ELF( 4 O4 ( ZEF\\@0 6QQ O @@( @0 fD!@P@Q?P1tР -L4ZZefd@bemain() returneddde   ! X(@@T @@ 0/fefe// P-Q0|e -LM@PL00S @0 K080(0 0 0T K6KdBwdS@P/00S 000/dHf -LMPčP ,0s tpP 0ooK0 0川@P ၍ l @ 0R (0R iKZOoB ߜ$K!BedAq@\ `P/0 !`8 00 ,  , !/deeāe -L>}P|嘽0 !!X0`T0P0L000, !  !@@deeāe -LMR0S`pP `PX DKq@ȁ3DKx@T P  ` ,ZP `0 00CS 0D!@a0C0DK̀@DKZT%ÌP DK⿀@TṌPPPP܌P DK2P x(KP P$0@0 ᐌ  $+ ]f]f!BA@6A@@@/ -t0L0: SX 88S!~0Y 00 ݼ Kh諼@be@B -1@0LPS@"@2p喼 `1Sʀ0!` 0    !B? S[]0 !! H»D<彻8g0帻dHf-deeāe@#@E@@BS@0 P000/$@$ 0P0 00/ddPD0 R0  R  BQ 0//@be -LM a0@S=pPpP! P P PހP"0p @* R 0RKh@PlPd0`000 8uPKhiKde@l@s@p@z@@be` @ @d -LMw)pP  ? hM 巴 7GWR  tPp7p00'7 7'0QWἤ ᴕ %ḅ5v f V000::`@W@'@gSST 㿶Ѹ 6LP H01 2%V QV11016%V `16 16vP6|V#6$1 $1)0C$1a0!10b0`V! 9 Q1 @ P*TW1 @ P:Y)$1*0C,$1?,1!10b01u0S 9  1U @P :$1*0C$1! 14  @P :$1刅*0C$10! 10b01 @ P:$1@*0C$10! 10b01 @ P:$1*0C$10! 10b01 @ P:$1射*0C$1ـ0! 10b01 @ P~:$1*0C$1ǀ1! 10b11 @ Pl:$1)0C$1嵀P$L3ap00 V  Le`v"d `KV0$p3儓c #3`in !`0 p K1D3!0i>00f pKp: K"p: K"p: Kpp `\ :Kp9 K@280 <2<0 00`V000 0 0p:  K0bSp!L4 p0 YKD L$1Q 1!0!>0>00!10c#6 !$1 03/03/03/ 08Q3/XEm/L80L<0L!1 ! 1 !1! ,m! 1`"bRI (K@@J>0 DSBO@beHfᆳe@ddeAiP)i` @S@ -p `0Ld 0@h 0Pl0`S W P  0S 0 P000`PUP I/ 0V 048<Q Q PU p0p0p` 04 8 <030(RPҺX R  $  (// -LM`pP( K@}00 (0@ S<(0<0(P S2<0080< Q0 0000000 000&HY bKPP UXKPPP`0` ` X0 , 0$"/KK1"0100KMPv[96[WK1!~K0100K>P+[Z >[  0K KK[p `0K KKS0S0S L3 R0 < P0E?oY20S2 X0, `p(<0,P QPeP A> KP 0 0 Rp ,@u} 0S  X ,0SPPD0(K dcx@c k@!C@y@ -80L`SP@(0S ;{0sf/A} S R8SPT$ 0d0?o0c SC%P Q 0202 0P 0R* H׋f/}WEV -`pL(M( @PDK|(D` @p G0< BS00\DK$0 ,0S00DK$0 00S40S040 <WD4K p-LMP`A@匸`00 0 0000 0PP 6 dp0$P P ,0d0(@4P00X0( KT80P0<0L0@0H0D0D0H0(0(0 40evKp@C@@! ! ! @|! x! t! p! ,q,{j 0-@LdK0h 0-@Ld~}0 00-L@zP0 0 0000@(00 SP/o/@be -@0PAL`(p$ 7/ 0X$ V008#8Kh/ 0-@LP(0 3/ X8#8K0h/ 0-t0LP@ T\00P00 S/o" (SK0h04ded@be` p-L M`Ph`0@0尷 q1PB 00,RP, 305/`P KphQ0 P R P  \0R c80@40KphKp@C@@j?A@be` 4ded 0-L@$vP /o"K0hB0@.e -LP@T|v`P   1,00S  Kh%@.e 0-LPh`v@P 41U      K0h0@.e 0-T0LP H0R<9v@P  U  K0h0@be` @.e 0-LPD"v@4vP  T  K0h0@.e 0-LPD v@4vP T  K0h0@.e 0-L@ uP  K0h0@.e -X0LP L0`R <u@P  /o"Kh@be` @.e 0-@0L@ 40R (uP  K0hs0@be` @.e -0P 0RL3 upP. ` (03/X@  R0X8 #8X  0 8/, $Kk9  00$Kk/@be` @.e -LiuPeu@P 0 (`6/,X0X`6/0 (P5/, 0XKh/@.e -1L 0R: 6uP2uU@ 0$ (`6/0X`0$ 6/T 0$ (P5/?>XP$ 5/0$ (P5/ 8X$ #8Kh/@be` @.e -pLtP\tU@ 0$ X`6/T $ X0Kh/@.e/ -0 PLT@X`0 6/X`0 6/X0 Kh/ 0-LP@9@0 T000S0d00h00 S0d0i0h0^0p0 S 0d0i0h0^0p0j0l0]0t0x00x0K0h` @be@- -LM0PST@ Sa Ղ Be(0K0p0*b7/pP Ă !(@`0( X` 6/X`< (6/X`0 (6/X`0 (6/X`0 (6/X`0 (6/X`0 (6/X`0 (6/0X`S0  0 (6/X`0 (6/ X`x0(6/X`(0 6/X`L0 (6/000S00(0 00$0 K@@%@@d -`0 PLT@ (03/V V (0 3/  圲K@ǭ -LM00 @ K\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -0LPT@ pX` X0S(0$ 3/@8XP#8$ 5/3$Kkk@ -0pL`T@ PW WVXp00 7/(0 3/D0V00 V0X` 6/$Kk|@ 0-LM 00 K KK0 0 0K; K -LP`᪁@PP00|xEt0 P000 2/   0 2/0 0@C@d -`SL@Pp 0 2/ P lKhwW  P 0iV 0 Kh/@@ -H0L0 S P ,?vo@o@be@ -L@`rPP 0S 0T    V   0p0  T  R0 OoSB@T 0VW0 VW0 Kh| .ed 0-L@nr0P Rl0T @ @  00@0  T  R0 TS0 @K0hR0 .ed 0-L@Dr0P Rt0T    00 00T00S0 OoRB@T  K0h&0 .ed 0-L@r0P Rt0T   00 0  T  R0 OoSB@T 0 K0h0 .ed 0o/8de/ p-L M0@K`0$ P!nP 0 pKp7 0-0L@TK0hM$0\P 5/0 \P5/0塬0垬0 K0h虬8de\K>@ p-L MP)@X1PPqHűD1D0: S0!01   $! 00 5 !0,0$ W0 00( V0 A4  00 0,0  0 f/$  000( 4000`0@ 6/0P pKph` @PL{08 8Kphn8deC@@bedpA0@<; E@g@7 \ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe 0-L@+0 -1LP@`TKhs0 \p7/U 6U* 1U-U U U!0 \P5/,r0\P 5/0 ,P5/ Kh8defK>@ 0-0L@Txx)0PP0 ,P5/ 0 ,P5/P ߫ݫ08detK>@ -LM1p@TZ90` \P5/0 \P5/P 巫嵫«0P ,P 4p 40K1\p 7/0 ,p7/ 0 ,p7/ 0 ,p7/(0KPU 凫八僫0 \P5/$0 ?1 0  K8de@K> -1Lp@T呰0` \P5/0 \P5/ KIV㜮0\P 5/0 ,P5/ ㋮0 ,P5/ 0 ,P5/P#8deK>l@ -L M01@P@p(,0400 ,坪(嚪0嗪4唪  I`0 @( <( 8`VP0 ڪ (q ,n0k04h(KoW8de0 S-L S S Kh KhM@0 @o/@be -L M@PK -@2LPRp` 0CR*p2R h2R0 X2RY P2R P}008Sx`0p0 `p. &.004004 0$0P`L00 0(0u S015 0 (0 S01X0 0 (0u5 0(0h`l`60d0070( `8(88hiiaa5008S(308S#`0p0 `pc.(`cs <\.00500ff5008S308S0 $Kk跱SW HdHHdH@T(B@ p-LM@`}P@d 7\0\ ,K0,0 L0 P (0 D0$0 dm08 8`P(KpK>d,K>dE E E@ -L|믰 0-L|@ᕰ000: S/k@beK>d00co/@be` a -@D2LPRV ,2Rv  2RP 2Ry008St`0p0 `p- &-1414$00P`L0$0! 0u S0151!$ 0 S01X0$0 0u5$0 0( 60d0070h`l``8(88hiiaa30'008S&308S!`0p0 `pk-(`cs |<d-151ff5008S308S0KhHHdHdH@T(B@ p-LM@` |P@d \0\ ,K0,0 L0 P (0 D0$0 ql08 8mP(KpK>d,K>XdI I E@ -L{ -L{0 0R/  p@be` K>xd 0-0@SL S2 SE0 10 1\Pa05/1!\P 5/t1\P0 10 1\Pa05/@14!\P 5/(1\P ! 5/<\P/0 10 1\P!05/0 \P 5/0\P0 10 1\P!05/0p \P 5/5\P\ 5/=\P P 5/{0\< K0h/[~ _f-/0/-/-/-/-/-/-/ -LPpN`@P N/Nq0 2/ p 00S 0@0 @0000@ -L$MP@`M塬08 K0 0  p7/0P *4 K *p7/0P 0 K "(p7/ P80@040 0000\1 RL `, K  P 4̬A,@0X@p0$0d0 10S01 0 0S 0kh0il0j0m Qd  N|0000 100 0(0K00 8/,0$0(00\0` Q*,٬ K@C@@#@H@Hde\T @8T T T -LJyA Kh~ -LAy Khu 0-L8y0@ 0l0 0K0he 0-L(y@^ Z0 000P/QHde 0-H0L@T P D0 00 K0h;0Hde0P/Q1Hde 0-0LPU/ 0S S* S* P@0@ 0 0" P @T 0 @\0P0000C00 040P @@@0HdeRW SW 0o/Lde//D0Q 1CQ -1CQ /00// W@/ 0-@LP2S EPPAPP,i0 -LM`xx@p3`0P循XpXR d` (M>d[ E@ _ ^ [ V W d ddV- -Lw// -0cL@`qWʀ 0! `!#0"   !P0U 0x GSP ㈧P0U(0y" ' B y0X0p P ,0S -0U0( ## & ]PP0U 0x PP0U0p ,P(]0T PS00R  0S0008!0 0U0 S U 0(0l0 S$00Y"PX0@ 0sTGWPW 0!t `q0h d   !YX0S`P\ dH>$0deeāeLded -X0P@0`0\00`LX0`0s ̦ X 0\00Lde' 0-L@0WP0 -L0 @o/@be//0000/QR R  // 0-@0L@0: S K0hU0@be 0-LM@(PKWT s@T 0(Q 0S0\ 0S*0QR0 SSK0'\ `P/0 !`8 00 ,  , !/deeāe// 0-LM0@P K1ㅚp00 K200|p0000 000000000 K0bp000K0 0!< 0`4 0 ,   !/deeāe Q-L@`tSPPVjb b Xd b d 0S0<00]0S0;UT@c c c c dc c c c c pc c c c c c  0 0000$0  0 0001 000(020<0 F0 P0 Z0d0000000Ud 0d @bedHQ> -LMpCt`@ p匦tT4P  UlT U t10: SSZ0s0e00傠|@(1 @1 P0P0PP0 00@0 @ޗ0 @ח0 @З|0( K(0 p0p 0 h0$@ 3dP <D000TK@C@j j @bej lj tb Pd@De#d -L 0-L@<0 0K0h Td -L0 @o/@be )-LLP0% Kh p-L MP`s@ѥ%P0F.0P05/PP Kphy#ҟt0 @#P )ȟ@L0 )F40 \P5/Kph@C@`@@`l Hl  -L -L// p-L MP`2sP@ 1x0: SQ0|0募| 0|0!00傟|0|@0 xPt 04@800<00@00D00H0й0P ht^0t0  SP4KphKp@be8n (@l `n n m R@E@ -L|吟 -Lx刟o 0-@Lxԟჺ0 0-L@ 00* R}0l S|Q r @0(00* R  Su@be` s@!C9: P S@-h0d1@40040104040CCL00L0 ddHd -@ ML, $0B 0N?|Ko @@-0xx@T #ʠ0 ʠ,6 0S (0S Q .0S " dTde - Z0ZL%VU`-@0S+ 0 QP YXQQ00S  8VP d傡P\wP@e 6@Tde@@@ 0- :@l :#6LP 1 PD ZwP < $@߃%r0Tde 0-LM@K K$KPgP K0 DvK0 0-LM@K K$KPSP K0 DvK0 -p0LM 0 x0KR@P d` R 5P K,K/P  K0P 001vKbtd 0-LM@K K$KPP K0 RvK0 -LM@K K$KP K jvK -PLP3 @`aVʀ 0! `! 0    !0 2/P 0!L `a0@ <  , !Tdedeeāe 0-X0LP@PQ P 0 3/0  0K0h/0Tde -T0LP0S @@P  B  R `6/U000Tded -pL`P~P@  P$ P" P@P P #PU PE`Fp l4T00Y0S D)8% P@`@C@@`A/ -L M00\ @T   4/KTde00S/ R//Tde00S/ R//Tde -P`<@L/ f/080Kh/dde - 0L@ S(@0` !P0 R  P UP Y L0 R0@P @@00 , !d @0-Lp !@`PUP * 0R00 PU P $  0R00 0S,,@```0 !!dy y 0  )?)/ 0  )?)/^/ 0-L@q d#Q0P0Cq 8 q (q  0@%@+@3@?@ 0-P,@LT0 K0h]C@@z 0-L M 0@ Pr4  ( 0 0  (  ,  04 K$0 ,00 C]P04 K_K04dy /0! / "// -L⦟H@ -L⠟b@ -LpQ`!N@@^NP@t0 ewUP `e``p|`eU*0 ")Z0, d@$k>///1/8#81/1/ R  R/ R/ _ 0s S40Ho//0H1S0/d/m8@Q0 Q Q/ /A@A@ 0-@0LPp3/> `S0TK0h/H2000,,$$#  K0h/0@@XS>@@ -LM@ 0 3/03/PkQ 0 P `%0 3/2S0d 3/P %.!P 3/ p0A0CS000 3/0 80 04 r3%&P0 000 %900p0 %8 t %@  x   H < ʟL \` H  H ,Šd hʟ T h d 0H| 0 X0 0b0 %:030 :   %H   a  0 8 4? %  ? \  %  ?  u D d 04  10 9 00 Q- !0AYS8 8  8 x Ј 4 ܈ | ć Ї ` `  8 D < Є P l h Љ 0`c0C S񟗷| 0 0 0 0 0 0 0 ( 7S  0(3/ 03/@ 03/  03/ 0  03/6  12/0P 0 bt0 0p 4h3/l00S0Tgf =b0t 0@0 U 0Q0x 6&0S0J 0 3/50S 5%0S 0L3/`0S0P3/ 0H3/<0S0$ #O8OS0 0 43/0S L,03/0d h h3/<0S 03/6S03/03/0`l0 q V 06l0S0l0  0< 3/ FQ0<3/d3/06`V0<3/00 0T0|0000Xt00@40q040 < D0Rs0D0 0 D/0G0D0\0h0D0887S0( S0~03/ 03/ 03/ 03/0<h g0c b0^ ]0Y X00N0@pJ@0ST`0\03/0 3/0L3/`0S0`3/03/<0S 043/+ (0#03/ 00` 6/0\03/\0` 00 0 0`0 t6/0d3/p0 ABQpR 800S80 <0\3/03/$(K@hS>]>h@QzA@@ mA#B4OB]>@@K>A"BJiA@XS>@@@B@@/@\B@@@cA@@@@:B@@@@ @@AA%"B@GARzAA@@@!@8@"@'@B@5@G@Y@C@ ^>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$Oi- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8 -Pp`@LP _0118p(0000_K PMKPH0 b/K1 (01 0P>_/KṨKpGH01!0R$04$0/ dO- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 // p-L M`P@P Q 0K +P 0S00S 0@ S 0@PH0HP0sX0J3/40\A03/0?00?Kpd`dedded -QL0Sp!; P SaU X0O03/TN 00<000S:`#*;0V0C"#   c?$F:@#*@;D0@^0C̠"#   c>00000C0/$00dde!iAi0d@//0/////?  22//-P/6Ċd N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: Nഊdddd1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N// 0-$0L@4s 0S 0  00 000!! (0(d!! (0(8 2$!! T(0 (Ċd ! (0((( ! 40O(0(x  2t ! \0O(0!(H ! 0O(0!( ! 0O(0(d 0-H0L0S @0  "!$0p03/0 !!0 eedde03 /0-4@A@P(PPQ P0(00/d 00-@L4 V< 4 @ 8 L < @  < 0/ 0-P@4 LV40<080@0<0L002 @0200< @  000/ 0L 0 00/1001H000S01</ -0` @ P  L       $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@009p<0002X10700 0\1 -LM@<1 L Q -K0H0`H2 刢!@p!.KUKL2mK,@K,11 18701$ D eK!.K@ T 0000 0 00H2 pL@C@P@Cp\C  P1  0L000L0 A 0 ApppdP (d 0-L0M P  t Qh hQQST00 DKA T0 DKD0 8 40 ,P K0d 0! R!10/Pee -LP` v@`0 S   v0 X 0-L0S@@<0 00P,(p$@@ @"(0 P00!1 0000P0,(p$@ @ @ ( 0,00 (00!00P$@00 @ @000 0'(KBAȊdAh s@ @$ 3@( @ ee8 @d@@ee@@@@@@@ @@,@<@ M@ -LxM@PK`p` &Q0T M 0D 00P @00 0 0#$K -pLMP`K` @Q ,0Kd #\0 0p 0`@R0  0 0p  00 0 0l#?o2P0S  R R  (K eedde| -L|M@KP`p` PP0T L0D 0 0@ 0000006# KȊd -LxM0`T@pT 0S PK` PT@ L0D 0 0P 00000 0 #-$Kee -L|MPp`V- @K` sPY\ YdL0L 0 0@ 00000 0"(K ]f 0-@0p pL` Q0S@P@803/00t@0K0h/0 dde`de @-Lp03/dde 0-P0L @T  0 !! 8K0h=0ȊdZ@ p-L4MH!H1HQ03/x01 0X80 &P@a4 8Xt 0  (K0&h(Kڈ000000 , K0KK9>0@ 0(K 0&h(KˆP<:~ 00KpX0 J T܀dddeee$k>0de7@@@:f@dȊdd*f@ -L M 0K@ P 0S!0000KP 0K P 0S!0@00 0K| P0KhP 0KP P 0S !0000K P 0K P 0S 0800KP 0K P 0S 0800KP 0Kx P 0S0 0700KHwPK@Hf@@@APA@@@1RA@A@ -LM@00S400P3:0 00  KTceXce00/G-(@, TH`@^ Þ0P @`|a`P pZOR: R:p\C @h Y p  ` S1^ppVpW p pG`$` V *Y pp' ` `^ p`@ 0S `  ,@H@Ѝ S-LP@` > S SERq@03/L060p0  P@b`b@03/L0 3/W'*@`Pg PU D03/P0 3/X @PL`@03/L0 (pH03/T0 $Kk/ddeeeee -L ^0 \ R:R* a0  ˇ^>@ - @LBPp<`)pP 0 0<0P`PD0 $`0 0(,d 0A<p -LM@P00 (@0,@Sp"`!:00VTV1X 0  P`h@ p(,0(0(K0(0,0000/ -LM0 @` T0  04"0 S M4S BV2d0(Ko/ 0PRq@ L D pT@g  P"*0pd=0Wp!80 0 @`gV 0Y c P"*pT@g %*0iS0!pdS0p10 0 A3A3C?o200@`g0V 0Y c P"*pT@g "*0iS0!pdS0p108 00@`g (K@$k> @dde1@\@ -@L$`KM@&(` PTp 0W *K^(0 z0 ( @ Pi$K -L M> @N@ta`TPpTv#x3P0 i<?oW20S 0 ^<P > p0P0040 W1` ` 0Q%*TX0 00 00PQ:Q: 0S 0040S0> jJDp P0(K@d@$k> 0-P.@N@LF$0l0 K0h;$k>d0@-ASp`T @TP0 0 01  -LMP`0pV@ 0JW$J(00K4 K+40 R#:$&:080 00 0S "88!880 00?o2 >00L80 008 K*0JdV@108 0 PP`d(K$k>  -LM`0(0,000pS@ 3:RH0DP DP0P80000P0(`Pp0Kd -LM(,( 0@RqP08000P0S[ `VT0A#AR [t!t R R R;0SH0 0H  0 b(H0T d b"H 0Td `@6 100 *V00zbWp4 00 \04 0 0 kP`g 0 00 _d0D0 0 0PP (0(0000D00(Kd -LM@P(,00 0`p80`0Y P0P(0000000P0S` 00W100 0 0ph(K -L$M S`PS*004K! 0 ng@P+4 p N\:0 Z 80 D\P80)T,  @Rf 0 0 (K -LM@`Tp@P ! 0U00S   0>00>00 0 p 00000 0P P@H8 p n(KXceTceA-P`@Pp* U'\ R*0.b Q00 \*0 0cS0!>0>00P@-// -LM)0pS@`P  ( "%+PPP@V@PV @!*0 PVP0V0" 00"%`( +0PVPV  P"%ӅK^>@@@ -LMP?lA02R/ r/ C<0S00,0B20S10A60S00B$00$".0 ?`0?0?0? 0?p01?0/N0/J/F0 00x0 0000 : 000L0 2 8Kh,eeeefefefeeeee/@;@G@T@@@ -LMpPQ`RU2 0@T R  !@0 llŸ*Q`  KD"04"KL1SKC> C K a KK\ KKKTKT:T\1 T \1 ||\1pp߄\1@ddڄ\1  TՄPӄL1L!0S @1*B0S 0!60S1 R0S 0 R0S  T P0AGT ]Y ᥄ K^>@Њd^> mAA@@QzAQ B@A$@C@P@\@i@(@6@u@@@@@C@AXVde$eeL@@@@ -LMPpQU`l2lB03/0T1\2PXHq0 08@\02 0z0\2 00\2 00\1 00\1 00\1 00y\1 00r\1 00k\p1 00d\X1 00]\@1 00V\(1 00O\1 00H\0 00A\0 00:\0 003\0 00,\0 00%\Khh'dKh̓dded6@C@P@_@|@@@@@@/@C@Y@o@@@@@@ d@@ P-`@ P4 p!apЗ!$ 0 R LpL AQ 4/!\@P!W d dP! 2!oDЍdRReset vector called, LR = 0x%08x-DMO-pB P!W d dP! !oDЍN  0O   ! "`"Рo@@A@#A@A.AVA~AAAAAA -LM @`pP 0S00PAP 00(0S 00(0L0#O@0?  0 L0 (Q00S 0 c0 E 0 000`@$KA -L MP \p`@ D0 E 0 0pP K p-LM01@x`QP R&  k?0     L!~0t0~$0`0~40(L0~0880L00~Kph̊d A@AaAAA -LTMD夤P0a3/0` 3/- 0-00S  !00Sd0 00l0 D1  ᳾ z  0p AT \0K0` 0 4/Px{3( R0 d0SP L0 ~~@E0(0L0`0d0S xB X<:01D0h0 :S{0d  L0\ R0@ @014CH$H:;:C:Sf ?;>+ R Sa L T@@hl0  0Pp0 .l1(SRZ07~0`  [d20S(0SL20h0 00S0 \KD P  0L ` \0 @ D l0 \ Kl0So lL00R6BSR  6S 10S 6S 10S |1|A0S@@@p0 (0h[-0P( d0S0mM7d R ZT0 0h}0 p\Kd0 }D d0\ S S S 0L P0 0!xpPk/@0 0 t} 0P0  0 0P0 0L0 `0@ D0 (Kdded4j>D IAA`dedAA -L8M`1  PAPUD1  ች00S  !U 0L 0LP(1`U U*10S0 TKD0T0 0H0 0T KD0 vA(0P$0101D00`o/dd!:!P/  0 0S/<0. T4S Q0 /0/d - L7C - L.CT -0d -P `@pLV PP 0`P R  Tp@`Q 0 "uT 0101D0d4e 0-0L@ b8 #8000P0S0H$Pl$!P$" P1%R DA\u800CS0 80K0hPu0dge@ie4e -LP`R@<l@Km[PPi003/003/03/0$0 0fedde -pLMP(Ko@@@ @X`V' YP00w84 0C84 0(<40C<4 0 @h<o_Y(P @T0,03/0(Ko/kedde -LM0` 0VPp0j 00@0  a000 0 0m00kPQ 00:#640 4 080 1<0 80 0D0 @& `  1 @ 0@`0 0 0@ 0v @ 0 @ 0X1 00C0C1 01000100 `  0S 0 0S@Z 08 41N0 +<`V(Kfed 0-L@0THD 0S ` 0S  H0Q %  % @@EK0h0d@4efe00 Xē Q\\$/05S/hdfe 0-\ L%R K0hh@@\P 0\40 $ 00/X0fedd@@-^ @Q@R @    0 0 0" <đL<ā l0 Q S1A00C11 S 0A00C 0 0d/ -L4M6@0H0 Pp6`5S80  lP8 8000P0 V0S40 4000  Tl0 0L0 0 6T<0P<0 /d%:@0 %<18X <0 DsPV <08%* 㒊* <  R D0 2sP D0R@8  `Xs:4[ 0:#6@0 <0@ 0D0 1T0 D0Z  W8 P40S 804 S<`0400  L 0R    0 d$u p8 pP0P00S 0 M4S_ `]L0?o2*2X 4H03/RPL0  00` T8uurt1q0p H4!*$0100P0P$0240@01 0(1@@0 @0@@  h1 01 @@00a0 00@@0 @0@@{h0 00@@0; @@@mh ˽<0(Ko/dfed4e4eHAtAhoeAAddeAefe@4exle`deX!9ATleDd@Ake4!FA@ieX!OAge4e 0-LSU0@ SU f 0%0踆ekefe -L$M0i((i$1P`t @@|@@(W(0㓆"V8 /*0 %PP 0 0040K0009  QP xo4pW U *FT0 Z p 8`(Kge@ieddWAXceTcenA@!\4 \$;0 /fe -L` pR @!: P Rh PP0SP^P4n`PJ$KhfeAA 0-@ !:L 0T$ TD0d ->LPM^0P@P00 |nQ Q h1hkP1Pk `00S;0p40 pU>0p80 Z9 Z\#$ 40FJ00 S00\  < P< pt@nZQ#,80HJ H DJJ(KAfeek>A/A0 /Ḇe 0-P@D0LM@ 0S      rK0踆e@-h0:S AP@P 0R `P:p B`pUT0踆e-T0*R A0 S ^00CQ 丆e  -AQ`**%L 0L*::0; `k` ;/0S0P`k `+ *+* 0**** * U* *, *$ *0?00?踆efe !i!! -`@0La00>0>0PTp $:P<gm:K#xJ0?0?0000?輊ddSA -LM@ᘀzT*$::6WxP!P10j&eT*L0 HS @03/003/ FJ 00(Ko/dded0H4 /d0  ")//0 !Р!/0 ! !/ p-LMPX>P% OK,`202 ~?2 02 0 1`0    R"   0&#(0 <@0?6/Kp3eHceld0002?0/S0?0 S/Hce 0P/Hce 0-l0 0QPL @P P8@ 0AP`00003eld -L$M2B<03/0 QP l2 PR0PbS R  :4: #&! k| * *"&!k=Ps 0Sp 1\@@kt(KokPPA0ap P?#K1080 0SG@1<0 1@0 <0 g@006S46SD$uk 08 1:0800#K8/P #K 0#KJP`pQ Q Q Q Q |xEkplh>kdAAAA A6A1AB@@KL p-L MP `0R.K! 1 -p`LP&.1:~ 0@0@P 10U P00P p-L M0`x'k00^>0@`0P@e0N@  0 g00  L0000L0KpIA$k>؊d 0-$@L Om0005e 0-`!L@ SP@(@`@006PKh{5e -`LpP/0@T R0@ R 0Tj %V m000Y KhXS j5eSAA 0-LPmT0@T 0S 0cS:@nTP`%VE$ 05e0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/ -LP`p@P 0 x00T`Xp\00PD0 0L00h000x| @00ⴸ 00S/冶xdA 0-L@P$ P 0K0h/0xd 0-L@P$0 R 0K0h/0xd 0-L@P0  0 0l L0S0pxt0 }0A 0-@L}K0h -LMP`@40 0P00 Y2:00 S+ 0R'p+ 96P 8 +8 p .6P< +< 8 #6P80 p0SP040@(K -LP?U!U!U!U! U!(U!0U!8U!@U!HU!PU!PU!XU!`U!hU!pU!U!xU!U!U!U!U!U!U!U!U!U!U!U!U!U!U!|xtplhd`\XTPL3iHDAAAA ACHB A A A' A> AL A_ Aq A A A)BFAP00 T0S0CT0 R B 00/M 0D  0S0 0SЍ/ -LMh@0S   H 00  Z` PhKh K~e A A 0-LM@P 0x0|  0 H 0R 0@ 0<00l00,0ԤP L zjhK0QzAPz! A' A 0-@LP0p00p0|l0S 0P|0K0h$ -`D @@?LtP0Ӷ1 Q P R   @ P0Kh0S   0 / -\0L@QP``0R?H P @0UD0V  -\0LPQ`p`0R?)@A0⇶ @T @0VD0W @0⼶ -pL@00jX`U0 S80  Y   <80S8``00 W58008000{W00⁶\A[PP"W F03V 80<80W400C000f00 03/0Vf -0W@@8<00000t0W 0t0P0t000;00 03/0V00C00 03/~e; A mAC A -P 0@@R8` 0t0 0 L \ 80<8000C00S80 080w{80 080Khn{00S 7P 00Kh/~e -@L`4PU0╵t0Ut0KhεL0L/L0aQL/80/:{ 0-8L@0  xP  #d 0 xQx|00x0 H^x Q @\H@^||0|08 @0P0|000 0-@P0L02L00L0K0hl 0-@P0L0 00K0hZ -P@L`00S 800800nz0KhA -P@0L`03/0S 800800Uz -PL@e08 `20S0@C0eSeDA(k>e A -@`LP00Sl@ T T T pT qT %T 3/p 8008080@ 80 00 03/nT~e6npSp0յoյp8QzA A A A AC@ Ae A A A -L M40:   ( 00 K0 1K K' 0-PL Mpp,0 ,K$㌐J2K 0(K@0 ,K`P0 S H1P J0 `(0K@0 ,K`$K'lk> -L M40: 1KK $ 00 K0 K K 0-L M0 K<1K K (   00 K K'` -L@$M  K K*   KK  @KKK -LZ@,M  K.$  K K *  K K @K KgK -L M KK0 0K 0 KKM K -LU(M K# KK0 0K 0 KK0 K -@Lp0`ᾲP0P0pPP P0  p0p0`p0bx0 -PL@4p`W0⓲T :T& \Q *@t@`HTO P 0 S8  0@00S: 3/6Q;x@T 8 0  S |  8 d   @@@x\0Td0S` @ P 0Sd``0VW0$Kkn -L,M@@Pp0 d0SW0ST80 00 03/b0M`0\Scdb`40X3/0<@` 80;8080崃K008:0?4 K0 l0 8K8 8KG80P;80堀 Pd P00d0 d00 03/ xb080 0⼱d0S /0td Rz o!4m!4m!n!Lm!n!n!hm!n!m!003/`u00 03/ybd0S0(S@080 D040 0 R0C B0 00 00S00 03/L^b000 8 K`KD0S`G 0CD00h80P00!00  x`PL0!0L00 0⌱D @P`D0S0CD000 03/<b00 03/d b``0"v0d00<00<0H00H0`P0Pd0S ~0E0 0S 3/080 03(K A= Ad` A A Ad Au! A A -L MqP@`\P d00e?o2?6\0U3v`` V,`0V)0⽰Ud0UpP Pp W000 000 | P 0❰0ܰ(K -PL0 l P d P \ P T P0 0000( 1`iq (k>P P P P P0 0000 1d/>/(k> P-L P P P P0 0000 1d( ((k>00/00/ -@L0t0S>x`V; @p 0R L0S80   80`P*P  P0> 0{Pt00t0p00p0u80 @00 03/`0$Kk 0R0|0 8080;80 P@L 0c0?o 0sPUP 0CR#P 0U00 03/ 4`P0000 w} A+ A -@L`4PU0⓯t00S0CUt0 0ͯt0SKh\ 0-@PLxS0v0P 0⯯K0hAp  p !u0K0h衯 -@@`LP0U<0QP0 T0 00T00 0@ 00C080 @080 1P;80"P <080<0d0   S L00L0d0S0S80@;8080 @0 0KhUd0S0O 00000@@t0@Kh -@@`LP003/<0\ 0<00` d0080@80    88007880808S S S 0"0!000080080l08S  00 03/8T 0808/pP  0Y0 03/_D`3/_+ 0خl0␮Z,<0Y 00 03/g_@00s0⺮Jpp p0m0⫮?0c_ A Ax A A A -0L@S 3/`a0MP00P0Pp0US0sp 0p003/ 0p00r p0"  0 p 0p00XU 0R00 0I0lps0;Ad A -@PpLM4 0@ ,@ (@ `0T D`P@ 004 K00 X q K- ^ /$0/ -`LPJP@$@T @P   0-L@OP$0S K0h0 0-8@LPᗭ@T 0U@ѭ0e p-LM@Pf^9$1P^ 00 03/Z^%PU) !R00 03/L^`` @P:0`: 99000000P $00Kph AA/A 5e -P@`Lh0K10@J1d0S'(!<!X!x!!!!!\0` 0b1$ lI!F %0plIq F%Kq00 03/|] 0 000 03/dL]0K180 0000Kh.?AcA -LM#K(U` "S "S "S0  "S Q 40 80 ` \0R 0d05 l @ 4   0d Q 0 LIZ0 l d4BZ$KkꈏdAd@Ad_A|!~AA| -L$M\8  (0@ 0 ,@ P4 h` p0  @ <0 w*@ <00`( Z400S j*4004( 00Z$Z0 0S. t0S 3/0 20_00T`0$6/ 80SL0 0p80S  6*000( d00Y0x0S 3/}?80 $03/` $0 3/d $03/40 0   5   Y Z qt!!!t!!!!!@!!Б!00P`0 `Y4@T0 4/F000 ,}Y0aV 0 uY` 儐0 49/ Y%0 X :/I000 YY0aV 0 QY` p0 47/ Q0000`f`80000009000 0Y0`0u.800S80  dY $0,3/4 $03/5R Y40 00d5 0l  hY0d0!(K舏dAA1AKA}AAAAA%A[AlAA -L,M\ P(0, ` h04 @p80 0@0< @0 800000 X40 +)< @008 0 ( X0Sl80 00 !C000(Ko4 0T 89/t0S 3/804 $0 20_00T09/d0S5 02 000 0MP@0< 0 00 00 000 0 ?6P40 50S(00( 0`X0S00ʅ0040T 89/ X80LXP '0'0$" t0S 3/804 $0 20_00T08/ 000 0p Pb 4X0d0V0!S0 8   #8 /@000`0 S8000000 X 808 < p5X ؐԐE(0( W0d040T` 7(0( 00W5W0d050 l004T`86/ kX(Ko(K舏dA Ad%FAAAmAAA 0-RL @ R00d00K0hW WXXAA\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -LM `0'L 01 @PP P0S 30 =W0 'Lp h0A( K2 0 P2K?K y,H" @K P 2 ~'0( `W\W/K - 820* m'R2[0( 0 \@  ,K$03/W@ 3.P 10 K'R2[00( VM00Y@P2 piYPd1 0940<8 C4 8 S@`D,0-000F a3९K3A0xKt2 )(0K|B *K0/K 0.  ?Kp2 0 R0 `0+0 0 l h 000 ?KP@  1@ (K舏dAA`AuAAAy> -0pL@P&W`<@0Lp@00 &0 _V&P0 .@P0d0$Kk 80 P000000X00\00L0,0H000D04000P 0.$Kk舏d>A!!! -@LP,0L`   p x 0 t 4   ,  , \ P P0 L0(0 Tp000000 0 Hh!!ԙ!k>!aA -LPz&@s&`o&P0 @P40Kh4 -LP`Y& @0PPFjDjBj4}`P0ͤ 0-P,@L P@庤 &j0egA p-LM`@!&0P ~P X`@%W`0!S\Q dQXP0 X0 Sk>SA5!B 0-L@#K0h -pL`P0@   V0 0 ;뜀@P0W  gr ) 0PR00 g,aka[AdAeee -!@LP 0T T T T \0T 0Kh Kh?01 00Kh @0eUUU R0@o/ -Lp;#@P0ȡ\0U `P 0S P0Kh -LP`# @0PPဦggg4<`P0⌡ r @ R / 0-QLM@ L3U0 @00T@,P#UK0QzAA A. A -L@P"@P`"0d00`0_T\U4P 08pfffpp 0 PlTP\p_P@ W803/@$KkeC@L AAAAE@ Q-L TZ A -LMP(0K@p`0 0P40t 40dP L0  #"Y$T Khx>i A!!B <0 80 40/0 8< 0/// -L M@p "D1P 00(@P3##0 !`a0i  6@0 00TUO{T0℠D0 (.(S0S(K`!y>z> -05 L(M0  K$ 00 K0 1K K0u 0-L!DA0P@1  80 +.80080"0 0-L(M0  K!