d" 1h2 `2@0cTl2 @ G:0@a1T P@:ZP@cP RᗟK`5R2 0 Q`ZP@b0h"`` h  T: hۓX@iP `|ӓ0@e`Xt QPU `堬d2 0 9 0 (K|R#Zv0 0]0 S S0 S S t|" h|"PP0 0C?o02P  |2 " &|2P X":* SUc 0S` p|R xRpp PpR WO 0SL  S Sp S X:(፪d `P @0l ` 00(K(y `P d@"|20T`B y`0` sPp (< 81-L0TMP 0Qp(0 `* X@K .0) P) 䀟V 0`0 *0 \0K0`0K00 3/P ` 0  ( 0R Kh h .hP `@`ǫTJaH_P_D -䀟LM@pTP`) V 0,0 (0K0,0K0 0.P ,囫 0  KX ,L@,勫T K.P @l^P -@L0^`P 00a cP\00000 aRc00 -dcLOMXß`H pWL P@0  W 00ՙ@/00L10 0R(K0Xp .dJP "0 ` T S  "! ".\  RG\ Q.RA 0S~H0CSH w0 `CX0H! 0P1 m?P1P @ մ H`hH 0H pVV:  H1  0H! 4 0S1 0S.`g RKH( 9 :P1 IP1P2 S(0Q.S H1  @A 8! <1 4 0 0(0 p0  K P@f00c :S.S00,""40S0Q.S:S000@0H<.K PPSI^HhO [ -UML M˟@ 4E @% 0  P(5 S0`00  @8% U U  0%0 Q(K ;0<5 (0P,5  `4"48 pVS#E P0 00 # 00 5 @P0 " @@V:(%0B?o2`5 R0SL5 @5\5 ,=K 0Ct p5 0%t0P4 T5 C>K 0C0Ct5 0h5 :40l5 :x0x5 9 B0'xX%  P% H d5 pW':0%T0#02S! 5  c  PPy0 x @ VS:I $ F PC @V0G:Um pWP*T5S? ,%PdPP%P ` SQa450SJ 0  450S ,%HU u0e0@0`T ,4e 嵐ᒩP%X a  0`R 妐8 0 4H5,5 ,|8%000+80<5 25p\5 妓P4% pT} P~@Pq<53/PPj$%L B/o"( Q  RD% ($%Q? 0B'RS00PQ(| $|5\%0d0%+DU?&B^K PEPE0   0P/   TQ5 % cXX$ ႏ5$U@5  (% R R R c<53/Py$5 <53/$5PB@P$5 45&$5P4% SP(%RQ T%R5 UP  Q p%P Q* P$5 %$50P 5 T5P0T5 %B^K PEPE0  0P   T*h5,%H50R,55* ,% ՒP8 Β 5 h0SS$ +D5 %D5$U05 45 @V&5P \%l%+DU$5 $5P} O0H5 Hj 08 \Uᗒ5 % c@TTˎ54%@E 0K J`J( X.@$ ^N !lq0 ăȌh1̌ pS p @t1p 0P3  R$5/oT" R0 PVWPP@XU(f T5Sc @JpX5@`EQ 0SQL|CC@T`PG8C8p0p0p  c PP0 | PT_T5S*U45PPPU p45 0S'QK % A4L!4%5 x%j*PH( h5 0h5 PJ ,%H 0h0h5,%H50R*,5U0P,5 U$5 45Pב$5PHU(h5 0h5 P% ,%H 0e0,5  t$5 娎D$$5R@TU<$rFHX[ D -LM0S`@0: S-0p 02PP+ P& 80P0 P) P P0`FV  0P P K3 0  K0 0p' K -2LŸBM Mp0`84 0 S00 - S B.K✒ B0B3K @P<4 0u #0dX(P @ T *V@@"<F42P 0  840 0R|(K 0 B.K B B<$ ! .(㝢@P% |PP' 80<@ 0 P!P0<$ 0P 0EᰦX? 0 @ 0 @d0S 0 ᝦᚦb 0 0  0 ᫍ00S0  0@TG   0 0= 0 6 0P P}EH4NDX -LM`pPP00 0  `0 @ (K`0 @P -LM@`pܔPP 0000 0@ K 00 p-L$MRQ``@ P>0SH 0S0S0s S 04  0S 0  Kp 0  0000( 0 ,K,@ $ P <P 00 KpR R a/0  Kp03000 0H<< -L|ğLM`P p`0 0P \ 0 T0  (kPP 8@0K H0 ᐥ0 eP @P 00 H P0ö RS QR d0 R Rh @0 S S xP 0  R H ` Xp L p @``g0P PL0[`0V R R R`  U:(ᄣ PZ 0hP@XpP`h d0Q 0L0hX0 C1`A\L0 1V@:`cV;:H 0 0 PP`c=0V+: H0 L0SH0H @`c X00T  0  L0PS`i 1 A V*H ԤҤo 0p T 0P00 0R9(KH  P*o P, 0 0X L0 {L0X3@XpH|ᥤT 0 p0\L 40L T 0020p0ChHH< p-LM@P`00ɠ0 0^Kp|A -L M@ 9 K(A 0-LM@P( ɠ 0 K0@0 p-0L M@`V t@0@0 0000P 9`Kp֩`V00B@@!1 - LM0@0 ,pKP `K 0\! 00 0 L RM0100 L.\U 00 K R0 XS 00 9\0! \ gB!R,( $ P(,0Q 4 c(#("$c4"K0, ۊ@0,B -2LŸ4M 0PH0 0`P00 X PJ@0@K:T0@0 0 0r @20P0 0 K0T\P pT L X P`  BP A PU<b @TpW\P0K L0Q.:*ĠL T R$ LP0b# S0 sS a v/00H00 0RB(K%L0S P{BPP :TU 0S L0X Q:*40PL p@:T`T0SL0pT0 .T\PL0@0TLPL@ 0Kœ4BHh@ -0L,M P0p 8`K@@ ( J$P030#PP S( 0R KBH=4 -Lß|M P  0 0 PK  0B 1T0  b!",0K PT  ` p  R 0S p v00 \0S  R` p v00 Y0S `Y00` D2堐 00 `0K0  0@2K0  0S V:0@0T\ V00 STG PUY*:0VT0@0S Sa 0S8l0!S40. 0 e ⠐;P> r `VB 0S5* 0aR00.:@ៈ0Đ/ 0 0 Q0(Kz 0Ppe1 k#WP @Tv㠐 `V Ꚑ 0 v0 { u0S*: Ad0S <H` ! 1 p- LMP 0R 0 @) ^0* KP\*`K \\ 1@K0 "@^ R KQSKQQ  R 0R Kp 0QKph@@@9H -eL`M,K0@SPL ۂ(XW U U U 00`Ղ(K 0Q  Q 0X  ˌ`P,KP8/0 QP 00P @ P K00 0 0 0㞂(KQDLU Kp -KxPeK,K 0Y-K-K  %0  KRZ 0 < P? K8``lPmK6V 0#00S  0V0L0mK0c` 08/0 QP 00  P  @ P ܠ00 0  0`R0 ^Pn0Vk 0f`0`#`K . %= 0 R?Q < R? KP KP6(,KR0 0. KY Kw 0 Z_ < ἐ K 0P8/0 SR݁` Q ` ?-K^-K `bZP @0Z b00弐0 00 㶁`-Kp  K-KP Q 0 008/0 SR 弐``lR%Ȏ0 8 -SL,Mp @ \0P @`PL0 `L #Pf080 <0 00KH0 W0 00H@P> 0@UT  XB*H 0R0: \V X VH @h800@ TST'80S @@T<08"0Pt < 80 D0 D0 < Y@0=P08S<  (K0D  R LP RV  AX QVo S00 @ C Y \ V L00 S\  D P@V0 S @8@VT >P 08S  LpV V 00S008啉< @<0 嶀8U<0(K R R@@R V R@T00  00SV @@AH Q  Q V P00 0-@LGPF0p 00100@@@ 0TS 00觍 0 -L M@P0.S00K -L0K M@#pdK R ..Q AA S.S Q0B Q-R  .R0S/Q0B Q/0*S 0.S S/ R !0B]S.R 0.BoQ 0#\R00 !B]Q//]R0S! C//$0 0 /+ 0 0/+P / 0(<0/ 40/ ̠ ( 4 0/0 R @R /AS0S01!//\4 -TL0M80 D4`0<0 84P0@0 @0 Q pW 00T T*.00@P0V@Wp ȃP\pP  "0B!B:SC9A7?>=32:987-543210/.-,+* ('&%#"!  V0Qp @PŸ]^< d1a10B0 V9 !0 0p@V. @AQw0 S40 , cS0C1  R  00V Ẅ40PSAڠ104pPW pGP!( 0 (KI0V 8ᗄ<P40 0@DW PW pg0 7@""PP4 <P@dT@40Sp4p0pg '00T T*00000cT*.00@Ӌ 0 ̨Q -TL,M<0 080 40D0 4@ `@0PH0 Qp+ PE [Q` J<P edpQk @<Pg eQp` 5<P\ epWXVVpQ@p80 c B0G8VD8R  V>@ 0bS9< R<000(K\Q .Q80 0c0C'8V$80Q S.Q 8@ @];PF ph0X00 0xS @80@(K2( 0 (K|"D0    VW& 0 L /R4 ]R9\W PP0 0K0 P0 ]RSL020 VWZ(@ 0 VWpp 8A00 0@S .S8 /W VH \  P0R 00WS V@0 cR<0S0 0  x H L Y"L 0nSL0[0J 0P00 SbL  0`0c3\ P W V <&0 -qPQL`p:*0@S0 R2 0x0P, U)P`   R00N |`00`h``RN`0 S@0aC(00P!` -LMR P3P#XP3U0`80 040 p0`@00  Q6 0@S S S (00(KV40S h040 0?@D00T00PS@< < 0P8 ^@V Ppl0Sppjp40Sh4 -LM K -L4M`S@H P 0Z <0 ` 0S `0S PXW p0S(00(K衉00(KH0Xp  p0T0 04  0C0 L` P0 D` PU 40PS` V@ pP00U00S <0D S"*80 80`80 V 1jY 0. P? $ R``VD08 SI00E(000S L PR*,0jST0S 0pX 0 T L0 @0 -@0 0PP P  AB\ AL^ \ R0SY4 0RD`)4=#=0H0cW<` >ZD`M 00J<`6H0cI? -LM P@nK@p0 p@  p 0RK@Z9H -xLtM @J_K`p0 ( p 0 ( 0R$K69THQ/!0S/P0\*R/\/00/ 0-PLP*0@S @R R R z( 0 0QvP Q0@SP00P0 Q- AL 0S R: cR B 0S  A00`8(00 -@LT\p2 0#0W& 0X"g P@T\ 0   WX`P T  0 0 ( 0  000 Q-L`@S 0RP@`V  0PR 0@P  -@LTA`pQTPdPW1Q@ʮ?00ꩇ(00꤇00 Q-AL% 0S" Q*0S  Q :cQ0A }0 0w(0 0 --LM00  K -LM@$Kp TKKR-0S0 \ R \00 -@ BL MT"R`4 0 4PZ P DP-Yt +Ym W r8`ptaP " Q-SP&c0I ^0aIPW0IAIP70IS| VQSP1! 00SJ \400J(K҆0 0R004  (Ko0Y' P @9 Q 8paPpg`0o 7p`WpdPP X\ 0L ^ @ AN^P@Qc 0 0 0BT? -LrM P`@eKp( tK |@ x@ O{K 0 TAXA\A a a p 1( @0R$K6(H- 0 P -- LM 0  K -,, -L M00  K -QPLMP4 0 h 000S000s !R ! p00 ~ 0 dX@ @5pR)4 @vP@i@` # 3?/ RR  "!"""$"( 008 傕8 P! 00 TP  0@`V 000S  (K賅T 0 @00(K0ꦅ 0 -L@P`pOx0 wPPx 0-LP@ᇅ K0h -Lp`G7t t0 Pl@ X  _.@0 Yt6$ $Kk, @l|8 -L@pP` V  p000PP 0-@L呖P00S  3/000S0K0hL - PQL` @1@S q Ul00 0-L@PP0K0h2 -q1BMLMpCnK`F0@PF@@ @@(0 0@0C0 ,0K <#@00d -P@p 0!Rp0 P:, K<" d0 A\AxA4@?D?8L>C-l,2dBn P_ 0Sl q:SdP A 0@n؁\@@AC`8@b@D┞0gdO0cNdS0C1gx`g0CN0C1`1c0^@0B0P0BTpL4pLa^d@0V8S@@W qqG €L P># 3nP 0S :S 000\PD0;P@:=0$0C0Q*gfff$IQQ-` ?@@TQPTP 0 /PV 0R /0 0S 0 0S 0 0S0 0S0`/// -LM  0 @K T0 00S ౒ /"ab౬ a1CR0 10bQ00S2 L8EHUA@P?QAC1a@A1cP0A!BQ ! aS  R0P'ǟ౜°̠Ϡ/ l b ూ@Q0 aRZ ݀@T0P0(K J\bQvS 00:S U00c0Kp;0 P 0 2c100:S<0 P 0 00 0-0LJS@( MS 00C S!00 [?P 0/S 0000 0 0 P 0.S 0 uP 0.S 000 80hK0h0 ] m -L M@P`p0S@0  K -LŸMPP 8 H <2 0 0#NKS0 0~0D@2  <28P 1"[R`v ^bXw 0S0C@@2 T0SO=0M0@` s,KQPbA,K !AT\: K0ILL2  Z1 prF|l0SD Lb@0@BFLl R h?oh  ` 2 0 <2 8r12[Sh0h 0a0co0 YD Z}`T00H20 0R(K8 < }<"P28`08 }P280}`00. H?P0 S-LϠ^Q\ 2FFF. 02VVBFLΌh@‡F̌x -RLM@ 0d0 0h0 0l0  PP00h0`V <V 00F S+`FVh RQ0S0 C+Ch00cp0 p R l000 St0 R,R00;R00S `KP 0PPSPU;S,S S~pWd9:2 F,l^-}  }-` `PF̌l\ UPppd2F lFu0Q`eF<h0^PcW` l9 bx& h|hl&p&t&u&&&:+t V< l h0@  qp`Ph PqP0<S S 0 C R+0CS RQ0S0 C+CiZ/(K0>SS  0>SS>Sid 9P b`Ph&lfpftfufxf|ffffl0V|hpʄk  0wq `(KdK0Ph0 0 Sl0 h 0 >SS 0>SS>S0bp0 h d0>C`0 $8T0K0 8P 0,S@0K0 .P R`9adhl,`Knpt&u&|&&&&lx0ጃZ`pcc|sP +0 d`Px@ a XPCH3XDC@ PX P E0a BF hPPe x@0P>0 `㠠 P | 娐 @ LŸ,d aXxa"X|x WLx d2 V|ʀ0| EK⊡1A 0 x0 WÈ0P<|EK B`P: |0S x0W0  ӈ+|0 PB0S| =d `0 0 p0x  0 `0 ꨐEK A^P@V㠠P娐`00@堠P娐`0eS000z0x@ POz{Q3 0-@L@0S xK0h h؄PP T@ @`@IP40 0  kk[\u -`QLPV @T=  *@P 0:SP  ~PJ 0S qVlg`VLp`g@_(PT`Vpp 2F"F,l02PhVD0C%/PEQbQev.D0e BT`P J,/12B@1#b0w?C0C0!/A!b!b S0 B .0 ~p.0 wp< 0pp< 0 ipH0Z 0 T2#d aTa>ao("0 000V `c 0 S 40` 0 `$0=^GTS0DKH0 `B͆  G P&2;f܃K`pYXUT 0C`CWV C`WV0C\H DKp0DKH0 l8_x0 R lR `l0!dR50@-2%DKR000H0 IQQQnm$Ij 0-x@LM@0 0PP U0S VŸ␃ⓑ),9# 0#KKRP0w t 0 (K0S 1P0!V#K0VP? Vo>Ÿ␃ⓑ),9# V0#KX$:∛ Fh 0P: F 2l V0`Q SP3T!倐K 0  An l4! P#0p`K  PHl00XP@@ i0( Q"$K  P0PPP`0``pT 0 p( 0QH0 $KkXie!4 H]\L]\H\[[\H H0 -0@ P000^ cX ` -P L,M0H0 %140 0D0 08 @0 D0U80SC80S0ᕃ'H0@Z  @0`<0 000 00peT_*< 0p`0b hR <0 80R㕃#00 00@d g0eS0!S<0S*UB*U3:00dl0D0 0@0 D08 80S#@ 80 R**0`e@00 KPETAXA\A 1 1  0Q Q Q Q  ܁ 1 ( 0R$KTmT00넭 H -(L$M 00 Kh -0 00- LM   0 K 0--LM0 K 0  -@L`X_`00CS`0 PX0 X `X_p SP UX P꼫 @X X0 `00CS`0 X0X/p S RX$ @ -000-LM  X K訪 @ -44 -L M00  X  K` @ -L`Pb_@T0@0 %e000;` dP@Z  e 0 j  I_D_ ji --L M0 0 j K -- LM 0  w K -PL0M` K:PpP @P  uP&0P ʠ p@0 $0, (0 0KK00 0aK,l00  x 0-PL^@$C@^0 -LP`@g RT0U :T:0T:Kh{d R-L KhW00 s-L@P !R ! 00 0S 0cS`0AP R 0 V00S\P0\P `\P 0 k 0`0 -P@T@1UL`p  L{P  e!Hk@xP  d | -LL0KDM@d  `X0 (k, KT K0` P $0"T` \ 0Sy0Sv %S@`0@ CZR%#"   *e$"na{zy\ mF`  u)P0U *T0X !01SP XXd0X0 T Td0 Q񏐷` uP0U%*T0X `  uP0U'*T0X ` uP0U*T0X `9 `7 uP0UJ*T0X ! 