$0  K*K[ $ 00 K1KK K -PL`!P@00 R R   H0S@10@1p+S V'9Sl' U0DQx0t000P 0X00080 080R<S0 ᩤPKhISd-AC@0z>E@ 0-@@0LP1!hQ P` U $  K0hS0 0-L@!P@0aS0K0h裟ZS -l0L@0p0CS@PRn00Sx0SypWx`PI1 0<n00Sx0Sy0Sx`P-0 0n00Sx0Sy0Sx@P(0 0du! -@`pP  M L! 00 0RK0e - :@:`#FLMP!`pP D18 Q9@A XT00 0AV K0e 0-(0L@#0H!!@1 0( $ S$0D1K0h0e -P@L`0PP 0S 000 0000V 0S000 0000嵕|0S0S00 0S0000S$00Khv -R0LM@$ pt@ t0Kt0KFKp@ l KspKPLL6 @0 P0K tK`P5 F0h@ jh0K0FK @`0K(`0K hKd@ @Pr'["448#8S<C0\@ \0K0[0KZ0K5 @`0 0P \KX@ EKVpKTPK@P0ptH5Wpp'4U0K(5 @ 0p0 \KTpK@P0G0 c0 @ @ PUM PRP PRpP PRW_oRPU2 PR%rPRWP PR<PRpRP PRWKPRPEX(Pp᐀XpX᐀pnP XPpP W W p W<pxEKP%P PUP<< <P PEP /oQ" RnQ  n R0 岐PP@03 @00 0 0 0hSሔC0\@ \0K2 @`0 0P \KX@ EKVpKTPK@PN0t2WG'4U0Kl2 @ 0p0 \KTpK@P9GPp0@ 0 Q  Y0Y R\p@phR  R\\\[A 0PS 00ph   0 00 p07@DN  %[J["448S0`K0 [N0[/`K40/ [M0[4K [00000"20 00 0@0I[ 0@0 0Q<<<;0P0KKP0K GP0K CP0K?P0K;P0K7(K0u  -LM0K0 0  K@z> -L(0M 0 0  \ K輷!! -00ML06 0 0J K輷!! -L(M K G0K0K0K0 0K 0 K0K 0KK 0 K0u 0-K L(M1KK0  K( 0 00 K0 K0u S0-L,M 0K 0K@ !K:0$0 0 K K0u 0-@% LM0 K*`  0 8K0 0 0t1P0K KPS0KK Q:; QS  QO;00Q 0 ` K" p䀟7K0 | K 0 p @l0KK P$Rx xKf0[a[wKxKt 'KJ$0q Kp0K HpH0K xKuP H0KBH0K>cP@0cS00 K0u!A  -LP`p@P! ῒP0""H0cH0$ 0600000$0 0 0P0000@ 0! -L$MP-DA0⹛ 0Rc80 080la[@Y H$0pAM`a p`QP0409 3K0 0@0K 8?0K 4>0K=K< Kp@`K080 40 3K(0*0,`K 0f p"410K0 K $0 0H0 @P  XH0PTp\00D0`0XhPL0a@D0D U0#@0␛(K  0ud,! -SLM\ 0000 M0 0 ) K N -LM@l4  P000 P000 K N -L,Mp`PHK0QO00D KP XH0S[A [DK!$$D K !( p ` P DK (K -L(M`P8pK0QO0p04 KP UP80S"[10[4 K"44 (40K0"80  Q   4K80 ZK -L(MQ K@ KB0K,4K0K0K K(( K@0 K K 0u -L(M  C KQ,$ K KK K* K@ K K0u p-L M@0P Da 0@P40   b8"8#4b4# 04"400 S0S000Kp p-LM@0Da PxD3 @K?4X0 X 8  !0X0/K K<0D 00 0  0Kp!A p-L M0@ CRP`/0 0Q0vP$0S D14  4"400 0b1Q A0C   D!4  `( ("$`$" Kp - :@:#FLMp!P D)@!8@`@@$R@@T %?U Q?U %0CU 0CU h?U1 \?U 0U00 0?U :0U 0UQ>U 0CU :0U 0U >U >U 0U  >U 0U@5^KQo l>U (`>U4 T>U H>U\ <>UP 0U0 4>U 0CU v=U =U\ o=U =U =U c=U =Ut \=U =U. =UR  ct=U l=U G  BP?o@HM204@@@$Tk Pg@T< PU_0Qo0 5>K`PUN#[M3[0b100 5>KRPG.PC0 Q7@P3E05^KPC LC @P3K"4I3K0@|H#K@ @@0 D@0D,S5^K0 Q@PP  "4$("( R !70\ 0 Q 05NK0 0QPD140   4"4 0T5NK VP0 0CS 1K5^K G@P0 K0CS 140SX 5KT@7>K00 00Pp3S M3[/K"44/K80#8   00PQo7NK0pߏK00 P UPN05^K00 Pu|3S !$$K("( K!m#[KK M[      E @0?0 09 @03 @0-Q )  V$ Q0S8X00P0 T0@  "P  5P@1 0@1       <00<0<00<0; 00 00@ Y0PC P3K0LC HC L3K0娦@H3K0 @@0 5K 7>K  5K0 S)!x!!l!!!!P!!p!!8![0 p3Kp0 fg3K05>K 7K P0I#[0"30[0p3K0 030f3K0PEg#K 8@ 5>K7K f@Px Kr[0p3K0 030f3K0ʠ@ g#K 5>K7K J@P\ KV[0p3K7>K0p030f3K0 Tg#K 7K5>KD*@P< L#[20"!0 0 05>K)[0p3K0 030f3K0Dg#K P 5>K7K P0I#[0 10 \0p3K0@030f3K0 KO3KgCKr :@5>K 7K P00\0p3K0P030 @f3K 0 KO3KgCKpR0c@ 7K5>K P0P0[0p3K0@03?0f3K00 00R 87K5>K [0p3K0t"g3Kf3KP0 5>K7K PL#[00"320K3[0J3[0 \0f#Kp3KO#K0 L#K!g3K05>K 7K s0Sc!`!!!X!T@7>K   5K R0p3K0`j3Kz0PQ@ 7K5>K gCKMP`@_KT` z 0U00U@0D0U00D0U0D 0T 0P30DV<0ed@c Q c c c pd c c@c cccx@cqdvdcdcccc c<cc c(d!@ y>*" !A0u%"A N5>K . R 0P#K p3 l3 I#KJK  00\@G#K 7>K 5K Pl3[0k3[0@HPP 5>K  R0P3K0 I3K0H3K0G#K@03F3K:00 015K 0 D@P+; A@7>K 5^K   R0p3K0i3K?0g3K1@ P7K0 @P "4$("( 0BS K 0BPP 5>K  R0*P3K0 I3K0H3K0 h"G3K0 @0 5KD^@P  0$ R @ c@ C 庋 x z F0*C 3K0_K@@@@@ ,#3K @0 3 -@P3 04RS#հ00 ;0040  3@,09.K0 ?@P@X$3^#: 4P`F0{```3K $43KCK偃K) :0D4 `0 3 `P 0 S0 ă0# `L03 , (V񟗍\!K @Pn 0SB v   0 /K00pS lS PC o3K0p#Kn3K* 0 h3K`0 P 7K @P0 7K00b30 30 3: @0p0nCKiCKhsK@P030 00b3X|S@y0C07KpS  PPp3K0  j3K : 0 Pp?K hsK@P_#[[00a8#833##SN[IS[G#[00 10000L3[M[43F#[K3[a43J#[E3[4303    KL000@! p7c[8[6[1c[<4c[t 3c[5[2c[0 00 00003[(0000؉Y@0D8ST eNQ 0DS񟗲!!!T!d!X!!K  dPE3[T@?0E3K=#=E3K:P5.K<0 P T  T  GC  % Q  Q QAQ QQ +QQ]A UA M A 0X 5KP3 00P#K  0"K#K*  LK@0 B0S<@ 5K  0D@ 5>K Pz20G3KF3[ @0F3K0DSp P0ESk0S 7nK 0DPa0\3lC[kS[0E3[U0=#=@D3[@00 0D3KD3K0 0@3K0  F3[ECK@0F3K5>K @ECK l? <05.K20  00 00/GP'0  00 0 0N3[UJM#[@,K T@c@cAT,0K3Q#QQTT(K -LM(0P#0!![D1`80pp0((0S  :@P #⨄/KK 0$P?0HpB41 h $4)<㊡ 6ᨁ *: & ̟ 0 0,K1K0 !Ƞ40 0c0$ 0c00 p1 ܏KXǟ0K0@ 0pP$1jP0P@0 p /Z$0K @ 0pP p P0000@هW  p DQD$0p0(K0ey> -L(MP-Dq@0P%jPj0&ViPaV S  0 @1 0@1PP GP PU V}z-"PP80n;D@0 z> -L(M DH0S40<@0 @@5  K, 00 K0 1K K蠆 -LDAP0`@1  P@1`0 XB@1@0@1c80 .80080W"A 0-L@1@  P@1`0 B@1@0@10"A0Hf 0-L@Pf aX14D180X00X00 0-@0@LP@!h@` @!Q P` U $  K0h;C0 0-L@P@0ZB0K0hB -@PL@t8 nP00Sn00Sx0$Sy0S 80 00 03/h?80<80RP l00p0CSKn00S;x0S8y`V xp?7P0 0`"V?0⹎8008009(\`P` |!B0⦎800800`n00Sx01Sy0SO``#A#Adu!5#AY#A -@`pP  M L! b00 0AK/e -` :@:p#FLMP!|IP P D180 0S9@A VT0`0 0 E$K/e 0-(0L@#0\!!@1 D1800S 0( $ S$0D1K0h/e -LMp`;PY@Vş 4t%<$  0 ?F V Z8PP0@@K0 KK00$Kz> -(0L@#0t!!DaP8080000P KhA0$00Kh/e -`L4MP <KV%0 <0K匄@Pg p I0 00ㄡZ PpP0 <K pP ` p `p@ <K&a0<0K 0 /0K@0 ;`K00@0<KP0 p0 P`` <x0p0`t0p 0pp0p0l  `(`p$``pC(K N -LM0K0 0 " K {> -` 0L!@<!PP P  0KhA/e -p P0!LM`!d@P`P D180 0@ 00 00A K/e -L(0M 0 0  g K!! -00ML06 0 0U K!!  Q0-L@  Q  Q Q  Q P 00 03/0d0?o ,0cT$< =00q#A~#A#A 0-LMP 4  \d @@  000 p @@   000 IK0p -LHMp@`TPKXK0   000V0(0 0 QP V,`X0S$[Q0["4408#80S0?0S 0 0RS000P  R0>0$K -p :`: #6LTM! h0 DQh0@8)0!00#R00SV #V. #V3 #Vo  V  BV  0SX00P0 T0@ pP80 H R0 \Kh 0QO``K `0\ KP`0\KS\0K\0K000Y [Z [PP%PSX0 XFH 0` 0\ KP `0S\0K000\\PJn H RC0 \Kh0 P$h0` K 00\ KQPZ`\0KP00        R! %? P 0 \ K[ K  0\ KDn1 \K0\ KDK(-&$! @1 P @1P@0`0@10 0 0@P 0 0 0; (K/epdpd td@udp -LM@`~ P*0Dq( 8P 80K$<60K$84P 50K3@K$4@40K&4SK10K0`K0800D0p0L080KP0 0T00$K -LDM D0`0 0x 0R80 080+P@ 0T@1 0@1$p Qt A pD`000$(0UX T$$f\  4 ) V` `X0[$KM@KO0K\0[P`KLpKN0KPP@K=U$,Td  V(`*`H D $Kd [C@KH`KF KX [@pK PE K\ [H@KD K'$A K  <Kh0 %,V``: K%(9 K7PK%$Pd0[8 K',60KX0[2 K'(50K\0[1 K'$40Kh03@K<`K0 K/pK<@KS00 00p$`vP 0 0D0p0PTPXp\`L0h @H0H  0#@`00(K  `d|! -L`M1PS@c< 0D`K 00K p4 00000DT0KjP` PL0[M [4 0 DP< 0@00 00l0h J[5:,G[ `I[K[0(` 0H[p$0fK SRWVQ! HF:&K!  0#$+4 $0dKD`p0a60# `0 ` K X0 \0 T0 P0 L0 02 D T0K`KX KOP PQ0[S L0[0S S T0Kp`0a J0[K [48I [0d0 -dDP$0 TK`0K0 000T K Q]P`0S$[Q [T0K"4$T0K(0"(0R 0$( d dDP<d0 d&7#$+4 $01S (9D00(0SD1 80 HP  P  :P  3/P@00 000 5:0>00  ?> "T1 (0P1,0H100L140F$Kp#A N#A -L Mp` @0P 01☶1S40940000 R R   H0S@10@1p;!; .0DQP0L100P 0X00080 080T;;40 }PP RlP;U U UT`d^ 0# (K! T1(Kx0P10H1L!;\X;<;FD0 @ԌP0v;KDdC@{> mA#A=$AK$A!l!E@ -L@[ DQ`0p"PE$*@*"F9@A0T S  0 P@ xP& @T#808@@.O@P RP80080X .=80080@0@-p` \ TJ@80~SL,%DP, $@ 0O @P 01O@S 0-(0@#0L!,!S$7$ 3R$0K0h/e 0-LMP@( K00K@00K0K0HK0 5$HHK03/P l:8[ 0[S [  0([R hK$ h K:K00u]$A{>$A -00ML06 0 0㜈 K"" -L(0M 0 0  劈 K""R/00S  0 r 00bo///\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -L MpP 0 1@P:  0 `a0i  7@0 01T+D`5 03/ ,Us,44(K0"{>{> -@Є$ 00gL00-(7PS00 < 0( 00 'R0<Ա0<ı@<0<0< 0< 503/P P P0  $Kk 7d"$A 0-L@tPP 0YP 5(W0C55S0 -(0@#0L!!#R0P `$p( QP0700K?P $0SD ( ": :#6)01Sr> C P3( Q :$07     ^08< , (,* *"&9 1S 20`[ x$Kk$00$Kk`/e -L@dPKh -@Pf/L$7Qq~(0<⾀0`,`'@ 0?S^P48`P00 0o tk SR0<0>4040X0000< < 8 0 00 $A$AWEV -L M@ሠ - <40S +$000CWPT10 v#zf0$A$A mA@JiAA -LMT@Ux 000SN""""!" ""!"#"P""`q `q 0S 0 `q`|q5 03/`\q0 00L00 (7S0/5,-5V (7S0(71!0/<@(7S7000S$0  R0 &a 8s>   '  K50504K$A$A%A%A%A@ AC@d"%A -LMt`pX0 ZZ0%VH!@P~ 0(00 Qt0$ P0`pn w ?#K9PQ00R0 R0Z0`0pS 005 0p3/4040m <  ?0`p0 'R0<Ա0<ı@<0<00(0 0전0503/P P P$5QH&"&"%"%"%"S4 xP4h 5 LC4 0 (K蜐d/em%A4%AF%A%A%A%A%A%AC@ -5L`0P3/P@ P P l440S( T6M@00;00E0@0 0FF4 @%A$A -LM`P@P 0#50S5 0`4 4% 66 P h60K  V~ R Q Q P00 (  6Q K ηPZ00 R ? `"K K60 ,60S00 5[>0]Q 7<70q~ 7@077  Hd5 5@ ,\55 X50 0 70ǔ : S<_.0 80$7$ 0#K R7@ 0 ? !$7 Kd0000006$' !$7 0Q>0$00(07@0,00P   0i: @l0 hPX5(K!"C@%&A AL|>6&AV&Aa&A&A&A&A&A 'AF'Ad$ArA2"0"E@ - jjL&fp!@Pb HP` q> 0\ tYx0`QSU`KP0S P0S7 503/`P=0 , wP 55"707U 0(U20S  W  W H0UHP L0ULPL H00P0ށ``P0S503/Ё/e%&A 0-LM_K@ 1P*0B8s 000:  00K0 -LM_Kp `@P2*0B8s/ - 00S)_K( 02K02 01000503/P `4 1  0!R 'K4 '.K,4@-@K0uv'A{>'A p-LMdP0@S Z>0#& "S00 5( K[>0K ; S000K0K@0I0K0K0JH0 5$HHK03/P l]48[ 0[S [  0([R pK( p K H4Kp'A{>'A 0-L25@03/P U503/0 0-L@707503/0 - JJL$Fp!|9t`P@A W  W H0DH@ L0DL@L H00SP0Ẁ/e - Z0Zp%VL M`!NP%IPAPP0T 0" R@(20P: MP UP: P K/e 0-LP5@03/P  0 0S0 -LMQP`p 00`p U&40&80&<0G4H`0@p( K00K09K9K@0l0K0K0@ ` 0 9[K 09K503/P Y3'#9[ 0[S [  0)[R xK$ x K=3 K0u'A{> (A - JJL$FM!5P3-e>0 7% p$g0 P K 0 `,0Tc9@AV"Kpf W p ?p_P` $K/e 0-LJv@W$0 R @@00Le 0-@LnP0S   0  K0hGv 0-LPZ$0@T 0U@n0Le -L,M`@P0( LK$p1W X 00P5U 4U*%U$U* U)U 0U UU *9U :`0ESU U 1$QcP^Q[ 0#[  #[ #K#[8 @PK*#K3[/LK:3K3[03K04  ,?$K04K04K@0>0K=0K8040 ,000 1% 2/P010'3[= 3[01B0[ 13[ 0110 @0[? [B[04[ 0L0 0 .#4 ?0000$00h K!(A\(A - @ 0*L⊦$M*8  Pgp7`4p m0 0P 80epc5U 5U |5U+ t5U l5UMNT5U 0CU A85U 0CU*$5U 7:50S25U 5U +- ,@$ X00X0 40S ftPp4 E/ @tp~707 0x@P+40S $00024$UU0P㊡$C& @P0 @_6*:0 &00#x@707 ~4P+7P070  7P0707DftPP4 A 98S@E/4K@tC0 %P a0`SE B  SȠ *0S  ]t<p0 p 0000001D0000000 00-0! 6000 60 080~00P0S  Et 0 080,00#0 01P0,FP ḯZ$p 0S0 0KP,P@0000@n (K/ewdrdA}d(@rdAtd@udgd~d(~ndQgd""6"y -PL`@,pP 0 00000000 @0000,0000,0,000(04060I"A"M" -p@L `P 0,01 0@000  040@00  w000@0P 03/Kh04034 S040  4/0 0405080/ @  / -LMp@0 `7'0@S, P 000( D-.0 0S040Y 0 Y0'<0PY L 000( 00"-x0S 3/P2 0  40p0( -0" 倀(0 8/! 0!! 0!( 000( 00bS0ڰ0 0408$K)A)A)A*A -L00 0p +40T`86/0  0 00 @ 81P40!  g+(Ko䐟ܐ 0( *0긐0( *40  *05*508004000 0p +40T8(Ko/(K'A?B*AA*AmAA*A*A -P @Lp` U  U 00400 80@06# Kh/ N*+AAR/ 0( Pr  "/ Q0-L@ -( -0*AGA Q0-L@ , 0,0*A*A -LP@H0S0 ` pH0< S@  `V @  @  00 @X<\ U @00 @00Q!p0S< *+A -LZ@`1S H0S<S@ #" R0 oPD0P`   E00C;00囻Pe 00-@MLPP 0L0 00@@8G 0x>K0Pe+A +A\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe 0-0PL@P 1 P1001P1P1 P,0D0RAPN" 0-@@LP P

o@P0 -L`@000P000C  1S 0 eHPPp P @00QP<0U Q@00 P P )+A -<0L@SP @0Sn@@`V0,0Db+<` S@  @@ 000K0=0K>S PP^0@0K0=0KD1`cKl80 4@ 0` 0LK03/PP=3[}3[@  0S  0QQ  0Q000Q800K0C?o20S4\0 P S$ $ 0& S$ $ , R 4 40 K'NEFXPiTD -L(M0Pp@( DK,`080K03K?00 0CKsK0DK3/P3[ K -L@P0`00 0S 0( 000YKhJ+A -L0 0-1L@T? P1 R: R 4     K0hɹ,0\0S0@ " @ ##  3/P01 @$ (0R!(00(0$ ,0K0h/0 0-L@"P,@6T 8 S0Xe 0- L@  0@00K0hz,0`0S 3/P[K0hXe 00-@$01$ L0P(0101 00S K0hj1 R 0P  000㩸0 000@ K0h0TO+A -L@P`1Q% 0$pT0 R W(0!(00(0$ 40 3/ T 0S 08  000 h1 0SKhV+A 0-!L0,@0P000  !00C0000X8P<00CK0h߸0 03/0< S@ #"0µ00!<0000C0K0h00! !0! 00 0-LQ@>!P0S 0C0<0SL0 -!@L,P$!`T 1T 1T04 T6 0T 0T. @#"p@ 0S# 0S @t T``@PV @00 P@PbP - 1e2A4A3A -L,P 0` S @ <0S@ 3/@P 00C 0 -LM`@P` )`(@P00S 3 lp0pP Co  xx0  0`h0b P T(0H HyP4Kh(KC@dP"PeQzAa"\+A\"LW"E@ 0-!LD@P 0 P000000 1e 0-L,@I 0P CS <0S 3/K0hV -LM@p,`100<00J1SX03/&00,<00> tP0W %:t@0S<  R0SP  0 0  00p00fb P  Ki (Xpt 0\R00 E:,t|k KiA KPeHe+AXeg"+ALe -@LP00`<000< S@0@  |`C0 10S1 R 0S 00 <000z00<0000$00  Z00;0000,1   B 8 Q Q 1 ,03/Q(%P0 QZb+A+A 0-!L @0000 1e -LMP@,<0T@`0S P +0 (0 00$00(0&&@(K+AC@ -ML MBK0 I @,p PP00S0002/K,K P 000#H|&0<"S006Sa _ 0#[`CR&# Vzd Rt  04 .P04Z 04 封S&04d R  CR````0CSZS 000 3[S R*,%& 6 `|3[S&`V* &V V V V&&0 @00R @@000S0S00ąbP }0PP00Z (K+A mA,Af5A",A1,AF,AR,A^,Ak,AC@ -LM R@,pr`>s<0S@001Si&0<SH R@ #" RT0 3/0 @P P00S <0X Q <K@0 e @00< ( 40 8 1< K0P  @ PU @0 P)d0S 3/ P<0R @0 0Q Q@0P 0 TP r 0LR00 B84ryi@`Pex,A,AN"LeHe  R0-0LPK0h#P@@  0 K0hd -L`HP@Ir0Lp07<0S 7~rwUP,$0 $03/03/$0 `7rprrr~o31PU , P( -LMP`l@P%H %`0000 0 000000000$0 00 0 8 P5/ P KhL%P04P800@PD00P02 X02t0\@`PdPx@|PPq Hq pq q,L72p 001 001 00F1 00N1 00Vx1 00^X1 00fz81 00nq1 00vh0 00~_0 00V$0 0P0 0 vPt$ 00 0TKhC@,Az"",A(oA,A,A,A,A,A -A-A-A*-A9-Adts"E@lo" p-LMP{d0`@N P0A@d0<0 0`40^P Kphl$Kpx@QzA ~"D-A -L M`Q00@S Pm p㴡1I_ R W p00 !W00W l!Rh1U "RQ) "DD R U00QPPW  !1Q PU  !0Q 0U  !0S ~!|!0W u!Qژp!VPpP`IO R U8Pa!U ]!U (KJiAb-A@ mAd-AAh-A|-A-AvA-A-Aa-A -Lo -H`PL@Rp000 P0D0L0D0@@D@6Khp - PL@U H`7p 0R0D00 0 00Khkp 0-L 0@ pPp`0SXK0hUp0 -@p`L p0 03/p PYDpW 0Khd 0 -L 0SQ 0 03/ -L$MPjf@PI#`0`P022$0 ` 0U $0R 0P008.  p 7/0P@4 K0pK 0 `p0*8/0P/0g?088 8/0P,0 8!8/0P008i/  8/P $03/(<03/ 403/03/jf K-A 0-PL@ 0 $0 03/$03/(<03/40, 03/03/K0hH0tKX@ ,0 P $0T0  Kp -L\M@X lKe/A/A/A/A 0A&0A -0L@P`^&0% WI0SxL2"`E L<KhV 0(`VI0A`0AC@o0A0AJiAQzA -\0 L@R0%00'P&0,0^IoMOPVP(!}> -LXMPQp0K$K(D`@X tKO505K20,0 0X@ 8p 4P 0 3/U0 03/T,00 tK@0,0 hK -L\Mp`Pd@|X |K&0|K6K`` 4 RP ?o\ 2?45@T<?oU20S\00 KC' -LXMQP`@$@(@TtKX pN405K20@tK,0 X@ T00K p-L M 0 K0 0@PP 0P0 0$ 0   #. R 0( 0 0 40 0 0 03/ `(PP0 PP Kp0A0A -L@*00PP v0P80P0800 03/4P`p X`000(0V `0p`08080A1A p-LM0P@`0K P0K R[Kp p-LMP@` KP1 00K;Kp -@LPQ `9@   0 0Z`P:  0P1 P1 R004@T  4/0 3/P` 0pP`P ,000`P21A1A -0L@S00Pt`_0  oP0S 00P0P0PU: 巬<d"!B 0-0L@S 00P50  K0hC0 -LM 0Kà c  '[ K -LM 0K!à c   K -LM 0Kà #   K -LM 0K!à #   K -L MP`p@@0d@T0  P@@D @  (K -L MP`p@@0d@T0  P@@D!@  (K -@`0P@Lqi0  Khi -@`0P@LZi0  Khi -Lp0P(0S`1`@P  `P`'`  `ⰛP !i0S00(0 3/00000`@00Oi -PL@0(0S `h 0R000 Q0 (03/0.i_Kh_ 0-LN0@(0S Ph|0StwK0hi0 -P`Lh@T 0 3/@h0 ,0Kh/`8 8#4`#/ -LMp0$ @0 1 ` K␠K ``0P*5/PPU0K0`8P0 5/PPY1P0P0 5/PPI08S (Z `0 :/G_P P* X K0YKH0 00<0 $0Dp @p 0KT0 'PP$0 08S ,`V 0 006/ 1P $0 $03/ <03/ K403/#_(K rZ 0-@L<Qda R0 -L\M@$0Pp X K< XD @0 0H 弆Khp 1thp |13`P T<0 $0KT - 0-`P "N D 0 DAD0 c0?o0cS2 A 0 A$ $0 p &6[SX KU 06K0K8h0 x0<0 ~P d0 X KA$0K0vK< 8h0 jP `(Krr2 6$ -L\M@$0`p X K< XD @0 0H 弆Khp x1thp p1PP Q<0 $0KT - 0-.PP "N D 0 D>D0 c0?o0cS2 A 0 A$ $0 p #6[SX K 06K0K<0 P d0 X K$0K0vK< 8h0 P P(K222 6$ 0 8 0\ S T S @ Q 080S ///᠆,@  0-2AL0B0204A aA?Ru@0 -LM00 1`SPT1  Y$02 p0K␠K0 pp0@0*@4/@P\0K0p8@@0 4/@P`1@0@@0 4/@PP08S (Z p@0 :/@d]P @1 X K!0VaH0 @0D0 @0 0`6K 1K0`0h` <0 $00T0 =@P$0 08S ,`V 0 0@06/@ GP $0 $03/@ <03/ K403/9]T(K r -LXM@PX p|K`06K4408V`0 00|K40 P.@DOoXB@T%ꠀ堐X |K 06K$0|K08`0 V0 040 @P \0 @i   `$K6$6$2 2 J1AX1A - LP40S 3/  2/P@Z000S@  3/@PPN04`V  8 6/0$ 3/P@<a - LM P1堐PY!0`4@T  4/0  3/P@<1S2A - 0LP@0  p `` dX hP iH j@ k8`l 0ma p t=H3A 0-LXM@PX lK 05K0lKPP $0 5K02 -LM$0@P ,`P G`P C 0  P1堐Y!04pW   7/0  3/P`3$0 2 p0KĀK0 pp00*:/`PU0K0p8`0 6/`PY@8`0`0 6/`PI08S (X p0 8/WP + X K0 KH0 0D0 @0 7<0 306K$00T0 `P$0 08S ,pW 0 007/ cP $0 $03/ <03/ K403/WV KN < "4  4K0  p0K (KW`$0% # $0pX K$06K20<0 0 Kh0 aP00 3/P0p 0  1S GT1  0KpP \`L Kd 0p  kP 08 0 `6 0$0            0Ho$##|0媢P1P1 R0Y0 S  04`V 6/Z`0 3/P`  0s夠 x(t0p 0$02 p0KЀK0 pp00*@9/`PU0K0p8`@0 6/`PYL3`0`@0 6/`PI08S (X p@0 8/@VP + X KV0 KH0 @0D0 @0 2<0 06K$00T0 `P$0 08S ,pW 0 0@07/@ KP $0 $03/@ <03/ K403/tVV"KR K nK pcKz Ku KpW`0p p{ב TFS7@`4.w $)X $Y Z `P# `0K HP 0  ` S T&p@ (K re3A3A3A3A4}>21A4A`4A'4A/4A54A;4AA4AC@G4A3Ap4A -LM@p`040 ^$0 p Z 0 PPl P0 P2 0P 5/PP,0ST$00 ,NS4 s0000 00, QP 0 2"4 P2 0P 5/PPV08S (0S 0 0 0R3;:p]X |K 0`@ |K 0#06K020D`@ 40 @P X |K 0`` |K!0$06K020d`` 40 @P X |Ku&06K60|K40 @]$K -@L` PP\0 @\/ -L  -LP@ɝPBnq_pU SLPP-  -LMPhQ@x1B~0t1qo0p10d!Z?`.l \1˄00s 8100j 1̈́00`p @$FL`V` a0l!.1@<x18|10101|01x01t01nd0 @0(0K0 L0IP 8 K4AC@4A5A5At"d"""-5A"65A p-L M@hKpP1\ap1h Q V  0$K1x $K0pl0 PU :` 4(hJZ5Ah5A mAm5AN5Az5A5A 0-PLh@, 0UK0h0vd 0-LhP@PEN D 0 D (0P000 01=0" 0-Lh@PP @@(  @ @!%0#0"0 $1 -@P`x$0LA_@p G IpPCA A 0 AWpKh -`P@pLh x1Kh8 p-L M`@PЄ@?X0 0 h00(00 $0 .P 0SX0 0000l  0d $0 0X00 Kpk込$009 Kpk荜5A%A5A"d\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe04 0S  0 0 40/\e P-@L`p4Q!R Q0SP W㄁ W Z  ,i  Q  Z 0 20DQP 0 @`0pq0Q100儡0p0Q 0T0V0S 0W  $ j 5A\e6AF6Adx6A5A 0-0L@S <0h S 01 00S \\ 0@K0hQ\e P-LP`p S0 100@T 0S0 8/00@AT 0V0 8/@5A\e P-PL`0P@Po 0 P0`00 R0 4@0@@p  1S  V  R @S       05Ad6A\ee6A 0-@L 0R 040 K0hP\e-0^ / b8"8#4b4# 0b8"8#4b4#0/0@-@0.? 2,? 00#?00R0S 00@P$?  ,Ÿ.?  ,? R\ y0@P$? .? ,?R\ d0@P$ . ,R\ O0@^ 4PU @o T\ >0@^ PU @o T\ -0@P$? .? ,?R\ 0 ?\ T!?Q /o" ?P R0000舑d S 0-P@LQ P@ 0P0 -@Pp`LV W@p P` - L0 Pdđd6A/ 0- L@q <9 0S (A1 q , 07A7A&7A 0-L(M 0P0 00 @80 0 ,  (  08 K$0 }P 08 K)K0" -L~>0 ,P9/ ,0P3/Y  X ,0P3/Z  X~~X0 0 !0< pP7/ip Ķ㵣 徶 0pow0  P  r 0pH0 0@0 dPlo 0d `;(K蔁edĒd67A0AO7Ar7A@7A@B7A9@/7A7A"8A@ 8AN8A@V8A8A "/G-0(M# #Yizᣋ 0A $00@SP 0$0S !P00S 0@ 0@0 0300@@ ̠01(0=0P(Ѝ0/ᔁe -LL 0S ,0 Kh/0S 蔁e8A -0LL \ \ Kh/\ 0딁e8A0/ᔁe - L@0`S P p ,03/\ V00Kh/0S Qj딁e8AN  0O   ! "`"Рo -`L@ΙP.  ^.P @eӑ(00 Khr$k>d0`0! $ 00/de 0(0S 0`o/᠁e@0 "!/ 0-L@u  PPPDUT ʀ0 ! 0$ 0D@0I9Ae 0-L ! Kh 0-P|@|L(P`  $0dP$0 ,0KO R0 (/,0`1S00!0蠁e]9A\"d 0-L ! Kh0$/᠁e -d0dPL`q$0`Oo@dt 1,Wk10, dP2/$Kk_de - 0 !t\l0 10 1 Q      $ `10Mꠁed 0-0L`APh0d 0-(0L`A0P !30d -LPpt  PUP\0!H@a10,,q$0 `11 0 ,u9Aed 0-L@t  P  `0,`PRDw @!0!0,1,pK0hꠁe9A\" 0-@L0\PH 5/,0 K0h/ 0-@L0\PH 5/00 K0h/,0P 0 Q>0//Pe@ P- L 0,0 Kh/00S Pe9A P-0L  \ Kh/ P 0Pe9A -LMPp@p00x00 ` 06/PPLG0@a 2/y/, 0 4 8 < @ D H L Ps  P   O R0L  P4Khi0@0 0K:A:APe"0:A 0!< 0`4 0 ,   !/deeāe 0!< 0`4 0 ,   !/deeāe -_QLMpY `ARY@@KPK _YY `IR Y "!P !,080 0s  PP_Y0?Y0@ 0`00 00UV  80PZ h\0 `1P40 ڌ1/@Z4j`∀ (KT:Ad 0-LP @@@@r  P`|@00/Pe -P`<1_QL@0`AOSp _Q`AO_Q`A Lx _Q`A L_Q`AR z021 pp0 0A000S$ SKhIPew:A:A -0 @`L=_T`DPPC0P00pwP_T`D@# PPe -1xPPL@` ;Y9d p,0S \,[I0 @0P,0Up0,0!b U0  YB0!0Y00 Y Y%_UO_UO_UO_U O_U _U  Pe:A ;A;;Ae;A"" -01LP`@Q0 p R> < 0  _T`DF_T`D I _T`DCr  _T`D$BC@Az_ ㈀P(X nPe 0-<0_Q@0`A@LDA0Pe,0_Q 0`AF"FPe,0_Q 0`A I"7Pe -`p0_PpP`@C@0Lc   _T`DCKhPe,0_Q 0`AR"Pe -<1L@P01`aVp_T`DO0_T`D LY """""""p p p p d_T`DO_T`D L ,Ko -L4M0D `@0 @ p A0R0##h##h#h#h##h#h#h#h#h#h#h##h#8#\#h#h#h#h#8#\# ! 8  0B0QC11 0B0QC12080   |3W P C@P  W/08 0 < H  0(p$0   0 <8/P R̂$80S00 0 <0 9/P0S% $<0倒0L0 L0X*@03/d03/T00K4 KP0 L0 0R0@ 0R103/ $00006  8/PR<0$ 8/PI<0 $ >0>000CP0J0 080S W W 80 0c,0 wR080 0c$0803,0@00  J0壀000 0<0,P0 000S0@0@0000D0@$Q <0< 3/ R 40H3/nB0 D 0(K8d -LMP@o00 K 00`".6/`P #00!01@ 005P$  0 0\p7/h1 RO `, K  P @D,@$0|@4p80$00 40<0S01D0@ 0S 0000 Qd  ٟ0000010C? 0(0K00( 8/,,0 0(000 #|, Kf P ʑ:” 0*\, 04  K=A:Ade*=AU=A~=A=A<#40P 0S/0S<0//de -LM0pSP@ X00S- f`0  P  0X|P#3 8 40 0 f  P8400 ` @000000(KHS\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāehh p-L M 0@(0C*st1`P0d0 0 KLhPh 0SQ |Q0 K,XWPW,`VQ kQ0<00D00 87 H0R R22H0 0SH01H0VH01H0v 0`s8 4\001 @ 8 0@@0 r 0S#4  4 A 0,0@008000@@0 0S%40040bKpde -@ 2LP:D`q@pW{ 0@0 T80S0p@ 0>80T 80S808  3 <댁D.< :ZXDXkR ** * D01 "0D20LML q @0@00 q' Q!4@P4 ,W ,@ 0S#,8,Q 00 , 0 001 @ 8 08 @@0 S $Kkde=A -X2@L,P\d 5/dPX”\0\`0d 6/DX2\d ,`6/X”0d \\Kh/' 0-@LP@PP TH H`"R X2\@4/`000 -L MP`p@0X20`rx0`X?0 0 8/ P  Kiu0X”`2 P\5/ X2d ,P\5/L2X”d 0\P0\5/,qX2d ,P\5/X”2d \P0\5/X2d ,P\5/1X”d 0\P0\5/X2d ,P\5/P JX2d ,p\7/X”p1d \p0\7/X2d ,p\7/X”0d \p\7/X=\ph \7/X2H ,p\7/X1\p \7/0 tP  w- P Xt 9  xX2`"\P5/0`2 KC@@'td&>A2@.>A# 0-LP@c  P姺Pp0000/-0*T00/-0 T00//- $00/$00/ 0-@$0L 03/$00K0h/// 0-@$0L 03/І0 0-LM>0Pl @.  lP 0QΌŒ Q80T00P05/P  0 K0M>A -0L@P Lh00T0X ,`6/T0 \`X6/Khi>A -L,Mx0@ d0S S04 00 S CS4  C0 (Pd0U,40Ka F#p80 80(003/P`  8 8 0  0<0p0,051P  P(K>A,(#>A 0-@$0L 03/$003/0$00 3/ $003/ $003/$0 03/ \$0 03/@A>A/ -L$M@d1!Q `d0Sx TX00P0 5/P HId0T 0C?o\P2X5/x0 d0S S0@ <0 S CS@  C< pd0W&(P@0KapE%P:/08 K80 00 40 |0a h pT0 p} h004ò(KRzA mA>A>A>A(NA>A8d####%# 0- L@R 0P5/00 0  0-@L\P9< 5/0\P$ 5/x K0h 0-@LK0h p-L M@00P0 5/PP `<0000 `06/00 000Kp?A -`0 pL\9"9/\0"9/0"\9/\`0h"9/\0\"9/,0<"3/\0$"9/,0"3/\0!9/,0!3/\0!9/̑,0!3/@YJ \@0!9/,0l!3/\0T!9/,0@!3/\0(!9/,0!3/\0 9/,0 3/Y \`0 6/,0 3/\`=| 6/pWg\p9P 7/0\p< 7/\`0( 6/\`= 6/' -p0 L⁐\`9"6/\`0"6/@0"\`6/_\``0"6/\` 0"6/,0t"3/\`0\"6/,0H"3/\`00"6/,0"3/\`0"6/b,0!3/@`VX &,0!3/N\`@0!6/,0!3/\`0p!6/,0\!3/\`0D!6/\` 08!6/,0!3/\`0!6/a,0 3/@`V ,0 3/` \p@0 7/\p=| 7/XY\`9P 6/\`0< 6/\`@0( 6/\`= 6/' -p0  L⁐\`9!6/\`0!6/@0!