00 B0C Q$S$P uP0U*T0X 0p*S 0 C R@00 C R 00B S0pqp 0pG0B Q$R uP0U*T0X 1!Pkkj@@`j@` ] uoP0U*T0X D` ``SC  u\P0U*T0X 1(uQP0Uw*T0X 1!P   ` u@P0UW*T0X u7P0Uk*T0X   u,P0U*T0X  6 u!P0U*T0X \ `8p  uP0U*T0X uP0Ux*T0X TX0P ){(K  uP0U*T0X  uP0U*T0X p uP0U*T0X \ `p\ `po\ `p\ `p\ `p\ `p\ `pwP RT X@011\ `p \ `pl\ `p\ `p\ `pLz\ `psulP0Ug*T0X 1!P ) u]P0U*T0X 2T X0?*X0PO wz(KTTT u1P0Ui*T0X u(P0U*T0X vd0P00T\ `4p5\ `-p# \ `&p\ `p\ `h0 h0pQ$Rc0pH\ ` p\ `p@  \ uP0UP*T0X uP0Ug*T0 X1!P)\ `p 00B S&010 00C0B P$RW uP0UK*T0X 1!@P\ `pt\ `p8$R0P RT X1@\ `pu{P0U *T0X P\ `h0 h0pp\ `pi\ `pb\ `{p[sTp - RL@ `P R R V00 0a 0  a0RS 000AA P$0Pࠣ%pX S X  R `AA^P#@1| ϠB!l! C0 T AA0AA( A!0C0000gfff 0-L@V0000 -dL`ϟqMM 0 pP ' 0 6  1S0106K&0   R 0 S .  ' '0K&  &   p 6 7 7 6 $ V ' 6 6 6 否 V0S~ %S @Tv %T60U &` J& R &  prTf c 05K@6 6KgnKPi>K `F 0C& `F 0C  BZQ .@BA@?>=<;:W7zZUx^Q p0sJ @GKY>K 0C @5 D D 8O3TAXA\A.f^nK `F,p0B^KDE PE@FPE 'ˠU U u PPVPP0@&00@000 '0 QT(KFmWP 0V5І V ʟ6 \w : FT 6&S1`K: &0SR606  0Q6 6[P6 f 0nK AP 0 YNK @Dd0P6 n>K 0Cv gvЀQ# X  Q  R 6[pG0PU`P 0 a 0] 0 aZP0G0  Gp4ɟ І V 9&0SI  c&  &R 偁 & &    `I0І V 7 6 S & 66 S !0 P@06 j>K 0CC C i.K BQ@&`V= 60fP7 ;w0P6 / 6fS-06Kv & @K 0C`P0&RG0SR606 f 0І 6 6І SV &め06 x0 \5K&K60S\60:6 " YNK0 @D6 6 d06 &F06 6 `7 6[T & S& &  P [ Z P PP [ P 0І 6 \І V @@PZ@P І V B6 6 6 966@O 6S !06  *R\ 0B Q  0B Q P 0B@@ 0B Q$R ( H++ :d"!20dD`' aRІ V  L X0 P  5K6S06 66%S6 0@P6 j>K 0CCiKkK A06@ `V 6S60f6 7 6s05K6S F6   &K&[0RS7 6m Rj \ , 0B Q@@ 0@ Q$P Qv   Qa + &K P&[R &K P 0І 6 0І 6 0І 6 6S І V ' l06 -6І S0B07 0V 6 " RІ ) 0&K@& & `' Y.K B 圥KV  & &K ' 6&006 S 8P 60U6S 06 6S Mt60@g>KF 0C0C@PPF n ?t0:S j>K 0C 0CQ  pP p 5[S 0KK 0C p<  @6 & p6 66Sj0 5K7YNKR0 @DKP@& 6 pmSb7 0C p@V <6 pPlU<UiNK` p PEU0P`6  S  p bP6&6 pP~ 6[ pARP&&'iKHP6 p'Q_>K 0C 0  S !06 j>K 0C CkK'iKR L0  6 ;&R16 `iKP p7S606 | &R\s<l00``6 k>K0C p `6 V70C7 60C6 6`F0Q00   P  7 @jTPPUڌQP   U@e@T(T,K`8PH @DT0SP 6 Pp@DT 6^ 7 6 VSӟ p6 S 0!6 6S6 '6 0,@Kp%dS @ 6  pP" p &6@bS@T ڌ60S 6 pPh p 6T0dS@S,K^`&8PHP`p @DT0S` 6 P;  p8P  wP7  ^iK&P6 p'QB P&  R0 piKP pt=iKP pSP7  \iK(' P p('iK(' P p('60NS `Z6[/ & @ &  & F F `H6S p6S &傡06 Z 6S6S@BnKD `F`F _KW@v 0HvVP 6@ 0 0@svl0PP6  B>K 0C0C ࠦ W&jK  0p &00& 60S&@  \z &R!` 6K0&  0 .66@( 6S& !`06 V6WS606 00 60; 6&S R&a0K:&6 0& 0 Q0S60R00S 0[\YNK @Dd@  @ ` dR& iKP &&@ &R ` & &P  R&KR &KS6 =6  &0SRN 0 QPYNK @Dd0 2>!R0bd@&  b6S &1 & ,@K p5d$iKP p`pL;0Q0  pP p7[VaB5K-0C+0S Q5KA700ES_K_K L L005K@&0l7 R06 6&06 ?@6 F F `6[& &d: 00R0&  pPB p 6S: 60S 6  pP p 6@cTTҋ,KY`&8PHP`p @DT|0S` 6 PO  p6 0R& 6 pn6&S R&a0K &6 0& 0 6S$ &1 & X&@ F \ &R!` 6K;0&  0 &R;  & &Kd \ &Q`6Kb&XR& &  6 6[6 FS" 06 j>K 0CCkKP6iK L`6SU !n>K 0C`\ 6&S@1`FKs&0SR606 0 m 0Q6 P f YNK @Dd!.000 0l0S00S0L d@00&  l  b0LV&R a & g6S &a06 BnKV `FF%2?B!c10A00 R0`0 0 `F c_KVV L0 V ``0V \% & Z70f?6 >6 iK)P p   B>K 0C0C ࠦ \U jK0vp@l&0@00 P& p6<6 T4&0Ss& 00  P& piKP iK(' P6[ p('06 +X 300Q  6p&06 '607 >6KS`6 =6 6KS6 =6 iKPs7 @F F G &6[/& && 200Q  6S &1 & & 0S^66 0B?o2EJ6,Ÿ: 6 `lS606 6`KW6 6 00iKOP#7 iKEP&6 p0 `ZWp106 06KWiK0P p@ 4106 +&6[/& && '@& & ' &p-0R6K0 QP&06 6[6 ` 06 S-06K`f606 0 P x05Kp0 7  t`tgfff    8 &R !&  6& & R 偁 & t6v 6\U S6a0&K6 0 0 t6 6F S6&06 n>K 0C`6m 6\- S6a0&K6 0 0 L6+ \ 6&R`FK&0SR606 0Q6 6[^6 6 B6K FT7 6&R`K"&0SR&0 0&  0& & R a & 46 6 S &0 6 @l6 P6@06 06 6&0 0& 6 0d@v v c6@zF F `p66 6 6 6 6 6 6 P 6 p36&06  0R& 606 606 306 06 Z 0 & 0606 606 "6& 0& 6 X406 606 6 0& 6 R&& &  & ^R:& & &` & \S 6S1`&K0S\606 6P6[@QP6 6 dS606 6`06 \ 6&S1`FK>&0SR&0 0&  S6&006 n>K 0C`R& & &`6K& 0&  0 R& & &`6K& 0&  0 iK*P p6[f6  6&0R&00`6 K&0SR&0 0& 0Q6 Ps6[6  iKP pY 0 6&06  0& &6R&00 0& 6 FK&0SR606 6 0Q6 6[P6 %6f 6& 6 d6& 6  _6606 0@6 iKP} pG600 6 @ 0^'YNK @Dc06 0P0 9%K R'n>K 0CiKPUR66[ 6 [66[f6  P6&06  0& S606 6`Ki6 6  iKRP& piKJP6 p& & &` & ;0Q6 ^606 6`06 &6R& 0& `K6 &XR&6 & fw =F ` 6S606 6`K6 06 00 6S606 6`K6 06 00 6Q0`&K6  c6 XQ  P&  & x&  & ni 6 f p &6R&  & &6R& & @K&0SR6F 06 0Q6 6[^6 F f g6[6  `&R  ܦ 6&0R&00`6 K=&0SR&0 0&  0Q6 6[P6 ࠑ 7606 6`06 &6R&0 0& 6 K-&0SR606 0Q6 6[P6 f & & &` & 6&R&`FK  &0SR&0 0&  0Q6 6[^ 6  m6 6 SB !0[6 :&0@00S? !06 , 0B Q0@0L Q$\r Qe   C6 0Q6 6[P6 YNK @Dd0f 6 P6 0 @6 0 6P6[@QP6  R R R"6f 6 6f 6 6f 6 66 cf 6 0 / 6 f p  ܦ 6   &R !&   6 f pq &6R&  & -L@L`PpI4@0 ;@ILS -L@P`pI0 %PI -L Mp`@P0  XPz j8  (Kow1  0(Kon1  0(Koe0:?C0C0UP UFpP< 0H0 S  CS0 S  W #R 0  C S  W #R $W&*C$W"&0 U U'PY0EP W G   CS(K1 0:Q0H0 0`@ K8 >a 08` Sr CK 0IpPa40K0 Kh#0P\0  &*q 464P5OB@Dlp =4-=A-=`pp-p=7 0`pt 0IP8Z0`0 <=H #K=P0J`0 ` @dT0iB0ST0 ECT0 UZ0 d h0 @0 S<S0C@0 @0@0C@S4S/0l  (K< L<R 0dfV  ,  (K0@4PpC>0 S@0cc `c<0<0A30@Gl0 A0@0 0PD0  00Z  S R;P L x l R4@CNT0@6@d@ P 0X0 f0X0 L00x0 0SP0 0PD0 P0S@@T #KZK3*H0  *b1@& :`0"rKV :H p q@P`p 0K\`p`0S $:}P: 0V: 3P0S 5AK80 s P0倠 |0 X0S H 90| 1 C3#K,D@K{P0PP 0P 0`pKHP? 0$#K=P| R | D0|  ܃K 0,Pt T   8 8p`>P0PP 0 0Pp`  0@P X0X0 L0S0x0 P0 <   P x0SP0 T0S P W @P   ! L 0PH0 < 0 0`pP 0P  PT0DD S Ps9U@ PP\D0T:  0DS000 0@(K|儐'K#K00Z / R( P `6RH L ӊ1ӀM P`V 6 Y#KP P`L0XD@\D@00 0@X RT@XT RY0 R 0 c@c cT h0S X R_ Py \`]PPt L`Pn d0SY `Pg Xp@0SpW <0SpK46SpqzzW@pd0SB 01  `<T00jT0 0jh0 0d0  0PJ 044  5AK80  4CK 0`p@PK 1PM `mX0@ R0Sdp W 0`S`T0@0T0 TPP Y `P `0SP0SX0SDPp @pPP  000\i\^p\ P T0DDQ  s9R@  X Y X3 0'K#K@jT "HP0 10 KLDB`p 1P ?`p@P`D 10@0X HT|@#KA"Kc 0 0`pP D@0@ 0K 0%Pl#K 0P@0T D0S 0X0 H P0D 0C0X0 <0@0T0 \ Hp?N ?aCoc?`(?yPD?'<??@$$@@T RP  < RN00S T0SG QnX0S @t  PP W  P  pP @0<  0P RP L0 L0H @0HSQ00S0H\1!0cKҀ 0h@Q 0m0@ 0WDP @0@`pLP0<  S  1R 0`pBP+ 0G 02000 0`p(D00cP <gKD00T@| 2&p`hP 0  0`pP# cK 0QP 0 0D@000 0@`pPmP0SG < PD00PP0cS pP4 =;P@ JPP& X0Sx0SP0 7h\\PP0X0 @00C0'P0Sb `\P P|^=@00S0x P L P0S x@T* 4`py 04 r|@ 5AK80 0J0 @0   PT\P_D 100\P I`$0Hp S p\0S Q PP P89W$ 1ppH@\P \P  @0T D0S Hp p9W\ pp@H\P 0 p\9  \P H@Hp p9W\ <0S @00C0 x0P@00C0x0Qx0P0 W<`i c<0S Vh00#8Q /D S /P/Q// P0-L@00 R@'P@0 0-L@PP00S0 0 R U0 02 @O -L0h0 peG0 X0 0H0 <0 0@` #Kt  0-S=,;:987654.-,+*)('&%$#"! 0 @` H0 \ `Q0@00\0SH00H0 R X <H(K0\0 @ 0S 0S  0 C Rd  P@ !T 0PB!0T0C@ 0@0 C R S p| ERA0 0 @`0@0 0+S -S0@0 00 C R@` -0S@  @ 00S 1 CR!@  0 C0@ 00C ^! @ 00 B0C ^nRP Y b@ F0\0 WT d0 j 0 0 SH W SY ?o20 T@W YK h |;01$CK 0KYKX05SWʄ0S 0Snڄ %0gR ;h `g1 Ka00f1 \0,K0 H0K0 0ll d Py80K|0 ` s| R@I0C%S<:987543210/.-,+*)('&%$#"! z0S \   0XS xS @ 0R R 0 0@` H0 < 4 89R8 000, K6 0"| ``h9 0!0 K05S0000,K0H0K0l 0ld :P <  R P p Y^ T@ 0 p0C PP 0@0 R p GR!P!WむWQpW@0Ј @ 0`80K|0 i`VU0 h'1 K0 K`p#K| D0KP< d D X8`j`Y8`   8` `D 8` dX0l0Q }0Q0 `cV<mD0`D` < 0 S8  00R0 |0 @t000 T0d0@ 0 PqP   ! B<0fP <   !BD00d8Pt0 AP0Ph0  U00t Xp`eP0ap`PP0`PbP`PU00W0SPc`cpc0S h0Ph0 !P r dQP Q jP V P Wh0Ph0 :P 0S` Ph ` 0@S@P@Tu @0030  U $!0H0 @ 0K K0 |0D X0#8pQ00SpML0KP KKPP PQ PV<` 01<P< o |0S0 CQ0 SD0 0C| D0 0SK80D T0pgorpW "2KY 2p` KC 1@PnP  0 KjP|0S0|0 @c  h U ` t!0ZH0 |0 @0S@T >`P h{P0|@ H0 X 80<0bD 80 mP<  &Y h t1 0p  `p0l465600 B  KH0,JZ Kʌp 01$0#j6oF5`F6Y00 _ 0h K`0 0  0ᩐ`\0#KH0S @ 00S 1 CR/p | 0|0 l& N|V瞯<(A$??0@@KaP d0l0@ 000H0 0(S0|0  d0l0< 00|0S\ 0S3H0P0000H0 O @0H0 G"0< 0H@@K0Pc @0 0C@0 'P@00@0 0H0 0|0 shH!0c 10 KA00P0H0 G"0< 0b ay^P h  1`pSP UP |@t0S@@TI1 'K)K00 `z0SZ ` |0S 80l 0 hd0 80R< |P< 0 CQ#|0SN D0X 0D0 0R0|0 }<P< 800C80 m00C0 h<Q0|0 @0 S0H0 X0<S@ PU0X@  R @DTPT/s@DP< ` 0@CX08@ D0 P<  3U  $ 4`` K P K @t 0 K'K~0S K SV  0P 0@00c0 \ K00 0|0  0P&  0X 0 KP H0  `0 H0 A0l 0\0d0@K<0K0PH {0@` < \0 $Pb<aP< 3 8 X0 eD0 8 \00c0 \000 `f0 h%1 K0 K` &Yh 60 "@ `@P0 4465600 oF K`F 0,j HXKʌ@ P 06$0#6H5H6Y00 w 6h K`0 0  0ᩐ`0|0 <0  0H0 9F"00G010 00  RU00 0|0 |a/)K@ 'Kg  RD f<_7 'K)K 0@ `0 <80 0 80 |@+0 0H0K0 0l d4KP>010 00  R< 0P00H l0 8Pd0 00S S S <dl0 00<  R H 05 3* Qd000    0c23 0U ` tm |0S < D0S *0| |S: 0QX0!00CD 80 H D0X @cT e<*< 80 0d| 80 V ~C80K|0 5``|@ @ QP0\rs< 00D0 0U!PP `HP \0S{\0S w< `0 |0 P0H0 0  80 Z!0H0 . |0X 0# R00S<0 U<Z  !R0S 0C00H0 d< d0|0 H 0H0 0 H S}<0! H Rx0 S  r ` `@ 00C pP< m 0D@@d@TD00D0 !0H0 U -L00蜼 - 0PRP0L``@PH pa0  (*"()(8#808ⴀV#8 pgaP *(8(!"( 0(V"8S 0\  0  0]PP   ! <@ -3LßM < 0@00 00S 0"0@0 180 080 <080  @ AR 0AP0Q  `@4 \p# 0 QJ \4R\T#3PQ P`Q e<V TA0\pRT T0#03P0S 0`1 c ΁0V TB 0 X *  X*800Yd 08S (KP  T@D 0`D@4  \0 \0\ XQ \0(K@0S 8@0  0c1300R)LoQ )\  pR R )R<0ppI7 XRM \0JH00(K< 00nX -LMp< 00 4 8(0`00S 0 00 0Qt @00Q PWY  QP  R\  \PQ pQ P8 @ S0D 0Y^L @0S40 0S| S~ S, 40P@R``0 000U`  00UV @d 0SD40< @0 y0 \P \Q R8   e!8 PQh pQf YP[0d0CSڣ0S pP Y  00QUV 0U\E Pi R0U00   PUjABg40P`P~`408 0R48 0R@bU 0S: S4 S*  B" P0 (K0(KP 8 +Q -Q @ ( AP ࠃ7A LP  >LQ@@P8a8  R a @ Sq S0S + 0p000 400p< 0AB" b0 0Q@0Q  0oᩒ,@eP` D21 `2 Q P``80080 eaF PeP408 0 R8 + B" 0 (K @ u4 00 ԃK Z Q* 0i?^0``D0T/G-hPM0@@ 0 Pn @tT\[2{dD0)Q1 ^\ @rP 0RA 0ЍG*R?\"l? N4, n4 l) L5)5<@ PQ0 Q7 1 00+Ѝ0@@@P^. QlrQ ?Q.?  L6! l6 a)̘ A7)71` p@P0 ЍG`@P$+ဟ4 080@ _0```p -pL`McK#K p 0n` U5\";&[E%GڤbQT ^+\*Q@TP0U Tp"0pp``ࠁ ࠓWVLŸ (00R$1", 02 0 L2!L<A bb4<"(Kom1?\(l? N2l n2 li L3i3| 0 Q6 QUT1<*@RP 0,K(K0   0a^3 QlQQ ?Q5? l Lj4 l4j pa̖ pA55``p@P1 00 #KK(Kol0000C?o200 <0 @@@P(P/P / /B_/ P/W SP- Ϡ`P(1 !d030#R$1",!020 Cr0 cc0r@C.c`_0p/HP0- P(1 !X030#R$1",02C>l0 AZ1, l01@0/ᴖ -[P4 ULEoJP bVTEoP~UED0b34 <  000V`  000&%;0 S-%LPo SR9 R :0!00C#0c@=ᆟ ZR 0 Q03:00 S .T%60< Q 4/?S $ /?S   -K@L$;T%0.: SG T$ S\I \P* Q03N:08!00Cà0c%Ō# Ġ pP` AB AARKhR& R)*P3':@ @AA!@aR\ C/o" R 0\0 Kh  0ꀓ; 0-$L MTKᡏS%U@⠏(J TQ TUR U\*P3Z: A@@DT@dSR< RM*Q03K:0<!00C#0cUT%U# `@d0p }@~@?0S  0"K%(<,\R   KiHRT  KU  K0 KU Ki0đx;0 S-L ;0S P& 045S x0 S h0 S 45S @0 SP ;0 S-L ;0S /?S R0P45S 45S 3# ;0 S-L ;0S ?S S 00045S f045S?SP0  3 #0R0 ,!-(q0:`SOLP !P0b?o20S" : S PS  000C>cv0! a.0C7#0`bT71 0Q 0AS2^AWV$  000  0-P@QL@ Po $+%@TQ A A!$Kk0l) 0\0SR o( ,0   00  -LϠM ^  Kq K -LϠM ^ e K K -SLß@M⃀ᣟ ^`pਊᡟ)@P X ^ X'0 0U T8#0 QP08 S41#<1 2 0 C(+0C# 0h4#8P@hv&( V, 5:%BKKKB0p!`8 (Q!P4 KKK,, (`pKUTCK0p 00"K 0K@PcK`pSR00bK`p000` 0RNN 0N $Kk07 0W V0!0 ࠓQP08 S41#<1 2 0 C.+0C# 0n6#>p`nR\no^@_0 0 $K `0 L0 $Kk[$KD< -ULş@n 500 00V(;00 580 540 80K:80 5 <0 0K`fQPo!#KKSR%@ 0 (Ko- V @0 3(K @0(K#K0b #Ki (Ko8`p`` dp FKQP* 0\p X #Kᖁ@0P!0 EK0ᑗ P#K@ R 0 R0U R0tR<܅KH L@ DK@PUT3#  0RK0&KSR 0i܅K!0 0 SRTAPEKXF!0 X PPTT 0 KH KK0P H0 '#UTP0 00%KpEK K0PDK`@P P0tWV R0EK R0@RPT 0%cK@PXUT3# 0000$@09 0%KO,@0 00+@PPuT -L$ \  \( QP= 0P@@P `Ip@P`PpUT P`IpQP dP@@P TP@ ,0  0-LP \@  Q Ϡ Q \   0000UT0P 0( 3# 0 0-LP \@  Q P P0  0000p m0HPUT 030#S00 -q1pL0`S1 V00AT !0S)00 0PV@!0 !0c1S! PV"B@T`P0S 80Y(0U0Q a x0 -@PL0 RxPQh00AT `2H0 0PAKh%KhF  x 0  0#100/#8 #4 #2 #1 0 / 0// -`Lp@_ 1# 0V@P 0 0V1`@`<P   ! ,|px 800000P /// 0-@LP0@00 -LMP@U` @P`0Y0P00 > p W01 3* Z`1V 04 58 511*\ 0 @P0``^@P`Yp48Y 0JS 0:SY000(K -q0pL@<$A QPZ? @ PU  PP. @p1`0S  wPP? 0S 41 1PU 0S 0C  P0`0SYP! 00 ㈩ 0S x0ݒd0ؒ눩Z0S 80͒ ,0R0 x{q -`0塂`@TPLڃ0TpP X 0 0X0  i )  \2.R@@D @;@ \ @D@0 0 R10P*3 1\ ://// -LM0 P0bS`I 0 \G*32P =:@0P 00 D 01P @`p@0  R0`RpT` `pZ @0`SpZ` `p  RL0<NS 00(K0@P`oP 0 0(K0 -` apL0 0` P00F `7R5V050#3<1@R* P0 FpR 5 `u1v3\!2 1@ 0PuV@35V -LMP@p`$P D(FFU(@ ,P (K(0X 0 C@@1` $K,KzP(0, ,  `(0!30  (0 S  X0 CHH5` $K0S0/0 R /H-M- 0Ѝ X1-TALMP`@GKvPP9 pP30S  S0 Kဿp% 0: SsEP 0X%XP `0 $0, (0 0K\P1O00 K10 010 0K x- 0-@LC$00CS00 PA$0P00CS00/v 0-0LrS+ wS% aS d1000Ϡ@0S fSČ xSˌ0S eSŌ +S0@S 0̠@ @0 S-L@4 #P00 P! !$ 0S 3/PP೼000P @ P yB00 tB00`aa#0```0#!P`B0 0P000 s0-L@ !R !P 0C 00 0 S / 0-Q1P0L0@S1 0  1# 0 P @0P $B0 <0Q040S> 0$0 3/0:0P0 0- 00D 00000P4@0 00 08  0 P00!u0 @ 0 ꬺ  R-L Q0P:Q:0Q: Kh(/ 0-L \S :SpB 0@K0hPPB 0@K0h60000B 0@K0h6@000 0 0000/8 -p0SWL M00@$ G/o"/  P$1 1(!P ( WW (1SyQ  0(QQ 0 0 P 0(K0S+ R9 P$a(0V  0S(0 `S:0  PV$aV(1s0(Q0(QS0S0 $1 0$10^(1( X%X00^ Q  RU00!0R0an00(/ 0 ,!$1 0(Q$1sP 0 P]0P(Q 0 S00$10 -L,ML `4ßV8 D   ! `H0 2/,(0Q00 0  0P@0 @ 0P000PS0 K< p ` aZA pW P#@TT)  80 m[pP6w&< 0 [PC 00  P 0 `Rp!WPD00CS#@ 000(K 0 P@ 000(K 8 PD0S;-H0L  W@ 0P00(K0  SP:(1 CW! @ 0  SPH0L  VP  00Q00S 0aH l@ !RS$1 0(q $1(!H0  Q[P 0-@L0 1 \0 K0hw.00,10q.00,1 0-@LS0 K0h_.00,10 R0-@L 1  0K0hI.00,10C.00,1 P0-L 0At 0@1.00 -LGM41@S0(KD#0 18 3/0`P *1K 0p0aK/QK ` P.K-K ,K+!K "1K1@(aK'QK&K%K$K#!K)qK81 0`P!!K 1K 0aKQK`PKKK!K 1K0aKQKKKK1K!K #0"`!P '&!K1K% $0aKQK+`*P K K)( K !K/. 1K-0aKQKKKK1K!K, 302`1P076!K1K5 40`KPK;`:PKK98K K?> 0K=0PKKKK0K`K K< ȠK T K KK0 ᰠKPKKGFEpD`PDEFpG`0 SP  0 8A/ap APM_`mU`?  0R SP 0(KV-O00S-0 ,!)a g -4!LPPp@01S 1!0C1>1S0C1>PP!RMo@0@S >!Rp Rx>W0 -pOoB -p-0p 0-PPL @]>00 Q0-LP @41S0 P0P0100, 0 -PL`;P@ Va0p;P V0'!!0V,@`,0@ -鐇pLMMQP` w;@P 0Uq1   ,0S W?Kp,`=,P`(Kz,0Sv,0U0*6 ,p  (4 8p00 1D,@ ,U KPeDP Vy Pc0 S400S 10S0REC4(P3 1D H $ 0|SP6|5(31 B0G<0, 0(py0Q4PpV QUQ0PP4Q0q$1$*9PP+ dğ$4`  0@@`  0@(KWK tP  0pF '0V V 0S 1A/ܷ@#xp#|p.x p.t., ,,̠!Ƞ#00 !Ġ! " "", ##$0#<( ((p 0 p$@ ('p''|p,x#!p,t,̠ !Ƞ'%!Ġ!$"+ )"",*( ##$/0#<-. ..$,0.<"p312 00&84,75,,̠4!Ƞ;9!Ġ!8"6? ="",#x:>#Ġ#< 0 C0 D0ApB@!̠ [SC[C[C!ĠK[BpW AP*1 R&00CS" 1 3/@0P(j011pP6 !D0 10C 3"!0!NJO`.oRR  *00*@`b*0S OG00S 0\000*0P0P*`*`w*`ȩ Dt$aZ -@(`10f0pVLP(p V!؁9P- !1( 0!1 0P1D 1D ,0 U ,  00,KoSꂑ 7P   h(*; ء 0-@ 1L3/,0( P000 0-@LQ 00 210I* 0 -fLMS`) p0 7*00(KX == -LşTM@ P` P`p0   00 20`W :W [#00`00 0 RV(K0w 0S0d0 W 1S- 4P䁄& 0! 000b{0Q:1S QY0 h0 Pʰh0oST T K 0Ph0 T  h0W崐P1  a\: A'"(Y !j:j *811 0d0[*0 ~ 0x(0 0S 1SZ  b W 20 2r(  Rjw Rd0 %*0Qd0 XK  p 00 SX0dD  @0 @0Kd < H0 H`K[  p X080  80K4KP0 L 0 0Sd0PPK0d0 B00C i 1  R>10C7#80C S0 !{/Ⱀ1Pb 2 _ 0 gpW d000 Pz 0S* !- 0Rd1Y01đ_ RY^ {0!W  P% 0㸑h0 h 0  L0B7#80CQ  P0h 08#800 !00, H -LM(p  QP@`^ q0GM0pp pp au !8! C!#8) p P ΁W 0L08#8 0C P8.Ƞ#8L(0 0S (K0 R1V*0C1  p 0 0  p 0RX 2 0(W X;10C7#8S4K% 0 4@ 3K P(00(040#[0!0v4@ cK0 4KM P(00(0dXQ210C7#80CX Y4@ 尃K4K0H 4@ 3K P1(00(0Q "P 4 Kp4 sK P7(00(0   P 14 K0C00C4 3K P (00(01 C'"( BX*  p00 04K4@ 尃K Pk Y u 0-@LQPQ0 P 00 \0 P 00 O0 -L MP,p10C7#8S/0Sx P#g P a V0FZ S1W @P `V0ഠ 0  p0  000(Kp pp a ("(0F≐8V# q 00C8 P#8 ΁S`0L08#8 0C P8.Ƞ#8L  R VP0 00(K 0! 00 -LM@`pQ 00 RP%W3 W*(0' )  `P 10C7#8S 1 10C7#8pP  |W  2p0 2(Kp00(K0K mPP 0 R p 2 1C0C7#8\*> P 0 P  Ep(K10C7#8 coᨂ  P 0p& \\L 10C7#8P#p0C7#8pp X8  80p_oR{P{ p u0p 0K80  P `0 RU ,0p=;:98765 @10aS.*0` S\0@0 d0h BX  000CSj     @1S @@P X0   P 0 X0 1@0 @@h0  %  0Sy 2; D H0 pPj H~ Dz (K[PH 4A00!1 B @d'H"(0C 7$(#8!!$8v[^H ,4A00 10C7#8 0C 0P0!@d BH'$H"(0AA B ȠDž0 \ 0 =1$[@dX0HS $8110 XP$   @    P00  @K@p  h[d!0 h  Z 0S 2; D H0 pP  AT0T @DTA H D60A$[7#8S  bL  D0H  p TRQ X     A  P   < 0 4 8 lp3/ 00TX  @X  P $( @    V0 0D0H  p E -L P`>@P] PU7 2 LP0'  (pW&Q0 0R   {P= 1P0C7#80C0 P00 RpW 0 10C7#R  0R  PpPp WP 0R P 1P P  -L$M@P`Qp 00W- &W W W 00(KWEW Wj WE0S 0S 4K 80KKX8 (K W :0GS(0nW,0p1! B'"( 0 p0d P(KW W$ W" 4K40Pp尣[ * (0p00rp(0帡= ` 2 Y400(K,0p110C7#8Cf  h1 p yP 4K 80Kp 80St 43[  1  [P W W W=(0<XAWa p WM6 41W%(0$1!08 B#8'"S' 4 3K4Kq 0C3K4 4Ka4 尃K4K\0!0(04 #K4KR0H8#8W8 p W  P3 0 P+ 10C00C8#8,p4 尃K 꼑{ Y P 0XSBXH  f,p4 3K꼑^ Y} P 0X!08 B#8'"SWH  pp w05 0P 1 0C00C8#8Y !p0  vP -@LP`P (0 00(0`00Q(0 -,0L$Mp@H D0 1 O0P80 C A0@DG$H6 @ < ` @#hT$ PX%XP @D0H8HP80 0&08!01P0  @80 0V PFX%X80 0#0P80<0 <(KH <00(K 2  V 8010C7#V80QpH <00`(K 2 < @ `80Q` P4 14@K0C00C 3KNPP 8_@1D HR 8 @CTA3TA  `P 0 SA1D PR@C08` 801@ 0 P 1!0C00C8#8PU0@8 8 v zP4 4@K  ᰃKPPg 8@1D HR @CTATAV T Pa 0@ @S61D PR@C@8 81 @@崀 -@P; PU0 *!0C8#8U08` x 4`!@H$H0@8 1 48 -L MPRa@p  b 0SA  0Sh*%0P_  0  0 0S6 06 0S  0QJ%0PD  00 c 0 0(K 2  0 @@  @0(K 2  0 00 S(K  00 0 P 0 0(K  vP00 0-LM@\P0 R  ! Q s?0 Kr?LP 10 0 0  1K3/K00@-P@ U1!^0 \0 \Se0 a00@-P 0U@1@!T  \@0 ^SU000 -LM@p ,K`P  (K (@@0T"p؁,H(@X`1`! @f T(@ p, PP$K$K$P p@ -LMؑ00K< PD I`@0 0<0UPU @< @P 00 Up1 p! 0 ``aa80 GX 80D PU0<0 .(K(K -LM`@ $K  K $ }P 0 q @pGrP @ P$P 9W @g:KK KP/0@ 0A0S *Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0 "@-A @ " @1 S0-L@P  P 10 2 0! 20K0h -LM 4PS@  $3/dp0 a0Q P pl4P4S $ 3/0 00$K0 0 - 4dLVP:@T@T 00S    00 S   0!P`0d0p0 0C01 0 -LMPK`p@P$0: S!@P + 0@ 0S t 0K dT Kp00 K K( $$4/4 s0-0L@`P# |P4U040 $000C0!0Q  10   0% 0 @ @| 0 S0  0C-0L1  0 A00 S   0m# -LM4PS@`A`q0S/0S,  T BP f !P 000  R     0    0(KPM 4 00 4 0  0QP4400 k$P P52[00000@S00  010 4 S  $ 3/0 0 z 0 0sO 0 A0 000/ 0-@LP 0 S   0"P"0 0-@LTP @T 0 .p0i0 -LM 0 @K 0$00 0 0 <h h0 0QT00S 3/ $㳞; L -LM`PpK00 $0 00K(0 ,@ @ (K P `~ PK -L M0SPH 0  R} p`@p* 0AT B,B R   T1 1>  h  0`0`S@`0 T0`@p`@pT  T 1+#,03/P0`0`S@`00(K`@0pT S M0Pf  T1 ! PX\00     00PpZ  ` hR@h ,Pn0{X6  h Z 00PN 00S *T  000|P=v T2*  0 d0 0hT R,8/P!00 ` 0X:P 0 0c 0 0,03/P:ʼ 0@  (K 0 R 0 M0 -L` PU @0@e0TP0@TP ,0 3/Pʼ0@00D0S Kh/0 0-PPL0 `0 @a0 0@0, Pn @n06 -L4MD  @0>R@0 <0 80 40 00 @T00 13"000 , KDKP,Kf0085   @-0L4M@>RD 0 @0 <0 80 40 2K1, ", , KDKP,K?00 0-L@ߜK0hޜR 0\/ R/ 0  0-0L0@S 0  R) 0    0"   0000c00w"0 P @P X 0 0 $0 ;03  -PLM@`ppP  K⃜P04 :CoR  S  L K; 0K ; 0K (0S  2  -R2LPlM0 @0 C 00  0 0R(Kx K|K00T+ |P$ H"H2x 0Q0P p >PP0PP 10000\0 00S!pK @PIP@ F0B/S9276543(10/.-,+*('&%$#"!   