\`6/\``0!6/\` 0x!6/,0X!3/\`0@!6/,0,!3/\`0!6/,0!3/a,0 3/@`V _,0 3/` \p@0 7/\p=| 7/X\`9P 6/\`0< 6/\`@0( 6/\`= 6/' -L M0 "4ၠ00 `\p9$$7/\p0$7/@0$\p7/ \p`0#7/\p 0#7/,0#3/\p0#7/,0|#3/\p0d#7/,0P#3/\p08#7/8s,0(#3/@pW ,0"3/\p@0"7/\p00"7/,0"3/\p0"7/,0x"3/\p0`"7/,0L"3/\p04"7/4r,0$"3/@pWc ,0!3/Y\p@0!7/\p0!7/,0!3/\p0!7/,0t!3/\p0\!7/,0H!3/\p00!7/0q,0 !3/@pW" N,0 3/p\`@0 6/,0 3/\`0 6/\`= 6/Y \`9\ 6/\`0H 6/\`@04 6/\`= 6/(K' 0-@L9\P 5/0\Pp 5/`0` \P5/0< ,P5/90 \K0h/ -P@epL0x ,`6/` 0;@  @@<@pW0\p 7/ 0-L00\@ 4/d0 0-L00\@ 4/d0 0S-L@P00\`D 6/0\` 0( 6/ @Kh -P@00` L 00\pD 7/ zPP0 ,p7/ -@P\ L\`06/  00\`0 6/ `KhO -L M00pS0 Y00\`\#06/,0H#3/\`B?0#6/H`LSY` 0\`"6/\`="6/ `,0"3/P `V \`<"6/,0|"3/`< Y \L"`9/X00\"09/,0"3/\B?!9/ V 䑟Y_ ,0!3/C0@S ꬁXQ ,0!3/CBPS Y,0T!3/00H!\` 06/ `V!,03/\? 9/Y$ ,0 3/რZ p3/\0 8/ᤀX ,0 3/0S [\d 8/=\@ 8/00\@0$ 8/`(K' -L,0`L!3/Po>?A7?A p-L M`Pᬽ@`0000`0 6/P qdKph0<Sg@8008000@ 0$0$0000KphyS?Af?A?AD#E# 0-L@jP 0S[  P<00\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -LM@`8PP 0 ,p7/P+ 4KD0p,P 5/0P, 8/@?0'0K%3?0(0K0+0K %V20KP4K,0K)PK{00 K -LMp8  0\@4/04 K*'0[(`[+P[? )0[?`06c0* [@@bhO4 P*@%,P[JPRX`0\ 8/0\P 5/d K\///- QP0SP0@00\$ /?A Q/0?A -0L@,P 5/ / 0`( P\p,03/0( 7/0\P 5/Pd`0 ,p7/ U PU:0, }KhPd @A@A<0S 4//D0S 4//@0S 4//80S 4//\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -L@`PT0( 0T0\`6/Kh -L@`PT0( 0T0\`6/KhQ 0-@L(P H00H00P0K0h}e -0@,PL, 5/0P,`( 6/P }PP0S   H0_ P0@0S P0<0P0H0@$ P0L  P`H0 0p 0< ,9/0,< :/  'W0L0 0< ,p7/0,p< 7/0p,< :/x't | | p$(,L0 ,p7/pH0p  p<0   iY  PH0 0S 0L0L0S@0SH0<0NY  P H0@ $ P $0L01P PP0Sj  `  P0L H0 P0<0P0H0@$iV\O PJV P`; P`P0 Sp p0gP0H0@ W T@ 0T00pG$9/ X 0HTT0 T 0D 9/ W 0\p$ 7/@P0Sʩ`P  +YU &@A -L@HP0\` 6/0\` 6/T0( \`6/L00L0J -@L`%TP TX  P`@@@3 -L M@P 0 10 \`?06/14 \`6/18 \`6/H0` ``` `@`0@p`SlW]D0W }Q <  ဗ$rP0L0{ 0\ :/0\ :/0\ 8/H0<0" H0`@00 ,0 00000040 ,0$ $00000(0X  P $P (09@ T0P `L0PP0L0@`\p0 7/p0 \`6/0\` 6/`pP0V0c?o20S 0\ Gz`FP0U<0L0H00H00P00(KocK@Al@A&@Ad{@A -L@P:`T( W  @o0h TP@0T /0S  `O@l p0\@ 4/0\@ 4/@'&@A -L(MP&@P4p0 0P 0P05/pP -0"P  >W  P>N?d0d022dh0l0W  P;<PH`\0`P`KT:L2P0P4n@0"`0P00  0 0 P0`0 P0$P0( 0,`1,P(0P$> @$0!`$0P$0$0  $0  $0 $0( `$0,P$00P$04 $0 ` DK®018@ D0 (1@0 040 d000 h0,0 H00(0 V  PH0(00(0  DK٨P{H0P y$P u 0 00P P5/ p$K@AC@Aj?AJ#@A,L N@A@A@ALG#DA AAF#5Ad)AAP0P ?R"0/ -@PPL``60T00  T0  Kh6 - JJL$F`ᏩPP 00S `p6@ T@ L0@0 `VL00L0@@6-ehe - JJL$FT^P``r6@L0 T0 0L0L00P0T06-e -PLLA@`T 80`pPH0O600P6-eP~> -PL@$``P86A@ PpW:@p6-e 0-L0L@ P R T P 0>10CB>A#>A0BT0(0C#d8   h -L000he\ `P/0 !`8 00 ,  , !/deeāe -X0L@S`# P0XPዚF#t0 0!`0`!XT P   !.#Khdhedeeāe 0-P@LXP#d0d 0?S5wH0 #2 03/P K0h0d>AAheP' P P- P)/P P"/ P  P Px/P P `P\/X/T/P/L/H/D/@/</8/4/cAAAABABABAdBA -@D`L`P+4j4 0 VvdBA -Lp@``P41W; 1W 0W V|1W t1W- Oh10S-PM J P!000C 4!000P>P0S#P: T c>LB A,A(0B\,dP00CP02 03/PP }P0$0S 0P000000P P3-eA @A A(@A ܗdheBA Q-L RCA0( o( /he p-@L00Ņ0@D0ŅPYT1$ 01(K mAJiA@CA p-LAM 0`QP @ @ 8}G/K< 0G/KrKpQzADA -p@`LVB 0s S0sPPc_oRPP! Q P P Q PP Q PP Q ܧP YY P 9/PU @`F 0-@Lɲ000K0h/ -X0L (*DA -LⳲ<1 S(NA -LM(0@S `4(0|XPP01VSV X  D  aP:@ Q , , 0 0 @ @ D  b D H0H00L ZM VN RO NL0P  cH(00   @ <(000Q?0@  Q T RC G +X00X0(P& 0,p  8/P H 0 D  p 08/P 0  2/$奱A P KxDADA -(0L@S `X/ 01S 0S P X00X001S X  D  `Q:@ Q 0 0H  2/ 0,  2/KhxDA -L MpX0@P ` l 0p 7/P 0L0P0CL P0 RL 5P SP0 KDA 0-X0LP @ 00K0h/DA -LMPX0@`p \T0S Lk 0 P P 5/PT$-TKEA  ` "ဠ0180 14 >   0<0 0< R80S800C S   $03/280  S$0 3/   $03/3/   $03/ @   $03/@080P0S1>   40S400C S   $03/240  S$0 3/   $03/3/   $03/ @   $03/@040PZ㴠:   Z$03/*Z 3/   $03/3/   $03/ @   $03/@0 P<0,0<0 00* 0S' 0 00$p7/ 0,,  P1+  +  0 00$`6/P(KEA -LM " 嫪}_K  0 3/ P~?K0>K0P`; 6/P 0 3/11 1  1 01 02 2 1!<7R01 $03/P1 0& P wK23/P1~oK~K01 K! $03/1  CRꈒ##########,#`#`##4#P0C?o!2 2 $03/!P $03/!` $03/!d $03/P< 2 0P! $03/!P $03/!X $03/!` $03/! $03/ 4EXPU$0Sp`W !$0R"3/p`2`Sq 2@lPj @bPQe! $03/ 0 !RqoKTU`B!q  $03/@o!  $03/!0 2 $03/!    $p7/ 2!4 2  $03/ PwK23/P 0 3/P02 !1001 2ZZڃ1, K Q U, K }?KU0`p; !8/U1001 01 202 !$03/P + 02 0 3/2S 2PS 2`p0 2 Q}?K0 ; " 5/11 11 2S1001 01 0 2 02 ! $03/P ! $03/CP! $03/IP! $03/SP1!001 02R 0}K3/(K FA -@LIM.MKў 00 0K/0  $!(! 111 1014!(M/Kp0>   Kz# -LPV< Q0S$ S  @@`0S 5(1$!0aV `V @T7`V  d0 S&D#И#ؘ#### ###$#,#4# \0S0 z0S Sro 0S0S ep 0Xh]0S TAU$p<Pp0XQ FB0S A:Q 5,p00 +0 &0 !0 0 x0  h0@ X 0 H0  80  (0  0  TA4KO0S K $KkFA/FA;FANFAfFA`0AC@o0AJiAQzAFA=GA0AFABFAFAFAFAFAFAFAGAGA%GA0GAVGAGAGAGAGAGAGAGAGAGAGAOBGAHAHAHA(HA-HA3HA=HAGHAQHA\HAfHAmHA - 0`P@q䡟LM00 $!0r0b?o20S (!0r0b?o20S0F/8 PU Q40 <0 P PM8 40YT<10S צ s0Sn T i@eT3@Y hJPP h ]0  0 41P041C6PdC/H010B 00 p0S00 (K~>ddHAC@JiAQzAHAHA (0- Lp0@0a?oq20S !0r0b?o20S(`F&A`C_P Q ~P Y(H"P> 0-P@L 0 P@HT00 -Lp`^H4@S DT)ᙄ@Pq 0-@LD@D$0@400S 00CS00// 0-0@LL DP@ DPP @D0@400% -L0M`QP@@D4` 0\D4 P H 0(0  RB> 0(00 P 5/P @ ($D0,4=PP2 424HU 0 PY Q 4 KBPPl^$0 4KPC <2 442, 4,23(23$24 24(4$:/P0004$0 00 % 1 41, 413131414(4$:/P0004X 0S R !0R "0R P0$R0TP5/2 $P5/PP2 $P5/pP040 40304N0P =(P0 3(P0H4{x (KC@t#eIAIA#D#IA&&H&x& &&&&D&L&0&&<%T% %X%Ȳ%%IAIA -L`@៤PhP m@P(` -`aP0L APd@P dY0d1`1P 0(1S5Q   %LAb 0-@L`d`50d10 -L`PIP 0@`1 I P KhE 0(0 8 0<00@00D0P 000400000tnh0h h|'PX000h1Kh Kh)x#eIA 0##QzAt%%%E@0S 0S00// -LM 0 R 0 R Q0 Q0Q0 Q0!S 0  KT> -LM\`P,0ph0( 6&U  U@1K#X@  $10L0 00 0HD9/pPd$K -LM\`P,0ph0( 6&U  U@1K#X@  $10|0 00 0xD9/pPd$K -L@`t2PS &V@P -LM 0 R\P 0 00 /P K脘> -L`D0@PU PV 0` P `P RPdRPf% -L M`@ ` 02 P   P (Ko  0(P000m?h00S01010p1{?0 0 9/P01 01 0S0 1{?0 p0 7/Pp ~p@01D011Y 00 L#d[MA#IA0S 00CS00//0S Rʬ  R 0%*0/ 0-LJ2PS PuP<Q  10 -@0l-p LR @ PX`t6/0 bl-p=tR B (`6/l-0p͔R0 XPB 0t5/0L bl-p tR @ XPA05/0 b/NA -@L$M`80 P *0 SP*0 SP*0 S 0Kו0 0Kѕ0P< U:0S X.0`pl-d0p R8`X: l0t t4t#8:/l-p 0R< x Xt:/p=l-Ph`R00> 0| t6/P`08 0@0 < 0eRH 0 p4 8 `8 V< V  V(V  Vt V(pV|@ X* $X S Bl-p 4R: t Xt#8:/l-p 0 R< x Xt:/l-p=Rph> p0| t9/(K 0-LM01 0 K>0S  0S0?S00// -LCM`Vz@ R 0x#P< `P <0<=2S `0#P P0" al-p=tR ( (`6/ Ptp l-' RX`  26/l-p 2RX`  t6/l-p l2RX`  t6/l-p 9RX` ( t6/PUi0RXP  5/0l-p tRXP  5/0l-p tRXP  5/p 00XP t5/Ql-p=tR0 ` (`6/. l-p 0RXPh 4 t5/l-p b0RXP: t t5/0l-p tRXP< x 5/p=l-I_K8`0Rt> 0| 06/0 S VPU0 0]P |/$ B X<Q /NA#Ez>6NA -LP@`t@ 0d 2 P L$Kk 0( 0p= t R R" R pWl-(R @ 9/APrpP*0l}D=堟< \0S`Vp0P  #P %D02 $KkC@@#eIA|#$@NNAE@/00S0Q."0/d 0-L@ᆟ R `0S0 `Sd\00 0-@LoT0 0-0 0-P@L82S 0S 820/ \003/0 0-@L003/K0h 0-@DPL0S00  T0  K0hꘃe 0-h@L RPP Q.៕ 80%0R   00C000d p-@LMP,Kr"K ?$ P00 P cR `0e@QN@@@( 40S t`8UYaKp蘃ed -LP`Ϟ0@S!0S 8" P 0

 "6==0"3?0? <,<,0 0  "3? =#=,,000  P$K0 -LMQP`@ Xpp @ 0$0K0#0K0K LĠ$K"`K!PK 0K0KKvK -L M@ 0 PPK -LM   K -L M@ 0 PPK -LM   K -LM0  K 0- LM0K0 K K0K0K0K0K0K 0K K _0- LM0K0 K K0K0K0K0K0K 0K K 0-LMKAKK K0K K K K K K \0-LMKAK0K0KK0K0K0K 0K K \0-LMKAK0K0KK0KK0K 0K K 0-LM 0K0KAKK0K K K K K K 0-LM 0K0KAKK0K K K K K K #0-LM KB$0K K0 KAKK0K K K K #0-LM KB$0K K0 KAKK0K K K} K #0-LM0K00K00K0K KK 0K0K 0Kh K #0-LM0K00K00K0K KK 0K0K 0KS K p-LM`@PP  (KR^0$0K0#0K0"0K!0K $K( K  K 0K0K3Kp p-LM`@PP  (K2!0$0K 0 "@KDD!@K#0K0$K( 0K K K KKp -LMpP@`P  0K !0,0K 0*K)pK+0K0 (0K0&@K,KDD0'0K%@K$K -LMpP@`P  0K ^0,0K0*K)pK+0K0 (0K0&@K,KDD0'0K%@K$K -LMpP`@P  (K!0$0K 0 "`K!PK#0K0$K( 0K K K KK -L~MKKK"K KAB$K KK K K 0-LMPb@PKW 0$0S*  P:!Q Q 0K0 -pLMP K`v8@P P  0堬0 @P 嗬00K 0-LM0K0 0K0 K K0K0K0K0K 0K5 K -@LM`p 0P@0 U % K 0-@< 40L0P MK0h0dQA < 0-@0L0@, *TP 4K0h0dRARAT 0-LMPK@KP 0St 0TK0 p-L M`SP@$K$K$` $KP 0S Ut 0TKp 00 \ 0S0 S0/ -L`p P۫0 @P ҫ@@ 0-LMKAKK K0K K K K Kq K00S/Pd.RA -LP`p@0@T  0Kh/0 Pd9RA -LpP`H0@T  0$Kk/0 PdFRA0!P/0m Q0-L@ ( 00TRA]RAoRA p-LLM@E 0 D00 I ăF0GPH0@ < 440 D0 0@8 X , AL H ( BT0 P0 $ ex0X Kt0p00@0Kk`P $0d``0h0p0S Dp -gᒁKp5}RA#RA -@PL`P> S   0JP0 KP tQ --CxQ -'C0SED X0$03/0S 4GEF0D 4$Kh/Pd -LdMP0 @p PṪ0`Sd !R8 #"!0D0EG IF0H@ T $H0P `P 4PL0 xP 4` \ 0p l h d0 t PFXG0SD0 0Y00@0 000<0 00080 000X0 p0  r \R Sr0x K000`0K⥁0P p R 0 冑p lof0 Qd\0hh Wʺ F(K5RA(#RA P-0L  p?D@e -@0LM$0K0#0K0!0K00K0` K(PKB$"K K0K`P0 $KpP(0S 0 0KK0`$KP( 0 K 0-@Lt J x K Lp K0h -0ML0B4 H KRA -LMP @ҩp0 G F040E D040 0&Xk@ A d @0 @>0?Id H0x   h/0@@0d @0d, 00(Ko菩RARARARA -`QL@ P  }P $ sMzATRA -LP` b@ [ 0-92LPSX0@T ?K0h40⣎0 K0hQddRA #0-LM$0K0#0K0` "0K KA4@$KP! K0K K KP p2 P 0pW @Kp@-P@0 ă P*0S 0\ :`V`U@PT^ pp 0-L@ Ď PP 0S0P* R  U:0S ST 0 -L`PPpPg 08 @`PUP ᚨ 0 P 0RGS*pQ :PP XP X 0 0Q P' g00!0 P P  @ P  0RARARARA -L,MM0@SpH  ̾ 0SP0`P U8`Ra8P0TP 0080P0T0 0w:8 KCP[Y  P`` 0 P PUo0SPj 00CS%@ K:P[XP[ ѧPP0 P ZP0S P0TPp0pWH0S4 0<媎0 p@'0p#30 0PX 2`㎧ p8P`0 0 P pW:8pX wU 0p0T0 (K,SARSA -`QLMPp@@M0T ( KP#0[V  K -p0LP `90`P @  00 D008 < @p 00003/`P 0 $0,@(00000400@X# -LM K 0-@L00 H003/00  0  00C000 K0h 0-L(M@0D ( E0 80 $4 GF $0 IH $, @ H$ A B  8 KB~PP 㿦0dP`0K0SA -PL0`pXhPY>M0Y+ f@P ᜍ0 6,P0 ᓦPd" `0 h@Z`dღd`h0TSS 80 SAS0@- \|( | \"| \| \`^0@0P ^ d@ QU  ^ ^0@p0 00-LXM\0K0 [0K0Y K@ Z0KX0KW0KU0KT0V KP0`0K0T K0\K@P`0S@ TKểK0 -`$ GF $ IH $ @04A04B04 04 0S004 04`0S`0X2 Vd0P Jprp c82೔`\0S4V0ʔ$`  NR00 R0S \0B!<0S01`00 40 0AQ  000 ą -@LP G80SP0`P V8`Ra8;PP 04TP 0-`Qd'0`0tP  xP pP |Kh -LM` @T7 `0SPP0 0 0Q P0  d0qWP`0Uߊ 4K< lyP 4K ,qQ li$K#TATRA-TA -pXLPQ`0^ \ \P AX   UH PU0 X @ P  W- 0  4 P$ H \ S\ R\ Q ? -L $e -LMP`"p0S Q Q$ PP:P :Q((($0Ab03 ,5Y0`n`&f`0@0P $0   00` 6/P100008`0 6/P  0 ` 6/P`06/`P@t03/<0 3/40 3/ 0 ,ݢ$Ktd$e -LMpap0@SP Tn@X@T@y0N@0 00P@P 0 @7c@T' 00U @(0 @0( @ 0@0R  S@ 0l0000S   0 } @(0K@ PP q Ktd$$ed -LM K 0-@L 0x0  Q$$((0       (0R  0K0h9$etdd@-00^  @0 00 4Q: 0S #00b 0-LMPP  (@T  ,@T 00 4/K0 00S 00 P/ሙd -L$M\0`PD0 &0S 0S 00 0KwP B[  @D0 0TD \00 p0<0 80@0 08001S2@ 0080 p < sP1 00480 3 20t@00A   80 4#70S  º뚉"70S7/ 帺 80 p  80 p@    {@0S(<Pim m뚉#<0S  <C a80 <8 HK< P  jFꚉ"1004Q?2   80 ;80 ,  p      Rp GR Q 厺<0 @0 0P  /  ꚉ(7<\0S 03/@@0 $0S P ~ 3~0%@P Mw%@(KUA2UARUAqUAUAUA -L0@\PU `0p: Z 0Sp P @  ; [ DP 0S`FHⓠ 0\ P 勠P 冠P 偠2 -Lᝇ0p\`@P 0T <Q 0 @P -Lᄇp\0S P 崷 \0E#<@TP U`0S0 `Sd Qh 0 Bh h`Vd5d```UA R-L@P KhR `0 S*    0$PU 0$0} \}Kh -L\Mp`@P&v`P00px崸p[ 0S 0 CR H&HS@60<& 8T pP} 0S u( TK} 0S5 00CS1_0h0K0g0K*0e0K 0` KhK`p \p Xp fpKdpKcpKb0KapK_ 0^p[SW   !R000T0K`0K T0K>}_0[RpKS0K]0[Q0K\0[P0K[0[O0KZ0[N0K#_0h0K0g0K)0pe0K 0T KhKb0KfpKdpKcpKapK/ g/oR0["S R 01 0T KhKb0KapKXRp[0S, K!! R0R! <$<4Q0$W04 0 ַWᄷ0GH93\TK@0 00CS R  Bd 0` K _ K 0C^0K`KC4]0K\ K[ KZ KY KP@I` KP(B0S`P ,`P1 00S,     0| ,|0$000\2 0 0`00@0 0P ,W 0 CR S㯞0 }<@P6 78Qd AZDQBD W0\0  P H 00ᲷW00S B0&0%00 PᚷP eP `P [X pGHS0\0t(KC@A mA@RzAVA VA'VAA?AMVAvVA$VAVAVAVAVAVA$WA0WAE@ 0-@LVT0<0-0 0-L@K00 S4  Q00 Q0-L@ 儷Q 0[WAfWA -LM`P%@`0T¶Lj @ yp 0 d0 fP 0 Q0p$000X NPxP 0 S00S0p tS$   090s6 4RX 0; 3 70ԃ0 0S $0]S(0S<㠃0 GS X y  { KK嬀 P Lᛶ0<0 43R 0S00 3 3R 2R0S 0V R W RX *RY R W  2R0S^00K00K 00K00K0 0K0K0K`2 KK00K0 K00 (,P x0 3PKPP x0UP6ue U  ᅶP  p40P &p0 勐pUp@  0 P 81 K400100Kp p t4 P !0 ȃ: W( 0  0 TPpU ᱜ (0S,D0l0D0u00 '(KC@sWAE@WAWAWAjd??WAdmLWA5XAx$$? -Lpᭃ0@<0 P (P ,|`P00S 40P (40q`P @ p-@ LMP $0KT2 T -0 `R $0R0C$0 `ܲ40P ^ 0@ $0S 0    ( K(0$ 3/Kp XA 0-SL$0]S(0SGS(0S 0S S?0 (00,00/ -L$M@@p 0` P_0 08P0U80UPS ֛00<1 00@ 0 P0$q? 00P# @ `PD0. 0,0K 0 +0K$0K #0,0K0 0 (P P I`S` O`唛I 00 00800 00 0P K`+$ 0-@LP .00 P  &0 0P i000 -`@L@p 0 0 08PPEU8P KhIH P PKh -LM @Rp00`.P0 0x `0 @$K -LM00 K -LM0 Q 00 K  K0/P0 ?R"0/ 0-@LT0(1-0 p-L M`P@P\1 00000;$ K K` 0$ ^0 $ X0 $ R}t# [ WPH0 %P$dzKp@3$2$C@+XANXAVXAE@ 0-P,@L?P 4K0hy@000 0Y0 S@ Y sZQ Q Q0000 0 S `P5Ju0  0K00fP @D$10CS$1<}(K,e|fUDU@iU@pUDUvt}fnUU@0 W@ W -Lm~0> 0-@Le~T0 0-0 -L`@X~P>S (~DĭE 80 P l 0@ cXA(e -LM > K |.R! K p.R [xΐ, K X.R [`ΐ, K d>S [l1 0K0 K K -L$MpLK P@ta,0K0 0SS:0 R R0S18#(#00@ T(K -L M@ KK 0 ЊPK Q-L :0S= QQ 0= Kh0=" -LMp}P3p@0000]080 PٯᒯP KKb] q`9KᎈPa t "8SQDQ @ < 8KPDQ@S000xP<0 S OBeU 0C#<8K0,P<TBRS 6@BL80 S 080 40 +BA=S $B:<0=80K -0=80=]P. 0 !P壉. 0 n!P嘉0t!` `␉0X!`剉0 =0=0 4=0=%0 R. ,D> 0 0@ 0 00 \0P>0>N^0UT K m(KJ$C@E@}XAXAXAXAXAXA(eP?@$V- -X`P𝤀0 !`!800 ,  , !deeāe 0!< 0`4 0 ,   !/deeāe p-L M`0P KV@@ 0000C 0bKp(e -PL@0Sp` 0S姫00`=0=.R0;= B0=P. q 00PV0P $Kk(eYA -LM0@PP= 8! `K100#S< Q̠= ! pW   <= <=``  R MrV ]KP Crn&0 P  5CV Ki4 Kp? -@PLp q`耄-0dR ჈P< ` 030-! 0bP0S030= 9 b=P<= <= Yt U=0S  qD02X00 ̄$Kk[$KkCꀱ??dXL$ < 0 /(e -L9{ 0 0-@L0{T00-0 -P@`LpP V`@P V@P @U -L`P{0@0o`pP fV,`00CS0 0dpW  j0վP P ?iP[0U0  -LM\ (8#800 qP K -LM( Ƞ,Ƞ 0[P K p-L M@`=0PS  P00@ "1 `p !0 0@4! " # '0 0&$ SB$% 0` 0 0Kp -LM0S000 t00u  S0 0t0 K -LMp^ @0`PN͌ ĐȀp`PP $Kk$K 0-L@P p 0S $00CS (0S SPS0000 -LM0S ! ! "0$ B$% #0&0'0  0 6 K -LM@`VP p 0 <N- U H S I B J C K WUV0PP@M@LN@E$Q E(R E,S  OT W /p000pȠ0P`Ԑ؀`00 HP (Ko(Kld -LMP@U`p10 00"P!0#P`0%P&P$00'PS K -LM0@SP10 CR&T$tT$T$U$T$U$W$W$(X$UB000S00 0IS  o0 00=0S 0 U U00 Q70S oU x`#3Vp`` 0动Kh 0 0CS000000g004P U S0 0Kh]@  hg0 4i 8j <Ÿ SU0Bg0S0ih0j0 N0ML 8 4k  O0<#$l #(#?Q@0 P Kh,0SD0 0D0000 P  Kh 0P p<0S 0P D0 0p0R<0`S :SN000 0P  0P  0P}  0Pu  0Pm  0Pe  0P]  PU000 0Pp ID000 0P@  0P8  0P0  0P(  0P   P000 0P  0P  P E<0S :Spmjg b_\YV<0S :S00= (00BSe$(e$(e$e$4e$!P`   0 ]P\KhKC@[AYA\?)B[A[AWA[A\A6\AV\Ax\A\A?|?\A\AE@////0 0S/ 48 0/S1<11 0111@011/6 -L0MPpU@ 1U*` 4Kj0 40K0Q30K000K010K0p (0K(0    @p P4 K05/1 @04 >5P 101$K]APf$C]Am]A -\@LMK joK j( j0@2K? 82 封4r 0R P01 - j0'S00S4\03x xSS S$ $ 0& S$ $ ,@T 4"40$K芄FXNE Q-L U*A 0!< 0`4 0 ,   !/deeāe -LM`(M?040K0p30K00K0 @4K2pK1pK/pK.0K-pKbPP pW ,Ki<0 ,0 0`$0 0 ,K(0 dK?8i$ -LDM0H @ 44}H0 R }  ` 0T&lD0 @0%X@0 ,P5r0D0 q0P`+r0@0 q X ,p`(q`P`1( (<Ki D0[W< K 40K@0[; K 8 K%$2 K 5`K3PK10K9 K pp H0(  0 0 K @  p $00 00P0< K 5/0 0X 3P 0400000(K?w]A]Am$']A -L`ATʀP`!P`Q PPPPP` `&! S0 Ђa`40 p,0aa(` pa0 n,0$0R0$0,0 , S$0 94 03/$Kkdeeāe 00$ 0-@L0S0=00 ?0-LM0K00K 0 0KC40K0 K K KK K0K1 Kp -LM0  K?/ -PLB@D0p9D08 h0`0X0` 0L0 0D0@$0<0,000h0Hp0``D00p$p$8o$t$$0S8$0 -L MP0@NrUC0S.\8Q  \  \Q屡@PP T0 `(@L \XpD7/0S S0 0d0KhGA4p(`@pLPX@D4/K]Aq$S0R R00d0+A -L MP`@p@` S3q$q$q$|r$0(|  h01D021H =0R !@L(0Cl@ @ S@ 00 D4/$K0d0$Kk@q `q$]A - QLMPL`9pPG7@P 奣>1`@p0h0J 40pKg pK~<P +a0؀Kp K !9 0pKp K A1 CoKp K0 ) p0[0K6[@ S/80  0800Kp `  N$K]Ay> 0-0L@0PNq=0SZU - U 00000 00P0000 0-L@h0P@0000@ P000000000ya00CS00 x>|GB̤! 0-LPt0 @<0h0h@00000D0000@ 0040Ra00CS00r$H?aA! -L M@l0 R 0> P 5P    40R8P 0S K `?! -L4S3 P -LM00K4S ?  K  K KAK KK K0K0K 0K0P[ K 0-@LFi 40CS 4K0h70 0-@LpTP040-0 -LM4S@  K K KKAK KK KK0K 0K K -SL@\ 3<3 $Kk P PU`RUp3<3 0&00 R`# U?PQPf `&X P lP` 0-L@L _D PUo|m[0~$  s& ~o0 h {d ` K0h ^A' -P@L SQ M0PP /`P oPT ,D`P oPG 03P `P voP6 DP `P goP' P 503P 03P )03P 03P `P @oP t؞03P `P /oP 4Ǟ03033=32^AP^An^A^A^A^A ?0-LM0K0@0K0KAK KK@K@K0K@KP[K -L`P"o4@S& 4F0T0 %@ (_(RPUn<{4SP&P_ ^AP/4S/C 1 -4L@SP-3@* R RR``# 4B04)P pi 0XdU$KkNQ ' 0'` ( 0(_A -LMP@4SX3SU {R4`tVK 3( 0c3( (0#C40 (0 0#@P `@t რ 3;3404PU 0S000000C03(P 40003/3;302K$'_Af -X`P𝤀0 !`!800 ,  , !deeāe -`LP@P( pd PT 0L00+40 4000P0X00H@` \0047;(00@S`Af 0!< 0`4 0 ,   !/deeāe -@L`PX*3Up;㶃3 UU ' 0'`V` U? ' 0' ] P0S $KkaA p-LM' 0P'd@坟E 0K00`  0S Kp=`A -LM@p4`SPZ3@W R RRP 4B04P  0 `U1. 00K 00 c00S   R & 0& P0C00 0(032 7P& 0&4140 00 < +(KaA$ -4L@S# ]! `3S 2 20S 3030S <$0 :MKhd}$ -LM4@SS@P`4!p0p PPU3    A3S.? iP @K ? ]P @? d001@ 000?>0?gP @* ᕞ\0333CS /  PH0C3F7P? 3S >.  P40P00(<#lH    '3;@03J0TT KhL@<7Kh9K`A`A}$0_A$d}$`A`A -@L7^T3S`& -PL`DpTw1W o0CW* d:10SR_1W 1WK 1WVG30300SQVM0X!.0CS@G +4P@@8 #@P93 - R#  @R #   (@@ 33 b4P@ 3@ ╯@ T@ iϖoiX5i6i( -LPrk4@SK K0 C 00T37nc_N%GE3p@ l u mP304 40CS 48 /F -LMp`Pk@ 4F0T04S @( K" K& $K K ETP#K K$K( K'PK!PK0K0K %{ (w_(3PUj\HK^A -L$MpPj@P0w(<` #D 7`P [ V3@ 843XFP4 0 8; ᜃ ?  p0 S00S#`0V8P nS# S#3S 3S 3S`#4K?` p  ##Zj孙4S!`@V? |0`!@$13101010i *h1 md!2`12X120㜒2tb@1$0000 <2S " ""`X  i :JJ04 0 1Ptӛ(KC@YAK_A,$z$p_A_A_A_A$_A`?_A_A`A`Al$~$$|$Pv$$$8,E@ 0-@L 4F0 45 !20S  2   TU;0  D 8#8K0hC0 -L,3S ' 0'.i KhȘ9`A 0-@3 LP `P iP 4屘(P `P iP 墘@P 0@38P 083XP 0X3PP 0P3 P `P hP d{0 3(P `P hP $j0(33=32^An^AP^A^A 0-@LhTP0,30-0 -L M@0!  8 %0P  P$PK? -LMP@,3SURC`VK T3( ?00 (T$K(0!T _0Xc( 0T#PPFP 43;3l30l3 PU 0S000000C0B(P 00003/3;302 Kܝ$'f -X`P𝤀0 !`!800 ,  , !deeāe -`LP@P h套"pd PT 0L00+40 4000P0X00H@` \00g(僗7;(00@O`Af 0!< 0`4 0 ,   !/deeāe -LM0@ 0 P,3`S[3@X R RRS t3Sgpf (>V Ot3t30t3/t# 0K ?0 00C 0  R! `,^ 0 S& 0&0(032? pY7P& 0&4.80 00  0 =K}`A'ԙ$ -L`tg@Pz3`S 3@ 0z3\ p-LM@2>P `P "g@ `(? $`PP3LC`cSXc 5.  (`P4PXT04CH3 7P -f@ 吖(83S /  ?P87<0 00 `0<#883;@03 f4f$fKph`A`Aԙ$`A`A -LM@`,PX<}3Up;㶃3 UU/ ' 0'f`a 9U(J(0K00  P c P(0S ' 0'' 0'0S  KaA -LgMPfp@Pt2lژ` Tޘ0 3043!0  P ? ``33 $P  00V,0P ! P! 0 S,0 03,0 `Px `` 1V/P4$0Y Pt 0S00SS$S !3s $3s 3sT`$3spN  $P TU*01Km?K <w\eK k/KPk/KmKPmK` 40@p3000000e mK0z3 0 PPὗ(KC@YA?aA0aACaAWAgaA|aAaAaA0IfhA$t$$E@ -pP,3L@S`K7(1T 1T 1T33033@$00S,(0 .0CS@# 4P@ @P3A0S @S 3@ !@@K4TiiXi0@-8@ ,  Q0"P  -LM0   }P  Kd 0-@LeTPI030-0P/3S/ 8L -LM3S@K KKB$A KK K8K0K 0K K -LMCT?00K00K0KAK KK8@K@K0K@KcP[K -3L@S"i(`k(`m(`oP & 0& @0-L M 0K 0@K80K K K K K K K P cd8*K ^A -@L#`s3S1DPP `P CdP ۓTP `P 4dP d̓XP `P %dP ,当P 03P 03P 03PP `P dP 圓0P3TP `P cP l勓0T3XP `P cP ,z0X33=32^An^A^AP^A^A^A -LMP@3SXs{U{`VN 30( 'c(0#0( 0B$ !p  #Pp `c\ 4 83;3303BPU 0S000000C0w(P 40003/3;302 K$'aAf 0-LM@ 0KK0 K K8 K0K0KK 0K  K -c_柀,L@P 0lc0 U,Ko0 Y`rW<3 d !\3\!\3X\ p `P 긨@ -X`P𝤀0 !`!800 ,  , !deeāe -`LP@Pb偒"pd PT 0L00+40 4000P0X00H@` \00b4_7;(00j@O`Af 0!< 0`4 0 ,   !/deeāe -LM0@(0 P3`S]3@Z R RRppS 303P yb8 0sV2P/ (0K 0(  Y ` 04 S(0 & 0&(00(032: pT7P& 0&440 00 < l$KaAp$ -LNb@1B0 80 A83S 3`@ P gᆾ03P 81 -@L`܃PX-3Up;㶃3 UU ' 0'a` XyUT ' 0'  P0S $KkaA -LMP@cV' 0'a\P 0K0 0p! 0S K9`A -LMpPa`@P|Xt \% P <0 18c =  2 "D40$4 D 4$8 K,`P Ꮣl8<p0 S00SH#`0V8P ptQSD# SL#?0,0K 0 +0K0& K,K4 K8*0K)0K(0K'0K%0KP 'aÐp4K` ᝓ0P @`$03000000 aP J4KG` :1ZA03A 8" KC@YAK_A<$h$p_AbAbA`A$$ı$ -@LM3`SWP "4!p0p gePU3`   j $ # " P3S-5> D<~PP `@] ? H<nPP h1P000<#i `@@ ?0333CS /  TP&0C3n7P 3S /  PP3;@030XX 1Kh@@`8;`(׏Kh`Ap$`Ad4$`A`A -@`SLpUs1W0CW]*!0CW' \1W 1WV3033S3@%00SMI0@!.0CSPD 4PPP< wPP63" - R# 8_ @R #  /_ `@ 3S 3@@ d33 k PP 2iiiX -LM0   P  K? 0-@3<LP %`P _PJ "@P `P {_P; LDP `P l_P, hP 0h3XP 0X3<P `P Q_P 0<3@P `P @_P l؎0@3DP `P /_P ,ǎ0D33=32^An^A^AP^A^A^A 0-@L?_TPn030-0 -LM K"$@0 K KK0K K K K K K -QLM@?0K#40K0K KK ,ĠK0K0K K K -LMP@3SXckUpWN (0\#01K#40\3( 03 !(0` !0?0 0\#XXP` ^pn F 3;3!|30|3VPU 0S000000C0(P <0003/]3;302K$5bAf -X`P𝤀0 !`!800 ,  , !deeāe -LMS@\ 3<3   6000`bVʟ 0&0K0%0K2[8U  1[P P TX00XP` P 3<30008P#P#8   $Kk 0!< 0`4 0 ,   !/deeāe p-L M^@`rPPP +30K,30K1[88v0P33S 3@ ; /PN03Kp -@LPsW*C3U`;s3 UU ' 0']pm LEU @V' 0'0S KhaA -LMP@cV' 0']\ 0K0 0pX X0S \K9`A -LM3@@`p41 P$0KS0 0S ? #    5@ 1<3S ? 0`P 0]@ H = 4`P ]@ 希<0`3X3TCS /  @dP$X\\0p3h3dCS /  <SPhKl|0 00 0(3 00n`P d[@$ -002 00Y`P O[@  6 P ;[d׊/P 8;8 K`P 48p0 S00S4#`0V8P =[S0# S8#03S 43S 000o` P T >+3:0K,3`90K3[88sPcp X0P @$03000000ZP  ᦼZ :J03  KC@YAK_ALbAqbA?bA?bAd?bA ^A cAp_AbA_A"cA`A$L$$/ -LM0   P  Kl?03S/U -L3S3P 0-@L30CS3K0h30 0-@LZTP`ⰴ030-0P/3S/ 峾 0-LM@P# PQ?