0x0  |VP0fpt0K` `p0`0t0SP| 00ꃾ1 HLL, p-L M@0PWm00TamV Km0T1S OFm0T1S m0`m0U0T\1\X1P 4mKp0U\X10\PX1m0#mKp 0-@0PLmU0 \AQ\ X10CSX1 K0hmT1Om0K0hm`m00 000S/`-  0  -0PLP0l00TAhm0`T TAT@ lX1@0X1Wm0T0`X10- 0 000S/, 0 000S/Td, 0 000S/<, L L0 - L4M@DK00  0RK谽 , H ˚t,@ -L M@PQ4PKT0@K 0 00{p`  QXW QV V0"00(K V0 R0 0S  "00(K R0(K (K -80L4M @`0@`0K\* - 0-L@PP P \@00 -Lp@P`P }P FP  bT@0 "0@0} 0@00v  0 Q:// BQ:// -(A(@0 !0000L0Q9 `PV0PP  QĐ p(@P  " 0R` M@Vd@0@S 000 !B e!$Kk Pt( Dhtt 0-@PLP 8P0U0 =S0=S00 0-8@@@LPP0K0hI0s 0-LP@P (0 P0800r80 00-L@P0 P3#0r -1L M 000 @pT4 ^ `P vP0=SD @PT40SD  448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$0$ 0 R /@  -LL0L 0 -@L0P 6p`r@` //////ᰎ // -lqL,Mp`@VP T`KZ( f410@@0 (T` L KP0 4/(K"0S&  pS$ S0S S S0SVZWp00\d00X0 0 p`000$00lB4BlA\AHA AA// -LT0P DS4  - L4` 0-@L@@ 0h@ -LΟM `Q 0 0 n00 00K0 =00 =00 =00 =00 0%SSpp4S @0P 0  0DZSb[K\ "$L4V)uP0 0 p0R ,K,K[0 SR* p,KS0 R@ Ԁ LKp p 0}00  g vQ P@PLK@PpԀ00  A 0Ac RWh  `X^ a0  V 0305L`2\ʼ0Wv Vp5`2 ^ay V035 B`2RP: V 502 5`2P*0a V 3 50C`2SP0 p0R QP[ 0 0l0QQ0 0 L 0Llc 0 R  `uP,   00  R0,K0&0SN K0 0 0S[E0 00Kjh0 P@ V035L`2\ʇ0pG   000 D 00W S[ţP\@ 00X0 @ P@ W@ p@ +p@lT P @P P@ ,0K  c ppp 000 0Sv00 0S[o 00K@P@ V00D@00D SN[@ I@ *T 00D S00 @ @! 00D S?0 6 W U Q@O 0 +[ \@  0pS$ R 0 0P- cRp ` P@  0Rp00 0[Sp Px@ 0x@p0 ".!  c cT_ ,0K@c ` 0   V 05 `2 V* Z0pp@ƅ ``0 R,K0 ,K r0,K0S-p[ţ-p ,?  Pp K K p RQ[7 p   U  Qp0p QP[w 00K V00   F  0 Q(K 0 Z< 0pP K Kp 0[SQ pS` \ pp R K K[ RQ p 7 p0pS00 $Q[ 00K k0@00 h X 0-@+ 0*0p Ppx@0 p 0 `-@+ Rp 0kp @100@  pP KFp pWp `c0pP Kp pG Qp0Qp [b K000Sp [bW@0?0 00 T 0 1< Hгijt t0  -pL`0@TZ tXP 0@DS 8/tXP`pW 0 - 0LS S S 0R o 0R0 8`o -L@`pU0@@@P !(0( 0ŎDP @ -(AL$MM@P X 0 .0p)X40 0Rp0(KBnK]K `F PE  0`FPE0  P0L!P  t t0 P⃎P+ v[0  40K\4 o[\454Kꂫ, H@S -0LS0 S,QU) Y&p@` V@ 0`S00 P R \ \\0S P PU ^ 0\1S30\@ T0Ȝ 0@8\ -L 1BM M0PD4 4%TX%X0UC~K@ 8 <$ PE00 @`pG'PU%:0 00lP@ V:MmJm84<$ @YP@]PD40 0R(K٪t H -hLdBMMpP @@ %TXT`8$ <4 %X0 9 0Q6:0x0(S4 84 4"48#U @40 0R.(KUPE' CKH@ V:ll<4 084 @ lP PU:L0 00OlP840x0(SxH H -LϟoM M ϟ & & 6 0 , @T0  !R  R `  ?D@ X@00& A @ 0 & y n R R3 w 00 @0Tu PPP0SAC 0Sʰ00 9 Sc 0SX. @ & L.  ' & & < & Tl$>܆06 >06 v?6 06 06 60S71S4 &3t6 0S3 S006 -K1 B& &02-K& g.K B& g.K B& 1ATY fv*Pp0&4/P񏐡KE;&n R  & R g00 屆VZ 0 P 6 @06 T606 606 0& S& 6SE6Sa <00x60 0R:(KPUV A06S60c&S6& 7  FPP PPP60s 6 0;G jT6 S6 P K? 0Ae^K PE=K@E 0C6 0Cp6 =K`0C `3ʟ   :0 7 c>K 0C6 0C6 f !:fnK0 `F6 2b^K& PE0FPE 0P0 p pP~ W6 0R0 `1  L:P XP0QY0   B@06 W66 6CP0&L6l& l)?B9cϠ<"@00SP 00S ,$6t6 0S06 䁙 pXpG BNK @D@D 0 bK LL0W 6 )@Pf Pu`  } 2P&v01@@00W0`& @P䁙X CNK@D ]6 ‰6vp160GAT 6CBNK @D0 @D00t l7P'0&H X.  6 6P `1 I 47 P XP08QS   0 DP0`1 , 6 PXP060 06C-c>K 0CBK0C Hf H`uP@ Q P8 ` VP5 R P* p 0 D6 P 0S   &5`@X@" 0&Y0   ?1 0106 f{@f0Sz 006 4@ X006 0 bK LL0W 6 T !{&P 0 _  <4 X00& & 0 3 @XI (06 06 00 6S<06  60000 AQR G D 0@ 6 nF R=00 d ^`1Su 0 ḂP0 S6 6 6& 6 m1Sj &36 60Sx S006 ,2cnK06 2`F06 206 06 P1n %6 ڃPG0&0xP1016eNK @DPD ,i]K PE &c>K 0CpC6 6 $60Pw 8#86 06  DP0TP `("(R D0D:  P0@6   6TN6SK 06 H @CXЕx(@@؉6 hYp[0^&0 D6 P0TP `("(R D0D ́Pʮ06  I y06 &R  i("(R  0T `("(R D  R,#夁Pʠ6 0R 0`1 f `1 0XP0gY0   X=U6 Wp 1 0X0Q & xv C`!!,! R? `!  2&@x&X0Y  2=0&R  ATE g^K*`PE&tP04/P񏐚74`V A !0+0CSk 3g  3@ X0066 D3 X@`0Y0   K 0C0C @80.,0K TJe껢X H0@  -L@P`P Kh; -LßCMM` p84 0 @ PPd@T 0.TP@TW@S5.@D2Oo1B1U d! U 1 #R 0084 0 0MPZ @40 0R(K0L$ H4 @$@9 @L6 D DR1 @DD c0V6c 3c 4"40(",4f0$K  #c  c ,, ( ,({{ -L@`Pp帐ἀ@0 dQ WS! bPb@ wg Gbfr,Tz`8 8`#0MSZ0PЍ/ -LM0P4 8 dt嘄嘔$0 @`p 0 S-0 S S  P%  yP2 sPV  mP40[ !,0  SR 0  SRS(K2d1P00d10d dx2P000 D 02P  +P  $P"0:0060 |2P000 b8  \000xUgl P T P090090 P  P010q090m P020c  0P<0 40SX @?P01?0# @0 40^O4 @00< ["D4 0P<0 40S9 @?P01?0# @0 40?O4 @00< [(#% P @ ~P010  tP010 zz0zFzyxxFEDxYP`0pS ` 1SP C ?Y00U0S@ P; -cML0 M X6 ;0@T6 000 `0Tp; U^K`  .,?d!0  d!5 . 0`1111a00 O5KP@ 0ʟ ? O0P6 d10d1 x Pg `@ M`0SD@_H ~ \ S R#3J* S RD* S S00 Q@ 0SL 00< 090ༀ0P6 5 06 06 B>K 0C46 C>K6 ^>K 0C6 K 0CόqxŸD @P%`0 xqx|sA v   f uw`0S= L&R&`0`SH DH@ ` .S`0SPPU00V0S .ϛ`FV00U0S  007fP !   #  X `X $9vP W0S$S$  $0x uP 0 x x 00S    R t 8Pd0<P:@00D0 l$s 0  ^0PPy@0`@Pt0PPp0 /0S0 P000@P ^ό000@P|! /:P' @0P0D0 T10 PD18 0 41< 0 $uF0' 0 U0P08<P@00D0 ܈ ,xVP$lU|Ud |tD$t`T@(pV0U|4$SRQ MLx`LP -P@PLP  Q" 0P p `pq^0`0L0@ @0  $  ,} x -@p@`pVLPP 0U1 PE1PS8 0 0 0! $ 00 L| Q-L`pAPPQU0?@P 0 p``PPpP(P,P0kN -`L@P!P U0N  P 0 000P   HEHNhN 0-L@dK0h0/ 00$/00,/0 00/ z ,0 00/z 00/@ 00$/00,/000/t000/` -`L`PU @P pdq7@1S<0< 0 ($,@x /LL -D0ML 0 0($  Wt Kx  L 0-L@0`00K0h 0-@LQ 00 2 20% 0 -HsLMPp@ 0p T 00  0 0 0 0 0  0K- 嵵PP 0` 2+ "Z &= " 28 0 000 QP]  Y 00@ἹZ lP@(K <R 2" 2: 2KimP%K0? 2< 21!1!0 01! x10 0P 0 R00 0  T 0 2 13/p~0S 2: 2~P 2 @0 2 001Qc00`@l000-00PP ` 02 2ZPw  5` -L M@`pQP 000ESR7PNM$:JB"P?o2R0S  EPH ($P(0 p7 2 PL 0  K 2 + R0 2 , 0 K0PU "U00(0 $P"PU00(0 $PPU 0  K13/p013/P0"U00R0S  F0 -LM@`pQP 600U30PU/ 2U 2 0 K13/PE `P 0 p 2 P  0 K0K 0m 0 0 -LMB1`S7:Qr,P W(@ %*,K@T 彬pT   0\ P $K0 Q pPXBQ$KpX 2< 2$KP BPA -LMr0W40K2P8 b<0 5;*ȡ̑I 0@rp@ V Y!1 cP 0* ́! 0bS00 4 80S 2< 2(K0 l< 0 4 P 80pS(K04 K P (K -LM"1pS8:b, V( B R#*T%*H,KRU  R00U00SR S0  PV U`"B$K 2< 2$K$K10P "1! -L MrW Rb,*PA24K2*U4 "0S 0 0R S@`0 0 l PY Up 2< 2(K`@(K(K -pഁL0@`P< a1Ƞh,ȠV0hF1&h0 ^ Q`0 A    c'"(R B ^!( S2A0C2Up - LPjP ` @P  g -P`LQ@ W00T T(0 2S $AP$00C$0@000Q 2Q@AP 2@:0 2@ -L4M@`PQ 00 Vz 2+ R (K 6 0 00?0+ "0@0  P0KD0 $-/0L`KDpK4 00  08/P:p `h&hD Kᐼp D 8 8 K4 @ < @pK`0 ᕵP202܁> H -LM@pPQ` ˿00 2   R ]1QƼ0" c!24 00 00 40 VE SBAU>=C;0PU6 U 2 X \* 2<,0 (0 C,KPR U0  2 U04 KEP0VP V$P  0 0 K 0  K0PU U0(0 $P0PUP`P,  ( c13/p0 KQ0P "! 1i, -qL$M@`TP  ppd/0S@P0: S ^P v0S 4Kh2 pW :+@[0 T@@ 倖4 K0 AcP00CS0Q@0 @x` Pp 00CS0P?0 @Y@DOoB K'H,&\kJS+& -LA00K0SS( -LM@`P 0S.PP$0K( K/DuP$(/Qp$ X0P$0 ( K 0K4uPL$0 P0#($0 ( K 0K'uP$0 0$0 (0$0 00KS(U( -0L 㑆.( -LMP@^pP0 x# --LM  VbRb. K 0-L@ZHZzZp0pp0[H''' -LM K+ @ K+d @K K+ A @  K+< @ K @P K K A @ K蝷 -Lq k`_  -L MpP~@P$`K@&0P pP ~PL  x4P$KG K80 S-L S S Sx!( (0(  -L0< ݳd0P( (0(  -0L( Zͳ됉̋8 80 $0Q/$$0S/H - H<<0 0R/( 0S/ - \ -@LTp` 0S /[\PP@Q P0 $Kk/P0 `$TH,& -BLM`Pm aq!6p@ lP* bP BP1 F(eP0 fP& 0tP nP0 sP0uP vP000000 00,40000 `7~ `40@0Q,4S 0"K#K02K4 K0 1KYp p0R R  R R R0S 9$咛PKh1&JL.+&H,&%&o -LM@`llppt`@ P00T#T33p= fP( LP P HP:pPRP XP PP1pPuPrPhP oP%w0@S! p2@00 0!C!-\ P R0C0L20X XTZ Y \UPPWPPxYu PTq !p l `P  KYp0`0  B@  JpPPxM Y@PD % B R&4qqqPqqptqqqtqqqqZ ᥱ$ P_P h $ P_ `Y V  X ,l 8/0 #PP drDP0S H$]P4JD%L.%&0 -YLyM@`vk_)圉圙圩0p0000)5pC aP01 NP' HP LP>000#PP RP60lP% fP )  iP+00 rP vP pP"00000(0000000000(((0x80@cT2 dT80S 0SH 0S0S0S Q001 0S 0S101 0S1001 0!S ! 2@DW7W7W7' 1  P tM1P/X  1!08001~0S }K-X  S/R C C10S}KXp$0S & T|F0Sy 2WKXp2!|T1: Sz 02 2/XS D&H҂1: SY02 @IPU ZP0@ /Q  έ0P2 '2S@P5K0S WpX : S  S  S  ᤥP 5 QP (% ,]嵮@P 50CSwvwvvwvvw$ PE^ u 1`00 a00 S\ ”eL0 S2S, />dPh dP,0 0j2 0/S 0V/S/00`2i  Y̓ !%":*"B2#0020#Sz S/Rwx C CWwX K QP! KQP  <`oX00: S 嚯0: S 0: S  YxR Sf SX1U L0SP !nN0eS P20S V 9 iCVp2 P 1X2X"X)Q VP*0: S9 0!0Vx10S !00C0S! 1!FP 廯P X0T V P0S !f0S !>Py0S 0めXZT 0S X00S~L00Sz2WKVy0S0S~ 0}E'JE'E'E'E'E'E'E'E'E'E'%&%ZE'E'd% l%ymm%&L5& 6? -LMP@h\&k2p$6v@F$PPp6($08p 8p$UP($ 80Fḧ,6 80 R 0Ff$P0(058p$0!0 5%8pTP( 80 0%$3/ 00 0((0tS$ р뷧Tu} h50S 0@P6,5Ѐ QPP P 0000#0 W#0 0; S 040#! (081/0xtpWphUd\T4"Ppp p Z8080 CS s p4 #K0 4Ѐ   0KQP W  80 $0(3/4? 0 0! P0$ $ h $$@2 0 80 (!1/0 $@0   "!ŸSR ! 0  ! 0  0!  0   0 ~ !  RQ)0 00103/f1!0S]!S`!Si0 QSR* b_! P 0@ p0`  O!`Vp ` 0 㺦(PU x08003/p0S80(03/pXJ %&pE'{p%%8F'E'oF'QF'l$p$xF'!F'F'F'L@tE'iv -KLKM`pf[䊟*0Zpv iP/ aP GP0! PPd$0gP hP^000mP kP lPS00nP tP K0 0001000;00 0006000SPU 0S~nS0oSP0 00,wP PX2 0P,1 ww1PPQ0x  FZX0S $0S 0S $0S 8 0S8BKCw`hAP~1SBK}?|xP @Dd P3 K.TP.P&0: S%P vP0S1   '``,P7 >APKN@`ZN`@UP U0W 0$1 0 1 1Zg 1q@`0KS 0 00TY!MYx#FY|0 AY%;Y(00S(0B0S,0 S  S$\6PX&5054864600 040 0S6000>w05$0S ,0xxG'(UME 'ZkYk/DK -KP 0X/S ,0K0/ `$CpPU' ϼ@0/S P@/ @P  弼0 S: L~p ᱬCK PpZRM'J2%&6 -LDMP@`8$84 dKaNP%KdK&KMdKWNP%KdK&KMdKMNP%KdK&KMdKCNP%KdK&KM3C  l3TK0xPKT3< KTKT0 @~P< KTK:~P <P< K1~P"Y<0S < KTK#~P < K~P<0S < KTK~P < K ~P<0S < KTK~P < K}P<0S @< KTK T@ }P< K}P< KTK}PP tLaPM!1T-p x即@PpA d1R@һPPd 0p/S P`(1qPG0U  ᡸ 000/008㈰00CS\d00S xC0sT0  >P00 KH,&|'Ax'8'PhI/%id'''X'dd' -LP`_S@ )p LP PP@T00U wTPwxP 7PJ%& -LGLM`PX_0bSP PP ' (p) fP0 RP PP( 0WP dP"0rP iP  vP xP0000 0$000 `6`jV0S_@ӯ qP`V. o@`P/:P`.Q/Q00@Q .QQ U`   Q`P 1S<  85R`  R 0P?o20S$0 S0S@"P `p /PP 50C SKꈦئئХئĦئئ 0S! $0S$ @RT 0v0S $ ?RR00R0SX5S+ S, S5& $ R #0SX  #P  Ia!SR0SX  P rKJP 0S 0S 0S1LPdP0S 0S} }0?Sy y0Stt0S }v SKK$0P S`20 !0SH600PUkT0S P0?S L0SS R  0: S R00  S/o" R0: S kJ KP  SJ 0SKP KP0S600 0S 0?S 0S 000X0S r3O ls600 0S0S 0 0_(K'Jq%&h{ -LP@x]Qp  'p pPp 0 U10CP@zJP16PPW` /P 0S 0S0]JP 60PNJ%& p-LKM@ D J8 J < I3P ,Q屰30GK41 PP `30S S S K83 03 ,3 041 3 3 20S 41S 260S 20S W20S K12 20S B00CS00 UL 0 `5L~41S$D2G/K J2 2 yW K0@D51n0S, @10S 0-S 041 /041 /41S041 t16 R !41S n/M0S 041 l1 (1@T. #J81S 8xI<IOJ<1SXI@pJTUI@JTP0P 0S 041 /00S@0P  P`@HTB000S000S (0)K'J3%'`(d((''''ܥ%%'33(3 -8LMP \ *P3@@ @0S+`qY!"%p a@P괰x@b_HP xEt@@D2\ 010 0K IP80K8P+t0Kd IP40K$ IP4T *00S 0KKK@0l d8^0K8.\a0`0 d0 0Q6 KK]P-KK[P(KKB^P#0@0 000K8P @00 ᓳP \0d0 Pa000 d0S 0K8 yP|`0S 0Kd dVIPT04L%&J %&JJL.Bt @JJht@Jt@J0&JGJgtJ -L>[GL -(dLMp2[~`000USPh4\ x6QQ00SP& pqvpY pW pW!\Q008&S00111S fon!R UUU00%;dpP%&1hS KAFP4: S011PEU$h``V01Ic9Vf([$5$%0 5P0BK @KBK @a#pPBK A1@P oE$wlt4 mᮇT`M.KNK0 BAd d d 4 DPP׸0#S MK AD@\1}㓘%MK ADcEE_EtE DB>K 0CP@NK @*4S #;ppPMLNK@V0`?o2? MK AD4SCBKd @&L@PBK A18f/8bDX f@PBK @F\K彨0异0CS0o@0 @ Pp 00CS0d^0 @NTgBK @EmVe0S1* 0S1* jV11e1PQS1S _|! kD1  mtt`Pd=VxKP 4plbP +00V,4 yB.K B0eP p`FVlP@=pP  f/n 圷T  [7`Pe&I( (\]P\\\L.*(\H\%&\#]*(0%*(5](+&B]\I]֍7P]+&mdg\Z( p-PL Mʗm 0P `@ @ QJ$K$P Fqh`00CS`0X KX0 X @T@0qKp.(k+& -PL\M@p`0hP dP `P \P XP pP %t0 t0p lP aP$P Q @R"dPpP nP p rP tP0p0 `$@hTlVV!Yt qrVdV 8x0 OCx0P$$$YdV0 RV SV QV0X0 pV\ rV. lVT p  q hKh K Dp  hKծh Kx Dpho TKȮPT K Dp@( TK♶ TK⸮U  T0K౮T@D`PtpP nPT4@ 0` T K qDpMPK` # `   Dl0K0" `V hJ lP0 [J nl0Px0 S T`+}p0S@II= xd1P% \1P* PP) 0YS pp `Vt01,pK|0 ('6g XxP0   IxGl+n(KzrL.%&r0~DrDr{Drr|D(rrrrs}Ds#s0sCsVssz(yaratcidsH,& -.ԎN_0LeM22222222220  1 1 1 |.7pV bP !EPI 2PA 0P< 1P0;3P; AP SPM FP0F IP2TP aP02sPS iP< cP fP02lP5 rP=0dvP: tPb uP02wPX zPb 0000` KbJ1000? < T,20202\l@0 H@T,202~`0/2fpP000pS Kqp& 01 Wh /e`P000`S Kpp 01 VU /eP000SL Kpp01 E02_?K0;00C tP |10S hm2 S;2)L+_?K 0 B<tP : |10S:|"QQ"p/ejP WKBPT1: S00 `P C/eP0 xx NezPTl@`P8 T-V|KnBp %KcK *0R0 1 S *@1P  3-9)1!4)S  @1 )?0?0202`9@1PPd\"8R]2Sj"8Rl2|iSpUsʠ1X10ox2S "x8R~"R{"RxBTu2Sx0 8_P8 pM0Sh{dX02X}lpT<!02Of P 0SE 0l0qlP"R"R"R"R2S 72S "R 2St0s`boBT00 00 @@>K Kep `pP{ @@>K KeppqWK{APpT1: S02j ?p 6Z,P lPdB f/lCD52S* K fApD4 %K<`p L %Kfp`p$ <n247207<(72,7% =Ap,5% 4Ap, ?0 03(uT,4ǘ0<'Le?Q0 Fˆ…cK nc?K  P T$y?Dp`+ ?  00@ Td#foP r$o`F$Vo2CSX 222222|C|2S o?0PQ0&  PR<3"R"$3R "R 3s"R ! wR2SBT r"2R;" 82S56D"?2@SP  j",2 R" R2?S B0? 2"<t1 xA W1PB`>K0]/K>K^KmP`V&`1p!p0b`1 0K0Z/KY?K[KpmP/d1`th c ( Pc?Kx11 l1C!@T!P0000 00S cK 0ႀ0cK 0{p@ pW"2"1|S !14!8!% \(U{Ɉ߈>+&bT4(J%olj؉4(>`[(ъ[( .R(2( `   $ ( , 0bC20P PT  mpD*D1  1 SR \  R\!R!RS r/q?080s/ 8!R00\00| u?v_0 (X02SrD2 H20SPkR2SnphoPi `pP"0`Pn"0 `Pn"0?PnpoP @ꨒ`R㆏P &Dx0s5DD_DH#dDmPX XϬPhĀ Rt 0R0 ) ER00  KPĠ` 00 0SUVP-DV 0  u0s "R2SPpP4Hx2Sl4zl2SIoP D`p0 0?`m5oP Z C1Z011%01101101 2׃<ѣ< 2׺2SD9(52S w8SL59S |*oP ?r=r :rPڬ4rPڼwo52S[`ᔑ!pPN6< pXp>K0]/K>K^K/kP x1 St!#!p!!#`!S-X6 W+"rBR"(K -tEML-0Mdu9K`5P`YKP@P0<%p nP, dP! PP/ TP1 ~fP lPy4OtPC pP qPu lxPd yPp vPf$00Z$00V000bl$0 0\$000YH$00<40S : `P 00 Y ) )P?  ,0S gS0S9  RnR#oQ09 0 0 0' Kh@ҜP X#XyPw0u34#4{yota(3( $"C@ K'K Awa0002  20`V'Ki pJ2"z@K  @/S/P bPBKl2l" @/BBK Ic`Pb`Y/o" R b @`V K  @S@P.K B `aPJ \PE WP@  0U9U;pP ;gt!t<P_;`Q& X<p H S;ᱪ(0P`CQ , K2/SR  g0!TPU0 gry00  w9Wp0S9 j(Ka(a(a(H\(L.{a(%UJa(a(H,&%&›+lxțP\(zd@](edA>g -q؁L MP@`! p% pP fP nP PPxP yP qP(0000 \1 00000000!0(1`V 10S 10S `00PUA{P 0 R pPUJ䡉V 00K P`&0| :{Wp(Kk(k(k(L.%&$ $4-L,MP<K ;P#K<K#K:1:TtT$000H$H4HH@`@@@H L0 ,$ mp0 cSO US FSY PSv BS%aS 5XS nSd fSL mSM dS#iqSd pS}#bxSe ySwx#000 h3Z0L  0TP0 P0P<3H 00P\ 300 0 b3%00 0嵡P2՜200000 塡2>0S  e|@~8"000 2 X2  sL"H"00 k`iV00S 10S 10S10ZQ _@T@@`h10S1  ؝P ӝ410S ̝xɝpZ00SE?^P<V00S @0K 0P%@H0 + H0Wpe9  Wp ᅾPJ0P(Kq(s(s(s(s(s(L.r(r(s($s(H\ r(q(0:%Uhk(8q(s(%& -LM`@p` L^ PT@Da) 0-K P.K.K02 KL&00PSPK"pM qP mP nP TP sP vPPPPK p2K P::p(K-K DL0 QP K0 S Kr0X K pI0Su0S L1 R V0aS !1Q0S  ' 0 m0P 0 KPK0-S -K!00.K ;PP  @P\ 2d0 3/p U (KL.%&T1ȩ% 0-@LK0hv( -@p(`L0P,8`@PDH@84Khw(%lX -L@M -pKHC 冫8 K₫6F`8P`D^ 0  R 0,K@ ѯK3!?! 0SFUp PpchIpH@ T @5U@5W@5@50X3 x%p0 dS) NS, AS CSj ]aS| bS WSWAuS# `lS sS hSL `wS zS4`g B岿000 04`^4 `Z0 04`5>K┤Pe!00 0 `P3SI P5>K5 DK@@ <@ 8@ 4@ 0@ DP f DKfU5S5Q5 0X0  ,0K4 #@@d K\K\P [pPPUPh0PP 0/(KV)n) ()?)nI))֍))0B%HAAL@`@0}( -6fLMPp @P 0 t&'pl lPe RPd gP FPrP uP8 mP-0W&0P0 5 ! @0#S :PP K""00SP K"00SP p5x `IPL5X 0#S K0oP K!0 0S K!0 0S 4 00 4Z0 ca) T0S@p@0WP hP`k;q Pf;q @a; ;p @P 0SpBWG  4 4030P cQ pQ bQJJ BR 00 00 TxJW00 a \`0S00W0 B0 0 00 0K 0K00S 0WS(00 20S 2 0S! 0 P0 0! 0 Q0s0  T2000@% 08 !W`p- , K00"K03/ Rp` Y`p]  G@D40S 3PB R00C?o20S T _Y *4 0X4K4P0S)KSR 00 0 #  R' S 3 50S 3 0.4Pqu  3pl 3`p(KFL.H+++2+%&8}(T+h+x++0&+++ -鼆@'ML MPp I & jp@ oP" aP AP pdP fPGuP& rP tP vP wP@p5  50S K@Y ^eH%0005`19 9fPg P POWPF IZ`PA p@ףP 0ңP ͣP YP [PpὣPP  W Kp KHJP.K00 00*0 00900  PP' K @WPP  pVvPP PpG00.>Z^-K B00^-K0p>^-K B0^-K0 B0]-K< BLNLn0]-K0 B0 *p B@4P񟗾$<<<@\<<<<<x<<<<$<<<P<<<<<<T<D<<<L0<<@]-K0< B, ᭡P =  ᦡP w = < < r 00 0 0 @ =00(0 0,4 =0@ D B0 P^=K0C0r04JP0L$`rAP n`J0 2 ?V=K,0C `p`2 R0L:K,0C4SS V=K,0C p2 QP* Y]=K00C0pp 02(b? ,!0op   ~Y^=K0C0 KAarpؘh s]-K0 B0P0i@ o((JJwJJL.X(H(\H,&J((VPK %QHQ_QQzf0&5KQFKARdRcK(l(%4Y tKKQKKlMKKL%&=LjL|LLL(LLLM›M|H(%MK0CK^QKKA@pP4.K BXWK(AP KZ AK⣗PxKP ]K Ayp  T:K,0C4   3.K B0W W0 :-Z*ML M @*mK* * * : )p ZP NP\ FP IP= DP=SP0[ VPl OP0 0 p 0 -`9mP fP0c iPm bP0*0 0+-9sPv vP nP00!0 0 x-8W0: >K 0CC ("80Q "( |0CQ h8 :0s$8  0(0 40,I-$80@ 7  W0 0 0 6-:0*0 0++-7c0!0 0 -7W00c 0 t0 -47J 1 L`1 -87>0& 40S840: 17P:e0s6  X j-) K~K  @pGt pYAlf# l6 R, 0Sh6p R0`&*p  L )K AK,p 4 0S:U; J0P: %)K A1,p 0S; *P * K@ O`P  Z 3PPZ `VJJ K>PH: %P:Pr04jP0$4aP N@J >Kp 0C \E4pP$ h$0St:S00V$9[S K @*0#t :S d4P T4#PVC:S 3 0pS`V0)=K 0C0 3 0a>K 0C `p` R0$9[S >K 0C QP*@U00 :  2 0# ;lp24   U*00> KA npؘG ˬPP UH2 br':0S 00K ? A V0>K 0C*V0  )p<U`VxQ4S4S4|1` V0; V0:4$1R$$`0S$1Ѐ R 0 ẘ0$p0, ᰘPٙX0QљX0%QPP '. l):* R00S c)s.()L.g\V(HQcK$)ܸ%\,)P )K zfAR8)dRlM0)E\%&LLLLM›M[%M4 m20(2PL0:L0L  A⸓0)30(38 v, Y 0`S 8000S8L000 V04)SV`p^ T2#b 0 a 0 Ka K"3R+ 0 K>XP% ' f0h"h2`p3XP20S L0 |3T' T0`p 0XP`p 0 KXPlK.B N` 1``p 0 XPZA` p*0 0` 0`p KWPlK 0WP 2<3 $0 帉K3%p 0*eeefL.e%&*e`RMb@Ae f*fHfdf}ff* p*fЙ*f{Gz??fg4geAPgvgJ\*g0&g.hMhԙ*)*d*Zh{hhhЏ*h,%it8~A-C6?$@(**$i@@?iDiH,&*Mi***0*riiii%p)"je/Xjtjjjjjk k9kSkikkkkkkk ll*l8l]llllll ml+mGmkmummmmmmmm,*mmnn+&g|)"h? 1 *`n_ K$@0T ( 0S$ #1p,0K |`Kt #`00+<%pP l0S  1%;0 00!  W L0 0x& m+!b 1@S0 3R2T C8#<4 8#RT2oLR?L!L040L040 20S;    K⠐/K.?   K␐K⿗K(.,` 0 K}_+K_ 0Ft_FTc K VP+K ! KVP3 K 0+K 4"48#8)*P0320022P30C24 8# 0 4W x & ԋK4"$00(0"(0 C38#0 $0gS (S;L 0;;  L   0;**0S`"p`4't4x!'x008#C8SL0 0G 8(#8"(H*L0 \0h5qL0Vx% kK4"$0`0(0"(0 2`̅0ZQL0NPp gfqPE Y0 5RpVx~% ԋK4"$00(0"(0 2xf0 a0P D*pp0X:*7*`0CSEFF,I,IDGGGG(HPHtHHHHI0 G2P Q4EFFFF4FK 0C BK @:pT BK A.BK @FM 0 $77; 0S 8#v X++q`*rL.\+Mqeq+q8%qwqqq+0r%&'H,&h+pND%|)P+0-+&Zrurr/rrr;( -PLLMPp PH唎P W0O0o0/p5 fP SP# LP >(TP! dP >!sP nP qP >tP vP >00 >  >00 t>p> d>\>PhAD> R 8L"$>>0S,IaV=0SYUP P P)P /P  P`=0S kS0X0 `H D h @ d < ` 8 4 h d0RV``S00Z`0SY P Q0 \1`0 ` < p0 gR d<h<kd0 l0 H0K0h0 EX/p0-SpT @03Rl`bb`b,aab a`bT`a,`,```_b`b<`H`bba|a\a4`a|``a\`aa_aba`bbbbb`t`d`bb`4;"  ;   ;  ; *Rk : :*H``jjiihllkU H0K  U| H0K Ut H0K Ul H0K Ud H0KX KZS0l0 UX H0K MS)000UK h'PyUC #StI! ShI S\I SLI&S@I %S0I@ (S I *SI  T@K)ȟ00080S0S  ? 0S8   o380H0KX KRlp %H0KX KRdp 70S4(44 @P 70S (  7'H0K R @P70 `  aR `70SX70 S eGSZ7d T#  T] g0 000 0d^ A PW @ 2bPOI$0S1 aF ,Kp<}8K0 QPm/*W@T c*,0 #   0 "$0$P bb@ڄP ՄP >;Pp`̲` ,L.%&:ӲH,&Z6IYOp -LP@` p RP fP `0' `L0 U10C@PeP 6fPPܵ4,%& -MGMLM  n#4['-00- -0z-}P=0=@@=@=@=@=@|=@00p-00h-0d-`-0X-0T-P-PH-H 0D-P@-0<-P8-04-00-0,-0(-0$-\z`P  ~P:? 04< Hz<P, Az@P& +PH<   #P$< <P<   hP+00+0< /84@P; ; փP;   z;P 0S+; LK0S ;0PU P yP@ 峃OoB;p ]yp+p;h;p  SyP :PTP)P:P0FK4 P`}KHK+8 G~ P :?@> 0j>l:  p 40JDS <       ܋ H               Ԋ           \  h     `Ȋd  s(00( h9 d)000X)00L9 d8 \8 T899\8 P(8 8 88 7G>K 0C C8 P8Pڈ40Sj l8 G>K 0C CP8 =l8Pڈ40SW 8L = t78PL $8 }7dt @  K @rP 0S76 @T otp- %04 6 D7ʦ`00\&0x&0GTH7P <յ8707?Q(ct 7[l 0 D6$@ a$ 4p14 6U@6@6p6  K  @5-K0 BH4 p6Dt Lt f0P S'~0 40&0F0,00dx0P 0S \5PV@P @P U0S P 0S EB5LD0S5Q +|lUP X5?@ LC3 +4J6P50S4 txCP| 46 x ˕x tĕw t录w t嶕w ᰕtwp$l媕hwd$`夕\w TDP坕ㄙ,D〙}z w4S|ژ4S  @20Sc'u4:5P 4P偄@P[`!