@KKBKKK KKLĠ KK3P0CS3K0 -LM3 KS0 0 0K K -LM3 KB$S K0K  K P-LpP`4 Z3@0/303UUU U U t0U hY0T TaKhO Q B7F?JcA -LM0 0K3 S  0KVP [ K -LMB40KB80K3 KB,S K0 00K< K X0-LPD \O0 K0h赉 㳉@T.' -LMC T@000K@K@K PA[K -3L@S`Y   \ 9<9 / ,Ko&  bV p VP P @PpY `Pp9<9 X    T ,KoN&* -`LP@PXs"pd ރPT 0L00+40 4000P0X00H@` \00X4Q7;(00\@O`Af -LMP@3Sf3Sc ck`LpWY 3( s(0;;Sʸ< cN<0(! /#尿303U3p0CS3;W `bX"  ż3;3303PU 0S000000C0=(P 00003/3;302 K($ecAf -X`P𝤀0 !`!800 ,  , !deeāe 0!< 0`4 0 ,   !/deeāe -LM@p3`SPoR& RRh L0P0L0]P WL 0 drLU=30330CS330 00K9 00 eN00S0C $ , 0, P00 0(082s 7P, 0,]\0 00 < ľ303i30CS3P(KaA$ -@PL& 3S#?_`3S3 30S 303L1S `$$0 7Kh;d$ -pPcL@V 04P@C@@ @ -@L`샔PX79Up;㾈9 UU( - 0-W` 姆U303嵾30CS3 , 0,  PL1S `I$KkaA p-LM' 0'P@V\w 0K00` H ;0S !Kp9`A 0-@2L3PS5$F7P EpP V`j <BP 6pP V`[ 3P i03P 603P ]03P *03P 1pP tV`4 l 00P pP cV`# ,00033=32^An^AP^A^A` -LM@`SUp},!0 PU   3   3    LY@ PPPs0S 0S/3Sx3 03 0ȻP UP 0 帻PP U xoP30CS3UK0333CS /  P2 0C3=7P, 3S /  P!0P00(<#мx3|| ;@030$6u UD}U4g K/.`A`A$d$`A`A -LPU3@S8 $ 60 0 "3p0CS39`P@ 2 o \ᶾᴱ03: ] -LMPHUp@P叇` ᓇ `P T H3d3D03 d4D8 Kᾼ`P 80p0 0  b B> h000 00VaP  00S 0R 00S 0R0` 0s 0s 0sw~3S(0.040KZP ͆ `4K׽ 0!`@*T t|1o`9p1p! (1h101`1b<1T141P181L1 3H13D13028100 2S " "=4KᚽRT :2$40 35 u0 Ptj03(KC@YAK_A$$|cAl?cA_AbA`AD$$$4$$$d$$$$E@ P-L@`9TP@303VVV V V t0V hS0T T匃@{8Q{ HB7F?JcAP/ -LM0 $  HP  K?4B0 0w -LM\ 0KC4@?0K0K KAB$ KK KPK 0KZ K -LM@pS$`K@f@P0 T@`0 @`@0 (V 嬅 K! cA -LMpPS@`0 @0K0 0xp@0 `W L充 PE_o\3R0SPU1[01K[K cA p-L M @3aS00 sPSQQQ002QP `0PYP3 S 00PMP00 DPSQ_QQ002UQ  0+PCQFQQ0020*$0 x(4 |pr)4 lpl E*4pf\# \ÄC $> 0 0>;0:00:\3\32 ~ G Ġ  0 (̌0 ̌ 0 2 G "Ġ  0 (̌0 ̌ 0K\3 0 "0!;\30 9>  9>># 0 0 Z= hT卵P @ox !? lT偵0P33CS ;. H P6033CS @L ᷁*/ H ӵP˵0p00#H4娶P3;@03d0=/PL勁7KaaU.*`A`A8$d`A`A -p@`LP_0W PP#A @R AR R  Q30# S33 4PP(00SPMiϖo -LP,O4@SD 04P P |P =n/0 P図3Pp@ 40CS4呻H/B , mEC04 P -LM3@=@SmPg`Ve \揅% ( P3( p"800W|@p0",#4 03( 0(``-Q #0   `( 3(` 000 0#嫵SP 3;3!303PU 0S000000C0N(P 80003/ 3;302 K$'f -@LPtW(U3U`;s3 UU ' 0'pT PU ε' 0'0S VKhLaA p-LM' 0P'd@/ 0K00` m 0S 0(Kp=`A 0-@PL 4SP $4S 2 20S 0$40S  0=K.K0h0d -L$MP`M@M8 (z "PP=p $E 8P \ L 0$  0B~ \3:= 40D4/HPp ?  T\3< P3 0S9;H40`h3l3d3 0A o  h~h3 `0VTܴP y\P lpl3 Q  Rd3W< o 000@ mP0,4?S00s3+$?R033s03\3`( `0 `Q.0K0 0JP02K0` A뾂[;X  0Y 8%%% % %% % % %% % % % % %RO (( 0PcQ:KQ0020Kᗼ  10PcQ!KQ002K~ ` 0PcQAKQ00C1Je 10 i00 PZ 7* J1*? J F (X /p0PY * J*? J)  0`PV*C)?J7<0PQJQ002J P 0iPQAJQ00C1zJ  <0PPQkJQ002R0 00 Nx0t0 2PcQMJQ002CJ᪻  <0PcQ4JQ002*Jᑻ  0PcQAJQ00C1Jx <0 @PcQJQ002IKR` `؅00 PQIQ002I B 0 0h P3Q@0 IQ002I@' 0 PcQAIQ00C1I  0}PcQIQ002I Y0 0 ~ 8 #8s0 n`0 `GPϺH0 `>Pƺ0 `5 P彺`0DH 0 D`'(P寺3`S"0  P壺0 `<P嚺H0 ` P呺0` `(0 0  P债H0` Pw00 8h  0 2PcQHQ002HSDF 0 1PcQHQ002H.K3(0 P,,2[o`000 P ~|02K2[X0F#40F`00 | ?00 uP x`|\3 0+ 0(4 0)40*4-C@YAK_A?<%p_AbA dA  d"``dA5dA0VdA`A$$H$|$%U$,$$8,4$E@pPp ;Pdk 2| o| @8,0p30000000000\3 h">0 m 202020r2tb10000 (2S " "`DᒫI: =n5* *0<4 PŮ0 P{(K/ -LM0  P  K?03S/H -L3S3tP 0-@LX30CS3K0h&0 0-@LtITP`⣣030-0 0-LM@P P@K0K3KK 0KKK3KK߱3P0CS3K0 0-LM@P 3S@K K#KK #K 0K0K0K0K帱3P0CS3˵K0 0-LM@P P?0K3KK0KKKK3KK哱3P0CS3妵K0 0-LM 0K0P3S0 KP [ K -LM3@S_B>0     9   < 9<9  p i1 0 $0 0$ K0K0:RU`p9<9 Q0$ K&  K?01 SVC P` PEP K p-PL M`P#mH3@0300 @   `  0 K 2[ 0[KpP/3S/ 公 0-L@A :  _1K0hFx DxPU' -LM@P3Sn3Sk ckhpWa 3( 0Js(0;;SʸÔ< c%><0#C0#0(! /#303埭3p0CS3兴W `Gl Dw 3;3303R@T 0S000000C0(P 00003/3;302 K8 %udAf -X`P𝤀0 !`!800 ,  , !deeāe -`LPS@PNGv"pd UrPT 0L00+40 4000P0X00H@` \00,G4v7;(00@O`Af 0!< 0`4 0 ,   !/deeāe -LM@p3`SP}R& RRv L0P0L0gP FL奵 0 |vLUK303剮30CS3A墳>00K C P0 o=t 0 400 l  - 0-!00 S , 0,0C0(000 82% ?7P, 0,Ys\0 00 < 303e30CS3L(KaA% -@PL& 3S#_`3S3 30S 303L1S `\$$0 &Kh-dP% -pPcL@V ,4P@C@@ q@ -@L`샔PX79Up;㾈9 UU( - 0- F`˴ uU303屭30CS3ʲ , 0,  PL1S `$KkaA p-LM' 0'P@E\suY 0K00` D ;0S Kp9`A 0-@2L3PS$B&P ApP E`f D>uP 2pP E`W /uP e03P 203P Y03P &03P -pP pE`0 tu00P pP _E` 4t00B>0033=32^An^AP^A^A -LM@`SUp~,1 ,K;0, K\  U 0 3  J F U=  5  - PPPs0S 0S/3Sx3 03 0忪P DPឳ 0 寪PP DᎳ pftP30CS3哱UK0333CS /  P20C3=J7P, 3S /  P!0P00(<#ǫo3tt ;@030$$b yD<tD,tT K`A`A%dP%`A`A` -LD3@S6 $%0 0 3p0CS39`P@ ~2 oUᯭ᭠03 X -PLMp`P# ?D3@0300 @ 0 PK K ETPK  *  K -LMPDp@PuYvv` l]v~ q`P @ 43 3Ddw3D4 d8 KᆫP | u80p0 0Bn  )000000 00Y )P l 00S 0R 00S 0R0 0s 0s 0sup3SW04 KuP u H[4K⡬ u0!`@*VC th1`9`1(1\101X1<1T141P181崀03!81o4! 3013(1302b1~00 2S " }"ᴴ 4K _C :2$r#0 3 :03(KC@YAK_A%<'%|cA?cA_AbA`A%%D!%#%!%%%L(%%% -@ p  L`APCQ  U10 0R -P L0PR* \0 Kh R ^ s9RA -P Lp1PR*\  R0 Kh R *\ rFRA/ -@`pP 0M!L! 4 @  0SuK`3e *0-*P"L@!030P l1  0K0hu0`3e -p P0!LM`!H@30P l1 0@ 00 00uK`3e - p0!LM@`!xP3p0T  Z 0 00 :/p0P 0 0 9v(K`3evd 0-@(0L(#0!!3K0ht`3e -@`pP  M L! y300 0sK`3e -@ P  LM!Dp``30P l1 00 0wK`3e -L(0M 0 0   K2%0% -00ML06 0 0 K2%0% 0-L@A |1R00 0-(0@#0L!$!3$hK0h`3e -L@P`A^ 0 Kh/ -L|A Kh~ p-L MP`qAAT 0` 4/@P  qKpvddA -L p-LM`PA1@S PKx!? 0 ,n9=m]衆eA0eA -@p`PLl-p=tR` 0 (9/\=S+`oVl-p=tR(P  5/x0PV0 `p<l-p 0RX`h 4 t6/  0 p蠆PeAweA000 ͓0 PSK&' ⋫ -@}(`JLD1嘀,012S !S 1S ܂PP P10CS1 ,⡂(0P12202`d -@m(PL 20CS22,₂KhH -@`pLMPP_P000 :40 =S=Sl-p=tRhl 6 0P:/=0 0=|=   P :40S 5l-p 0RXl 6 t:/l-p 0Rl 6 Xt:/-9l-p =R(0l 6 t3/ P Lpl-p tR(0l 6 3/0P(K4xVeA -LM@PT` =S=Sl-@p=OR@8pl @06 t7/=@M{P K-=  0=p l-0XRh 4 t/  -@P`}Lp= (t8/  \=SmpWo<l-p 8R  X`t#86/0l-p tR  X`6/0l-p tR  X`6/p 8 XP#8t5/eA 0-]Lp1-@P Xwo= S-<<l=0=0>030 eA:?eA\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe 0-\=L@S=P0C==0CS=>3;3 K0h0 -=LPS@` 2PT\=S <m =@S蠆 -LM@ !Pp P'`(0K`P"[R- 2[T  \n0 B R  0n 0  KfA.fA -@L M0K@#PTK 0-LMP@X=S 0 9 00009S|=000 KP `=[S Q Q  Q W09S(H%@H%@H%$H%@H%@H%0H%@H%8H%   K0D -L4M0@pPQ񟗇H%H%H%H%H%t7S `7<`7|=0|=vxy|=hhX K0|=0{ XK2 XK20Z Kn5[!6&R!;%[l=l01001t7GS( w20aW n2>0?0?`70?"0P K9P0[ S 00P0K V20@W M2t7S x0 L0d t7S H/oh"DL= 3/(KBcfAAddN% -MLM`A^K PE@p@#EP0U0C0S$4  S;U$4 3 Q< '0CQA  Q  QK f2Q 0Q _2Q >0CQX= "Q2 S?;A0CSNTp; 1$4SS$t X=S |=@NS |= 96M0YX=S |= 0N0PX=S |='N0GS@ |= = 9SP >S$_$$RM:L00R*LBY9L 0 $4 5X=S 0E 2PA31Q #0CQ 0Q "0Q 0QN0 6M06M0N000$4 -$0S $4 0?00b1 'z $$E /  ("( E K- * 0-L@hP  P⿒9S 9S00 70 K0hl|>%ddN% -L M`@PpU 0S # 00 4 墣4 Li00^P  000T00@@(K{fA -@L`X=S= 04p  3/=S9\]Ul-p 0RXd 2 t9/6= AP=.00 :^^ XX3XR=3 D=3/X]$Kk -P0?L0M0p2K(0K `@KPU 0 P0 P K! -L KM l0 K -PL`0p@P=3/`7 W45`7")")("(Kh@ p-L M`=PS00CS@t 0@ӕS@\ 0.@ӕn T 3 000-i $@KphKp0?s?fA -H=L@S 3/`\]U'i pP `VkPl-p 0Rd 2 X`t6/l-p tRX`h 4 ,06/ sP N[A -L@M3@@ 6= \`=S vS's)"" QPPl> JPPedpK@ t/n` V P/@U@`0  PM) Sh-d1R X#> H8=`=  S9S    PP&n PP0 S 3H Q |W pp p㤀吐n`0 PP X@`P3@ 6= U|=;|=$K !*(#D@$00|- /h'/X-R/\-R/K - SL(MP`p@7" @K.@0K DK'/"0@ KvK -L`MSpL \S` K.`0`bV  W5PT K  .X@ `@0\S K C$K -AML MB~K pG0G@$84 PPW`Wd A VS 84$@V"  VX=  V $V] V4$  V 3VP 0V3VI V3}  .0  ғ0 R00 Q0SX=S  -.0 P3V|=3V|= 2V|=2V|= X=S, W0GR0N0 #AR06M0 R0N0 AR0N0<R06M0 R0N0 VAR0N00 P mQ0: F>0  Q P\ X=S >:S0gӥNS 9S `=S S S0!v90G0 G0G 000G0 GAP,0>03^S2$ 9S# P 0 P  P9S9  09EX=S  w0 P (K%F*- -LtM@`X=S \=S|hPK =< x0 G-=P t0 00 =S >S3;3o9S YU 0S990090C90 .0=02K p 0I9SQ{P廵UJ tPU 0S000000C0婵& 0&0.0 (P 4003/x坉pP 2 0 x  xPPᆊ' 0' P 4003/05K9S.05K @   xVP;' 0'5["05K)(0R  |-   |0 p  G|0  D9Sㆍ/ P0Spx P 0!:kq(0! r("$s(0!a( t("$u(j(2 $008/>p0 p (00D100 0>0cL"C1_0K9S 101]0K|= ?<0 Zᚾ(0 3Kt01=|0 |0P( *YX3Z" 0Z! b( 0  4 0 |qP |gP 0j00 |0 g' 0'xuD10=0  0 =0C== S-8t0,>t 0>p0pW ၉(0'"(0(Kf̃?fA -LlMX=@S! w5P 3@ l-p <RXP4 h  00 l0K00 l-p=tR0 ` (P5/x   l-p=tR @ (P5/<00l0K R0P|0  0+Wg76[ 9S16[&[d[80 ;V9S&`ep[PP V"dd `PT 0L00+40 4000P0X00HP` \00& 0&l0K +0`0`< `(`3`20@@00x X$ d[,3e0[168f0[(7801 6[2("$ 3(0!08+ 008:4("$5(0*($0 9/0) 00R00S! 蚔 1P 3 : (R B| |  (\`$ q  #P`0 00m`V d0,ႡgOx0 .l-p=PR" D (`t6/=-0C==0=1 2x0` l-p=tR$ H (P5/00P0 RP0'c`[ V 0'Rf=.00 3~pPQ   ⼡P0E%=Yc0[L'P.f= -0HX0' !f=0=0 0F&>>~3 ;3x0 l-p=tR$ H (P5/<0 0Pl0K P0x&Lc0[ S `&Pe=.00 ;b44f[XPP eU Fc Bc >c l0K4t[ڜ 4c0S .c,c'cp[ 0Un'` SPQ 0,  eP0E%=Yc0[%e= -0HX0$e=0=0 \0G'>>n3 ;3Sl#P 9S|=0|=9`S 043/u U l0K6[p 06K&[000>. > 0(Z0`-W[p0 R R R pdJ p0K >p`Dp2p`fTP:> lK(>W01>0#=]x0 Y'x0 0l0K6[ 0fKE0)6[06[`0&[LP0bX T05[,06[(03[$05[ S 0P0l0KP )0>l-p >RXP04 h t5/= `3  |=0S PE80=00S0 @ 0l-=0R2 d p XPt5/(K?fAff?fA?gAgA5gA?d8eQgA[gArgAgAgAgAC@gA -LM@PX}WD=3/P0X= oo`=bS00S989|=0|=9S*@q%8q%q%dq%q%q%xq%q%q%hP > ?989 ?  `=S ? `-R9 4;S ᱮⳎ  4;  HK(l"( 4;X,1 0E(0 (9  )% 6= َ80 |=  6= |= |=  |= :S0gӥ=.P9S `=S ,s o`=S! fF P 0 0C0S000ӕ S O;"J9S 3   t?9 *> 0======`=S`V0.> >'S227m =  P  c 긂l-p tR(0` 0 3/`&aX|c080 3;@030)9R232  Tl-p 0RXPd 2 t5/W 9S `Q  9SE9Q:X+R> S4 0   4K6'XQ "JK`=S+ 04 K$|%l-p tR(0D " 3/l-p 0RXh 4 t8/=Z0=l_b]0_(K8  -%30?2D 1hA)hAI\@;hAXhA -LP`M4P@XMT  @:b 00-@2LX=PS) >S 0CS>02 |_' 0'K0h>S 0CS>`=S0 >S02 K0hI0shA -LMPp`/P A@P(2V 0CV@*2V` 2V `2V. 1V? X1V& 0VR 6$ ;@P[#X= SR 9S    tJS@FLB+-0 I@: ယ4P@33@  0 @`0q@P" .4P@3@ `=S@ )8=09 pr94P@48=X=S 7 9$K2iii6i(9i5id -L,M@ hjP@ X ^Om (ܭ(/,Fs0l-pp Rd XP2 t5/l-p 8Rh 4 XPt5/0\=P0\=!]0 P +P X  %h^ .T^0P,K0(0@ K8@P 0 P ~`:4K㠠OI,0K10S S2 슄G베YH0F KeP$[,K0RBQ10CB>A>AQ0BQ3!K. *:S< `=6S0 |=  0F K@P4[ d00|= |-`-R R: RC |-h-Rb?|= ڰRژ0|=3R98<99 <9>)/|-lh-Rj>0|=T3R2R9;998<9 9<9>  :$( H0h-|=2R 9<9> 0F KP4[S909 08 K@0 @0KP'@0S$ڸ3[ yS0 P0 80K#P0L" f4 <0>  B ᲀᶀḀ x P `_ EZ_A G]4z04 L=<4!P=1041;1 ;1<41=1=1 =1$=|I!>0 `X 6/@` Z (O#>`L1a  ,8 (F#>`0l8T H@ [0@= (K$c%hA?hAhA hA dQzAhAiA' Nv'$hA1OAhA%iA8iAMiA\%8y%\x%hp%O%"aiA}iAF?_eu'(NO+ iAiA(G%x%LH%p>%@>%Q%:%:%;%LV%f0 -T=L@S* p\}Pg`H E ]y(`,P=qpqW pt)p@ @} 0-@L,T⿆0-0 -X=L@Sj,P 3@ p 0tl-XPRd 2 5/l-p 0RXPh 4 t5/0Rd 2 5/l-p=tR(P` 0 5/P l-p 0RX`d 2 t6/@ 4S //0X#R" / 4S// -L MPo0Brg?0᳐ 0 :/3T"0:/ 0 :/? 0T1#"0:/0 T":/)4"T:/ 0 8/3"T08/03.08#80 R0003(K -BRL`p$0 3/$0 3/$0 3/$0 3/ -L M$CP0S`rԢ@aH0$H@ DPdX2> ` &P 3<300T<300W -LMpPBb3>sp?pp 09/3"0T9/ 0 8/3Tp#H07/Tp0#7/Tp0#7/3Tp# 07/0Tp #7/3S Tp0"7/ҟTp0"7/Tp0"7/?80 Tp0"7/Tp0#7/Tp0"7/pp 0 8/3"A0T0  # B 0Kr(K -Lp៱`PM @P3,(p2WE fWd RPT 0L00+40 4000P0X00H@` \00$ [T0   B0cPcX %XW010!X0%X 0 Ę0; p0@ D0 p! ?o?j?`@P`P 00-@L TP5/0TP 5/0 $P5/P 0 $P5/800 -LM K K 0-0@S@0008L0TP <5/80 $P<5/X0 0008<S 0CP  S0ԕ 00ĕ0TP5/08 00T0<K0h/0 -LPp$X0@`6@ 20S R 3/00X0@0 x0 0 pP 03'0.xP. Ɗ(@ 9Vx`?HeTde 00 0Q   @0 0 <D 00/ -@HPL80 $`<6/ PU 80 $`<6/P -@L08 S@00TP<5/0S80TP <5/X0 80TP <5/80 TP<5/08S 0 XP<48 #85/0TP 0<5/80 TP<5/80 TP<5/80 TP<5/80 TP0<005/80 TP<5/PU'80 T`@0<6/80T` <6/8/0T` <6/8 0T`<6/08 p1TP< S005/8 T0<Kh/0Q@00000/ R 00 0/S R/0Q00000/ R 00 0/>0 000Q  Q  BQ 0  0000/ R 00 0/lt - LM!?T@p8PP 0S P  0$` 06/pz0  p`n1T =_PhV&1TA 1T9 1TU:0T<t1T/ Md1T$ \1%$:81T+ D1T4 <1T' 41T:51T 10S. l(0T %;I\000\0ٛ ` |ϛ> C X `$K`1e\t]t@yt 1 xt {t 1@Xt@1(@jt@1(108_f-0S 8<0 <C<      000T0 / -@V_L`ዛ000P1  ᾛ0  sX0 @0 000BRS000R08 @000T`<6/᜛0S 3/00d @ -!L?`,@P0@ 003/d0S P 0@0S`1e -0P#0L!`?l 0@S mP(p 4P$0WS\0X0@ 0990p1WP!0R똀V@똀0B 000 X0      ?   &   +    +           ( Rp!R  R  I R㜐v0 R0 0 (0KS0ږ S~0A0R0000(0l1(0p10P100  R 00 0,08d0h00 00000I0 000p0 0d h0ᕚ0S000003/XS0SP PsL`1eHd - :Ll0d 0 0000000003/,XKh-oAaARA%! 0-L@#0 S !DQ0D0000 -L`@P0T 01DP@mP P 0-LP\@pK0hr -, (pLPh`P 0@@ \00 $P,5/ 1 00000003/P00000@- -LMS( p@Q ` `V 0 S0 ()0 (PP (0@L@ 0 (P 0D (KM@T!C000$KdsoA -LM,@lhp(P`PLP\0u%p<0 04 PJ<0S@0Qt0S 3/0Tp $7/ _> $0,3/p@00St0S 3/0T $9/ E> $0,3/@0 R@ < R 0S@0 #K`@@0 R<0S@p@0 Rp0z>p<0W00SQ@07#  h @ 0S 00/KP $2 $"0K00|@/K {Ps (@0 0Qp d7t0S 3/20_000 T`$6/ =X0T` 6/0T` 6/ $03/XP@0 004 $03/P@ `0`p  T0(0A>A!0B30@000(0nh " 0 ,Kokd& -H0L@`0_p(R(0ShdKhQ -H0pLP@o0 S * !R P0R,,(6Q Kh4 -H0pLP@o~0 S* P!0R0 0(Q Kh -H0pLP@o~0 S * !RP0Q,,(~Q Kh -@H0pLPo~0P S,( ,80 ,S* !R0,(0,8~Q Kh S0-pR@Q0^P.UPEVL`P0W *<PP 0Q04@库10pM~0U*01S,(P ,8~ 0HX 000? H00000 X ? -@@H0P`00BX@1p$FS@!@LZ@U*PAEA 00Dp帄1(0PU 0}08 00PE2~@D -0LpL0T`@X 0 P v8 S5900 0 u8S   P /n1|P 0W0  0 0  00u R 0~10CB=A=A0B1x AxP0,( ,8L0(( (8,0S0 0 00, / -LMH0QP@0pL` l0 hoc(0S(p8S000  0 uppE8S59 00 0㚏~uᨐR}p 8 0 8P0 80X0`2 \:/X 0\ \:/3X 0300 `2\:/X 0\p \7/~ p0S B`}8dpS40U,0 S040 8S Pmꙟ ?}0P  呿 80 |(R'8004P 4pX 8S 0 0t 0 0t(0 R%)00 00t(Koe(KdpA 0-PH0L@O|%K0h|<0S@ @ @0< / -LMP |V '~ 0 t8xS``g`@p@0 tXp`2  \8/X0\ \8/3X 03p p`2\7/X0\p \7/pV &1?0X  V ,0S,80,H @Tj4`V (0S0h b0布S  8S   H i3  8S( X000 3( ,40Vt @00L8S 0  t0X0`2 @ \4/X0\@ \4/ X0 X0 0(0eD`$VpW(0S0ha4 @X00aX0000pd0(@p00 040 00 8S00 >0#>00S 0(0W((0S%8S00| 80 S000< .448#8C^0: #:04  P040  00040 W(0S400d@dX" ,0V < 0 ( s@8S`5`@ 0 80ws$p8S`&`p T,(KpA -(0LP0S $Kk,H 0p ( L@  0 Ms8 S5900 0As/d`lD0Ue `Fd8,S(0R%)00 0 $Kks;pA -`p0L@L0PW 0Tp  0  s0  0 0  00rk8 SL0(( (8 0-P0L0@P0,( ,80 0-P0L0@P00( 080 0-0P0L@P0,(T ,8K0hxr -@Pp `L 0 r0 0 0 0 0rP0SY 0   Khr -L M0`00 0PHT  $00  S4 P@4H0  P04H08pP  ZLp P 0P(0, ^ ꠳"렣P 0P 080@S 0 \ʠD40  40\:00D8S0PP8S0  rZ Z Zq 2 H0T0q@Poy$H~\2H0@0s0S @*@tQpA @t0 S*  p RP110?Lp00 y 1|B 0 0  0q 0 0 0qp8Su 0  qy 001x XxTX4@0@H000P0T0X@ry#Ly0OH0ey$yY oXy,80,yt@(K?0SI0L0 0JT 8(S"(25 "% `8SZ8,ST8S00@L04,0 #20Dp!=0<Q<1@F8@0 00}pT0 @ T0 80PL ^P8S00999!4<#8#80#0<00<0 H000 0P  80 800 (008 0D00Jp8JST08#82 8S8,S8S00@04,0 #20Dp!=0Q<<1@F8@000 pT0D 4 X0T0X000 00(040 @ 0p8,S404 8S9504 0 0 o@x(K -H02X@LP`P* pP 000`pX0000  !PP w,80,xw Pw,80,hw 0-@LT08-0 -L08 -@LP"]`WKqhlXwVwx2S '5o,P4# < -L,M@P+" xR /w +w  媱+ K\ `P/0 !`8 00 ,  , !/deeāeG- P8M0PP004P@0 00000S00br 0400S40} p.n @$dJp.n @$$( 0@`,lȠ.n`,l̠, 0 .p P0#c8  ,lʠ P0#c< 00 ,̠0 @$dH0 `0#c: @$dL@$dH .np@$dL@@. 0#@.n,lʠ `.n@,̠,<P@$@,lȠ 0#c:P,l̠ 0#<0(00@ 0 0#c8(@@$dJ 0#c<@$ 0L}00p00p`p`P`P PP@@@@@@0@@ @0@@@0 @$(0, 00 4 080 @0@<@8Ѝte k2-bynd 3expa 0-<0L@S 0C<00@ ``00S`0d00d00!0<<00 5e -LMp`@PPV  K`@ @U K 0!< 0`4 0 ,   !/deeāe -L 0 Kh 5e p-L$Mpp@ 0<K{P<K`]<0000p0v <K⟐KpHf 5eLd -8@`L\Pyp0`S奢 5e -LxMK@P KxPHPP`h KAT`1@fV$s?@ KKdKk0 0dK0 X : KK\0@0S0 000 TS KKdKL0 0S0 0dK00 `0 @ dK5 K1$K -LxM |K KHK0P0K0P 0K0P0K 0P| K\PK@`pWp@@TtX@ T HH嚠KHrAexpaLqAnd 3qA|qA2-byqAte kqA@)rA 5e&& 0-LMK7P@K0 p-L M K(` P @Kp p-@QL M`@ KP Kp4/\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe 0-LP$0@T 0S@0舝d 0-@LP 0T00 T0 Q 1S<13M:1! S!!1! XfOe,0003/K0hPꈝdYrAĄekrAf -L |0P 0CP@@  L0P 0CP80P@N @@  ?0S0-L@c. R:@cD0D0T T 0 ,2020 0\@rArA P P /  P PP0/N // -L`P40@T   P@舝d 0-xWL@U" (R  BR(13/4WU PEU4WiD73/4W 8S 0CS 8 083/ 8P80 0"0 -L Mv~0@S!P!RH 0`"0\BQP6Lb10/ R U  0 S%e 0!/ R#0 SlQ(0!V&R!- 010l8lQ*l)x1S 0P!`mMU !VVVl X 0 SVlX Q VfV`x08U} UyOhP G P@O2P K`@rArA\@sArA -LM@p0dN">0 iP 5/ cv^ d0o`000S4 P 0 8pw100&16 "6&0- R    R    R   "-" R   .R 0  S0@00p8Sphp W` 0S200\1n8^0Sd000 fc00 F8dc0S00d0P00@Sg/1!01h5bK01 R!0 S !101 S  10CB>A>AX!0B3D00@0|/1S$01$Kf.sA\@ddĄe_sAl&0.R  "-" R   vP/P/////Rܧ&̧&ԧ&&&̧&& P p7S00 4 Q 8/0S/\@ -L M`@0u_00 Pv>0S4" 0!00p눐0UW0 40 P 40X P0 0W  lp0h@TP(KAdqsA mAsAnsAC@ -L`@PP4!4KhT00000x7vnS00tq 20t7Sh8D!0 pt7S S S0<0<0;000CSP&\&h&t&&&08 08 08070B;0;0h@sA -LTM`0Ppl0 > `!M@0T dKv>hP |0 |00S8 3q0 Th7  0 Th7  0  Th7  0 Th7 0 TXU 2t0 h4 0  p K{wA@<S 0-@L{SP0@000T@ -LM<0`0 @`0P PHHp0pWppS0ppp 3SH0LQT0 H0 00cS0 B 00 j@T 0 (00(0# 0# 00 `#400`03030040040#400 `<\Kp 1 01(#|K LK gK0 0pgZ pP g  e U  |K0 | K H$~ KKl K }K lKPE00Ss`VUn  |K| K H4l KK ~0K}K lKZUU p0S 1 # R  jP|0K 0 |0K { p0W0b |Kp| K H4l KK ~0K}K lKa딠Z p1p#Wp pe0RlK 0 P0 0C0 00pgslKB0`PV c0p \K|K4| Kf(K0@wA -LMP<0 0 0 0@1 :F@ 0 000` ($ ,0t0K" SR : 0 0  *0 00000 teqe+K"p|K 1010 0 (00C0b0 l0K 0L0K00K000+K(\0K A e \K0`P @0`ਠ @d00 0唠S@1hX J4 K~0K}K   lKl KH0$"00 00@00 ] 00S0 TV 0| KKC4~0K0[}0K |K e lKal K}@0T`9 0S1# T#0 d0Q* ( 00 0 C0KC$0[~ K }0KZ  6 lK2l KN0 )0`0j0 000 0@@hy0@v lK\KP3 0@1 0 4E0 0 000(KwAwAxA////< 000/< 000/ 0-<@L1 P E0 #30000GxA 0-<@LP1 D%3 0000jxA, 40 "4$0" /t@ -@`0#800pL40040040P0 縀P 08#80  08#80  08#80  08#80  `V㸀 -L MPpP04 0@00 @Ḁἀ``h&h` X%XP 4("( 4  x008#8000  oH$H@ h(ἀ ah4 &h`00!PX%XPP%P ("(08#( '8@H$8HG0(8ᨈჇ0*400( 0㾀0`(਀(K4< / 04 8 / -LBMIOK \P `PP$PKPqU p \aEPP bLaS 10b U $@K@qT$KXDqHAT@@$pK@qT@@$@ @$@AB,$QS  P !Ġ(K'K!Ƞ!&K%K$K\$@K@QTQLD\ $K JKA\!\0S$Kt@xA -LAM@KoK \P pPP,PKPU  \qEPP bS 10b U q `(`ab,K,&,`KpaWYGaIqW``,pK`aV(QS ] P ,40,8,̠0 D@,0K0S,KQ\QCL1S00,K0S00#T0(Kt@xA -LM0S < !"  ( $  0# K{wAt@ -LM0 <@` pP 1 B(  000` 1 B1 z 10 1n  ($ 0, 0$"SR :0   & 0000@ 1$010LP, 00 440 4X28U00S0 0  0004 40 (0  0C0h }P , 28U0P001 00 pB\  000 Iaa(KxA@xAyA<N 0-@LPNP0@000$@ - L 0S44Y 0 0SR@wA -LM<`Pp@` 1  B2  10 1w 0p 3SH0L RT0 H0 0 0cS0I00 e@T 0 (0 0(0004 #4<00 0000 03030040040#400, 1010S 43 8 00 3 $(0 0K0b b# 0#("( # 0#(K@+yA -L$MP0`0S@ S S p<K  <K <K <0K0S0 յ00K-0K 0 K.0K/0KUR@<KO G$ D N  <0KbA$A G$ 6 N  <0KbA$3 G$ ( N  <0KbA$ % G$ p N `A$0H0 0P`fX`1W 0gS0! L0 @0K|L0pWc0@KP`cH0 G$  N `A$0H0 aQH0 G$  N `A$0H0 A0&qp  @KGgXP`, K0pZ  GS@K0H0 G$ . a!"'" 0 0c 0#$0 #(#<0 40 8  0(K -LMR@P<0 % `p4K`O1 01(00C0` (,0K A_ ,K 9P 80R $_$"$K p-RLMP@0  <0$`K0!` !(0 0`` `KpP// -LIM1K=K 0 00 S P@0L! H1 ,0KQH1L! ,KQP U1A 0Pa0(@@D@iQ!@a\ ,KX,K YHIX,K^..#4.PUT p1/ ?0 u0#ĠD1KCK#Ƞ#1K=K 0 00 S0P  L1 H! ,0KH!QL100,KQP U!A 0(@P@b b0R !@b H! H!Q T ( ! ,K#4", K !^YN!I^ ,K !R(PUT p10  ?0 ' 0#$D1KC!K#(# h>V0x0 j0 |0 Pa !|0E . >x ;Z hQL R1S = h R?h|0  0x0 ]P|0 p0 4UP|0 1 x `Kr<p0P4!LKl<=P =z000ioS㩒Y   -P  C%PPt t0[000l09t7S0300S000S)0 )!! 4" !P\ P a^ʐ  00 0;+*000101>0%l00l0 h0S S S`0Pa`P 1S L;  00 0t7SX&& &X& & &d&Zp03  0   P1 :0; 000Z Z 1 :*0:000h8U1 ,:`*0p:0 002S1 9 *0:q0 7/ 00 0 2"b 0 S.0002021S LKh;> 00 +HS.00C02021 LKR;> 0 PQ+ 1 LKB;P1   HQ 0SH1L1 P10CP1QP1 S0 900S00001S 3/0@0# `71 7'08Q$00$010120 0Pt0 101' p0@00t0 080  L$0x0 00S& P | oP0p0PW  0|! Q  |0 P|0  P p^ ZV t0S 80 R ,0 t3/P 1 @6T&0d6101db0S*_`P  LK0pS0S0S 0S 0SYHZ pHYK0[ 0S S SHK<K BKHK <K<K 4K 0e ,K4)(0|0 |0 SV`0Sx0 [P Z0 ZP]x]`S00|00jfS ڀ0 X4d PT0  L  $ $  P X $H `\  H `  x R   Baa  S0 0CY0]``W  W (00C8#8#4 0#4 0Vl0@S 1 3#0,3000001012 04"S$ ! ( 0 2"000101t0`'?o2< 04H"S (00(0101p0p% 0%`10`1( A ? At7pSS`7P =^@P0<0' 0'? S"P: 20 h8P@@`  @! !>$T% (N 0R]07@00 000S@@@@000OT '` 0'( ?(Vk 2S3060,)afA!zA7zATzAHzAA_zAzAzAzAzAzA{A{A+{A7{Ae{A{Ah|AyA{A{Af{A{AzARA|A%|AB|Aԝd\|A!|A||AQzA@t|A|A|A|A}A<}A0Ifd1Z0d1!  p0t 0`03000(0S R 0 0 00 0 l0@S S`70 t7?o2S 1l "`K 8t0 0@00@0 l0S 1 p1lt!0!!t140040` 1 1!01$00$0# 01P  0@00dM0 0t00l0q7/+\h10h180080t7Sl0S2S!20S 2"02D10D1S " R 0"2H10H1q0 7/lHqW 0SH1L100P10CP1WP! LK%8p R+L10L11SH 3/DX  LK 80 090 LK7  1S 3/00000 0Spp0p 0001S h0 04 p0p& 0&0h0 V d~[hRWX( (0Z`0(0!0! (5`0|0x0S 101(K -L$M@`P @p@q X `0Sڐ1`g` @K70 0H0 B@00@0 1`a 7(KP}A 0-LM,0PS@C,,0S !<00S (KO7  ,K0@@}A -LM`0@V@0Ppt0  V  V  o V 0V j V" PV V b V V ] `7t7S2SP SM t00g S, XK=Hp 2p5K2ܯ$p5KxSKTKt0Wu*0Sn S S@p g SH00H0$}P 4p 0S 04 8 < S0S0p !   0.>P00P000p<0S1Fb= 0S! 0Fb=@0S1Fb=  R1 Fb l=T [VQ1  D.Fb4=!T00T0S[Q pQ 1  -Fb<!~X00X0[@!=Q:1  -Fb<!id10d1ohxU ! c pV101<00<0  0 t7`WSl2Si    Pa H{7!Q0[R 1 lK5Q [71 v>0S`77!66`7Q0[71/5[0#  1 lK5%[? v>Q!65[?0Q 2  cPu7L0S ;!0:1`7 0 00XK00I#08 d7 Wd78d70 00XK002#5[   QP X KpP?S0 X0Ks H0`P00 00P  h8W`'1* t7S x'R ``{t W * R 1:2R`  pZ19b  R1 8k Y1S 8d)0`9 Jp W1Y 8p0) QW h R p0 Pp0 1Y 8 So`'r} 1L 7(0 8,Ch(US p M  P  PU p1 lK4  0 00 00 1 6'0 7a0P 6/W t7S ~t0pgW1 47H'0, @7qaἑ lK4` 0 G:S 0 3/P1  5@&06000t7S0q87`7 1A 5%0\6l00l0t7Sa0#W1+ 850 6` 0 C ! 0 %<5I000t 0R+0j R ! 00a00$04. R FRZ1 d40,5S !y 0@40$r0FSt7SJ ' '&' '&'&' '&' '!> 0# 4Mx7S ! 03#V Vq2 ph8U PPpr pp2 020000PP  ,H!<30SX XK3#W30 lKh8U  2"0l3,P  2"083000 [P  H2<"02h00h0 Z820S XKj3 /#  `1!q0 00>q0)x7SV V),P ?0,0Yz !|10SB tv XK83 0 45P  ,0a 6/u1 `0 b tQ`( k Qbx7S1 ]CP}A}A~A}A ~A~A0~A=~AR~Ae~Ax~A~A~A~AA<AQAiAAAAAAA AKAXAAxAAAŀAAAA"A5A,A@@OArA'AA~AAAAAPAyAA A7AaAxAA}AтA}AA}A}A1A}A mA:HAZAP~AԝdQzAW~ 0S! 0 0000t7S` h`0 t7S''&''&'&','&''! 0d!d1x7VS 000h8U 4PP2 ⧹2 02a06/!10S XKb2  ' 0S x7VSY !L20S XKI2 0 p h8U<10<1h00h01S p2"{d00d0t7Sq0 8 7/wt'R^x7S[ V0000 000 t0pg0S0 0Shx0Pp0  1S l3"Fb0!2Ep00p0K0S0"|0 0 x0 t0Q *00S S Sx  x 2S  S PP|00|0 00x0S x00SY1Fb4 0 S! 0Fb4S RP 1 t4Fb `00`0U1 `S  lK1$4Q0H P 0 00xt00t01Z0 10 `7 !p50S lKj1 /a 00 `X0 T0K ) 00S0t0 !50S8 46t0 S 60S- t00X604S X& R06 X0KX[P !60S 6X 0 `dhF80 t0&h 0C0QXK 0p  ' R H47:R  0 W0 p0 B9[at0 CV0[ p!70S7 <00U0K0 48CȠ#8t R`ࠣwQ 8(   ` Q Q`FVt !BS[ !80S 80\8(!80S 8t0 S80S| t00904S ) R0H9l X0KX[P !X90S_ 9X0 ` dhF80 t0&h 0C0QXK 0p ) RA H9:R  0 0 p0 B9[at0 CV0[ p!T:0Sp: A00U0K0 48CȠ#8t R`ࠣzQ :* 0p0 /    Q Q`FVt !BS[  !`;0S l;04;h+\RRK х1Ї45Kp00S a 6/000&!;0S lK/5[,0R0[0Q 0T0[ 0U0[0W0[0X0[0D<0 ~,P B<0,001S lK/0,Q0<0 c 0 a6/x00x00 x0/S00`'2 1S lKx/H-H=Q0P 80 a6/|00|00Z0009[?8[?h80101h8M? M? h86161 X0 0T0K 00 90P ;0|0S 4204P ;|040202 yt7S`x7S]t0pgW ʐ1& >.Fb0!>qhXW 1 lK//0V?p0  h8U<10<1h00h0F D0tS*2P  P P \   Pp 0Q1 ?Fb/0?!D00D00S! 0<4Fb8$!H00H00ḑἡ 1 lK.#0V30 ch8U<10<1|00|01 W㺟ᴢ  <P202K0202v~`7Q /  67Q`7 76`7!D/0S`77!66`71 lKT.`"Ÿ   2Ÿ h"0V0 d 1ox7So t0pgWʐ18 $2!00 200a00101 PU1 lK.0 t7S6 1 >x70CS=t0pgW ʐ1 \14!0( P1;L00L0A0a00101 P1 lK-0 t7S S h8U  1 3/400401S `p0p 000P%(K~Aԝd mA:HA{AA}A}A}AA}AQzAكAA#A!|A -p-@` LM0 K0 Jt KP-0K Kp 0 Ye 0( x2 嫹0 4QS"K( x2P8Q (RK"(   3/?mK l2K? k2K71j2K׹1GS0c2Kc"[ι0S+W*) Kù0/K0R"[R 0Q   ⶹ0   0R"[R 4Q   ⨹ e[P0pc@1pgq(K\@ -LBM1`SP% IK0Z@P IK`P I?Kp,%0Q  R ,p!0IKR1Ł!'[K -2LPS@ 0aR  6/Kh  -L M0@t7S2S KR0K 0-0L@3A0ASe -x00 -LHMP` Ah8BR0'6'6'6'6'00'<0'D0'6'<1'D1'P1'1'6'6'1'6'3'\1'0' 1'1'1'1'\0'd0'l0'0'0'h1'0'0'3'4'h6'`3'h4'p4'4'5'5'5'5'5'5',6'46'6'6'<6'6'6'6'6'6'6'6'6'6'6'6'6'6'6'6'L6'T6'`0 06 n0|7h7 n0 0}0{ ! F BQP r0e0c0a9_`75S S S`01]0P0!e R #7E`7#2<`7<9`7#=6h7#81h717`76-`7=*`7#>0#&8S3 >!0R1Ł!_!@R'dK Y@Pv[4Wd0K @Pp Whs ^K~K8. 0d0K0`0K00_0KQ<<_0K4 0  P"%K#$Kd0K 0 & 0R `0[0`0K 0%K$K d0K ༷T f@ dKYpG 6OopB1?0!6&R!  @ T00!10S 1]J1S dKXP dK-`P 1S01Ł! B2zAT dKdXP| dK`Pu  2dK^0KoY@)1 Sh0m`d K\0 "1\ R\0 \@TA z6pP R d KX`p \  b("(!DY@6@h7< 1 (R(  0#/AB0)0Q5'5'5'6'6'0000b&>9b&*9?o2 F8 ?`720x8n01:S (03/$KH @dD.'(' -LMPPp6D%@W`PF (5`R9 6@0CR 0CR  R ? Rt7   RR4R x:0Ru 4RU 0CR 0R 0CR4R 0CR`7#2 h4R 0R7 L4Rh 0CR 0CR 0CR`78 4R +0CR3#4 3RY0 3Rh 0CR 7!0CR 3R q: 0R r0RpP |#|Dqp堲d坲x7Sch800h ◶h800 80(⌶80?0x7Sh .  )++#po V0aP C200  RylNV`8h3/` P0ct8s v.RP1h8D!01008^05`4`75^0-h8?*00B0%^0"h1 ``0 P D ŵ1n^0`P V C V @`U0"0^000`7=$`00 0,0 i;00 K(0 w 0KL00 000`0( 00W`4 KF%*CE,^fd *' -L,M@|`4p(PcVpP`0P(V`F``S -' BS ? S  S  S (Sb  SI  BSE'S  BS   S  BSl'S  S BS'S. . BS  BS  S P'SD p:+ S# 4'S  BS*7 BS  S^ / BSM&S r S V00 QQpn`   (>V0S!V&R!} 010l8t7SzVs3   R< gRe <3jVd0S`D?'t?'D'P?'D'D'h?'h' p'RSh' h' M t'St7DVFP0t8= v΄0S㼀u?0X!S`  YP  Q0%"q? 0\P  t(V > V >   V0S h7  `78`7t7Sx7S`7  8`7 <`703A0AS7SV0S V0S7V0SV0S h7  `7 ; `7  ;`7^V > `7  UV0Sh( 0ծʱV0S h7 `70 `7 0`7V0S.Ұ0ѓ2DV @0SC00Q0S R0n⩞`ⲠX 0FFP0 Գ @`# VP0mVg W?B0CSa> 3A0ASV13/Nt7SP cP?t7SG `F LK⧳pot!V0LK L1R9 P$  R( S  10CB>A>A!V0BXX6X ,K R3 0B0S1 3/4Pp p22 03A0ASwW4pp4p(K-%EO -LtM?@QpP !?QA ?Q ?Q' ?Q ?QP t?Q F0CQQ X?Q> P?Q D?QD 8?Q ,?Q30@?Q ?Q ?Q 0CQ >0S9!-0 Q.! lKx7Sh( хl0Kl K l K.! lKT`> 000 `Ph0LFSZ@H'\'\'\'H'\'\'\'\'$I'HI'lI'\'I'I'I'I'xK'4L'M'Q'\'N'DN'DP'N'N'N'N'4O'PO'O'O' P' P',P'\'\'LR'\'\' S'\'\S'\S'\S'\S'\S'\S'dT'T'Q'Q'T'\'\'\'\'\'\'\'\'\'\'\'\'\'\'\'T'U'1S S S`740^`74`7400@S#P 10CSH'H'H'I'H'`70`701 `750`750`75`7!h8 /! 0B8#Q>" !:1S|7v>0Sh7  !0B8bS> Ñ!1R71S`700`71S`744!@RIlKSpPh0[ Sp[@;Yg0[S9t7Sl0K hX ᗸP [  PPh YP :3/0g [l[Pp! h0[S000ȅ%K"0 # ȱl0Kh [  Ul0K  Pp 6[S>ñ:3/U \!RlKRpPl[Qt7Sl0KP hH☫ :P @1p$ < @P gQAp!*RlKtRpPal0[0CS񟗫|L'L'L'pM'pM't7Sk [il0KR lK 0 PP _Pt'R R 1&[3/0lKP4P   @Pq lK$l Kt7Sf l0K @P_ l0[S ft7S PP0P ` ! RpP e0䈄!> 1S`7 3 31S`75`7!R R R5451S h7`7:w `7:1S`733`71S`722h'P08602ӑ 10CPW !0B8S ȕP8p%1S7 W0h0  P p WY㎐3 1S h% "ґ0( P!0B8S ȕ!I!18h7D1019`7h;괁 X KoQpP\ lKmp7 ?o2,K`QQ 6\,K@Q@A QlQ0,0K@PPlUP 0 Sv , K!@ RR! 010l8e lK‰03A0AS7St7S c6pP1 3/!RLlK尊 QpPX @ P@ 03/P; 1lK6S003/1zS#tR'tR'tR'R'R'W  pP 03/P{ z03/W 03/W 0:03/We $03/!R pWlKPpP lKj 0P f ["c Hh7I !/L8S0 .   tB \ \'\']'(T'DT' [) \ \'\']'(T'DT'C#!@)(!r)C# Y)') 108101?o200 $3t7SS!0B8SF(ĕUt7SS!0B8#8=S>2 1H:1S`7 0 0`7v>0S<10x8 ii8iiiiiii:i6i(i5ii o?) -'H @h @ >A* *i8e\@deāeeih7!H0R!T 3A0AS13/p4W03A0ASgV4``! lKP`Plp[ W^P l0Kx G 0BS !R r39S0Sy 0 SpC00WppWl Q@ lKͮ RpW:3/~=p`0 !l0KO`P t0GⴀG 0 P 0 0Gl0K GP X@p 0S`:3/VN~⩎0SE@pX0 0CS0 `74`R$$  `'`'S0`7(000>0N@00 p0SPW@@000 `P0T0 T^P`P  > 0S h7  `7 ; h`7 ;c`750000[> 0 y Hƴ`7P::`7x7St7S  `gj     hY41$S48 S!V&R! 0108l8x7St7S8(%S h(0!SSl8p8u h(0!Rq x7Spt7Sl`5 000`P D5`0 5Yʀ ! `, ! @aRa/#0 O\&`PW0a/Ꭽ0 ! 10`00  !<0 0CS4P`2  "`*4`(`&C#!A)(!s)C# Z)()C#!?)(!q)C# X)&)C# [)))C#!B)(!t)(K 0-L@M,00 `pLP(00 000$ 0 a 0(0KP0(0`0$  0T0,0(0Ka0 P(  N$KEA1BhAAAn @ -L8MP 2 !0  p ` @P$0 0,p(`A Kу0P ' $00  0,p(`A K`徃0PP" XX T0T@TP R T*03/Ke`'AgAdA @dA,fHPBXPB -`@LMPpK` 0 0, Kd"\  0p 0   Z0?o2P@@Tӓ0P(K -`pLM@K` ỬT0PK Mg0@ 0 00000TP 0 0'$K -QLM0 | 娂EQR0  00P?o2?y$@`1S0 ʀ0!`$0$   ! K h4H0$HIK0 S T QQ R-0  Q Ri.0  hQ1 pR0 p R0  R0h8`p 0 @0K\0⸀ ` 0 T 0!P#0`D#@#<  , !X0Qs#p0p0Q  Z` qZp V h(`Rj h(iT`  P  P  UT?00 ;[K  K9K̫ Kȫ0!|KR008K0cKC18K8K0K ~0K0}0K岫71G[0K2PK5K= 20bX0 0 T0 墫D1 4K?3Kᚫ3lU 13K5l #3KM?0K3K61.0K<1-0KJMPi0 e00 zpJ ` 0 00 @0T̓ Ri΃ Ɠ Rhȓ  ^1SP0  0Ǔ-  @P @ Q0  ,P @ Q 0 '(Kdeeāed\@0S/5꬝d8^' -L\M@PD @K1# 0!0p`0c_D0K$  ,p(` ᮁP0 $00!2 ,p02(` @000D KH0KᘁP'> 0D2$,p(` ?!(2 0H0KD K₁Pw>0 0 0!1$ 0,p(`H0KD KmPb>0 0 0!1$ 0,p(`H0KD KYPN> 0 0!X1$ 0,p(`H0KD KFP;> 0 0 0! 1$ 0,p(`H0KD K2P'v>0 0 0!0$ 0,p(`H0KD KP 0!0"M@$ 0,p(` @H0KD K P  <<X(KԄA\`'BdA_'ڄAAAAAAA @c▃ 0-@LP00 -P`L@T 0S00`00C0  `]@ --L M00 + KA 0-@ TLPpT c=P @d@@ CP 0000 0!A@A -L M1P@` hx 0Wppv 00,0 2Kh8 T ,KѩXde0, KAH ,KéX0, Kgl~A K mATAYA -LM1@P` hx 0Wpp; 0hh8U0 fZA $K␩0$ KhMAK mATAiA 0-1L@ 0i K0h7AzAQzA -L8M`1P@ 08`000" 0pY  >KR DKN80@ j0 80K0bKS070K"#K 0D KA$K茅A -LM1@Pp` 0 `h0V00  &K ,K0, K 0Kk0pK@KͅA  @A/ -PtLQQ 봒n I$A$Q:|f09@8 #(R \ X  #(#(00 00C0`75`7$Kk'19A'A p-L M`1@ ^V00  0"4V92 "!  0R 0 0 0 0S  0 8Kph/00@T -0S 0C8C8S0 1 \0 4v@ 000d0IfA -@L`1 0 pPU 2S :0S 3/"492 "!FKh @A -@L1 0 `//0SP 0U 01S 0 48XPh&00g/Khc/ !@AA 0-<0PRp(L@0!7G C0\@ -L`0P+VF0&8"T@@S@$ 0!S@t7S?`'@  @(@Rp 0RYP @`7    NP @<1S1@@F @=T-+ ~ !  0!  !  ?0!  x?ppl0!  WL0HH\@AAHANAUA[AB020`003/09909*= 20T1.00 0 0 0@0 01 `a R @`Pp Ki9.T!@CA\@D@ ( @0( 8408008,08088> 01/Tq'q'h'To'\o'2 028 0/202/ -LMp8040#Qd78d7 .0 41 ( ( . h  K 10-L@ `70 0 ,00( `7=`7d78d70!HAAAi!@ 0-@P8L3/K0h -LMP@` QVtxw v>0!20Q PR  BUx7SD1@ G?0R K1  .yPP0 mꮈAAʈA!@ՈA -@L`8p3/PP\00\0   p-L MP 8`3/@P\00\0. 1 0 : h 00h822h80!P0003/0990920T100PKp!@AD@ -PL`8p3/@P\00\0  h8 0 0h822h822hⱤh80!Vh8 99 -P`@L,?P, 0-LP@P hG GⅤ1S 3/0 -P@`0L0p0 k g c0?0?h80101 M? 061071 N? (Q 4r$Q 0m 0 1S $Kk/ -LMP ` p^@P 00 0ZK -t7LPSS` `7M@ iN@p,0 R0S P@hH⧝M, -L Mt7`SS@ `7]P i^Pp+0S TAT-0 R0S wP@hHt0S i V1S1 P0D D0 0PYAU+ K!@A -@m`Lp+t7S 0 hX;4P+Ut7SSPP ' 1   0 000!@7A -LMP@@@`pm+AT ݐ  ᦩP01SP1 00 0 0@+$K!@YA -`LPV;  R 0S RpsPppp`*+@T!  cP 0R01 S R 0S R  OP0 0WpP@E+ -LMPp@`* 1P @T. 0S %P000AT  P0V P @c1 J0( ( 0*$K e!@YA -L MP@U* p*EP0S0S i V1T1 0X X 0!筇 Ki*P  Ki K"@nA 0-@hLP 0h8i 4P [!048@P U!0@80 -t7L@SP m`J*088$8*hhXP 0 02222000099~0v>01p8{mt7 S13/草A -1L@` !C]Pp *t7S118888$8D*PPT p ( h8 """" 99>0?`7?0?p'RM?6!t7S`7<`7?0?`7 000  Ს Xphv> Q QG?G$KkM,"@A|AA p-LM@PhP ` էP >P 1 <10<1#"P 1 `'d0d 0PL  0 0 4`7<`7KpB"@A}AA mA}A҉A -@LAMt7S9IKin  `ߠ@)VU 83/0$0K1PPS@5p)1V6 S2 0S q $ K !RRPq 7S 6S1+ " 3t7S `7 8S l Kii^ P(6S 0SV? $~QA1 0 h20Sh7  t7S 1 0!0"52+~Q A1 f0  0S1 `76`7h7  1 x `767`7+V @%]Kh%Kh@RAsAAA"@A A(ASArA -LMPpt7SS0040 %```%1 `0"%0V  `(Ko%% r%@T 0V `t7S2  P d"|0 0X" S*x300h8T =00 0-0C024 S RU P1S080 7 H1S 0 R! 8<0 <0 00aHP 0SH1L100P10CP1B3 B0 Y 1  0 @D1P Qܑ13/000S(Sʐ!00S 0 ⒖ 8%m000Sʐ!00S 0  %%2S 0 9/000M@^ %00(K"@A=Ad0IfAƌAAQzAA -LM2@SP`up8#8S *  4( ! q0 7/ KiH92492! !000v>0SG? ~0001 0 GP202*~0001 0 |7S 1 t!t`76`7?  1 @ v`776`7pp!10S `ǔ   0 W0 K1S 3/8-8C800ᬁ0 8/: 0S 3/  Ki6AcA"@AA@A}A mA}A}A:HAٍA -tGLpT T TgP'V+ ? 83/P@`@PgV 83/P@`@PgV 29S 83/P@`hP 83/U@T 0-@L1 00 0P#00K0h#"@A -`iN@L K@Ph%hXUhH  0n 022220000990?KhA p-L M^D2 @R0Ł+P`4  1`!=P@#>`1 0!01c] G$#  #07|1 PV8080$8`1W,h08(h P( 01 0!0 15in F " " 0(' 0' 8' j^6D'@7<7VYh8 h  h'         h8  Kp#@=A\A2#@{A|A4'AAs' -L` jpp@ nPQ a0QA@ X X X X ,X8V#H@ ㄁h@&h@@` 0-P@L gs000 0u  `  t 0S"   @v w  " @x @ @0L#@0/ 0-0 0SLP@0$ R-(''\'('\'\''0 0 )  % 0 0    0    000210000 -LM@PK-`P000# <p0 Pݐ0w=0H0 82 t7S0000(001011 a pPḼ0\ \X00 0000L7S`P7HgLg0P7i$KAʎAƎA-20N 2S 101, ʰ1 016300000 Č\ 0R  R (R R  R RR R    S00t'R8S ">)R1 0 *60L#@ -LLM0P S@`pe <KA`7 t7S <0[ 04(Sᘀ.Ⰰ (X ) >Ⰰ7X 0)7R X#[7R 1 <K >0 07J000㲢p #[d7Rpp`7@@ ppX800  3S H L0S0T 0H  0b0 IR)-,@P 1 &000$Y @+0X 00@0  B    0@@  0R 0@K.P @@@T *U 0      #[ "$ (0l0 0 3SH L0S0T 0H  0bW00g0000 .@P000 0(00(00000t'R0h'4'Բ'h'Բ'Բ''Բ''0 0L 6K H <K0 <K@ 6K <h  0 0<K2  . 6K*0 0 00Z 060S  S  S#*9S00w0 00#"!# #321303ᇮ0( R00XL  0[ #Q`'S800L0  0H0 0S (H0S-: t'R8"Q  @  8 Q ( H0 9/PH01 <KQ l 81081-X 0h@ T0 0T 00L0L 0d0 H00bX0 X (0` 0b\0 0P0 d0\ H0 S11Y AY r1*P; L0 c) T vP0!`001P00P0 d0 c0 0,) 00(0080h0`0 0`0 \0 0S\0 h 000(X0aW)0P 8000000C00 P Pj-X0C1ln00 F ? F(KAD@vAh#@x#@A.ArAAPAA -LDM0 08 < 4 @ \P P` ``V``P` `PPPePfQ8@ @H D0 @Pd@}pD0jWD0H 4P 4QpP 4pWPP@P 0 0 @0 0@@ @@T@80 000p W 8<墖 <0000(Ko(K#@A 0 0- @LT@@ ᆖ0 0-@LT 02 @D @ u0 00-L @i0 -`7L@pV 00h 00 000PS R  E0000` `0 0d70 000 @-`0000P P0 00 000 P9d09#40dQ0d ì`@`7] P"0hx 0P0P00S P R L D0000` `0 0 ٕ0 000 ϕ`0000P P0 00 000 嶕P9S0Ņ9ׁ#40ŅPdAdQ@d DYA#@#@#@#@#@#@!A#@#@#@#@#@#@#@:A - L⋕ #@ -L$MP1` p 0$"`0 2W0550KJ@P000o0p0 F20080 800 W0   H00 000 0 0 a (  3SH0LPT0 H0 00cS00SA   V+@P/ 0pw(0 ` 0(08@01011011 p` 0T>00L7S@P7HG0LGP7 (K#@SAA -L$M`Q@p 1 o0)`0 9x0W W W# W W PW W W `70KkPP  0Yh80?0 000 t7`'S000 p 0 ;0h 0 G0 p7S000 +0000 0  0 000 M?0 0#40 00p000 _P$0p000 UP㌜00 0 6! 0000 0  0p000 ?t7S0 0 0 0 0 0 00 0 0`7 00 v>0S*00 000>0` 000000B0 0`70   8H(#8CQ, S ZSh JoR Y0K<0 8 PP8 <0 0Y㰠0岀0  @&80 @, ߓ 80 ( Sx1 j5 0:0j0R0(0e 101tX1 O0 0KPP 00ᰀ00(010180KS>HH}PP t7`'S000 p(  0/  h' ;0  W000 0 . 00 h u00000 0G0 0 `70   40S  0 Q 0T00 000  000b0(0j30K(PPG `'00 p 0 0 ;X000 0 岀00G 0 "1 1000110 0 `70   40S  0 00 0b0(01 0 A0KPP00000尀00(01011S ~0 P#000@z0 3SH L0S0T 0H  0bS00S 00C0000 (PPT 0 `(0w 0(00000=080a0  , R :01 / 1 0@001 PWt'R  0pp'qo 0 m1 0100L7SPP7HWX0P70LW嬈2@ @101(KfA$@SAn3AĐAAA&$@?Aԝd[A -`Lp%PP 00(0K0@ 000p4  0 -`LP|%@P 00(0;0 00`0 -LM!-0崠pG h7-@# 00 `0K PP 1S 0#1000 0唑0 ? 0t7`0 S000 0 0 ;0  000 `7000    ‘ 000 0(v00 S 000 0000 0  000 80 0 嘴80000t'R0 000 000 000 !    F  00000 010 `7   `70 2`7`7 00 0S*00 000>0` 000000B0 0 00c1 0b( 3SH0LQT0 H0 00cS00S B  b'PP 0(0 0(000岐4   붑(K<$@wAA -@LMf pPt7`'S000 0 0  ;0`7 / 8)9 S!  0"0808S !  !808099`7  P`72`7t7S^``F >P00 U!=0P U *@(Q PU0C0P0TSPbUe1Y0 ! 40  40 Ⱁ P@!|`75`71 00x 0 0S00C00S0  R  R000 (KS$@AّAAA -LM`T1P!pR@X10X11S 20 0X1v1 0 OKhX&>0_Q?UP00L1EUS0 `HaPb0PLaPa`Pa1 ` 00IV1Kh/K@AnA0 / -2L@SP a0 6/Kh 0: L > 0t808x80|7709010101/* 'H'ؿ' 0-:L@0S 3/ z:S 0K0h/0 0-hLP0ST0T    00U 00!@R 0100踝del$@P0/eP 0!/e 0-@L w0@0蚒Ad0 R  j긝dA 0-D0LP @R,X@T ؍P@0踝dܒA Q-0@P PLS B^RSh?`00dUD54Kh0,.`0dS'b-A`AAf A -LM1@pxg 4!1000$XxhXY $D'<'8''X'`FV2'''d't7S S"  Ta0 6/rt7S S  a0 6/eB0 8U:0S 3/V\'''''t'R(I032$ `3Q 1 K8 ,`7<`7hiP <10$1s7S`7  V񟗟X'X'd'd'|'a0Wa0 )W W 0a 6/0x77S}a Vw''''4'1So !j0 a6/c7Sa [V@t''''t7S9 1S6 D!Tx1D!1R 41 t7Shp D10!  08t7S G/o"03/t7S: R 2/0S 3/ 0S '047 8$K踝dA$@''\@AA5ASA_AmA{A -`0L@0SPp  S' S `[ U P IDd ?\:L 5( 0(+0  Q #21v0@ ql X!fWaV\ZU`P0dpQhNUP,KoH蓓AAAAAAAARAdPzAAǓAГAדAAAC@Af A -L$M@P` t8sP0 q?00D0 0H L 8 < 80 @ S`HP L P t8\ G4 \4q4  P4p@<P< @DƁPp \q@P tP00  P AG^pеpPD100000Z0S/o"0  (K`7Q;;`71S// 0-`7v^L6`7>0@S St7Sh!0S`7 h' 76 67`700@-\0L@ a\ PP 0S00$@ h0@-P`\@0`U0\p00LW^^<<0l$@ -LM@0 &0R!S"T#U9k:l;m<nSt7S8h82 `7  v> P1!h740!qX r Y sZt9[9 0W900 \09t7S!>0S8v>0 01 r9Y9 00 \0t7So900o9`72`793/1  t7( 0S$9o9KhKl$@d`%@A/AFA 0-h7L@ f_nK0h0 -LMh7`q Pp娐ࠈWv> W W 11@@!A0 @x1A0@@!`A0@t'R  %) &) ') ()00%90&90'90(90)91  )9 0(9 0'90&90%90010>9 ?)@A B  00  1` hpWPh8S    Z E F? Pj6 0P`p!10 00p,P(`$@ @@ @X0 000!X10P1 004p,P(`$@ @ @X 0!10 04p0@,P(`$@ @@ @nX0 400'!0 008p0@,P(`$@@ @PVX0 400!l08p00@,P(`$@ @ @P0 ?X$K@eΗAAh(֗A8AdAA 0-LMP 嗾00S|0@ T @DT \0X 0S @@DT d0` 0S @T@㔾K0舞d@e 0-@LMP j0HB0S T D@DT 00S\0X 0S H@D@DT 00S H@Td0` 0S@`K0舞d0SM 00P Ѝ/0 R C\ 0`00/0/ -Ll 0 S0CS \ ^DpUT 0S0CR$!Kh@e 0-P @L`K0h5 Te 0-@$PLA) 000Te 0-@L   K0h D( 0-0@LMsP @(&  H2 SD0CS QT T hT R `T XTH0SD0CK0舞d -LM<0PS> 3A0AS:`ᇽpHBT/ D@DT, 00S&0Kᔽ0 00sP  0S  0 o   03/Y0KpH@nK p-LM@`DPHBT! D@DT 00S0KuQ0S 3/ 0   2$0KPfH@9wKp 0-@Ll1K0h|Qs 0-LM@ P <801P 0S 0U K0@e -@ L M@ 8:4@ @4@@K`e -`QLM!4048 pP 000o4"⿬@PJ  00030K0  `0K40KsK4 K,p (p P N4Y-%P C4N "pQ ࡇ1S0 h 1@0L A04 (1(0(14$K@e1i`e 0-@LM3PPEUP 4&0#0K0  K$0KRK9$ KT P P 0@PS   (10C(13K0`e2i@e -LM0`S 3/~sp0@TP P0DS  Q  QPX U0S0CUX@@8K6 X X T 8K/D,P 00 $$K@eTe -@,0PL0,0 `E(t x0Rx0t 1x0 0S  0 00$000FKh@eTe -L,MR@|PLKS⌀`pLlMQP` |>Qx>p>Q h>UYS VT3 8>U 1CU 1CUE0  0S@0S=0:07@ T4=U( 1CU% 1CU)(@ lK| lK}l0K }0S l0K }0;0K0<0Kl0K4 0l K8Y00 |0  K1!(00R|0  <U Kp1!8|0 HBp|TD@DT  0SZ 0 80 S H@T D@DL<U|P @ lKo| lK|l0K| |3 l0K |l0K |ӹ 0l K?Y 0 Y @ lK 9@|;U!  0CUm X;U T;UR H;U 0Ud ,;U0CU;5:;U 0U0S!T lK$q1qxቄ:0AT @DT 0Y0W @lKrd:P*lUU00U0S Top1@,U0S00T }0SX |'|궁18ကX0Sp/ Y ˵9)UUs T900 p|9  0PT@P 0| 00000080#  0  ᬠԠРܠؠ4x8U^  0CU l8U h8UpX8U 0Up<8Ua 0CUH 0Upm8Uq 0Up2p8  0PT._7U#  0CUf x7U t7U th7U 0U mx7U: D7U `7U b,7U9 0U 0CUYp6U 9 7U 6U 6U[p| p 6U 0U 0CUKp37 h p3. hpp|K00 |0Kp 0CU%p3 |K⌠ "{  P|0K ,0 |0K0 k fp P5Up3  z5U- 5Up0 00 I0UpL `z0Wd00`  .`hpp0Z - 0z0d030 !0S0 0 R W0 0   36 !0S3 z. 0z3  R    0Szo(zlp00pplK.3 @`W> WO `r Ec0t01x0@t010S ؐS S p0ؐ I_0S 0S000pS 0 8_p{X\ Vp@Z - p7  pXVpFpp'TppW lKe>-<:| y  y y @P R00Q 0S101UV p0 CTp (Kiii iiAi@i ii#ii@%i@e'i'Aod"i!iXeTe:08 P R ! /  /@e !  @e-`eB.`e/`e -LM@Pp -`,0 ;0K08K<0KCKfy@0K <K4@ 0@ W`P H03cH0HBTT L0S H@T D@D lT 0@0@@PCL1@TT 03 @T @Do KT2 0X00C?o20S! 0S P@@P 0  )T 10@0 80S 3/@P1003(K@e -L M@  048<Q0  048<R'0S$ b$",R R R ȵt00S 0CS #  $(,Rϵ0˵K@e -L`P 0@0L0`0D00@0 0<0(080,040D00040,000@(((( ((( ( 0-@L K0h W -L4M0,00PSH L (PP 0p `p0qQdPP 00 @4D H 0L#2 1<0 000 Pq &4dd8$8dD#D$00h 0c40 00&h 080 8 8#<48#(#@  t0 2/Pt0 "R RV VV S  Y Q@lK\ lK 0l@Kl0KT (K -LMpP40 0 U$0(0`$0 "h@e*!4)Ġ*Č"$ Ƞ(,Ƞ"(  0 @T ^ x^^ ^t^ @U $0S PP4  005/P QQ@A(K p-L M(  @`"X",$`("(1P \\t\ 0081P  R&Rt Q P R R 0Kppe -0L S 0S0S Q*t,@ P 4,48#001S00 01 t,@ 4,48#0 0!t,@ 4,4 8#0IQIx,@Ptvf'4Ġ&Č8 Ƞ,Ƞ#80001S0001 x,@tPtvpf'4Ġ&Č8 Ƞ,Ƞ#8000!x,@^PtvZf'4Ġ&Č8 Ƞ,Ƞ#800  -L`P$㝠@PC /s00008$00(`088,P@^0 ` R 00@&P4"4 8#8 ! R 0 1  &4"4 8#8 A&4"4 8#8 1 0)J7pe -L\M(0@Ბ0SP,`|  R!d0&KP 0  00 "p p P lKuPd0@0d06[0&[4"48#86Kv"44"8P#R0 #0 30 P|KlKa 0|KᄠP (01 0H0[  10R<10S   0mP2 (01400S 0\P 0 8(0t R!  `Pw`P:   >mlRm S pSW#DRRR  R  0 k 0  0gS R010CB?A#?A0BS  0S    0 4#4 i8#<40#400 0000 (0 i i0( BgkG0,0 ,0IT0V!(210#(2 hK  0 p(KdHeH 0S!00PP  ,0PH0 '% 0%+Y8$ 0V$ & 0&YHP"'Y"H0(S 7S  PP H0 @P* 0*p xp`P0  #0(K6e7ed 0-L M+0K0,0K0xP8 ( p2K$0 0 ˏ`00K ,K@PˏLbLK7e -LtM=]= AP l TK|P \=0S S @=嗏  0 $=嚏l0 =   0SuPl l@`0@S u+ 0+`aV0V\Pl @ 04 8 < R  R c4#<S 3M. 0.hl`1, @000@S S 3 ;0S  P 1  0 L04$#48#8V!" 0"<l(S! 0!1 Q0(0 an,K@ 10;0 04 8 <0 0PlP 0SPl :! 0!h:lp001Sx0 0x R Pl p͎" 0" 04 8 <0 x0S l0`|0  0@4 8 <0 0010C0 0t0 0 0SEYB Y9 0S 0p0 p 0SRQDY Y &Y Y" dKe0c0K8dK0Sk p0SXu0 `Keآ dK0Pt0 0Y p0 HQ*+Y 0  0480P 0 e0I) | `KeY@K dKRP  `Ke et `IP  `K}e ye@K 000000S00  dK e0c0Kp0dKS+0S@ f p C0R: `KPe@KdKI0Pt0 t@K` P  @e@K t p00C $R@ RR0#"  02R0a B0 S  L:S' F @Kd0@K?0K0 0S0<0 |0P't0S ")t0 d  @Kd0@K?0K0 0S <Kd@K0Pt0 000@f s h  @hKCc000p 0p 0b0 @0S% \40S  |0@K.@P | y@K 0|03A* 0*3D0l0 lꝡ3`V 30S`ca`&`0@D08@Lll30Y0I S T  V  Z  #0S0C# H2SD0C Dx000 0S  _P % 0%@pATK ~0 40Sp lKPc TKolP M1m(K@Kt Q H0S D0CS  R TW hTT `TQ XTN QJD10S TK 8厌% 0%和lY TK )0 0ly% 0%}0l STK l0S p001x0 ]' 0'a, H0D00#x 0l3/Πohf6e@e,fğddHedep'@ -LLMX 0!(9@P`p0,0,P 0 0`(p$@ @@ @: 0!800,P  04`0@(p$@ @@ @ :0ㄘ40 0 00'!h8,PP0 08`0@(p$@@ @9 0 0 0!84P,P0P0 8`0@(p$@@ @90400 0 0!7,PP0 08`0@(p$@@ @90400 0 0!d7,PP0X7 008`0@(p$@ @90400 0 0! 7,PP0 08`0@(p$@@ @90400 0 0!6,PP0 08`0@(p$@@ @}9 040 0 0 0!\6,PP0 08`0@(p$@@ @f9 0406 00 !6,P0P0 8`0@(p$@ @N9 0405 00!5,P0P0 8`0@(p$@ @79 0 400!d5,PP0X5 008`0@(p$@ @ 90405 00! 5,P0P0 8`0@(p$@ @ 90404 00!4,P0P0 8`0@(p$@ @8040t4 0 00!`4,PP0 08`0@(p$@@ @8040$0 0 0!4,PP0 08`0@(p$@@ @80403 00!3,PP0 08`0@(p$@@ @80 400!d3 0\3,P 00 8`00@(p$@ @ @80403 00!3,PP0 08`0@(p$@@ @}8 0!20<,P 00K8`40@(p$@ @@ @f80 $00!`20X20 K0<,`@(0 @ @Q80 $00!20 K02,`(00 @0 @0<8 0!10 K01,`(00$@0 @0 @(8 Y P| 01pp! 0aC1Q\!00@ THD!8A0 S * RPP aB! ,0 I0 0  n0(K街A8AdAAAq(AA2A=Ad)EAdQAq(]AdlAdwA6eAAğdAp(E'BT eAA!*ęA*ΙA( *יA@w(p'@.dedde7e 0-@L" K0h`hf -L`e@P0S PP p0 010 `00  ^_pp X: pHG` ` 0-@L0S P 000耈e 0 /ဈe -LDM@(Pd`PK/pPE 1  <K'=1 <KP@ 0 |P@   <K`2 80 0<KlP@ P"0 PPPP<K0 <[<KXP@  0 NPK K -0`@L1@@P@Kh6e01(!("/d0!(21 (/dHP/D@P 00S/H/ -L@`=P@P uQP/u 0-0PLM@P  R R K K 0[0 P0S0ĕK0 -` LPR@  DP) P% Rp|P P100 p\ Q __0000p10;0 -h0L0S ǁP @ 8#8!P!00 de 00- 0P0@0PL_ K0hF_ -pQ00`LfX&X%TfT%%<P WP@dg\0010S 0CS V @#REP @He -LDMPpdK `_ @PId0 RD0`Q$V`< ( LK^\K\KLK P1LK@PHP P00 LKLK6d0KVPG1 P P009 K -`SL@Pp HP0 $Kk/$ 0-LM @0 @A4P$#4 8#8d PK,001K00! R![0 0K K0|P/ -`0@Lp@A@DT R`f R P0 PTP  ^0@ep  -L$M,0PQD0 0D`01<0 \10D0 <0 c0S00 ʰ(0L0 0 <00@0 40 0H0 080 04!40!SpPe L0 p0L0 3 @@Y^0 <00<0S 080 8  0-0"> 080<0 04#$44 : a148#(#< 00 :0#40 04$#40 8 #8R 0Ե Ե0b00 4:0ĵ#40ĵ 04$4"40#48 000 80 #< 40#400* P B塆( 0(奆X7@OnD0( @  8U  ,0, @00,08 008001}) 0)p1倆H00 0H0 40040 T@0a@0@ (08#<4 0#400 4 00#40D0@ <  ,0@0,0X @ 00bH R  T R x@8( 0(7@;000T PV pP`(K,f6e -QLM@ 0 l p 0PH4$#48#8S:00 Y` 04 8 <  P]0 3S H L0S0T 0H  0bUP 0.0C0000@000 $] @0 e00[(0p 0(0]00 0 $4"4P8#<TP%TP0@ S00 0@00000 ]C10@00咅' 0'喅10 0S( TK\T0K0 K)0Y 0S 0 (048<R ~k iPP `PPK|PK0 |K lpP K3I+ 0+M` `@00 000 04 8 < sR 0 U 0SR PO K`P ,Kp+ 0+@0|K0 0pPq  04 8 < sRs 0Po3l0PeUPP H0V TJA+ 0+F$ 0$400IUPP IpƄ+ 0+ʄA"LP I崄p+ 0+巄A`P|KLL`0H`4S0 @0Lp0 $ 00$  0(U %0 00` 0`0  04 8 < sRs<< 000S00X0 @H^+ 0+b30  #R  3 04 8 <hKcP 80S hKm80 K3/P hK [hK ^0 48 P3 0S 0S- P( 00S P ,0  h,0 0,00 0 0 0  0   K0S 3G l1 04 8 <80S |K80K3/pP2 |Kp  "[ 00S E心( 0(ÃZ 3 0  0 4$Q P 0<  0<00 0(DQ  ,   404 0 c0Ab W |K0 "5 0 4@00#40|0 KPp R p @0 10K 0 | KKpP0  R# # R , Ġ!!