@PTGL D4@PBnK4 `FP@@@P6+|4td pT 0Lal4 0h4 T!GK0Ap002T0p0C?o20Sq R jd20S T20S 1 80410}c4S! 뗖(Kh!-JI-/c-|5-d-t!-l!--H--t5-l-$J-- J-I-J-I-T[-L[-c-H[-8[-`-I-0[-d[--<[-c-I-!Z=@[- F+&+&`[-l[-L.K(J-I-T-p!-OH,&E-w\- -U&Uh[-J-P.%&-X[-c-I-c-2X-h-PHz(^]0hTgr~tټz."7 @  ,Z- X I-L- -LM@P!# 5555)5sP5  ԰TkvP`u S0P9P vP000 l%p0@ 0&`<受450`cVAT 5 000P~P B,z0 R0$4  4$00K0@KtsqsnsksPl:p` XCT3vP4PTPL$ @寵<4 @R P  :띨 P0SP3 30S C  P PCu`sP 0dC<0 00>00 `000!00000000ӳr2"Q2p_ P\ hB18 /bR`00CS0|bQ @<0 0\ R  0010KlVcoQ! ̴P1K Q.S S=?o20 S% S/ 1 [\׳=S` 1 0 010010K<1 1K{18 1[ꬵL: S0 1Kj18`兾00CS0P @ 0 0S001Kho-@p- o-tp-yo-o-o-bv%&0&p-pp-Hf {+&p-,% %U xp-o-p-p-Dp-K 0C0C6 倥K>K 0C0C6 6P0-S0S @p0S @ꆻ> y  y@P 000W0S 00S |d XpPϸp5: S   S0XS / `Pp奸v B^K PE+x|4 Y i  6 ~P 6  0S0S ^>K 0C C P pm00 0x 0S 0S 0S UK AqP0S-D P:  yC0S U>K 0C'P  gKK0C A QP 0 G S Pn pPl 0S%$aBK0x!00 @ P: B>Kb 0C x 0SBK- @J p`BK A德N`&ᆹQ 0S L p嫷 ÷W h&0S& 06 q-T%}|AITH,&%&I]P_~qq (b+& -0sc0L0@@P0$P 0S001||xsPt3  r XH`O{0S s/R|cP003#PP &T 0+0C 0S |@DP PP 0S Pd2  \XbP 0S @P 0S$20 2P R" 2`V `PET j@DPD`ᥐ0SvPPK~IPFy\10S P10S1Q4J1 @R1,|PHP5P NP0@QP  .PP#<-`- @-r-ء- 2-!d-B]\!8-!D-&!P 000 =P '00 $ 0 0 QQ PPPE P  d0<LP H>6 y-L.t-J Eh- l-+&UDyDDH,&%&\-o -L$MpP6ğ N{@x4/h4h0P@ 00H0 . P<4 00 @@T -R R -R i^eR^iR kR eRs`PD@ @@ <@ 8@ # p] eP+ QPL EP IPP -PVaP dP8 SPLnP kP' mP0 iPBrP1 sP2 pP;0P^U0S ?SPP0`^V0S ?S``0@^T0S ?S@@0<0 0D0 0@0 080 20 cYZ;졟q0葟0 1 4 K0 #[3[R S 0S0S  Rڴ3K04 Kt3K  ~H080S, ?WP ;꡹@0S `p@P x@&z 0P0 0 !JD0S  w<0S   |-G-4.0&N-%L.GGGG%&D.--ht@gt @bMJGtG[GG tGH,&GGG -0r@LTM`Pp@ " p gP uP GP0p0 0P0S@01p`gVʈU P lKpl l4Tx@  x p`V `4pKi0P 0S Y{4l0K r p!.p V lK+ p T xp U  p]4PU VK XoT@T 0P@3 8G4L.NH%&UHUgH/HHe @֍H $4- dLEM 4 " 8 4@#S33@3@3 3@3@<#C{0S P 0 s@ Nsx3x#xS4t#@4l0@00o0Q PKKLLpPh rPj,3 $K #84 pc fP2@\PX < CPA DPJ 2ECO,P\R  ؾP# :w  @ UP PZ@4# =R@@t Ws NQs=J1 C:1 pGJP ASS`RS0 @FY`1`PLIlP l01D?Tu kkk`F*gI~ 0S J0Q b0 (K. .0.b.(..T..$..H@-x .$.. H,&+L..c7$.TZX$.]. .8.l5 9 5 . <- -,LqM$ U@`0 8p@1 A $.p, fP# bP eP+101 pP zP lP! 1  0!0 ` 0  p00@,410hSyW PP P0 qKBP1: So?K& 00Y0S$ W  sK@P|  KK⩽pP KKKt tgP,s2ċT Ӛ@P ,V,(r 0 2 "QX00"p0K/K 2pJ/K B P  gP| sK5PlP` $\AY*I!('2P jy! )`P z0S   Py  ?`V )qP`0 K1 RRSQ#4 p! YQy0ST Ny (.(.L.i%&7!O(.(.+&(.ht@(.l( Eg]? -L]M0P00 0p`1 1 @vP vP  [OKN/y> @1 0㐮^后0 0 0 0 h0 r01 1 1 # 30=K0  @>,p\ VPM NPA 6PR ?PH 4PTP; =PP#3#kP' gP( jP fP=0@1 pP ʘ=!nP ! 10 qP〠 p=!xP 10! 1 4f<=)4 4=1 00 =1 00001 # 30 ň ،4݌0[OK c11 0!  ,a 0q 嚟PP# 30P`0 ɞP # 30 (,0G ScP@ 8=1S7 2 0GS0 fPP `0 ᝞;oob 0S 8d&`[KYY hT l&h@ t&pG #0 Q# Q(![K##)*#[K#0 0 @P#  00 6[?K#0(01X sPAxX000L ZYD: @*Y<:000:0*+ :*00+ #(#[K# 30 ; p 듊P  , @9 p # pt  #[K_ p4  W 1aK b P0 0P9 0P%P 80W + o1 @Q  Y0 l1[S Rs,0KAP6Y,!Oo0 =7B 0S` p``Y@Tf p$PQ Q- (00X70| 0s | 0s t2 $|`|VL @fw0S (@1SE Z1SS  qPEw0S ,Zx0=0@-S#*  `P p @ 0Q R P` 0Q p @T W000`\$00P00|lX p-T!LPAPPPM@  0KP #PP  , K$K$ &``p ,0SKp 0 `P000 0 `P000 0 `xPp000 d d0 `lPL00 0<V lt l8XTh -L M@Kf 0 K 4 - LMQ K 0K#Lp 0 S ,0 0   K@ r jhD /$/'/y*/*/*/&*/%*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/~*/c{*/x*/u*/9r*/o*/l*/i*/8f*/c*/`*/]*/Z*/ W*/T*/Q*/0N*/QK*/H*/)E*/{B*/|?*/#<*/9*/)6*/=3*/0*/-*/"**/'*/$*/!*/////*/*/<*/*/ */T */*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4W*/*/=*/*/d*/(*/e*/*/*/ */f*/*/*/*/2|*/Ky*/$  0q*/O +/jh*/Oe*/b*/h_*/i\*/Y*/vV*/S*/P*/M*Q/H*/E*/B*/ ?*/<*/pP/< /!2*//*/,*/)*/&*/I#*/ */*/1/ *//7*/>*/ */6 */*///*/@-@>r@*/ps_strings missing NULL Obj_Entry pointer in GOT Corrupt Obj_Entry pointer in GOT Dynamic linker version mismatch ~ ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosgptifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory H+@^@80J@@c0g$@@ms Q z@@hB@@unblock and -DNO_CONV?pLL@@4oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp file& no previous commandunexpected end-of-fileinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sInvalid type in GNU longlink %dFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... , ,,,,,,,,-"-E3-ZG-\-v--#- -_-^-F-<->-?--PATH= ftfu4d44sm1c54m44l 55 rnp5,1n 54 v(5 b   EOF reading here (<<) document=9E9I9M9R9W9[9_9c9h9m98ԏq9v9}9999999999999}-+?=0"9'9,931979r/2F39=83 @;;;;;;;@O2;2222;;abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'(0Y=\(1a=(1g=(8q=4(0=p(0=(0=H(0=(0== ! ( w#h$!f _,f$ 72?  l8>]N;>\ Sa!H]"<"o%O&;~1O               v/X`?Xn60e?0n?du?p{? V6(cH?DOa0?0H?ij?ij?9?:yt_oR_???Pn2YTes???w?#Z?\?Hz?PLH?8alias %s=alias: %s not found arithmetic: unexpected '%c' (%#x) in expressionarithmetic: ++ operator unsupportedarithmetic: -- operator unsupportedarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ')'expecting primaryexpecting ':'expecting end of expressiongetcwd() failed: %sOLDPWDHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumenterror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failedusing redirections: do Node type = %d do subshell done subshell Cannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)DoneSignal %d (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sYou have stopped jobs. ${LINENO${#LINENO${#${(($(...)"(...)>|>>>&<&<> && || ! | &if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT.profile/etc/profileENVOut of spacestunalloc p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: EOF in backquote substitutionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Illegal eof marker for << redirectionBad function nameBad for loop variable2nd "!" unexpected%d: Here document (<<%s) expected but not present-o promptcmds not set: thenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncdirectnosigpipecloexecEXITEXIT trap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PScPS1-xnpxefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range%s: bad number!=closing paren expectedargument expectedmissing ]unexpected operatoreqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreadonlyreturnshifttrapbgchdirletfcinputrcgetoptshashjobidfdflagssetvarumaskunaliasulimittestwordexpPPID20160401 BUILD:20240428101703Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'missing format character%s: invalid directiveprint failedFF w=FG =LHG GG GH  F  HhIcnF:&G&G&./&G%<%GT&"I&H('G'(H|%(G ( H)D)Q|(H&H% <(GP((rHvHzH~HH#H3H#H3H2H3H3H#IIII I@@IIIIcHbHeImI|IIuI+I :I@AI3IHI2NIkHUI\I $HC$#HC)HC$(HC0HHH:HCHHHIHHHHH@QH@H YH HHHH@II IHHHHIIIII I@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.i]z]]]]]]^%^2^P^l^^^Mg^__`@^@`@`@`@`@(`@-`@2`@9`@H_ @>`@D`@M`@U`@__\`a`g`n`v`|`_``````````@`@``````a a_aaa&a+a2a9aCaIa_OaVa^aeala__taF b$b)b֓1b6b MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown archgetlabelusesmbr() failed%s: not be or leAB:CDFIM:NRWef:ilmrtvwunknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbarm64evbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn26acorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] p+lmUsage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s successfully scanned %s. forceWedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:unhandled type %d QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMAND: %sdrvctl-errorget-properties: %sdrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': select neither dict nor array with '%s' m&BUkƋ G f   όߌ *=wōۍ +!?#?$;&?1?2C3?4?5_6?8j9p9w:;<Ȏ=@AB?CkDEFGHJӏLMNOP(Q:ROSiTrUzVW\aѐcېde8fLg_h_i_pfq?s?t?u|v?wxÑ .=Op̒3Qcz˓ۓ000Ppxaiʔݔ???? 5(L_l~Õ4<Tiז-Aa|͗??,1DYؗs??ט  ,O/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gb%s is not a valid %s number. %lld is not between %lld and %lld. cylrealloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]XXX@{aaaaaaaaFaa:aaaaΞaaaab bb˗breturning to single-user after filesystem check -ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %srqInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directorysize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for todo listNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check          @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledDIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkINTERNAL ERROR: expandfile() failed to allocate a new block bad filesize %llu to expandfileusage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-!.7`ja@c$6JX%%,%D%\%t%%%%ب%% %%$%@%X%x%Pv(@{aaaaaaaaFaa:aaaaΞaaaab bb˗bm&BUkƋ G f   όߌ *=wōۍ +!?