\* 5 \  ,   @    ,0@0,0 3  430S 30S ,00,00 ,0尐K  > 0 0 3  20S 20S ,00,0@DI 0PB0  ނ* 0*A P @@ :Q 0Z@0  O0  K 0 00 ZA崂Љ市|K0T KSVJ KvFp`1 ( B @@00S hK0 101x00h0Kē똀t( 0(xT1, @ , "P0 0  fa (K,f6e6eğd$dd8 ed)@ߙA -LMP@`  ((tT<0S 7 Sp S0#03R0S0S 0 00000 000c00SQ QR $K`YR 0 0$0 0 $KMP *K -L,MPpU@\<{PP7 0 000  0P0 0CSȮ(\(h((( DK+@PD0S@ -@K`DKP 3S?1@209@0S4[@@04[0  @0H0 0S0@ K0HKD0K0@ K0HKD0KP@+H0S% #R" `DV S Q `V;@ HDKa H0  0S0007@1@0@@KHE`,KH` `!\0S`H0K@ K@0@ K0H0K⭫P@+` DH 0V Q Q\V1@  0  /  `0a`0R 0C0D@K -@0S  ,0R`V\z`(K p-L M0@ SP( S* S-0T 0S  KCX 0"K1KF`P P0 0  T K-XS K P0P00 K0aRKp`e -L$M0pP`Wd@80 T6W*ppD6W*ppP P00CS~((X(X(X(X(X(( ( ( ( ( (((((p(0(X(((X(X(t(X(|P 0|0ZY 0@0 GP7Q`0 @0 pWZ`10SZ. `V+Z)`SS@ V H0 0 D0 W `F` ,R W@ H0`00D [ (V  W| >8KP 00CS((($(8(((((((((((((L(((`((((80i080p080 CR0ŕ80S@@80S@@80S@@80S@@80SKK8KOP80SJJ 4K6P00S3[83[8 5`0P PH18888@8K P80SSS @ y @8KP8Z{0 CRz((@(@(@(@(@((L(L(L(L(L(((((t(\(@(@((@(@((@(|P[ 0 P P0CSF갸((и(((l(l(l(l(l(l(l(l(l(l(l(l((ȸ(l(((l(ظ(i0+p0)0'0%0#$60$1350 R R 000 84K3K83K$ .  080 8$8 Pd@*p(K  -@PL`P 0U P p s \$Kkx -0@S L  p0`  a   B PU 0R0 0 h ̊Kh9ꈈe -LPUp㼀0`AT 0S00e0S0 ~$ 0$~1!  @p@W<( 00C@SP*蔈eee6e 1- l0@PpDML!0 000,P(p$@ @@ @u, 0!0 0040@,P(p$@ @@ @b,0400 0 0!P080@0'>,P0(p$@@ @P0 J,(K興eA8AA 0-@PML000@@ @0 㩈h0 L <@@T0200Q00C1 2K0h%A|dexd 0-LP :9 Kh萊e -@Lm+0"0R S  B! "2 2R2S0t`P #P00S qP P?UP00e?o2PKh}ꈈexdȟde -LMp8 0   4!04!8#$#<8#8!9< #8  CRCQ  R0S :G}- 0-}0l00 0@0 00S  LG}, 0,0g80P 04 8 < #"   "? 4 !AT !R S  $(,R  P @ 00PUXV_ 0R[@G}# 0#K} 6 D0 D0PP` 00 4}M@PM8}00 n@0 p0003[T13[10 01   0c000052S S$J@P 0 000 001<00 00 0 0410 0 HT DT40!0Q1@0A400 1p01W !1Rp00S0 PP0P0 K Q   p 㧈! B!  B WY R P PP PU ! R H!P   R  !R<3|- 0- 3|)z R  a   B  P z pRW 0  00 I , g0p p 1p( ",40#40 S S0 0100 010c00S 0p(p,0'00Yr ! ಡjZXڴ!Z610C100C0`1|# 0#D1|D P80UP? 1{( 0(0{3{, 0,{I 0  C !* !!jഡ!lQڴ!Q  `! ( R R (K6eeee-//-/-/ 0-@L0.-0Z 0-@LP'0S 0S 8[P 0*P 00qP0蜊e -L⏌.A -L≌8A p-L MP d @ ` d 00S(01  0 K( 0 ?P(] P 1M  Kp --L M080 0`30K0 @0K40K  cKR,` (`  0p4p$#4q0g0#40 0$4"40#40t1PU/ 0S*q0S Y%t R 048<Rx R  048<R V P 04 Km`PV 04 Kb 0 , x01# p0Rh@0 `z& 0&' R0'zB$K蜊edep'@(6e\ `P/0 !`8 0 0 ,  , !/deeāe-/ 0!< 0`4 0 ,   !/deeāe -L@p@P@`Chfe -LP`@ -LP`@' 0-LP@0 -L@`P xQ`e 0-SL@(`j0p0S S 0S/@wP-P0 80 ꄎ070@71@d0f -LP@`9X0p0S S 0S/@070@71@B0f 0-@PplDML!1(p 000,$@ @@ @P`' 0!0(p 0040,$@ @@ @P`'0 400!h0(pdp0`0 00080,$@ p @`0' (KoꡗA+!B )eCA -LM`@  $ pP 0PSq R R x 0Rt $0R7/@K -LM0S%0S"P 0!0@PSR \ d 0  $( ,00c K`)@l=(e -LMp( `! R4 $ SPR @p KPP0 KKWP Ud0"(0E0S0 3SH L0S0T 0H  0bS00S 00C0000 g@Tp 0PK(0 0(00000q0 0( )040#40 Px P00|DSJ 0 #RH L R ,!   @P< 0 ($("QP,", "$  $!$ "$  04(0DSʐ000 0P00 xx, 0,|x|0`8 00O (PT 7P PK,f6e -PL@p`U1 8@00S S 0S/@07079@ 0 U@  @xO1@W X  0f`e p-L M$a@T0P!QPd "% . P@3 KmP- @d0T0;d0; $T   P P\ KRP 0Sd000d0 \d  K ! f@Kp `8 8#4`#/ -0L48 40 8 00 4 8 4 0 8 00  4!40#4004!40#40 - Lt0R \2" R  T1#  B 8 00C0eȊe 0-PPL@ P@ 0S@8e@P 8K0h[ 0-@LP \0c;@0:#9PK0hw80 -@PLDMpUX0S S| X~ `XVz0CSs(((8(T(T(x(Vj 0g ;Sd0^0K0]0K%[4"40[VY 0V ;SS0@000Sk1L0 R .\KN. \Kk!\0K4k6 V40 09N 2N 0! ;S0<00l100p1V 0 ;S T00S0 <00 K`fPv(KKAUAeآd1M/ x -X`P𝤀0 !`!800 ,  , !deeāe 0!< 0`4 0 ,   !/deeāe 0-@L0  0:00 0-@L0:0K0h 0-LM 00 00 , ;y K肚AЊe 0-LPz@0Њe 0-LP@G|K0hЊe -LM PR R ( Q< h p0 08 040 00@T $ 00Zp(04 $p 0(000S 0 0cS08p 00 @T 0S$04  p(0$p 0(0  00S0 0`R010 0`@00 8p 0 D0 $0 P@ p4 (0 040 @ 00S0  P@ Ja^j\aPDu @ 0 @  0 u  V P \P"0  000 U@0S)  00@  000 t R $ @0 ppc@ 80 0b80 8^\  bb @ @ 00pb000 800b80 0 S $04  p(0 040 G 0R00  0R010 V 00C 08 40jS@ 0R00  0R010 V` 00C 0 @DXDV8p 0@ `P 4Bt @ 0 @t p|`202t8 A 0 A 0 00S 0 @ 0 @ 0 t40T  $p(0 00S0``0`00S0```@ 00 00! R!100a0;S2@T/ $1R+$00$1(` 0R00  0R010 00C 0<01  <0 G<(Ke -Lp`@APa Y;`1,0 00SX S S(8Q0 !p  0  Ȏ  Ƞ8,Ƞ .# $("8("(#(R.0R*3 00SY`1, 0 00SᐈS 0@ x00S0 0 rP 0@ts/ 0/sde 0-L@ $00CS S  edd  c B"K00C00@0bT΄댚A - aL@Ps# 0#sT!R 11C R T!X!S0cB1C0S0X100S 00S 0T!0R ڈ0"0R252T11X10\PL1UP1;T!X1YO1C1S0P50S0000elddddtd 0-@ML 0H0 00@@0\v(0 $0T @ 0K螚Aede -LMR@0pSllm0S S6!8#t 00#! "1 6!8#'78! "0`02`bR\ 4  0䁟\ s̀ L 0 L s %\$:< 00 80 r  0 r 80<Q CCpm04 S000 S048<:#0##<04 p4 &>CCpm0S S#00 c8#<4 0#40  0j n00 c8#<4 0#40  0j  m0S S00`0000c8#<((40(00m00@ĀS SVPPH~L0X  0 0  X00S;0X  7(K,ffeedd -@ᘑLP1붋 `tq p# @ 0 @p,1D.vH; S. 0 0!0 S&*o"  0 o; 08#8!;0S000 S00000o @ 0 @o0P 00u$Kkchfeed*@(d -L 0 0R0@0K P 0  QI@@T k  0 k 00C 1 01 1 S  0S :R 0  00  !  ! ! 0 P 0000P' P 0S S (l0K 00 $400 48 < 0P0 NH[ H0[H9@k @ 0 @9Bk0 4$8 8P  -K hKhl0K 00$K400KqPH0[8 k @ 0 @8k 0$tKr0SYH0[j  0 j81S 0 SV̀K 6 K2  K 04 $#4"$8(#8"( x Kf00 l0K 0000$400 ,qPdH0[ H0[c<7j @ 0 @7j 0$qP H薟j  0 j|61S* 0 S'V̐K  . gu .Kcu. 8 _. (K[ 04 $#4"$8("( #8 K{ 0S  0R :0P(uY 0P(0 nH0[qP 0 0000P 0S00S   04 8  P 0@`4 P8 <cXj 0#0##<00 4SP0C0ą#40ą"PœĕĕHV0S`Pi @ 0 @  ? i S  04 8 <@ S蓟i @ 0 @  ? i 0`h48<0#0##<004Xhĵ(ĵ Pţĥĥ V ,i @ 0 @i}0@40<<hX6̒i @ 0 @ixii  04 8 <@ 0bSU<0S/ 04 8 <@ S%Zi  0 `h\i P  04 8 <@ S 406URPlK9LX1lT PD 00 04 8 <0 04 8 <``0 l-) 00 04 8 <0 0Wp0P0P 0`4 8 <` `0ApopꤚA eȊeKAAAAĢdedH?d̟dТdd̢ddeeU ;S| 01  04h!2Y0  h |00S P >000  21B  K? K?0S S)00K0[ K0K? 0K4 0S$ 04 8 <!0 cR!1 cR1&@ =0S 0m80je% @ 0 @me 0[4 8 <,10$1010000 ;81 >`0S xP<>`Y \PX>`\; R 1R8!81,0S0;" n(e! 0!,e80`0`Sk1h1j1i1 0KL1S /cL 0`4 8 <0#$0 #(#< 0 1S*`cf|U 10 d @ 0 @  ? d 04 8 <0C1 04 8 <(1? 04 8 <`P/40`S+Q/ -lP* 00`S&?p00`Slod A 0 A ?   0 d0 48 048<cY!R 0#0##<00I4S0C0ą#4ʃ0ą"ʓ ĕ ĕY 000=Xd @ 0 @  ? =Ud0  04 8 <$!S\=8d @ 0 @ ? ,=6d00 0 48 1 01  04 8 < 0#0##<000i0 04Yiĵ)ĵ ʣ ĥ ĥ00 10 +RS 14Pc @ 0 @cS$ i0$0(0<0 iY[;c @ 0 @;c0Y;;c  ? p;c ; S 04 8 <$!0bSP: 1S 04 8 <$!S000 c  0 c ? :ci0 i 0S  04 8 ,x1cQ 0b 0b  0bS90p10l1$  04 8 <$!S+ R02 '=0 6040I;Ac! 0!Ec  04 8 <$!R00 04 8 <0C0o;S  S3ڇ 04 8 <  cRy4!0bSuʌhc! 0!cr0`0`Sk1h1j1i1 0K 04 8 <0C1 04 8 ,0aS]`VK0SD1 R`?gb @ 0 @b$P 0 $ 08 ,0R `k$;S;08C8S; 0  1 b< cR103/PG+0R81,081g<048<$S `0asZ103/ 04!8f 4 0< bR gb  0 jbi[b @ 0 @ ? Zb1SCL!R 04 8  ;S;S SSN;0CS12)2)2)2)2)2)2)00;% 0;80020*"PeH?dddĢd̟deȢddЌeXee400?0"V0 0S V; S1 0 RS  0RS 0R0000S 0S0_40000SZ,1,, PL @1@@ PD B0S S0S900S5 j 04 8  P( 00 04 8 <000 00 0  04 8 < 00 0 0S0S 0 t  R0ą0ą ʃ 0 $0(0<(10cS( $1 B0c0SX01@01d10d1 04.[S1 1 'Đ  04 8 <$!S/0S,;S) @$1 ȣ0$1 @_. 0./ ?/_p1@  c: {)/0K 0@00000$10$1(K 0-L0  0'S(P H@_  0 _0 !D0e`8 8#4`#/\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe 0-@L0:0K0h 0-TQX1L@E1Q!P `Op\1+UP1L01 S 0xSx00 8c ; S0Ҳ;0$A*@d -LM0Sd0 (0`0 d00Sd00 `0  ( ` 800 0Sh0  S d0S0S h0@S S P>(PPpQ l0& (SRTQO.eePPNl0H0#&-d R Qp0 d0x}Pp0 @ eP:TP4 R R r TKp0 5!p0R @ eTp0 [Pp0!R ! Z dQZ:Z dQZ:@ ePd0S dlT ld d0`S `T 0Sᓓ`Z+J;0f S 0!X R01d0 Ld0{S 8X=d0d0P8%815<N=d0d0P<%<156[</PZPX(PV410 0P0  8(0P@H0PA8C@P2 80P. H0P8(@@$PP%00 0S 1  b0d!!08!R8!8`f V01 0!0 00 00 0 S:H!00b S:X:@0S x埳P<:@P NUP:@d 81R1*!d0!0S01Q881 `(Vl `` `Y0T00 9A ] 00T0S , 0,9]FPP p9 00SX)0X 0000 1S ! X101QāA0 3SHL0ST 0 c`00l0Tʈ 00 |000` 0 Sp h0 Sn0l x0 Q2  0S. 4+Rf (w Ts!4 aRn T Q R  7&]&΀L 07L&]00 (  p@pp0 5N y $ (     $m $ V (  TKN4  !  `0 p| 00"!SR00i!p$SlQ00S|0 (",$("", Q "  "! aR ! R1(",$ "$ h0S S 0S(01p0S, `jPA 0`h0(`Sfh&<&dx0`&d`(`Q^ p0x 00 i00x 0P| !`0R1+ 00 ZPP`1V4al\)@PI0 $@PD4h\|0S| $100! bR01$1x1000 000S^ !4RT 000 0 0 :0 0Px0 d 10S ʀ!   d 0cd0t0 d0t0 0x0 0  14!0bS `!0QX` c81#UP!;p0;) ;S(XK P$ 81X AT@b@b!?@bPbQ@d@dT@! 0c`0 0R@hT00p0  @p 0S U`0P0Spǃ8 0;p0S#0  ;S`0A0T@h0@h p3Tڤ!810!0bX 0SJT0p@`0@T@hpǃ@hTUp@ 0[81XP A@ 0S' `00 # `0 1#11S:`00S: S* 00lS ` Q!\(P`0` 0;0t0T)ڀ0St@ XtT1h:t@t0T00À0 0p0 8ddd̢dd*@ *@آd5AfIAd)Тddeed,fp00 00 p0S ` 0  00bspC`0` !1 b`000cR0T|0  t0Tg`01  0 S 0 ` 0 SW*0ST`1TQ*4!10bp  ?J|0Si$01L!|Pc,R  0`0 3 P 0R5Q300P.! aR)  410aS@P 8P10 `00S ~P8zP bUh0S(0 S<000 `T KAP PP `P1U1Hh  Q Q a0 `T K+ S`K"RKQ K  @ j1H`L KP T0K h30S 0 `0Q1/Q  * l `bl0b0\l0l0  `(Vl `` `0l 0 003Pt1Pcl0ll0 D1S`01 DQx0Sn 10 l `bl0b0\[ l0l0 l0Q0 0 0l0 0 x00Cx0 ql0 00 kl00Ql0 l00l0 x0S x00Cx0 00 Wl0$00(Nl0P0  #`(V|5P00 `)V 014!0bS202* 0*+ 0+) 0)* 0* h6d aePT 0L00+40 4000P0X06HP0` \00p`001 !Rk 0Sc01 < 0b0 0 PPfY0 + 0+ - 0-1 0bS, 0,- 0-7GYPP( 7 00SL4d dPT 0L00+40 4000P0X00HP` \000#j7PX Y# `p`YP  PP  /P2UAU;SY?PPp0S0@d@0 X 0\)  S0x l0 ( l x ) R   !BRp)p !0 T 8}P4 $ (   00 St0 40<  00 S t040<,0`,  !d`$!hVlF`F`&d`8IP 14!0 bR4114!0 bR141L1S,;P0L18;gX#`pP;cjXp0S !41R!0R 8pP 0;;0 |T`00S 8PK S *P0 hfx0 [ 0l 0P ifl00 l0l 0 4l  8l  <l0l  40 8 0 h0S S``uw`0 1R0 2w00S0 PPD-0 0000TTh  `p(K 0-1H @0C10L0C0 0R100  ]0謢de -@00!LPRp$`0 0R\P 1T010p00 0 R 01 @ @! !1财ddde 0-LM 00 00  sZ KTAe0 101/ -L4MpP   ABAAB S@@Q@TQ Q  `d  `lVJ4i\P`1X0  TK. PK.T Pb8"8#4b$#a8!8#4a4#fQT P0 iQcQLK X0@D0CX0 0Al^  Q,K 0X0@SALKX0Yj `10cS1aS   L K!'@PQT0 cR=L K≁ bQ @T3cQb Q(0` fR00"Q0 hR00 @0hS0fS0P 0 bQ000 hR00@L0K!0bS0@P 10fSa(K谢dd 0-0 @PD 0L8 @L0 cR@Q 00dS00dS0@0dS@00 0-@LQ 00 001 / l\ l 0Sl\l /!-R1lQ  Q  bR nQ0bS0; 1 0/P//`8 8#4`#/ -@LPT`& 90P 4 Mȷ-0P f P Q1Q88!5011Khd -@LPT`& [0P 4 D\X[0P f P Q1Q88!,\011Khd -L0 72HfЍe1M/ i0M/ \c 0-0L(@+R@ A3QR 0R+RY/ RY?zK0h 0-0L(@+R@ A3QR 0R+RY/ RY?vzK0h\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe 0-@L0  0:00 0-d0@L00SPPLfT 0,00S 0K0h@R0,ff_Adp) -Lg Khz) -0LS̀@ S XT x0S|0S0s0S 0S 0s T(``pW  0R .00QpP 00(0 +0 SP S< 0X0@00 00&a0`` 00 00 0  t + xT   + + 0  0000< !#8#(8#8"8|0x0`000` 00000+ +d 0###<0420S 20#$ #< 0e 0 4 8 < 40 8 000`00x0Sy00SSy00S 77' 8 8 8 8 80 0R RR  R (0( ,    0("(#8S W T29 ` @R5` 0p1$40  048< nPd10S` @0G3WS\p4K q#04pK30K 1 0K4 3K# 4KYH81 匭@Q= 048 <0`0cS0410cS,ʲPT4%T1X%XU$*81U0 :900D48ᡸ  10fS 90a0T000000 K`)@e_)Ȋel=( -0`@L(L1@@P@(KhLЍe -8@L(`pK1@`p`($KkKЍe 0-\@LI;EL 04008 000$0$K0h hfdede -L M@R'0p .`q P)  ( P% 10S!J0aS1) N3K0 2K00[ 0B0000K78K02( ìv'0Q1;08C8 S; 0;wK$ 0${KY?Q<uXhK% 0%lKT!X1\ 1L!C1S01!S01S00010 1S ;SAK( 0(EK0S010S01;S P ̬P OT!X11X10T1014110L1;S0;0103/彪Khfhd])ee*@d -@aLj0P 8 P2;` SHT1X!\l Q*1C1S014cS J' 0'J<J% 0%J}0000Khmhfeed -LM@Q0p ``h PWhQJ& 0&J+R?0S(0Q(0R  Ӳ11* 1S !H  a0R(*J& 0&J0 $0S0 BA B0 0  01h01  ZJ' 0'^J<[Khhfee4dd -@PL嬩0p ` P01; S !R P0H00aR:<01W [Khũhfed -0L R   Rd  RP   R<  0R$ S0S0dd 0-(@L 0 K0h e|) 0-@PPL@ @00S P 000K0hqhf 0-@L 8 ` K0h / -LMP00`Kp0` @0 0K\0 0L0 0`@ 0 0 000 0l?o2P0S  R0 (K -LMQ2 P 0R " p Rqc@P`0U2 002 00@3ƨ@R T 0V000(0 kP -KN 2b 2 2S S: {(  0  02 d02 12 2" S00| x2 ?K(R (dKcKt0`2 I\K[K&W?K x0X1 A(  0◟K  02 h02 12 2 S0+0|" x2 ?K( \(  d"KcK&$d0`2 x0 0[K\1K&W?KUK d0X1 00Z00W0S -KP h0^ 2 J =2 0Gsp @J2U20J(Khf -L M    0L2 Ke 0-LMPQ@ LP g 0K#R #P00K0 -LM $ 0 P (0S W PU !  P j@P 5G KhKe -LGM`!Yp  V @0S\@ R @00S!IoQ㪢 @T0R@ ,1 001 l 00!,,R \ RK_K, P+![T [RRo R,1[S0[S$!0R QqA SQq7 ةPcө@P_) @@8l008NP P (0S !Y`V !  ` i@P753 -@,R !R !r   S0S0s000RWEE,1[SPLPۦJ/K B:[ (@+@@(Khfde -pLMP`K` @00, K0d0"0\ @ 0 0` 000 0?o2P@@T (`囦00  ئ(Khf -LMpP`K` 0@0 q0K\0 0@` 0 0 000 0?o2P@@T 0S0 Pb\墦(K8dhf -LMpP`K` 000@0 90K\0 0@` 0 0 000 0?o2P@@T 0S0 P0)#i(Khf -@ `LMPK pK`  0p 0   0  \P L` r0?o2P@@T <P ,`B@+(Khehf \ \?(// 0- \ML@P`!,0p ,(`0 0P$@ @@ @M 0!0,p 0(`0 4P$@ @@ @8040H? 00'!0?,p00$?(`0 08P$@ @> 00!>,p40(`00 8P$@@ @040> 0 00!>,p0(`00 8P$@@ @H> 00!8>,p4`0,>0(`00 8P$@ @040= 00!=,p0(`00 8P$@@ @"040= 00!=,p0(`00 8P$@@ @040H= 00!8=,p0(`00 8P$@@ @< 00!<,p40(`00 8P$@@ @~040< 00!<,p00<(`0 08P$@ @f 040P< 00!@<,p0(`00 8P$@@ @O 0 400!; 00,p 0(`D0K 8P$@ @@ @80 400!;0<,p0(`80K 8P$@ @@ @!0(0L; 00!<;0<8 K@0,P$@@ @ 0(0 0 $00!:8 K0:,P @00 @00 040: 00!0:,p00:(`0 08P$@ @ 040X: 00!9,p008:(`0 08P$@ @ 040: 00!9,p0(`00 8P$@@ @0409 00!9,p0(`00 8P$@@ @040X9 00!H9,p0(`00 8P$@@ @0409 00!8,p0(`00 8P$@@ @j0408 00!8,p008(`0 08P$@ @R040\8 00!@8,p00<8(`0 08P$@ @:0408 00!7,p007(`0 08P$@ @"0 400!7,p00 <(`0 08P$@ @@ @ 040T7 00!D7,p0(`00 8P$@@ @0407 00!6,p0(`00 8P$@@ @0406 00!6,p0(`00 8P$@@ @040X6 00!5,p0086(`0 08P$@ @0 400!6,p005(`$`00 008P @ @0405 00!5,p0(`00 8P$@@ @040P5 00!@5,085,p000(` 0 8P$@ @f0404 00!4,p004(`0 08P$@ @N0404 00!4,p0(`00 8P$@@ @7040L4 00!<4,p0(`00 8P$@@ @ 0403 00!3,p0(`00 8P$@@ @ 0403 00!3,p0(`00 8P$@@ @040P3 00!@3,p0(`00 8P$@@ @0402 00!2,p0(`00 8P$@@ @0 400!200,p 0(`<0K 8P$@ @@ @0(0P2 00!2< K00,P$@@ @0(02 00!1< K00,P$@@ @080 0401 00!$2,p0(`0D0K 0 X1 1?0 <180 o k 1 Q 0 $1Q 0 1FK0 20 0 1K20 20 111 1 GK̽P*P'(K`*@NAd0If 0-;L@S))))))0;\@00T;:8T6 ;S40S0S (P e; S Q$ 00?00 S0S0S T00  P 000  P @0ddd 0-0LPS(@@T(@;SK0h1 QK0h@P 0 0-LM0K K   # KN@PtP K0 -LM0K K   # K6P\@tK p-LM0K(K( $  #$ K`@P EP <P  C@VKp -LMQ0 ps 0S Sn1`11@11`11@1P0K` 0 0, Kd" 0 0\ 00 000 00?o2P0S@0S<* BR7) )))))()P)))))))))))) )()P) SXV`` S`VU  ӖCjQP1P#U T  CjQ@1@#T0 0(K舣dtddddddd ( -$Lb  Kh\HBAXA]A 0-@1\8LS1P41104P 0P @0 V` @HH\ 00000 080 0X0 XTG 08> @$40$040  0 80< 00#|!!P) P X R#P0R#H0R DDP  L4P@0@P  0 80080 0<0S r`  0 pl 0`WV`pT 4`WV`@P8 UT@ T  (Koxe +@xeeeȞee -L$Mp@WH 001@0  D R0 01"0`(8` 4` Yd 0R8800 40040 1<0 00USZD  005< 00500 2U5D >CC80080 <000#p!!0PL0 P L0Q @ QPR!HHHH`<0P00<0S 밢0 A 0 A0t 4BYXB\ 8BYXBpD BWV`BSe H (Koꨞexe +@eeȞe؞e -L$Mp@WH 001@0 d D R0 01"0`8` 4` Y_ 0R8800 40040 1<0 00USZ?  0057 00500 2U0D >CC80080 <000#\!!T0PL0  'P GL0Q @ QPRHH`<0P00<0S 밢0 A 0 A0t 4BYXB\ 8BYXBpD BWV`BSj H (Koꨞexe +@eeȞe؞e8@-#Lb"#4,Ġ8` b$,#8("$`$" !A -L>A1M/ ␲ -L M@0p(0 `?PP* d 00S1  0 (K:(0 P(P 0l5l%l0(000.M(T \0K( (D+0/S0㵋PP? ( \K0/S0㩋PP3 (0@ (0C0 :00)0K0 (` Z* 5pP 0#  <0[0K0㰠K\0KTK0KuKXp Dp 0\K[Pp 0` p 0W0p0K0K0K( KyKp p j0  0ppp0KK(pKm}W0000`00:0\K0 pP1,3\K0000,p0( :*p+p_* +0<00K0pp0 kKP Q 1) 0)Q 1( 0V(Y VA V. V1+ 0+V: @V1+ 0+xVP V1? E0<jVP H:Ve1/ 0/^1) 0)0SU1* 0*N1* 0*G1, 0,@1, 0,91/ 0/20>CC+- 0-%1- 0-1. 0.1. 0.D00S 0K .\Kz&p\0K (,(KdEA,@AdcA -LMdt@Pk  0 o 0`  \  0  'R 3SH0L0S(<@P  0  RU XU  $ ( ,  $(, $(, $(, 0S ,0K #) 4P040:S- 0R0% *00K CP 0 0R0%* ,Q   0 0 #0C?o23   0 wP ! 0!s(MQMa.0 3SH L0S0T 0H  0b/S000C00000 0:@T @10SI 414!4+C0( 0 (  /R 3SH0L0S0~@P p0 80   80e} c}(P) I 4-0 8.00, / 0gPQ  0 i(s(K0eAd,@A -0L@'Sp`(9@P P | P |P 0 $Kk$Kk赇 -LyMpyoK( @ymK\PP 60S60S 0d1 0X00K?K!FP ,1! Q 0$ +1 1S F  0 mKr1uOK <1qK 6 w| P\r|PW1[S1[0S d50S<  .WK$W?KD%D`0S (50S-  .WK$0% 0W?K*!01K0,KX1i_K l _xP1 0 R 0S 40S$ 0q/KyKKKsp$0t* yK+P$ 840S  .WKi$0q/KKKYW?K$ * -x30S 0 yKKKG0#* x1[S 30S 0q/KyKKK3p#01[qK S1[000C?o2uK1 1P0S  30S u?K yKKK"01 (C1(V VP20S u?K yKKK"0Z*|!R  ≑ 90 00Y D20St u/K.WK#u?K KK9@IW?K" 7*a00000 0]mKZ? 0ԑ1 @xy10SP:yxOP KKK WK  0UK+1K[1K1K\QKfKIK,QKz?K0K0 WKQK|P QyawHx0+1K0@,K1nJ?K0C@IKq?K(A A ~ \@mKcC " 0"mKT(K ddA0ed",@AA7AAؠAAYAAġADd@7eģd3* -LQM(P( PaK-[0P,1  1  0U 00'S (6P( (10@1 @!0S(1%p *>K ( rP 1 Qp%p *8 7) W  @%P(1p  0 0(!: 2@P ;0S `PK ."00+D) @ 0 @,11  0 @B  0 `V Vk VA V# rVD VQ mVV*,11$ 0$VZ V  :V" V9 VV :0FSO,11! 0!T񟗀W*W*W*]*W*p^,11! 0!& pT,1p1# 0#K,11" 0T" T[p>p<,11" 0T" 1:TK. p-,11# 0T#?0  ݅PP 0 3SH0L0S0@!R 0 х@P 0@Ʉ P0@!R0(! G?K (tP !0Q:00S ~ U  ! A 0 AB  0 ('YU,1V1' 0'' 0'0 {@P( NN,11( 0(Ul70S U U T,11$ 0T$ 0 P@P ( hbh,11% 0T%U 0 7P ( lpl,11% 0T%U 0 @P ( c/c,11& 0T&hU 0 @P ( ]]{,11& 0T&O'Ug0 @P( 8%5bT=UU]50S @K .E! .\KA!,1$20\0K0@0'0Sp@pp/U 6  0 9(10@0S0%(!% *>K0 ( dPd !00Q:00S[ P`001 ,V? V +V a3V <V] 0R0%0 *C?K  >Pe !0Q:00S\  3V Q? 0R0%0 *B?K  "PI !0Q:00S@   Q%0 S0%0 *A?K  P !0Q:00S  0 & $,R P`0T@(1 P X 1) 0)X 1( 0(1/ 0/0@F  0 (K df0e 0-L M@:T0 o PP P R 4Kϑ@P 4K  RQ *K0 -0`@LT1@@P@KhU0e01(!("/d0!(21 (/d@-, @ . @@,@     P/K -@`LP  00`\ 0-@PLᯚK0h\ 0-P 0L#$#"$#"4#  B0 AT 6 P @0 0-L@PP 0 0-L@P x\00 -LP` @<0400 00 0@q@P  D,@RA -L(1#0000K.i10S1  pi41S4 X3\#0KX  PF   '00K0K  0K0KlP( \ (Z+ PsPP d p0 0 $ `KE`}CV P`KKAP $0S(PsC@2`U AegXl0KJ/K 0uCP10S  .K(1!0000K*i10S1  pciuhP+   VP kh!H0U  gHP `h> ]h0J/K2CP= h10S1  p2i4 `KX0X0 H0 0 KT `K \ 80 kP( ^01S 018@ F (Kdh,@A٢AAd0AdPe;+Ledx,@A,@(^f,^f -LMp@`0P p@HK 0-@L h K0hh 0-h@LPh0SB?CDK0hh 1S B?CS !R P LePeHPD0@/ \ H0S/D0CS\ R P $\/ -L@p`KP@P E^ -LpP9`d0@T BODT  `rPUDp0U A<Le -HBL`TDPD@ U 0S  NPT@ $4R@HPUDPE -L@p`P@P *E 0-0L@S0S0S 0S- 0S00S& 00S B?CS `  "d  " h  " l  " 100Le -LPp0`@TBODP T  `P0  ATBODLe 0 03 0 0 R/ R-L`P@PM !P 0 !0cR#QR诣A Q0-LP@ HK0h,  1RQ00k010AD,@ SR-LMP@p4Q 1CQ 1CQ0  0S0S0SS0SS`V\4U` 1CU] 1CUMP`Y KPG1@XK (0S,0SPP Kf4 Kz K0K U00  00 0S 0K ,U 0p0 0l0 U K = 0d0K0KP[040 00 0 K9H0 0 KB09 K `F K 000 0K00 000 00 0 P` <"U K$ KirHbVR D`FVO 0S H`Z  KTKi 0KK00 000 000 00 0 P\1UXP, K K00KX +0K,:  #0K ,0H0 B0 K 3+)-'1P5"0X hPP30  hPP '00 (KAikiii -@\8L$MQ`P <8Q 4808Q0 8Q 8Q 8U8Q :70S 7 0000(P`0D0 7U 0CU h70S$Mil7U `7U T7UP7H7U @7U &QT` 0 KHT 6U0CU*6U 60S6U6  6U0CU0C2:6U 6U Gt6U0CU*`6U0P6UH-o<6U 1CU 1CU0 ``6U- ]1CU) 5U% 5U`5 P5U 0C50Sx5U 0CU*0CU:0U0p5U:0U0UppOW 0S R g+hP`@ K`4D U% 0D0 D4U  0CU (4U !4U 0U h4U d40S\4U !0U P !84R/`D0S 3U3 11CU p3U 3U 0U 3U(  0CUD000r 3U& 0U. DX3 D]g`DP 1 . .1X<D@p /@Q`TpP 0 || R@0 0!A`v /p@PPV  0 `  R0 0!`Dd0n@&  R`0 0&'  R`0 0'i0P0D K@0K%`VD R 41iY`@KDtD@D1D [YDy@D` ``@KDa1` --` v(Ki kiimiHUiWiHMi >diiku(iijuP iLi0?Ni0Pi Ji(KiiildiHeiH5Ai%i ni i ߖ>Si i Ii !i Ti ddXe -`L Mpe@HRh0 UDPEU+  R#   R`e00ST@ y`Y@$Q@HPUDPET$ H0PD@@T 00S0  Q P 4\H0SD@CPV(Kd -LLM<0PSU 3A0ASQ`/HBT@ ,qD@DT< 00S4hK_@;0 00JP  0 0S ` .TKT0K 0  r   FRhK4@H@TD@D<(:V喏 Kdd,@nA8e 0-@LK0h -LLMPV z`HBT/ pD@DT+ 00S#hK?R00S ` .TK1T0K 00000 qhK?H@TD@D1S 000 K8ed,@A 0-@L1K0hQQ0 -Lk@00S?CS/ !R( %Є R p WR`:`V p WV:` pWVR  QR@1:@T  QT:@@<2S?C NT0@0fpd 0-@LP gP aP 00 -8L Q Q Q Q0AS GQ #Q 5QQ Q Q @蟤A -L`XPXX?c0 00 P0@0L0`0D00@0 0<0(080,040D00040,000P@z*{*z*}*~*y*z*$y* -L`@CQ0DP0a=BaXX cKhXhf0008C0 04 8 < 0/ -`P L@%0`0000!36 0 -@`P L0`00000 08C0 04 8 <0 -L$M@0K0KK 0-@L!XP * -L M@1p`0.P,K ,0 (0 P T @&0 k  cT  ,KP K -LM 0 00% K -LM0,00P'S< @ ((lPP} 0;S<lPPu 0, -@4p4D. 'rH/ q(L  i`PS d8$8dD #D$0j00 8#<48#(#<8 8D0 00S>0 7lP@  i0P40 *k6h 0(08[0D!d8$8#4`d4##,0-##<./08 9 0( 8 9@<03/P00 @4`0i00 U ` j 4`U j (K -LM0 0   K 0 ^ K * p-L MP0`( R0@02K 0K [f"[4"4#8#8P2K0b U  K  01K0 R![0 0K j,0`&,`Kp 0-@ML 0(0@@0 0K.Ae0S/8^\ `P/0 !`8 0 0 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe 0-@L7](020S K0h 0td*@-0S&@00 0@x@ @^@-0S&@00 0@@ @^ -L`0P ?oR20S (0S d0:0R @KxP$  P%(0S" V 6S@0S<0S80S40S  @KxjP W 6S0S X3/P\@o(K,@*:0@ -`@LT< 0S6(Pp (PpZ0W ۄp0S "PQᰐU 0V Z00 Z15 [ P Z\ [W (0[@ -p@LT 0`S8PY\0P H RQ\KK\@ p-LDM0`S,8P>\@P' 4 PK9<04 PKL0 00H0 0D0 0i40 T K 000 _`\VTZ\%\Kp -LTM@pTp0 $ !8t0 !8 #4$ !4 8#8 Q0U  R&tR~ RQ qh rQ````xQ>|Q;q h ^Q[`VXqUR Q` r```` Q R+ Q2Q R R! R rh  /R R  R R  rh  R R` xx0 %x0P pX  P QV 0PuP  00X0R$0S 0S} p 3/0x0 $0SUnp0 3/P 2t S0S 0S0S ````0S0 R R R S0S0S 0S S0S 0s$0S 0S` xPpX  00Q0RlKV lKlPKl0KU (K p-L$M0PS8` K<P 0S 08 S hP ZZP3ZP.0S@T0s  7 K 08K8 KCK40 0@ ,@ ZPS0S 0@70K00KP80KCK4@ 8K @ ZPZKp8Z -LMP` Y$($00  "x4 *D !0'D"$, (,@!4. ! Ȍ"Ȍ  A 8 0<0 T;  R6&R3& R0 R R R R$  Px R| R R R  xP 804 Sr <00 Srh   @Y  $ R  0 8/(K -L,M("", $H0 (("(@   pD  # " "@ D aA L T  RH R h  &R& RL Rzh   xP0 kPP0T @PzU @0D 0aA, <K03K@ 400D 0AaT 0SH0S h0 6S 6 Sh0  <Kx5P @0S @T&H0S h0 6S6 SZ h0  XxP0T 0S   00S0@@`(Kpe0@-S 0S0S   Q9x|0, 0# @,0 0#Ġ.Č Ƞ,8 \  01x| F, "4$4, 8 "#8 0 x| F, "4$4, 8 "#8 0 aQa0v,0`V, .|0x$'$,,`4%4,@,( 8"(#8  ! R 0 10v,0`V, .|0x$'$,,`4%4,@,( 8"(#8 0 0v,0`V, .|0x$'$,,`4%4,@,( 8"(#8 0 10  -L`P8 @PH  000l00!00$ ,P(`0 p R 00@&P4"4 8#8 ! R 0 1  &4"4 8#8 A&4"4 8#8 1 0~,00Sh09h0@7eԣd -L0M0PS`p6S|x0Sy|0Sv0Ssr0SoQ 0Sj (0@K@`K 00L0S/^|1)Y@PW} 0S" R rh0 @60S-  PK0 O0KP0KPKTL00S PK6P R S 0S0S0S h05P 0x01@S T  P (0xP $KdX,@ -LM00 0 0@S` P>0S0S/P70S* 0S(01S# 0S4oXPP 0S 0S0sh0 x0S|0S0S0S08x0S K4!8(2a1(2x0S :|0S0s|0S00s-pW* KR00K0刀K 0 (0K!l0K00K00TP0S100 0 K80;K0K  lK2ȠK00K 00K0pKx00 0p KWPؠKQX 0K XP  7 PZ 70S100 Q )Kw70wx0,*[S |0S0S0S 0 x0lKKOPUH0[Rx0S|0S0sS0S Q x dP 90K:[60S (0K 00Lx0K0 K8KP 6d 00d0x00SP (`8 8#4`#d0 d 1P0PP0s(Kddd -0L@S4`(P`bp0S   0  0R, 000 iP bP K8OV#v3uY0KhTehf  0-@L&06d (00d0(01 K0h0 -LM0@SP0S0s  0, K0"<KQ[<0K! nq :P0 \ 0RS^KQ0FF0RS0\ `V ^QPP0P52QSP5,`RQ&60Z RQ``R```Z0V `RP&`5V0Z`RP``5V0ZP0*P^ P@T*0P050A%d0Z``(K7Aa@ p-L0 /0`SPV 0S0S0S 0S pU KUpP[00 4 匀 @0T@`BOD0 0 吀 T p KlK UPp0 RHK`0t K qUPx K  kUPx0t R030Sq 3 0 cQ:` lK[P` V 0SlK^T [T00`S0 0bS0cS00cS0 0   q 2 0 cQ :p 2 0 cP:q  0 cQ*q 0 cQ* 0S 0SjS 0S  0<0s X 0<< R<RQR-0 R | r!    R8R4 # # + lK 0 P 0 Z  0 0 S0 S 0 X   匠 RlK ` ATBOD Vo1p``g0S  0S\K3Z 00!(210#(2(KdLedddP lP/Q1 00/d 0-@PL 8PR PK0hH@R0 p-LMP,`h (0@  "` `P "KPP h03h01[0![4"46"Kp 0-(@0LHH L0p0<00e -LMaP`qWʀ 0! `!|!0 t!p  , !Q9@@X00S1X00S+  4K80U,P P(P HP0 U ,Q ( H0R:H :jP,0H0,0 40H040 P40Y@#@2P@@T 0 0!@ `q04 0  , !$Kdeeāee -1LLM0S@-`H lK=00sXl0K$lP l0K0 R0 "K 1 aT# H@l0KP$pT  hP ,bP( @PFPH lK@L00L0PLPHPl0K$@U  DPp ,=P P0W0L0 K蔊muHe 0--L^Map@Ps$ 0T$ * 0*qT 1# 0#0`  ?R0! K 0 1 nK . K:U .PLP3T0<@@0 @`0-K  Keddd:ATA -LtM0x @,0\K2P x0 $0S# 04 8 <# 04 8 < 04 8 < 04 8 @P0,00P 0 ,($@ @@ @ớ 0!>)004P  00,($@ @@ @ᥛ0400> 00'np!>8P 000,($@@ @፛= 00!=8P 004p0,($@@ @x040= 00!|=8P 000,($@@ @b 040<= 00!,=8P 000,($@@ @L 040< 00!<8P 000,($@@ @6+040< 00!<8P 000,($@@ @ ,040L< 00!<<8P 0<000,($@@ @p 040; 00!;8P 000,($@@ @040; 00!;8P 000,($@@ @ܚ040T; 00!D;8P 000,($@@ @ƚ040; 00!:8P 000,($@@ @ᰚ040: 00!:8P 000,($@@ @ᚚ040d: 00!T:8P 000,($@@ @ᄚ040: 00!: 008P  00,($@@ @l0409 00!98P 000,($@@ @V040l9 00!\98P 000,($@@ @@$9 00!98P 0040,($@@ @+0408 00!88P 08000,($@ @0408 00!d88P 0`8000,($@ @040,8 00!88P 0 8000,($@ @0407 00!78P 07000,($@ @ϙ#0407 00!t78P 000,($@@ @ṙ&0 400!(70 78P 0<00,($@ @ @ᡙ0406 00!68P 000,($@@ @ዙ0406 00!|68P 000,($@@ @u040<6 00!,68P 000,($@@ @_0405 00!58P 000,($@@ @I5 00!58P 0040,($@@ @40 400!D50<58P 0<@00,($@ @ @'0404 00!48P 000,($@@ @0404 00!48P 000,($@@ @0 400!L4,008P 00K 0,($@ @@ @٘0(00 $00!303,P0 K00 @ @0Ø0(00 $00!3,P0 K0300 @0 @0`᭘0 (00!T3,P0 K0H300$@0 @0 @`ᘘ0403 00!38P 000,($@@ @႘0402 00!28P 000,($@@ @l040t2 00!d28P 000,($@@ @V040$2 00!28P 000,($@@ @@ qOP\QM!0lC1!00@ T!A0Sl* R RRlA ,0]AߧA dAdAdKAdAdAdAdAdAdAd'AdAd4AdCAPA_AdlAܣd{AԣdAd)EAtdQAdlAdwAldA|*AdAdAdĨAdϨAdڨA*E'BdAأdAA!*ęA *ΙA!*יAУdẠdAȣdAģd-A:A-@.ed@*+D7ee\*eddTe 7e 4 ><0<@K?&j4L㾪0t t@ax00c00Ū=K0(K -0L@0@SP) S&S S `z( 0(~``p( 0(t00S 0 0 Ve -LMP0@ 8 )S0p(040K (YP# 4 0Q0%0 *KS 0 0A(0R`%(`" *00K (kYP 0` 0R0`V B  0 `0D@<0 R :R R cXc tX_ R @04 K 3 K[$!$("( eXMpW +00f = 4D0 ( 0(*00f ) 0K+0a(!("$a" 0 R ( 0(,00fD 0Qࠟ8 ؈8 ,00f/$X @! 0!V*  fp `X@v<0080P(K褚Ae -L$M`(0P1@ p DKE2 DKqP@00`Sh0  DK⵿DKDK2. 40 )0DKqP@h0 0,K/ 0 )0qP@h0  0,K4 8 <0c(#(c4"4#= #:00 )0fqP@h0 0 R(pP2 0Q*)01 LqP@Uh0O (00+S S3S <SC H0 PH0 3S pppqqW qU@  0 %+S S 3S <Sh0)02  h0 )03  qP@IU0H0 CUH0(Ke -L$MPRp+ (@ DK⯾0DK(0 DKIP)0, DKp`P P0 zmPlU1M  Zl K -(QLM`P 'Qtt0(@pT 0K P,W [3W@ p[`K 0@CA p-L,M`P@PH[0K (0SH+R7 R4 )R @3R <R- ,R 9Q7'S5D0K( OPU>0[(0.@S*:D0K DP4[<S#UD0[0 S:D0K 5PUC[D0[0(0P S :D0K #PUC[D0[0KpdA p-PS0`@L MPK0%0PT @Kp 0-LPX@P  IX@P UX ͽ0 |X -LP 0- L@nXP K0hIX0 (0-LM0 0 0 @ t^0  R #' R @ (>02SF  0 y#  0 q# @ 0 @tT 1  0 `  0 d\m0 T=(   YU0'S(>UP ' 0 `R >) 0) \K+  ㍽0 K:Pl&P# 0'S(UP ! 0! T 1  0 0 `\K   0 0SK  04 8 ,048<! 04"8#<%$04&8'<+ 04 8 <  048<048<s R! 04 8 <! 04" 8# <s* 0*T 1" 0"0( KSP0` |HP pwH P &H P * 0*uHP9s00 0S#T 1) 0)P9X X+ 0+$ 0$XT?00K0K0K0K K嶊Kᤀ 吀 F0S 5  0 .2 @ 0 @1Xb 400S^H080SZL0 0;00< e 04 8 < 04 8 < 04 8 < 04 8 < 0 \K0  0[ KTK \0K=G \K#  ]0Sd70S \@K.K .@0K,', 70S ?$ 0$T 1# 0#00 Z( P$ [P pP 0 0 1GP 0v* 0*`000 0앟4$#48#80 pW\0K KKKPE`0 40SxU]( 0(aT 1# 0#1  0 0 0)S(0\0K (}TP \ 0Q0%0 *B SD)  0 -&E(p0s |4 0S  0(( AR*,T   0 T 1# 0#(0Q Q0(0 aVM0S30S P CD$ 0$0S 0S D00c0  $ ( ,  $(, $(,r  $(,! $(,! $"#0(<s* 0*Tz 1" 0"s|% 0%Z 1$ 0$X oDp10S  S[  0 ^TM 1  0 F0( 0RD  0 HT7 1# 0#0+WZ ,WX T 1  0 "( 0(0 ,0|K! 0K3/d0pP D 0P(Ke8f,f7edd00@{A dAd-@ -LM@pVB8PP 0K%`P 100 0K$cP)0K$}BKhfD7e -0`@L1@@P@Khe -L M    0W9 Ke -L MpB쀟젟0S Y0 Q00AᲣ(Ko3BP P@T `V x0S 0CSx0000 O800`S# 0#0X0C0H008Phfeed++Xee -@PPL `0 8hP M  gMgO\ `P/0 !`8 0 0 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -L$M@p0S0̀c0S+ 3P 0?0K08K@ K( 0R x00@ 0XS  CP8#8 0 K褤deX,@2iee -LtM Hp#P R`*3అX Q> R:p#5S 78S p@p0( PP\ 0 3SH0L0S0'S (sPPJ 0dS lS 0`0 0`0` Np0&RS:P HK0 c G K HPK0dR lR0`@K U 08@ #80@K  0 H KPVy% 0%7ps( Z@_PHK " 0"#@P 0# ! 0HK!"@P 0"&K 0&&0 &hK \ XKXx KhKC@Pt KXKC@P䄟 Tp* 0*': 1<03@|$ 8 #HR/d4CQ 3L$355p KhKbCP (D* 0*l KXKRCPp0x Rl0t R"K 0"#0 #3 @d |3(P# 0#\3+>+?+A+@+K`P1S% 00:S!0S*`7`V $+[,W7h^7'0Q0AiUY K`PS[?XTS0S [P` @P 0[ 7GR! p3&03;[20 3S00K6K K$` V0[ 30@""##;[ R$&00‘` KE`P[`y\ K;`P |0V0#x 0#t 0#d 0#` 0#\ 0#X 0#01qQ>CC@0K$W  eP $_`P0S0 p @Kl@K5[KlK5[  ᖸP$ 吸P0Sp0( [IP0 81\H41 7  R # 0  #&1JH P0@0@`0 0PP 10H0[0K0TK\0K0uKXp 0Dp dS lS 0 0p0 0p 0H0 aR0l0 0pS p唀X08@#8d\0 l\0\ K P % 0%  0  Z00Q~H0000 $@0x004 000030q10Q吐s(Keddd:AAedee&A -LMB040 p  0 40`( cZ  0 v/Z0@@ 0RPP00K 2JP 00 QPP4 U  0 i0  R ! 0!4TGZ0S 00 g4P ! 0!QA8 " 0"a0 @8SP0c4+/Z  0 00`S 0S " 0"00 4HPP 4B0@ 4C0}*4P 4Ka6(KeAdP0@0!(21 (/dP@-) QH\ DpW\ ` :\ dPU\ @:@`Q)  Q33̠3(:\!#*EP@ @PFQA \ dPU\ @ :\ dPU\ @:@S -0L@0t0Pt00`0x0x0|0|00S ;/PO 000S ,/P@  ?80S ppq/P81  80<0S ppq/P<"  <!p0S ppq.Pp  p@P& ppq.P@  @P /P /8P .<P .pP .@P .7- 0/ -`LpPB@P* Ud 0PT 0L00+40 4000P0X00H@` \00eC VP  媯@7f -0L@(S`pBPPE7A( 0000(0C00(00@ 偯@@ -Lp@W` =PP E100 E23 0 p$Kkm 0-LMC(00d P PK,0 01K00! R![0 0K GEK0 0-LM0@)S'0S$PP P!K-ZPpP 00:SP 00:S000 SY*K0 0-L@ᠮ00t0x0|00 q-``q.QL@PP -00/U00S00=U00S0t00U00S 8P -001U00S 8P -080#U00S <P -0<03U00S @P -0H@0]82UPPU pP -0p0 -L M` 0p  SPP#0H S à Q8S5\+p^+p^+p^+p^+p^+p^+]+p^+p^+p^+ Z+ [+x[+T\+\+d]+p^+p^+p^+p^+p^+p^+H[+p^+p^+X[+^+D^+W0S 0S0S 0S 0S @T.V^00S 0S0S0S 0S0S :@PPM0S  -PPW0  R0W0W0  Rt00 00PW0Q W0W R/S0S 0S0S0S 0S x28@P0,P b0 00@PW1 W| 00Wx1,08C0 00PgW`W] 00WY#X<@ 2Xp@@t,PD  ᇭ>W3 WA0 W= R:S8 @6 R33T,0@S#  f#W#0SPx0W^0 R000W 0 R|07* Kd -LM@0PS`p,P7 +0ES* 0 00 0 00K -LP`+@P  P , 0-@PL  K0h+0 -L`M|@Kp `PWPj|0Sx0St0Sp0S|!00$ P SlP BsU E|0[SD( LKg|0Sx0S t r  g K h Kp 6K`0 d \0 0g0K0`Kh0KKd P hKLKb6PLK96P  H0 LK 56LKE6P U  |$Kd -LhM0PDR@  )R  `FVS SSTSF S 0p0F;S񟗗Pc+p+p+p+p+)P|K@U PqP P Plh04h0zh044h044h0]K'UPlh0F;ST8l+p+p+p+p+o+o+o+o+o+8l+p+p+hp+p+p+p+p+p+p+p+p+p+8l+p+8l+p+p+p+p+p+n+8l+8l+8l+8l+8l+8l+n+8l+Pm+p+n+p+n+n+n+n+p+p+p+p+p+8l+n+p+p+n+n+n+%V& V/ V V- 8V$ $V61 2(V &V 'Vh0#9' (+V 9V )V"h0:h09l0h08h0#:h0?h0= h07 h000h0#;00 `1p` 9 0_0K0XK8p`0KeK\` @D0K `KH` l30p K@3T3p RDK p0 p0 DK(0 S@0 x0 0#`Fp0 `0 V񟗕$o+p+p+p+p+p+p+to+p+p+p+n+p+Xo+o+4o+o+p+p+p+p+p+p+p+p+p+n+o+o+R Q b DKӨ [R6 t0St01R8 0R@,R<(R& pQ  !A!R Q :RxR 000t0  tK*R `K& | # xK   pK V0 V V-1S 0S 0S000S00 D0 DKR$ S7* X00 0p 0 0a$Kddd -`PL@ T PU00 0p 0 0@Kh' QP-LMPp@`9yU0S  P )SP S0#03R0S)Q 0 00000 000c00S  p0 BP $K 0-L`p X?@P 00'S(?@P P330 Kh! -LWMT1 ?H! D !@ (21(23 700K| 嬧X0S0L1 0SL!00L1 0S0L!0L1 0SL1L Y P9 .8Q<Q  0K !pP  0K !pP@Q  0K  !pPpQ  0K !pP KD pP00D1 PD1 D(@ ( JR(:UKpPDQ 0D1 `D1V@ {:P 0p0` R0 3SHL0ST0  b`00a0 < 0bS00S) p=WP:PP 0'0:@V <1 S:T1T!0 4 L1(0\1 `8 8`#4 CS00'u00?0 hfd,+e0fdP/" p-LM` PH2@P$SD0CS"  R @ Q Q  r. aR)*rP aRP!H0SD0CU 0KhP @LOQT0K  0vKpd8eA -L$M2rRB0"07w$PЂXH@ P  `R @0R0QYx2P@Tr `BODTn a@KVBoFeq) 0 cQ$*2PU PP 0 :$W_o 0R v$ 0$P@KEA f$U@2 0r% aR *P00 03<10S _o0R3 0 $P 0 >$U @K 000 2@KP@ 1PtpP 8 `r ЀE0@XPR0({PH0 $(Kddehf+8edLed 0-L@P2P0(0` T T`@&0e -L M80@S #S@00 $px`SR $S R, T Q0S,<  ],0 0RKhKШ@Apd -LM400S S 0  K0  KУdܳ+ -PLM0 P0 P00 Ȑ O<2@t0K00 T Yw 0HSs:H tKԚtK tK&P .K KX0X0 d0T0K80P0 <0L0 023K8 r 0 `q0`VpR 1 0$Kh0`80 \0`pHP<0 0S0K0F8W#8* 00 0 S: K 0K K0KK %P  . Kf K KƚЀP`hp&h H tK3KṚ`0HPSP0@{oO0P(K8ed A -L4MP@p ppN0XPU5 X. (0W+:( 70000`0f%P  .\K\ K|e0011\ X0X  \ 022T((@PO(K8ee-Add p-LM@NP XP\ 0 0 x0x 0 b d PP  TTL`0D 04 0Kphe8ex@NA+w0@XAd,++ 0-LP8f00@0@000 0?0: ⸡?000t0 0S 80S3 #00D00S 380S000N00uldd1E -@`PL( yV0PPP 0` -0L@SPaN  RQ QN0P( ZE01 0P0:0 00S6 Q!$ P! R  R  t0PUڴ@ A  0 #|0 0S p |^ 0S pWHPC @ 0 @( 贤d0@zAA0eޫA -PL@`pἃP *Px00Cx00Ѐx0 ?wx0 0Vx00apg04  0'0 $Kkddذ+ -@0L@P10`SMpljM P( P% 6Y0C?o20S 0$ ЀX R?1",00 0?M(6XS MX 06hM6S 00S  M}M(MM1($KkoM d8eddd -LM@b嬀 L6@q 'RB@0p1 0Sd<+ܲ+ܲ+h++<+t++d6S06ıPjPPU 00PP . Px00Cx0NUN p0 ᱦG%02 061 10?'\0X 000Q0S x00Cx0R 0 060606S06Px00Cx0T x0SL0S 3/H03/0Cx0Lf (K0 ß0 <Kx0SL0S 3/H03/0Cx0L0 0 0 hfdd -0L@SP%06S &P `2L6 S0060xL00C0P @o/ 0/d -PQL@QUD aLXP $0pS 0TXP $0pS 0T0P T"`0R`00S 1S P P  +LP Khe8ed d 0-@PL$ 48K0h觹 * -<LK40X0S0$00S0 KhK8eed 00-L M@/0K0P(K00K (K,  K1U0 K03/P(KK0 0p-L$M70K00K`80K 8KK4 jP(`K18 K0@4/@(KU YT06Kp -L M0@S` 00S8K8K!P80K< K"P< 0`oS%K0S V\    "(  ",   "0   "4V 020S|2X R"`0RH TSK0S 00S8K8Kk!Pe80K< K!P^<0 Rt YJP pP"PU+ 0V\  00#(  00#,  00#0  00#4 04 ├P JEPDP 0VX-UJ100 0X R"`0R xJ P Jx0P 4   H VolK贤d8e de 0-PPL$  H@P 6Sڶ6d 08 #86S 06%0 H010 $000K0hJ0贤dd -<9LMP@P  9P 9P9 0P9`0068P  8P /8P 8P 8P%J8P 8P1 8PIh8X@`J/7\I<8`x`XP@U V~ 0 !0011\  \ 0`@20DP~.I7P ZU``W 0X0 0d0$080(0<0,00238 r0` 0XR 000 0  ` R 0 p``V W080 p`s%`P@8 ⿔1Q $pWQ:Q $pWQ:@1000100010 00100 0100$0100(0100,0b1@V\  \S:1 `p R 0SR: R 0SR: 0SR;: R 10 `Q 1&ep嬶0?0[ 0S! 0,0S! 0100$02 ZH2SS  R H0S D0C  ` Ra R``V $00$0\41 0003, ᑹ)' 1 000`pHbV D`FV 00S@Km6 000J@KpH`_$ * 10  00! !3 0HQQ 00S HQ DA`0Sa00S``4V1$ 0 @8H~Lr$\H42`V 0S00S; @TBOD  "0 1 SB?C@@T!V@K pH `U@K᭯ P@Kᡯ }`T P@@pK0 `P bP` 6(06 06$0%  xx RЀ , EH(KliHLi0UieNi0WiHOi miHMi 8eJi(KiPi dddALe 0-L(M?0K0@P@0K8K0px0嬀P`0PPTPx0SK P0 0  0KKOP (20S 0K .\K\0K"Ksw0(000) Q0S YY0S90 R00SX p 9(0  0(00 00@֊0ɑ@0A9 B! ('4", $ ,p"$-0'8'| .0( 0:/p*+ٱ0K* + 00V 1( 0(1. 0.X@哳F @ 0 @喳KK!(K,ffd0@cA0e -LEMP@ GK͊ CKɊ,8K0(1 APP  0R``\0K #P \0 Q``aV GJ  0 MK Kp喊 K@PZ H70S `K \K. . 00@ 0'h1S1S1S1SC?K 6R1S1S1[S' 60Sa x&)0[0K0TKGOK\0K\KKX D [P$60SI  .KԽ00&0K&=0[S50S6 %1 KILK\P5@TU %  0`4 V8` a<& 04 8 <@04@8@L 04 8 <00Z00S 40S $ 1[pK K 1 @P p'0[0K0TK\0K\KEKX@ D@ 20P 4  0  R  K$1 t@P$1 0(! ppT 0K00Z 9  V 30S K.K`F/`90l#00K GK $1 ُP$1 ,30S G/K.K0K #,j+ 1S#1S 1SaVwpP 0S000\`W``V `K@ !0K B/o",1 $! 1S&1S#1S AT2\`K qP4,1$p 1Sp1 0 S000 K@0 GK0,1$p 1GKSp(1  S00@ 0 K1@/@`0S G/K.Kⅼ0K 0S C/K.Ky0K 0S K.Km0Kh P`qC  0 tKK(K dA0ed0@ AAA9AwAXAAAe,@۰AAA  e -L T$ \0!d0d R pP XP 0S .\Kc 0 0000d00\0K⯿@\00S 0K .\KKd0p@0p\0K$ 4㚿(Kd!1@AddABA -LM`p @K ㏅K PP 1P\20S Y D20S| @K \pK.  .00 0"Yi0S0S0S0Sg  0R\0K 60P \ Q0tP hA  0 K|F KDYKiP10S5 0 R @ A 90 00T 00S K.K@D⧸@90 00K@0 0K P@垭C ! 0!塭K6(K dd41@ AA0ewAxA -P`@0L@T 0S $P @e 0- 0L@T  @0e -LM$20S " R "  "垾x!`pVs @P$0S UP ㍾ 01TP P@@`VTU @TN@TLU PD `V?<U P K K hK 0`KhPKPKPKPg0K0K0K0`0h K0KKpP| 0000$0  .LKط 0 00DL0K)UK dddAA1@eAd A 0-L@M080<0\0@ PP L00S  .DK⪷0P( 00d00D0KK0dV1@[A -LTMtT@T X0@`P  RP( @T' 0S00S X0 \0`dP\00\0\0 `[P\00\0@ R R0S@tcT; 0S00S2 X0/ \PPUpP 0S  .TK9pd0#0T0K⊽\0X0 PP 0S  .TK Pd0"0T0Kq@2r!(2Q1(20`SBOC T 0@ 1S hK1`jhK`X ATBOD{T0 [`@TI BODTF 0@# 1S hKf1`P     0  ?1hK`s A*`@T BODT 0H HR000hKX4ghK`U A( K00Q \ ` R Q X " \  \ 꼤ddl1@AAdLee 0-L@P P P`00S`0`@K0h0 -@0LQ0S   `P `U 00CS0  ⒼKhA 0-@L,6h00CSh0K0hJ78e -LMP p@ K( K8KXdK 0K0 R8l0h KԬ`P P20S @"@C`T 00 00 P 00 00 N@0T K BOD  `0 先P0 AT BODTRqKX@h10SR \!d MX  `Q03 ! 0b S1 q0 0b  @hQ 3 !0  b 00aR01 4 00 S&H0  0KH0 :P`0K@̡P P00S D X~11h  h `(KLed1@Ad5Ade^A 0-@LY0PS00S  K0hfL+ -`QL@ 0aV= 00SP $PU P 0R 0 0pW `P 0T0S   zplU 00CS0 ( SKhf dedA -LM0rOK p`P 1 J1jKPN 101 ~PG 1X 8?0S5 [OK .ȴ1PK. ´0000d.d!1[S1[0S >0S  .[K⪴[?K. !0 R100K P 0 Q` 嬺`V N唩  0 嗩jK ,e/KE eKP=0S 0-<ƺ0 P( T 08 PK\100C?o22 oK0U0K 0匠 4$#4,8#89K00  <@P10P 1$E壢10?0Q1! @<00 048  10S ! S!0… 1. [K0[/K01000` | 40KAP Y[UV0[P09[100[UI 0R +0 +;0S S:ڲ9[S7 (; $;0R KبC " 0"ۨ&(PP! ( K\jPU' mpjWP0P00G000刑Y 0K 01 0K01 p1Y0S{0S * Rt )0S) Rj `)ҹe0S S00S 90SX  .[Kg[?K)40 Ks00K0K0K0ܠ 0[ 030K0 [2 000K00K048 04 8 1 S0100C?o21 8@T 0 R @0[d RPP 0S 0[0僑z 64 1SC  R@ $( p P@*70S1 1[_K. P0$'XC$1PU 0SU:@PU:1!0@T ٤H70S 1K. ˲P`0&!R @ A 90 00T 60S r/K.[K@D⯲@90 &\0[?K@0 0rKXe3L3 8F堧C ! 0!壧 jK8P0000[X  X X00X0Q 0800<0<5 %0[ \0P`P |50S  .OKZ`0X%L00d00O?K⨸X`0/ So  X* 04d`` (%]0  S  4 @R 0X08X 000X0080<00[ 0 R H2 ! #SD0CQ KP ß$"    q  S  R@  ! ~!R{ UPr oKo}K``KPpR̡a`  R3Q$R"Q !r `pK`oK!q oK``p}K`}oK* anP#*a``apnP#*b`arW3Q  ^QK`}Km`n H0SD0CpUL0SI ᶣP0X!d0 R! 0! R8  !㞷1 [nK`! ]밺 5pP Ԙ!R2 00S ` 0l `~x1@ AAAwAd6dֵAeȣd,AnAAKAA¸A ePAiAA÷A1@AAdd0ed8ẹd1@жAd1@A!K}0 K1 300K0K0K0KYKP P `0!# 0#0 d0 "! 0#0 h0 "! 0#0 l0 "! 0#0 \0c0K0\Kd0Kn?KVK`P 0LP 40 000 H0@0H0 ,P P !.CK⯰C/K96"K]PP 10S !.CK☰1P!0C?K|C/KPPv h00h0,0A\00\0(20S  W0P 4" R @"lǶCK$V2 20R ʘBlC " 0"oE2@0QSp@PCu R92pW5 HT00S00S) \0`0S#H2SDC Q H0 SD0CR @ !W  对F1j0꣹p3 0R30K 00[d00800<00X0w`P c`P T40S !.K0`$000[00K4g `40S !.OKͯ0 00`$000[0O?K(K-/-1 01019X,@/-/-/ -L M    0N K e 0-@L-0 -Lܧ -L 0-@0L@0PP '00K0hꬤd 0-@L)0 -L)1M/ 0) -@P0S0S0S0S  T,P0s y  0 } (0Ql! 0!p0bCPPⅠPV/ 0 P( h L20S 0 LK̹ (L0 X*(P(H' LP 2" 0"60L0 `yV& h 10S 0 LK៹| (L0 HK'P('LP " 0">=! 0!0@  " 0"P0;SnI@PP_YU` 1" 0"Q0 Q0@š% R0%ɡ(K ee -LM0PS`@;0S8P60@PS P 00S, T 0p @0p00U0S   0`P vQioۃ 00  0 0$K:0@,@e* -LM (  &@S0 ("!("` P  0 0K00!P0K0  |P qp 00S6porHP]p 00:S00 P 0S@PY 0P00 0 3SH L0S0T 0H  0b'S00S 0(0C00(00 (@T0 0 (0(0(0000 Kx800 0 00K00K0x00 80 PQppW 0xd0 "0`0"", 0v00K00 00:S WPpw%p0S0CS:00 0,K:i(p 0 r@P 0( 從 K 0 e@P0, K0" `   00:S0S UY UA U. Uy10  rU: @Um10  fUP ʄU1? E0<XUP HUS10L  R C10  <10  510  .10  '10 0>CC0  10  1010`P1@@P@`ߟC@PCT ^ 0S K;V 7TK 0 (210#(2(Kdd0e e p-L$M`1@P R8@ 7 K 00K8 K0K4  R 8K70[S/@08 K@9@U  Kp 0-LMQ^@0 Q/P K ! ,P (K!P#0S )^i^e^^|kN^ \ \  K0  -P MLp( 0A000 nP3`aVʀ 0! `0     !0 0'@Pl\@P b `0Pvp0 㥘 u Kdeeāedde p-L M@P` 0R0%0 * 0K P 0Q0%0 *ٯS @ž  0 ƞ R  ! @`实( 0(岞0 , Kp褚Ae@ u8e 0-PL@@@ u20200 -1LpS` PU @1S !S T"S ղTSP11@T-1S \  0-0L@SP P0S000C0S@ 0 0{PP0002@T-@P0"  /8e-$8e -0LS0S0S R 018e -@LPTQ$ @P" 0S 00SS 000CS9`POL L  p-L4M0PS  .LK⣨0L K0S 00SS 000CS4  H `zP @KpA 0-L@P P 000S00S S000CS!K00f`PC$;(KddX,@NAxe4e-//-/-/ -L M    0  Kxe 0-@L-0 -L坝 -L嫝輓1M/  0-@(0L((0M  \K0h0 -L MP0p(0 `@P+ h 00S(01  0 (Kᓱp(0 P(P <@# 0# Kxe -@ `U@WT#8 -PL"L0  !P  0`O@:T 0 d e 0-@Pp`DML!2 000p,`(P$@ @@ @F 0!42 004p0,`(P$@ @@ @F1 0 00!140'> 08p0,`(P$@@ @F1 00!140'> 008p0,`(P$@@ @F040<1 00!,1 0'>08p00,`(P$@@ @kF0400 00!0 0008p00,`(P$@ @RF 0!0 0008p04P0,`(P$@ @ @e4P Y p00p0 ki0[S H(KC@AQzA`,AE@ϹAA)Ba$BA@AAg,@ 0-@L 0|e - L0M!@P_fPi 1Te0 S\* PY RV?o`2V0SO000R0SH0 0 G Vp 㔍 ` @P8DKP03/0 0 0 00(@0 3/ T 0   @PV eTQ 0 DK @V$K3eI - QL0 幦 嵦6A>A 0-@PL T P0S Dא A 0-L@P$ P 0K0h/08d 0-@( L`80,0H8P 40 p p  W`p@pQ}n0 5/*0 Q,"# p @{ 40 {00S>~m0 5/,0@ 40 P\  U\\(08pm0 7/(08Pm< 5/V }_(04`m 6/  PU,0 0,0\0\ 00.1  0,0(0, @0"NdIA~, -(0L@`P 4`m 6/  ,0 F 5    p  U ݝP , ]@[ 4  [y8lm0 9/,0@ (08Pam0 5/00S$Kk&(08PPm0 $Kk/3@PA -(0L@ P'  P8P!4P1m 5/(0P4`)m 6/P8 0R80 < S$003/p  -,0@i!k(0L8Pm0 5/}_(04`l 6/ ` 0S8PU, P (08pl ;Kh/,0/0,0@hM$00/ -(@h L00PR,0Aol RQ ` 0<03/00h0,0l0 -,0L@0(P  ",00 <   0 1H#HH 4c  ##c0pz 0 #"pb00  0 &"Ԟb00  0 &h"PĞpLb00  0 (,"崞b40 X   0 <0,0 0,0+0!垞a40  0 <0,00,0 0+s!d剞p`a40  0<0,0 @0,00<0 00[,!qa40  0<0,0 @0,00<0 00C Yp`00   03 dIW ,0 05<00h QPT8L$KkxA mA@AJiAAAAAA»AѻAۻAA|~,C@A (Q-/ 0-Lk,0@@P DL L0S   0 0-P@LP 0P 0 ?>#R @00 -,0LP  (04@kk 4/(0@4`ck 6/,0A0  KT   P T    0  P@@@ 01#/3@ -3L l9P 0-PlBLQ000,000 0-P(@L,00(0p4`k 6/(0`4k 9/`,00,0(04j 8/  000000,0 00300 ] 000Z (04`j 6/(04`j 6/`,@ 4  (04pj 7/(0p4j 9/p 00  6    60  6 60  60@6 0 600000 R <0000 000000 -LP 3@ -P4@L`V (08pqj0T 7/t5@ -P4@L`V (08p^j0T 7/5@ -0 L@R(0 R8PHj08PCj 05/(04P;j 5/`(08P3j90 5/(04P*j 5/(0`8P"j 0Kh/ L -@(0L8Pj P05/(04P j 5/(0P8`j 90Kh/p 0-P(@L,00(0p4`i 6/(0`4i 9/`,00,0(04i 8/ 00300 H `(08pi0 7/(04`i 6/0004 (08`i 06/(04`i 6/ R00 R 0 R R0 0 00000660000 5;00@005<000 -LP`i@p;  `(0 000  0d?>#20 0(p000,00<0iP0p0 xiP0q0qip0Sq0S& x =Pht =P_q0S | z=PS q=PtJ,0 d1 \1R 0S ?Sq0S814101$0c(04h 8/0 0 (04Ph 5/4l,0  0,000900040940q0S x0 0  5,dDX$Kk>3@ AA,A0A4A=AUA\ArAAAA6@ 5@5@5@ mAAC@ -P@@L`V (08ph0T 7/(Kh 6@ -@LhP 0 )S )St }0S S S tS .ShY n00Sjgd(08`qh 86/(04`ih 6/`(08pah;8 #87/(08`Wh 06/(04`Oh 6/`(08pGh;8 #87/(08`=h 06/(04`5h 6/`(08p-h<8 #87/pW (08h0V 8/0 0CS 3,' Rp`V ,0 x0x0 fpW (08g0V 8/x0  =fpW (08g0V 8/. (08`g ;6/(08`g 0 6/x0@(08` g 66/(08`g0 g 56/(08`g; 6/x0x0 R epW (08g0V 8/ `5R 0S(08`g0 6/x0=8q0S9 5R 0S(08p{g 07/(08psg 07/(08pkg 07/(08pcg(04^g` 9/ 07/(08pQg(04Lg` 9/ 07/x0 (08p (08`d 06/(04`d 6/`(08pd0 7/?, R00 R 0  R  R0 000 00000,000660000 000000 -0BL@P`S񟗰,,,, 0"S 0"S (04Pjd 5/`(08Pbd; 5/03 $003/00S S Sp S S p S@pz0(0|86d 0:/(08.d 0:/(08&d 0:/  RS13" 2N(08d  0:/(08 d< :/ 1R:0S70 (08pc 0 7/+0 #RQ N  080(04pc 7/(0p4c 8/8 0R80 < S)h 00R  F/ol,0"Q00S h0R0S S S00S(! -LP 6@ 0-P(@L,00(0p4`c 6/(0`4{c 9/`,00,0(04oc 8/  000000,0 00300 0= 00- (04`Vc 6/(04`# Mc 6/(0`4pEc 7/00 6 60 60@6  60 0 )c 6/00@000000600 -,0@i!k(0L8Pc0 5/T_(04`c 6/`P   0S}BPU, P (08pb ;Kh/ -LP`c@pL墔  G`(0 00(p00$00,00<0(04pb 7/0L0800 0ה $Kk 6@ AA7@ mA(AC@ -` BL@0R?D,,|,d, 0"S<6 0"S (04Pb 5/`(08Pb; 5/&03 (04Pub 5/P(08pmbV>0 7/  0"S p~ -LP  7@ -,0@i!k(0L8P=b0 5/}〒dP(04`2b 6/ ` 0SoPU, P (08pb ;Kh/ -LP`3b@pyϓ  t`(0 00(p00$00,00<0(04pa 7/0L0e00 0. $KkM 7@ AA\7@ mA(AC@ -` 0P(@L,`00(04pa 7/(04pa 7/(0p4`a 6/,0`0,0(04a :/  000000,0 00300  00p 0 0000006 0060000 -P BL@0R-ꐳ,$,,, 0"S*$ 0"S (04Pea 5/`(08P]a; 5/03  0"S pkoo -LP h7@ 0-P(@L,00(0p4`(a 6/(0`4 a 9/`,00,0(04a 8/  000000,0 00300 0- 00) (04`` 6/(0`4p` 7/00P60 P P6 P P6 6600000 0-@L(08P`0 K0h/ -LP``@p'}  "`(0 00(p00$00,00<0(04p` 7/0L000 0岒 $Kkh7@ AA7@ mA(AC@ -P BL@0R-ꐷ,$,,, 0"S*$ 0"S (04Pe` 5/`(08P]`; 5/03  0"S pkoo -LP 7@ -LP`U`@p  ▒`(0 000 j 0?>#20 0(p000$00,00<0(04p` 7/0L0|00 0E $Kkd7@ AA7@ mA(AC@ 0-P(@L,00(0p4`_ 6/(0`4_ 9/`,00,0(04_ 8/  000000,0 00300 # 000 (04p_ 7/000  000000660000 000000 -P BL@0R-T,,Ժ,t, 0"S*$ 0"S (04Pt_ 5/`(08Pl_; 5/03  0"S pz~~ -LP 7@ 0-P(@L,00(0p4`7_ 6/(0`4/_ 9/`,00,0(04#_ 8/  000000,0 00300 0 000 (04p _ 7/00  0 0000006600 -LP`_@pY寐  T`(0 00(p00$00,00<0(04p^ 7/0L0E00 0 $Kk-7@ AA8@ mA(AC@ -P BL@0R-Ⱦ,\,H,, 0"S*$ 0"S (04P^ 5/`(08P^; 5/03  0"S 8p 0-@L](08Pj^1< K0h/ -L`P^@p"ʐ P(0 00(p00$00< ,0( R0,0(04p>^ 7/0 0@Kha0ᮐ} Kh蜐 AA8@AA mAC@ 0-0@0 LP#R ptT T T03 dp#''0+A 0-LP@@P 0? 0^P 0t]A -LLP 8@ 0-(@P,0 000(0L4`p] 6/ ,0`0,0(04] 8/  000000,0 00300 0 (04p] 7/(0p4] 8/00 0  000000 6600 -LP]4@`p G  (0 0000pS00(`$00#20(0 00(p00$00,00<0(04p\ 7/0L0ᎎ00 0-W $KkvX8@ AA8@ mA(AC@ -P BL@0R-,8,$,, 0"S*$ 0"S (04P[ 5/`(08P[; 5/03 )  0"S p -L'P 8@ 0-P(@L,00(0p4`[ 6/(0`4[ 9/`,00,0(04[ 8/  000000,0 00300 0 000 (04`u[ 6/00000000@6600 -LP`[@p"  Ǎ`(0 00(p00,00<0 0?>@S0$00$0徍$003/(04p6[ 7/0T0᭍00 8Lv($Kk蕍8@ AA8@8@;A mA(AC@ -P BL@0R-0,,,P, 0"S*$ 0"S (04PZ 5/`(08PZ; 5/03 F  0"S p -L@ 0S ,0 (04PZ 5/ P 0 (08`Z; 6/踈 -L P 8@ 0-P(@L,00(0p4`Z 6/(0`4Z 9/`,00,0(04Z 8/  000000,0 00300 0 00 (04`oZ 6/00 6  60 6  60000 -LP`wZ@p  ⸌`(0 00(p00$00,00<0%(04p2Z 7/0L0ᩌ00 0Hr $Kk葌8@ AA9@ mA(AC@ -P BL@0R-8,,,X, 0"S*$ 0"S (04PY 5/`(08PY; 5/03 D  0"S p -LBP$9@ 0-P(@L,00(0`4pY 7/(0p4Y 9/,00,0(04pY 7/  000000,0 00300000 -LP`Y@pS  `(0 00(p00$00<,00<0d(04pqY 7/0L000 0凋 $KkЋ$9@ AA<9@ mA(AC@ -P BL@0R-<,,,\, 0"S*$ 0"S (04P:Y 5/`(08P2Y; 5/03  0"S p@DD/ -L MP`2Y @pW T1? (03/P  0 $k 0 e 幊`(0 000 7 0?>#20 0(p000$00< 0,0(04pX 7/0 0 (04PX 5/4T>00 40 4ڊ$(Ko#+ R E(r0(03/0 R ` K6/PU 0PE( 0  2/Kp -PLpMu@ U`J01SE  ku40S 00Uu`60` `000P}4P0 0 0000S  | R l  R  @0H 4/#P 0 $Kk`el, 0-L@FM4Q T T 00 R  K0h/K0h0 -0L@SP` 0P`4 T   03/P  0R  4S000//?o2\Q00//Q1S ///40S0/ q-L@P4000T0S 0  @QqPU 40`U@ 0H 0 00 0@U@ 00 0A 0-L@L40S T   0@K0h,0 ::-#FL$P=`L0S8 9S7 0AT3 0S 0S Zpq`003/(0S 03/0 R   2/80(0S 0  2/ 00 01ee 0-; S 0 0//e Q0-L@0 P05/0 00 K0h/0 -LMP@ `$ 000 0 0,00$(000$0 0(000,0400p0 $7/P 00 004`$00 0S 4 3/0 00`(0, 6/P400K<Q %Q 0Q0 .0 AQ BQ >Q0 .0/0 .00 . 1/0 .0!/5Q0 .0!// -L M3A@Qn--D---<-`Rd0SP`a 0 U*` p0 7/PD0e` 6/0` 0d0Fd0SCpPP`EQEPv 0p 08/`FPEP0U *D0 `0 6/P0 `0d00 00CR0` 0PS 0S@ 0 p E07/PPP K \Q-L 6Q-L CQ-L$ 6Q, 4Q1 %Q0=Q( AQ 7Q(!QQ HQ KQ EQYQ ZQ RQ0 .0!     n 0-0@00L0\P ̾0\0`P ƾ0`0P 00P 00P 00P 00P 000T K0h蟾0e0S 0S Ҡ /0Qh0:9Q;Q0h0  S 1l!0Al0 S 0$Qh0  / /tQl0S0000 / 9Q-L 0Q*$Q !0AS&Q ;Q :>0ASh0 S 0l !0Al h00h0 h00 S 0h0 T X0lQ \` 5R  R  d    BQ / d / -LM<0@@`P  d0p3 7/p 000 00V PZTPEU-(-T----@---------------8I0S0C0p<00<0\ dP0 30bS0A Sh* Re031b0CaS00[00pX w0 S 000l ?o2X0SF <0!0!S^<0p0<00 P.010S0.01.01pSQ<0 d 1`Q A02 ":/0d X0"0@000:/0 d2!cR 00X<00 B13/N<0@  d03 (Ko/(K(dA `00-<040@@0D00TH0$0LL0 0P0 0X0\P  0 00  00 00 =0 R\ 0 HQ0-L@ !/Q-Q*#QG  Q0(AQ0=Qw 7Q9 8QU DQu EQq >Q<00j_Q]Q*OQPw MQw NQ0r PQ [QhP( lp=PP0oQ^ cQ nQ0Y }QS ~QN |Q0K0<0<<00000@00D00H00L00P0001010 1010001g<0 d 00000@00D00H00L00P01010 1010001<00<0F009A\ 0<0090004000T  bR` 0C0R 0S 0d00 00CR0d0A0hP( l< 0r0,A0 00 -L MT@0 080\0`0d000000Ke -LMPP`p@ E 0 0000@080 ֻ\ һ0`d0 ̻ Ȼ Ļ  㼻Ke Q0-L@ :Q 0K0hK0hz0 00 <@K0h/ 0-@0L 000pK0h -QL@<0Q?Q Q: 8Q Q *Q* 0!R0 ,R0!R0 ,R0!R 0 ,R 0 !R@P ,RP @PU 0 @`06/0@!R0 ,R0<0 Q Q Q/0!R0 ,R000// -XPL@Q`1`!PfU0T p07/`0S T :0Tp D07/`P T0 P;`0S  0S 0d00 00CR00d0 -XPL@Q`1`!PfU0Tp 07/`0S T ]:0 PTD05/`0S T ~;`0S  0S 0d00 00CR00d0 -QLM@`& Q@ QKd 0D32aP2"5/ PPEPaU80 pD07/`P> 0 0' R 0PD05/`P  ,;D0d 0P2 5/ 0 PD05/`P  ;`0S  0S 0d00 00CR00d0K -QL M Q Qd 0D32a2@"0Dd 0@2D 0 @0 4/K -L M0 @480gS :JSv BS @S ASdl T0Q0cS0c0aDS HS TPSO KS] MS3LcSk fS XSFld P12lS0!D2P"5/3(So nS lS- ]hSh`PPh0U! Ph0U, ,Ph0U, Pl7 <7 ll0S 80 gwQ\PQ S00&P8Kt8K 80  |l0d S01P`UP!0cQ2 `"6/Dd 0`2"lT X0P00a0CS00` 0R0d0h0S 0d00 00CRW\l Pd023a0CS00Jl 0R R0b0c0<00<0D<l0 S0T X BS00S0 S0!0C0`0S  0S00pd0 Qd0<23S0!0C0l T`XPR 00nS10f!0cL\X0TuT`XPld P01PcUP!`Q2 `"6/d D02!e`!16/l0S l0S\ 0 S \%9 HPLPph@R10S+ S& S SP#SP SP SP%S SP#C"*SP SP(0CSPp P R40@0PP 08 K 0`` 09/P 0`` 0``   0` 00 ``0<K09/PR<0@080Jl0SK0p!0 0l0S S S><0T 00b 0 ! S S   ,  8Kr8K   8Nl0 p S0S0!R 0CR c cR X < T00000D0HPLPp$Kw$p$K?c>J?u&Al?p$?h?AA(B mAA AAA)A@A$A2A9A 0-PL@U& U \280  Q  /R :9R0 B##S\ 0PC0S\ 0  C r000IA -@`PL 0!0P3/UpP407'n 0!0P3/U:@ -@PL 0!0P3/UPh` 0 0P3/ UP<` 0 0P3/ UKhd;@d<@; S <30/ <8SA3=8SA@A310/>08S2AAP0<00  P2A0A`0Q @Q Q !@Q`2\Q :Q Q<2 4202,2}(2{$2y 2w QY (@QU @Q[ @QQ Q\ eQ\ QQ ^1Q= 0CQ= 0Q> S1Q1: 0Q4 KtQ2 @Q6 @Q& Q+ <<Q/ Q0 5$1Q 0CQ 0Q1m )0Q 0Q0 !0b0000000/00 0000000//fd=@+nA-ArAvAzA~AAAAAAAAAAAAAAAAAAAAA0@-P 0R 0R0<" b0"@0(, S00LR%B00 0-80LPS $@,K0h90@04 ~0P 00 }000 S`lc`cs @ =V`<0  2000S0  0fX``V P S``0 <`(KA -@LPp!A@` 0 R@1 -@L`TP (0H0P00P>@ 0-@L40S 04080S 0K0h0 -LMP0 @R <"p0bS3:4`KrpW 0< 0p0 0000 K0P Q@ Q@// 0p P/P // 0- 0LP @@ @ @  0@S l T d h 2/ 0l@0 0-@L>T000 -L>00* -L MPK %`@h PpP 0 4 R0 W88RW0  PKRW SW -!LX`P00@S  L00CS00e 0-!L0@P/LP  K0h00e 0-!L(@/LP K0h00e0 000/ -L`P?>`0r@p00p0000>0S 0Xup0S1`0 $㉳`000`딐 N h `0  @0d0 0h000000l0`0ZP 3n`0t0000(00,000000S 0$@o1pPP =(p|o$pX P po0d )PT ^P@$KkoXdA f-E@A -LM`pP=X4@V H4V <4V 44V ,4V5 4Vk 4V 4Ve 4V 3V 0CVn 0V 3V3V: 0CV 3VQ 3V0 R 00 d0t PT0h5/ 04x   |   0 0 000d0h`06/ t@000000000 0 0 00#t@B0000 0 00S000 ~P@B }x @0000000000M@A00000/000 ~~PA YT XS 0G p`P  Q3` zP500- P< S0< S'< 0S#`P``0 0,K0(P ,0 PL d0 0h8/  KW W @W@W @W W@W @W@WW WWW WWpdd -LM@`pr<1 P T 0CT #0T) 0T L R$ 00080L0S ,0@! rx0L0S ,0@10@S@ 00 0@@@00CS0K}f~fvt -@P L! }-0 pKh0e-<0(Q$P Q0/ f-4( \0^/ f0Q000/\ `P/0 !`8 00 ,  , !/deeāe -LMQPp@ 0q<0 0 X `VT0 6/P0T 00` Vz0 Kr0K@t5V% 0CV 0V`* \5V 0V 0CVW YWUWR ``*)` ~WC`0 0J: S=PP@9 4V $V*0CV =F Q+ &p4V0V"0c?oT$2V  0c?o $2V  $0c?oV  2o@@0 Q Q   @@a D(R D(R  T R @DH$H@@,D(oR* R >+ R, R R R T; 000 R; 00A0 T 0S c0C S@0@ 0; 0; S% 0 @0D8 T:S00@2T@ 30D8S@DH$H8T@ /T@ 00A1@H$HA$K1%#(*$' p-L M@(P/ $0S)`40 CS4 ,0 0, <@8oS: S >; S 0$K K03/$@P Q0  0 104,0PKp fXd -LP9ppUPPW@+UP` V&Vp# 0 URP0 0Cd00h3/PPPpP`U@ 9, 9 (kp A1A 0!< 0`4 0 ,   !/deeāe -LM`9T0@S Pp0S 0$ LPU% ,0S" 0p0CS00 4K40 00 >P #< p00` 2P <9H_k<$;@090 K fdA%A>@ -@L\0`S" 0S P|@P:u7P0SP 0U`0P0OP0`7Khdd 0-P0L@SP  R 0{d0h0K0h/0  0-@LL@ 0 -!L`k*PP@ @T@`V T0S LpW@0`0L`p@P Lp0e 0-!L0>*L@T  L 00e RL RL // Q-L jEA -<@`P LH  `P]0(0 fhI-I-P- 0-P@LPPPU(P0 f -LMp`Pt80@S 00k+0S(  `PP;PPP 4`0zU `0PtPP@P:60|6LP 00 04` S0P U0P000  4KP 8 hKdQA 0-@DPL0T ,)P P0S @000e 0-( L0$@T P0 f 0-L@@m)P T0SL0SK0h000e 0-L@P7P@0 -L7000 0-L@P7P@0 <8S@ /: S/>;:S0P0S/ 00S/D>@ -LQ(Z-Z-[-([-P[-<000 00000000000000008A-0S.`0 @  Pp R*"0^0@P@P0 0 0CTaaQ ! 0P@/ !`Vp`W 3#Q0C? 0 Ѝ輨d <-00000L \ 0^@\ 0 @\ P>*lNhoVj V. Q AoP   P >  P = P Q ΁ Ƞ\ @T*\LXoU  \Qڰ  gKh" qA -0L`S@P SL `& < P 0  0  0  0 0 -L,M0P ^ @T|@^p @C| T0K 1 ^ 0lChoVj V:#:PLttK T0Ka p 00W@*  Q= Q S Q0 0\ p*0C oZ: SQڰ \bf02"v@D S0VfTK0| S (K AA 0-Pd@LLT 003/X@0 -L 0-Pd@LT 003/LPX@0 0-@LL@0 -L Mp5Pd@T 0`V 0 6/PPX@U(K -T0 JJ0$ QC@L`LV@TL@d ʠ ʠ,$  !LP  /d ʠ ʠ,,  !LP  //d ::#$001LP /d/ -L MppϪ@P ^ʪPP`0d`h08 0pe08@0p0l`0 KAd -0PL `U p Ȫ@P@pDd 0P (@Pd0AdA AA -LMPP@5 0TPX0h0\0h0X0h0P0S00S 3/` l0S 0`l p`07/LQ 003/P 0X T0R\0\0h0\0X KW 0-TPL@P0S 00S 3/L0S 003/X \0R\0h0\0X 0T00 -L$M`P43pV 3LV G0CV 0V X3V 0V @3Vc 43V ,3V= 3V 3Vd@p`o LP Bb`qWʀ 0! `! 0   , !0 D0 0DK@0 * 0!!`q0   , !0S S {KzPu T0SqL0S0mS Qg T0ed@T_ 0 0R30PHX@ Vp 0`003X@T`CP> >P9 00080P2 ,0@! rx0L0S' ,0@10S#L0SP0S  d@T  0 0 :/PX@X T0V0l0(K~f`W|fbWvtaWdWcWdeeāeW$ 0d - JJL$FPb`P@ @ @@PU T0S L0S@0P0y -QPL@P PS3 dpPd`V 00S 3/PPpX`WPX83@ 53 d A-A 0-@LP3TP0 PQ SS K0h00G-p hPW@bEQP @R!  1!4$@DAR! n@rA@@0SH:PUP@ X         XgPL X         @ U Z@ЍC80&0G-Al0ST0 QPP 0bNㆁ20hQ0bN0tP 0  00\ R:p^ AZ A\ \  W @^@G-TP L0   lP0c C p@ bPB P5$0 0c\^a@  p  '0@TK:PU PS `VX 0000`V0 ^ 008#80PU0 0@T$:`PV Z PPPP`VP Q PPX%XP`VPPS ```Q`ЍG-@M1. Q8 X N&B@P0@ R:pPW`@P\ pW@@0N Rx:pPW`@P\ pW@ Rd:pPW`@P\ pW@lpPg``0f`0``@ @H``PDH`P R=:p`W0`V `V `V @`V@``\ pPUpWp W 0 V pW0PU `VPU @\@ Ѝ -Pp@LM`T 09/@$K -LM`p@TPp0U p 09/P@$K -L M`l @RpP%:pQ":fQ  A8/ x  Br'p 0%\ f Br"0PQ0  R!%0 * K -L M`l @RpP!:pQ: gR  B8/ l00g0C#"0%\P 0Q00S!% * K -PLp`0cf`@C@0A!b"p0@`W  %0`@ -PLl` a bA B1!b&p@`W  {%0`@ 0-LP@I P 00000P0 -P@L#@"pT`@p Y  G%0S  &0@0p`  R($000 0// -`T0L@Pp 13/ULpP`T0 0T01Kh/0T0 -P`pLQ  0R00 e@P p 0000@KhsdRQ-\  D10^0\(00 0t?@ -QLMp@PU!`000 p0V`00  `P@DT P`p0UP0 P(K -LMR`p@P U00 0 P@DT00 0 $K -QLMp@PU!`000 p0V`00  `P@DT P`p0UP0 P(K -LMR`p@P U00 0 P@DT00 0 $K 0!< 0`4 0 ,   !/deeāe ̠ S /C-@ 0@NQDn@.00^3@@8QDP!#8`pp pBWp pppppppYppppppp\A-@0 @N\Dn  ^"@ PA``0`pcQ@ ``````p`cV*@``````\A-Q@0 @D5\@d DL 4"`pp1p p WQp ppppppXQpppppppQG-0@ 0@00pb|P PU@P P U@P Pe Y@0SЍ Pi Q@ -L M$@`Q`Uʀ0!`$0$   !@V`YPP 400$F0@04 00 $00,000T 40 F40, @S*S S S  ,i( #p00CS]T0 X     V `Y `  d`Y` Vd` `@` 00  +ld+p+pd+l ɑhitPLx00| p#Tp 000 0h 1b 0d00c0# Q0j 0     1 01R01010101011000 0000B S꼅----ȅ-------ԅ-ԅ-N zpTp`.Tp '   Aτ00000000000  Aτ000000l00h00p00pTp(KdeeāeHAw-|l-w-q-Pn-x-o-x-y-x|-{-00 KP0 0C0員!`Q;[0(K?@0 0RX D0D0R0/0Q  [X0Y\0Z0] /--(00S   R0/<f -`PLoV0@P0# (f( {0`0Zp $o0$pbOP`[ 0`000   @@<f"/ 0-P,0L@T 5/@0<f@-X0P H ^ @ , Œ   <f d -LpP@@\ @@) @S P R  \ \t0 b\!d00l@l\@l@cV WQ cP!N N' -`L MpPd0@T 0 0 0VP`@U00(K<f -P`(0L@T  5/@<f p-0MPL`0PP@P ,  0< 0 0"00Kp<f -LMP(g@Pj k`Wp  dp0``aEpPD 0F<0 0P0 0$ .8 0S#100 03K @`&P01L!00L00 4X10CX1 H10H1 (K0 Q T0 BR##PZ/ 0-0 ML $ 00  F KteQAPf/IPf 0|0 8?o20/ 0-@L5I| I|0Pf -LM00 0@0R9(0E 0SB  10cK ? R5 00 R1 (,( @(@ ( ( ( ( ( ( ( @( ( S K  K![   K  K![  P l8[?08000K -@0Lv YP` 0 p  0  S0C10c<@Dd@9)P@@AIh 0@ @@@ <0  00dS$0 00o| 0-LMP@l@K KKK K 0KK0KK0 0-RLMp(0 XPx@h`(00 0S- 0(K0c ? ( R 00S=P   PPX (P N$K 0-@LMP K0 K00( x00/0 <#<0@00( x0 0/ / -LM K K 0-LP@  0 -L@p` 0V !6DF@F0 P PL@D0&\D@ P@PI000 -LP@``` ` 000 -@PL `0 00000CP   -`0PS@0L S @ h}@ h0 Xq@Xh0$ xd$S@ h@ h0 X@Xh0 xxh000 -@LPT T T T T 0@`@` ``FPb@`@`( 008#80"$R *0( 000`ff$ $0T`0$`00(^f,^f\A@ 0-@PLP K0h}{A -L,M`000 0!p PP20K@ 3[S 0\0P P`P00K0 S!: R R Q\ Q\<0 2/<0P R  Z R0S) \& #KK( ?P00@0 ! @ ?R0K B@00 0P0000000P  3/p0S(K 0-LM@0 P0!$ 00PP0000(0$0S S (0"00 c (0 .00(0PK0@ -L MP $p0@0( 00 `00ZV*T"V/ ` ǵp@T T$ ":T+ #T T T@pf `!@ pf`@4 40@ O뼂@@"`V 0( 00$00a$0  p (0$p`0@0S000(K@(^f,^fA -0L`SP U U T @ DP  ,P0 <0AAA 0-L8MD ( DK @0 K[@ -LDM,0 x0H0 0@( 0K !$ N0K 0 O4[S0 LKH0 0H0 LKuK[@[@ -L8M   +!K (0 0 DK @0 _ K\@ 0p-L 0@@ pV .0K `[ 0@@ d+P A0@8S 0S a0D8S @DH$H`V .0K c2[.S ;S X .0K UB[;T(K d\@ -L M @T=0`@plP0PVO .0K 50`00W0S2[ A C(R 02K  R;ST4 0U.S@D0W2[& R# >  d R!#&-- ##? ?0,<,< 00  R##?0-<"-< 00 R 00T?0@0հ@(KP@ d// -LM K K p-LM@0PS@ |`@,K _",K"K BKKp 0-P@0L00 0( ?! 0!""##$$000 -@L$MP4K aA@ &a04` P$ `(00 (0pP5C $0`0 Rp)Cp!KMF<K I"0?pP  C$7M<0 000S C<0 "M[H XL0H 0P00x01|@0d0qCX0S 0 0S " b80K0p?080 8  8 8P   <w8 #61t00CS(-8- - -8-8--00d0 00d0)KL 0=t0S 0=P0H @RL00L00@(KPfAAA4A\@Lfx@DfHf -PLK00!  !?pP1 0pT1 -0P1  1R RVa `TA @0SN01 T h㧑h hr/K0 Lp (0!0(06100000(0:(0,0<,0;40 0001P010p@@P0!0 @ B">K000?pPW1 0f\p0P00ãp001 p /000 Xp 000X0p0 0S'V' 00EXp 4 @$POo B@P T/ @  p@&p@ V!J!pppP T V Z   q (KedAc@pAAAA -LM`RP} sRz(  Xt p t mj  0Sd 1( Kq1P\(t0S Up0P(L<( 00(0' 00^\@P7(0 (j*@P.(;-0 (s@( T (n*()-0( S p p0!QP@  -(`0 000 ( -(R$Kdl@ 0-LxM0Q0P K||@Pt 50K @ #@P 8K0d|fApAHf -  L`hPPt0S IL.  )@ 300(0:(0 0-L M@ PR$K0( K $!K1/P0 (0| XUPF0K0 p-L MPK a0 `P@P `Kp 0-LMP@,P 0K0@-0 R; r8Ap`UT2bWV.0 r+HUT' r$x r!| r r rcP@WVDUT r "SR 0t0 CSR-- -LLMP0SP00p|L P00 00t0S(Q @aԑ@P L \0P R H0 0 000P XR`K K%KP00@00 080K< K040K 0@$K8@ P8<0 0P0@bT` @ <T&0SV $KK D $0@K0`cP0 0V`!L0$K P0RK}< K 0@$K3(K -LM0|@(`X0SK pP  G(0K0000 00P8"($@0  ??QP $0 10R@0 Q@@p0 Dp0* KP T 0 8f -L8M`@p|P8!!""8:#:0900 000X0Hh0Xx0)(0L "LX#t0S  6\0KD0 0 @0 00 DK\ #KX 4 X0TKL P0 0H0 >P04 +b" 90|x0(00000L (t00$K -L @* -L 8* -LMt0|0CSH#iSR8*PP P80s $ 0P80s(0 Ki* KA -LGA -L M`@|P t R02& Z t8P Irpr@p0 !T>0  Z K00C S!T-t-t--<-H-T-T-t-T-`-0|0(0X0S  0%  0+ 0, 0  0 // -p0@`   t0L00H& R*0X6\6S `&R \&``60C`6H&PeN` -B^ L@R -4=S< `0S !>00CSڇRP 0S = C!P$0S c> P0\ V0  = C!c΄ B` -LTM`tpQ@0 0` | (P$ی?``,db `H0@S\680 <0  0#280 nj80< \`60X6 0`@&D6 0K@0P 80 ь80L0 0&KB> 0D0  0K&KK= RK 000P -0 K = @[`P0 00Y ܆K   ? P` i Y 0P0 0 Q 0BT 0 0 S0 SB> 80< B$+4H L0 $K ? m 0 X0BS  0P2 KD20[S02 * 0C  ?o  20  20K !D -4S S ,D0.0-40020[0X0S P` P`fX0S`B.0`o R V <`680c00<  0P e> 0X& `(Kh@@-P0P R0?0A@P00" 1d(f@0@-PQ10SU- R@@T00S Q 0T? 300QS\06? Ã0T?0 08#800cPE b00@-A@@n@T@T\ S@L0bQ Ӂ0ѳ 0ҁQҲ0/ -LM@`0pQP0@4 K9F#KSR%,[+0[{.B B2$U  d0hZV <<uRoUk0V00U0 K; -LMPP@p` 0P "  4K 0,${. #K>2,0K>;5)0K~>@2P@4K(0K+PK'@KEPd/ 0 K耖0@-0S00R0100 ^0S*0@PTR@?0 Q .T@0 Q R ^0N  00a@ -L M @P0A S0 00.SR0 .QR @000U0S8J \.\ B0` V.^ZSD Q` c a \^'^C ܁ p`\00R0S`1\R_000S00Q< U^\.VQ Q0 p`bX QVL`0\ L S.S 0W S0200`V QS B 4pK`U  M0f VPP 0dr Q  cfP0b~ 0 p@V0405:(K0a@ -LM@P`0 Q s.R R 0E0S /K/KJK[  0` 00pp 0?KP `a        Y@PP$K -L"M@P 0@pPS ` 0?@@DW /K/K`KV0@ `d V mK      @W?K@$ pD@0P X0S YT0Q\  01PpW Q\00\00000#S$K0a@ -LHMP ?00CS`pz 0@P00Sh@K 0   ,  ( 00 R/R SYL`K 0 5  'XQ: QP6R0-Q P.R& !3?=#=0P!R4 !6==0!3?0?<<0&R0S @Q0\ c@f X0 ( "(R !  dF  0$K0 P 3 00/ -L`0Sq.\ \ R  0  /000S/| 00/0M000Ѝ/ 0S0S0`/ p-@|P|`|0ML 00 @`@x 5P0 00 @`@5( Kph[PfteAA0d@/ 0- @L88K0hMPf -LM Q|L  K K -@L$M`0K % 00PS rL S,x'6@x  !008P 0,0$0$00040X 0L00s0X02P L0X0 \0!0M $55%5F<0K0$ 80K ~ pP 7i0>00e 0 0 \ 02 Ki KA -L,Mp0@8P 40 `L0 0s <$ @0 L$K1\0V {ppVpG0dp3wG 0$KX0X`40 080  80K Pch 0 Y# l d8T0b@ Bi00K000p0 0$0PF00p 0 hX 0 !  p0  hH0<000/Y0\` 00000$K 0K8 r 0040KPd0`F6c80h`l04Q 00#0 (KA -@L|P"P .00`6e|`奏6Pf p-@LM( `$ Q(KPP⍏M4PD(0 0$00 001 0!00vKpPf@f -LM X  % KHn@P4a$QZ5K@f0f@f -0L`|@@ RP 4 R`0(  \PU 0P0$ @0 8Po@0 0C?o20 -LM L@  ؎ K8!P$F00K@f0f 0p-LMP( p$0 0 廎(K`@T 0U  8`( g5@Kp@f0f@f -`|@xLp<D2H ` \ !PW!!X0U xx 0 Hf-   1 `00C`0`0  0`0 1 / -LM KJ K0M000Ѝ/0@-`x@TPPtPU \ PT^\  0 -L4MpSQ00`R00XS4 S8@&X0S@0 (L00! d0\ RW l 0bP 23Y l 0bL 3 0 W00Q \0d Cp0X0W 0Qp0D K00D0 @0KD 0bS<0 0Q000h00000 PH0 D @0XU PkS\ S4Pp 7mc 80K000K< K<H0 S 4P "l <0 B"40K000000$0PM<800@P4S:PC @0q'00@ S@!@ @H 0@0 D00D0 0#0 4P Y@ d0l A`T0 0 D0W`0di4W P D0lP0Ch0(KHf0 `\!'0S/ -L$M@PP`A `0S 0 03\0 S ~ !o0a00000K00l 02 B"0$01P000p`0$K00! z0$K 0!{0 _0p 0#*D0l `$0 B"00$X$ 0 0000 >0P  PP=p.0W/ P = KPd@[AwA -L,MRpP`@w\0RtO 40K08 K00Kl 80$ B",0K0000000P[ 0, s040$- <1R00S < 0!S s *BS+,0040,0J 0 40$ K ,0CK$0 40@,0B040,0@04$K@! 58 ,0,0 0t0,P  K -LM`p@0 0 0KhPP T 00K@-@0 aoac cR\ P0#03Q0#S\ 0l olQ1! -@PL4M`H0 Q pbU{\ 0H0Sv`pءVf r <0K0@ K80K#l @0$ B"40K0008000PXH0`Vp Q<  q# <Q340J  : # 40 0<0KR <004)ᲔK0<0040 0)0K04 0#<0 00 e<00<0 80< R*V@ 4'0t00S0P0S(K -L,MpQP` 8R 000l<K4pGu\0 9D0 R 0@@0 0H D T !@p  @OoBd@ L0 VL0 X1@@ 5@@ @@0!0 00. !@p  @OoBd@ D0 VD0X1@@ 5@H T:@ @X 0Z0 0@ (KmNA 0-@PpL(M00 Uh\0Ueh (0K0$0K, K,`W 0Q  ol ,0$ B"00K000$000PJ,`/0!S s% *BS1000(0700 00( : 03K#40P000(0#P00K0 (0000(0 P00K 020!(0R0pP0Q , K 0-@L$M00 \ S 5702:0``0\00PV= xP UQp 0s000U P(0K, KP~l ,0P B"00K0(0$006P 00L S `U p K -LMpX @R`L0|1  h8Phhq Rh00Kp0l0t0-l  l 40K P_X0 Sl0040 440KePQ4 00X `cX0SX 0 B0h040 0 Bl V8 0l P 4e+h00L0 00 CS0 4 lT040 d0 B$0l3 L"p000$ 0W p(KHfM!Ѝ/ -LtM0 @p`0 0H0 |Pl ` 80 P9x0 `0(0 00CS``0`0000 P `00St~L0 0 .R  R R0.SP0PP b0 8K ?P P P0p0 S  >0  60p0 0xPl00 C/oQ" R0 00X0 0d0 t0 h0 80K0| 0 d0d 0 \0StL0K0D KP0Kt `P Vhl K BaH0K0L0` 0$0P`00d0 L0VKH00 \ QQX0 S0X0 d0h0 Q8@ S0X0 \0 0S 0- 00\ 0 P$!\U d0,0l0SU0I0009p0S  \8KP\0 PP P `Ht00t0 |0S3 40S0  *PX0Sd0h0 0X0 X0 Sh  0c2h0 h0,00I00\\0 0RK\0 QKU[q \RK\QK[XLUz R UPP `PbP dR`HX0 X0 Url LPRx R: vZ  lX0 @PQX X0Pe_oSRPU"  `0pCl  Q R ` ( v8  X0 P9X X0Pe_oSRPU/`0 P)X SPe_oRPU  `0p`0 PpP0`00 W  SP P (K -LTM8P0`(,0\pSX :p 000ad3000 H @P 0 \h9d0\ H3\0,d@0K00H0K4 KAP*K,0P0 H0Sh0P  P l BD0K000@0 0$0@PhD P0@ 00  BH00I0 0J0 0L0 0M0 0L0,K \@ @!800s@0 T0 00SM Q 0\ `0 0,d0 00 H0h0 h  0Z=*h (T0DS 4p@P[d@0K04 K08@PQKl BD0K000@0 0$0@PAhD  00 I80 0d` 00\0 H0 0P T0DS 5@P X0SX| L0 X0rH0 L S0H0 H0S20P0 <0KP H^P0<0X |00_d,p@K04 K7kPSKl  B3D0K0@0 0$0PCh0P  D00000  P P pG Z.h&T0DS P'd04 K76PKl BD0K0@0 0$0Ph0 D0000 0CT0DS w(K -L$M`8p<0K04 K0@PDo8l K B80K0<0@ 0$0KP(8<0P U*Q @Q  \OP HIP  { P u`(KAA -LM@L0P,@ e L0b X0X S@^ S@[ 8` rL ST L0P lX d0T B0`3 @",0K000p00$0@P=,00p+07  P1:0(0K;0'0K0帒[s4 ( K5 ' K"[X Y Y sL0Y Pn,(0K ,P C@P (z @P (M(0|P@@,P T `6U H$KAA -LMQ`p@Ppd0l P1b\Lh56300TAb B p0$pPUh0 `00``$K -LM 0$ 8 K -LXK0h -L M@0S0s0 QP"SR0qQP(SRx0s` 0|Ps8p  S0s  St0S0 QP `0(   0P 0 QP$SR4 `0(0  & 0 @;BPi #SR 0R 8K$SR 00V T0 H>L0 0L00000s `0( 0 t& 0 BP20L000L0000|0s `0( 0 t& 0 AP|0L0 0 0L0000\j  (Ko(K -LM0@|p0S   R: 010P S) 8 \0p`h@V1!`V0, KP 0`F`8 d0l 0b 3"KQP`80@l B$K -L,MP0SP00@|`\ P0t0S8pZ pp R  \ \0P$K0KD0S H0D  1000;P D000JR X?0<0K004 K@PFKl Bs80K0<0 0$0P78 p00 0aS@1D0h85Y0ST d  h0p@\ 0D0 0c@0 4 S@10X{ 0 = S Y (K -L0>00S H00$r #K0P0 H0P  000800[`P-T0S 0S&400 #88D0 B8@0 0(C8L H0 K$KSR |pp  0P #K 0MP `\ 0V80  |cKP0` pK 0)`0000ZXV80V - 0<  a R0  R1 (Ko%(KAM!Ѝ/ -0 L|pt0@S|`P NPW8E -PL|`|@V) P  p'@P 00 -/0@ zB@ -LlM0` `p ` d0 ` Rp S `R @S@p1d0VdP  #`0@P`|PL@@ 0S 00.S |0S 0 p00 0 h@000l0 l@ |0h0 d0`S|00 h0,0t0 h000|0 p0 @`I|| l0XX Q00Sx0 0 T9S d0d0 h@P0p dK@P"|0h0 d0S' |0S$ L  0 UP l0S0  h`@P ,d)0 ddUd@ l R @\ Kp|@PV040 00X0 `K@P $"`0S l0S P%l`|0U l0So|@,00  PK* \K &h0t h, |0h 000p0 0Pp0  PK `p0@40 0400,0P]0 `Cl0S8 $@0K,K( )D $ 40K ( t d 00@ hP `k @W t0`40 80Sh0t 040 D K 0`80D K` 040$00(0 00 0x0S2 XP$q,l dT0@b B\80K000p0 0$0ܽP `- @80h 00: 4rh0  8 P `@` 7`dP dS000N`(B@@(KA3A p-L M@0|P0t00CS,)QP`808`d l0 c0 0,`P 0#QP$ 00080l B#SR Kph KpbA -L M0X|@$0 X+0< #   0 "$0++KyAAC@0|0\ < -LM`|t R02& `0(0"L08p@0 @R00 @5=t\ I022P 0 v!0 /=$Km00C SL.L.L.L.L.L.L.L.L.L.L. 0`  0+ 0  0 // -LlM0|0\0 L0 00 0Sp0  $K0 0\08Pp0!0np0@Sl0 X0  0#2l0 bp0X 22h0 \0X0S rL S 0P0 $K@R00P0 @0T0 $K&KL0r0P0 Wʄ0s 0Ll0d P cT0h,<, 0W 000 0,, ͫ000S: $K`P 0$KX0S KX 0P  P Pl RX0 pT0Kd PwT L00bh 0t0 t p00bS0!0 \0\pT0pL0pcW@0K04 K<0K\`PKl B80K0@0` 0$0`P8 @00aS00pt pS  t 8t 000W:Q`VQm Q 0S0 00 D0Kfp4[0z w. 0B0K0A0K0[s 0x B0K0A0K4[8|0 'K0 0Ll0d P c5T0h <, 00 0 0 H0K/0 "2- 0 0X  f 00 04K00S*8۷/ P$K 0&KX0S KX 0P  P Pl R8忷`X0 $K 0 p$K[$K&K@0T0 $K&K@0T0 `&K 0 T0p 0b0\0\$K R? Q0R0 0 0S VP   0 o0 0 0o(K@@ -LMP@`0@p0 R@,K,@K0V 0T0]L0 0L0800"0 WT,K,@Kp0R 0E0 VT`,K,`KM00P N03000K p-LM0P|@X0S, \0R#6* `x KC0K@ P*00< 8  0!0H0K!'K00 80\0 00 0 80K 000 0 KK@P 0 Kp 0-LM@|Pjw0S 0 80 000 XwK0 -LM0@|P8`rr0 000 =!!L0d Tl0 XP 0 P c '1# PL 0 P c '1#$ 0"L0t 1 !Hp P00000 00X0000(0#"p 0 8080  0M  00|0L0 8|00x80p000h0\   0(0t00$Km -LM``0p(PP|@Y0 80 000L 00L0G40SD, K0K_PP> @,,H00@I00@J00@L00@M00@,,,,,L0,p$K\P P!^800sP0 ̶PꋶP K -LM p`P@P 0 0  |0 KP00"D012000 qP @Kvdd -LM0p|PX0S, \0R#*8@ 0(0K Px K0l@ 0 吠 0K00 ld0 T0` B3 @"p00$?k`p 0@ 000[M[J[GW [ [B[?[< XrL Q:