#?$;&?1?2C3?4?5_6?8j9p9w:;<Ȏ=@AB?CkDEFGHJӏLMNOP(Q:ROSiTrUzVW\aѐcېde8fLg_h_i_pfq?s?t?u|v?wxÑ .=Op̒3Qcz˓ۓ000Ppxaiʔݔ???? 5(L_l~Õ4<Tiז-Aa|͗??,1DYؗs??ט  ,OSFH0eCaSFU0eCgaHah!IdontNeedEFIqv(s*K>;|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+=rGy=iG} ;Mt?*mWC 3KOO5@yD<#*=(KU3Dh&_g\ M}-z-чHa-чH˗ZIчHXIчHIчH%2IчHa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerdestroy[-rf]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize-i index [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:i:l-a attribute -i index (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %lsUnknown %#x[partition not found?]Type: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:lua%5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrts/258^@%]%e(%det%:Ȫ%9:0* %X%j%p\%o%%** %:%6x%ww  setifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcapsjzi%0yi???%ȯ%??%%p%%=!C%@%j"P% %s"%""""" """@""# # #0#@'#0#5#!ٯ:#@# F#@ENinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst$ %` %%@ %%$O'(media_statusmedia_constructor$$P#^$P%c$$P#^$P%P#$P#$%$$$$%$$$P#4%:$:%paddr_matchD"|0+|0'0D)$1,!|0t |0 +settunnel&4%&ȱ%print_link_addressessetvlanifsetvlan.'`%4'&D%3'4'L>JSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#xTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sVLAN_MTUVLAN_HWTAGGINGJUMBO_MTU ec_capabilities=%s ec_enabled=%s NONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x>af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstrbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@O1F\1d1Fgk1p@w1v11 1P1 ~/1111112 2@#242B2Y2@z2ffsX 22X2X2222%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup44+lZm1f4~/ d11 /]/@4445555!5 bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.44+lZm1f4~/ d11 /@c7p]/@y@y1v1mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreload44+lZm1f4~/ d11 /@c7y1y@p9F]/@\1Fsoftdep44+lZm1f4~/ d11 /]/@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %s44+lZm1f4~/ d11 /@]/@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s44+lZm1f4~/ d11 /p]/@?C#C=-C 3C@: or @ speccan't get net id for host "%s": %s44+lZm1f4~/ d11 /]/@y1v1usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o _OOOO$P^PPPPPQ?QSQsQQQQR,RQRqRRRRSDSiS%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()]]]]]]]]]usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%llumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG;Ng՘'Gg 5UUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1LOCALBROADCAST pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtudfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsAppleTalkEncapInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanDT`jv|;vˬѬx4N\ltlllɭ,խ:>Zex̮Ԯ̮̮̮.FKTTq\\ͯد߯^ܫ%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %ld.%06ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_urlsendrequestrecvrequestJ***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPASVPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbvbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20150113malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)usage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzD"D#D%D'%%%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i[.E+a$. .J .J$..ɵѵ. .  .)/.2J.;J.EJv.NV .cb.jqD.{J.XX.[ ..¶0.Ƕж@-׶.. .%/..J .7J.Ax .MJw!.Xf8.x/v".J".J#.޿@{aaaaaaaaFaa:aaaaΞaaaab bb˗bhw.disknames2IчHXZIчH IчHC,=rGy=iG}3Dh&ǸSFH0eC SFU0eCa-чH%IчH˗-чH (s*K>;q Hah!IdontNeedEFI      !"#$%&  Z8(.[(.] x(.^T(./bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfWhat kind of system do you have?Raspberry PIOtherrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)51210242048409681921638432768FFSv1 [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] Installation messages in Englishen_US.ISO8859-1YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 8.2_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-8.2_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-8.2_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbols%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-8.2_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-8.2_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit BSD partitionsEdit and save MBRSwitch to GPTSwitch to MBRSet disk nameFormat as RAIDFormat as LVM PVEncryptBootable flagSafe eraseUndo changesUnconfigureEditForce umountFill with zerosFill with random dataFill with crypto data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity.AddThis removes all partitions on the disk. Do you want to continue?Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG) Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. MBR partitions, if desired, must be created before editing the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID!Disks: %33sSpares: %32sRAID level: %22dnumRow: %22dnumCol: %22dnumSpare: %22dsectPerSU: %22dSUsPerParityUnit: %22dSUsPerReconUnit: %22dMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uMFile path: %29sCreate new image: %20sSize: %22sMRead-only: %22sSet geometry by hand: %18sBytes per Sector: %18sSectors per Track: %18sTracks per Cylinder: %18sCylinders: %22sFile path?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uMBase device: %24sEncryption: %24sKey size: %24dIV algorithm: %24sKey generation: %24sVerification method: %17sDisks in VG: %-44s %20sM EMPTY VG!PV's: %34sName: %34sMaxLogicalVolumes: %20sMaxPhysicalVolumes: %20sPhysicalExtentSize: %20sName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)? Logical volume %-35s %11uMSize: %33dMRead-only: %27sContiguous: %27sLogicalExtentsNumber: %18sMinor number: %26sMirrors: %27dMirrorLogRegionSize: %18sPersistent minor number: %14sReadAheadSectors: %18sStripes: %27sStripeSize: %27sZeroing of the first KB: %13sLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named %s) seems to exist on %s. Do you want to use that?If you booted from a floppy, you may now remove the disk. Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uDr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-8.2_STABLEftp prefix/evbarm/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/evbarm/8.2_STABLE/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%cdisklabel -w -r%s -f /tmp/disktab %s '%s' -i /sbin/newfs -V2 -O2 /dev/r%s/sbin/newfs %s%.0d-tffs -o async/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d-tffs -o log/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /dev/%s none swap sw%s 0 0 %s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/dev/%s%cdkctl %s delwedge %sgpt show -u %s 2>/dev/nullPritableSectable:no_mbrdevice %s %s (%s@%s)%s (%s, %s)%s (%s, %s %s)gpt -qr header %sCannot process disk %s: too big size (%d) /dev/%s %s ffs %s/dev/%s %s ufs %scd0adk:no_partwindows,hfs/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/dev/rcd%d%cCD001/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %sfsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-ADI_BRHkern-INTEGRATORkern-IQ80310kern-IQ80321kern-MINI2440kern-TEAMASA_NPWRkern-TS7200kern-RPIkern-KUROBOX_PROgamestestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%scCan't open %s Can't read disklabel on %s. %s/netbsd.bin/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgin/usr/pkg/bin/pkgin -y install %ss,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update%-50s %-10schpass -s %s rootpasswd -l rootsource for 3rd-party packageschroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %dMlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s%s -l %d%s -p %d%s -s %dlvm vgcreate %s %s %s%s -C %c%s -M %c%s -p %s%s -Z %c%s -n %s%s -l %s%s --minor %d%s -m %d%s -R %d%s -r %d%s -i %d%s -I %d%s -L %uMlvm lvcreate %s %sPartman device: %s lvol%.2dvg%.2dgpt remove -a %s-t %sgpt add -i %u -b %u -s %u %s %sCannot create GPT partition #%d on %s dkctl %s addwedge HACK%d %d %d unuseddkctl %s listwedgesdkctl %s addwedge dk%d %u %u %s %s (%s)Cannot create wedge dk%d for %s. dkctl %s delwedge dk%d/tmp/%s%c/sbin/mount %s /dev/%s%c %smkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=humanvnconfig %s vnd%d %s %d %d %d %dvnconfig %s vnd%d %slvm pv%-33.32s %-22.21s %12.12sdk%d: %s %-30.29s %-22.21s %11uM%s%c: %s %s%-33.32s %-22.21s %11uM(%s-%d) on %sVG '%s' on %d/%ugpt create -f %sgpt destroy %spartmanSpecial disk %s preparing error Disk %s preparing error /tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks /dev/%s START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dRAIDframe configuring error #%d cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %s (%s, %s-%d)%s (lvl %d, %d disks, %d spare)dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=humandd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=humansh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom'dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=humancgdconfig -u cgd0umount -f /dev/%scgdconfig -u %svnconfig -u %sraidctl -u %seject -t disk /dev/%sdraidctlvnconfigcgdconfig-t nullraidctl -v -A root %sError writting RAID bootsector to %s gpt biosboot -i %d %sError writting GPT bootsector to %s Error writting bootsector to %s dkctl %s makewedgesmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.old/etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d) %*s (%s)Extended partition, LBAFreeBSD/386BSDDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%sdlsize=%lld ptsize=%lld ptstart=%lld /bootdisk %c/tmp/disktab.%sCreating disklabel %s in %s cat <>/etc/disktab %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:sh -c 'cat /tmp/disktab.* >/tmp/disktab'***************************************************************************************************************************************************************************************************************************************Jusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipesetvarcontrol_handle_datacontrol_writeonedhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1bdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionbcٯde]fg h1i"j[klmnGGop<qUrs tuvwXxzǝyA%B2CD9E FCGMHFIJWK^L'(MgNmOvPQES?TUVWXZv146|~}" }*0fp?HPXboy.vddefault_configread_configrt_descrt_headclear0rt_disposert_new0rt_setifrt_newrt_freert_findrt_kfreert_addrt_recvrtrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_initmake_varappend_config`d.make_envhP `:3script_runreason0123456789abcdefdhcp_envoptionD k     J d     ' K l     8 e      ! 3 N t      2Hf{{{'B]6 Om -V|3 if_copysaif_opensockets_osif_routeif_ifa )arp_tryfreearp_readarp_probe1arp_announce1arp_openarp_probearp_announcearp_new5( HPHHPbpf_arp( PEP HEHH@DCH``Pget_leaseread_leaselog_dhcpdhcp_bind>Pb dhcp_openbpfdhcp_informdhcp_handledhcpdhcp_readpacketdhcp_readudpdhcp_expiredhcp_lastleasedhcp_start1dhcp_initdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_sendadvertisementipv6nd_expireraipv6nd_handledataipv6nd_handleraipv6nd_advertiseipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1M/V/a/j/))q/ ). z/...//+/9/dhcp6_checkstatusokdhcp6_validateleasedhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrebinddhcp6_listendhcp6_writeleasedhcp6_recvifdhcp6_startrequestdhcp6_recv '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_envdhcp6_dump%s_%s=%s/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version7.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 7.2.2 %s Compiled in features: INET ARP INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-7.2.2 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: is a NET/ROM pseudo interfacepicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type %.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix lenoption `%s' does not take an IPv4 addressinvalid IAID %sIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argument%s: IA_PD not compiled inunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactive(null) rejectcmd != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.c%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsifp != NULLrt->rt_ifp->ctx != NULLrts != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL%s_%sTESTSTATIC6ROUTERADVERTUNKNOWNinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=trueif_down=falseif_up=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid= - %s %s: executing `%s' %sRC_SVCNAMEPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbin%s: %s: WEXITSTATUS %d%s: %s: %s%s: arraytostr%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s%s_%s=/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtdst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_USELOOPBACK%s: SIOCGIFALIASnet.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6%s: ARP probing %s (%d of %d), next in %0.1f seconds%s: ARP announcing %s (%d of %d), next in %d.0 seconds%s: ARP announcing %s (%d of %d)%s: probing for %s%s: ARP announcement of %s cancelled%s: hardware address %s claims %s%s: DAD detected %s/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %sbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: waiting for DAD on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: dhcp_read_lease_fd%s: %s: truncated lease%s: extending lease until DaD failure or DHCP%s: extending leaseNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %s0.0.0.0/0MS %s: using %sClassless Static Routesip_addresssubnet_cidrnetwork_numberserver_name%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: waiting for 3rd party to configure IP address3RDPARTY%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s not found%s: if_sendrawFAIL%s: dhcp_makeudppacket%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: cannot add IP address in test mode%s: DAD completed for %s%s: op (%d) is not BOOTREPLY%s: wrong xid 0x%x (expecting 0x%x) from %s%s: xid 0x%x is for hwaddr %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: checksum failure from %s%s: invalid UDP packet from %s%s: server %s is not destination%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired%s: timed out contacting a DHCP server, using last lease%s: dhcp_openudp%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: needs a clientid to configure%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %sDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s broadcast %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsip6_address%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: sending NA for %s%s: waiting for Router Advertisement DAD to complete%s: %s is reachable again%s: %s is unreachable, expiring itrtpref: impossible RA flag %x%s: %s: router expired%s: expired address %sIPv6 ICMP packet too short from %s%s: IPv6 NA too short from %sinvalid hoplimit(%d) in NA from %s%s: NA multicast address %s (%s)%s: %s not a router (%s)IPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: reject RA (no option %s) from %sdhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s_nd%zuaddr%zu%s: delaying Router Solicitation for LL address%s: no IPv6 Routers available%s: sending Router Solicitation%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: DHCPv6 Vendor Class too big%s: extending DHCPv6 lease%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: DHCPv6 DAD completed%s: ignoring unicast option as not masterbroadcastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: %s received from %sINFORM6ITIMEDOUTBOUND6RENEW6REBIND6REBOOT6TIMEOUT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: failed to request information%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%05d %s%s: delaying DHCPv6 soliciation for LL addressSTOP6RELEASE6%s: dropping DHCPv6 due to no valid routers%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Z<0&^<3;g<7;p<^v<|<|<a<< Y@j<<U S Q /etc/group/etc/master.passwd%s%s%s 646towlowertowupperalnumblankcntrlgraphpunctxdigitUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*ju,uappnduchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid*0- ).+(/, '!% #34 !#$:./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmta.m.pmp.m.dstmidnightmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagoyearmonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'NAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs30%llo%lld0x%llx/dev/%s%s%s%c%.*s/r%sr%s%.*s/%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed Inkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist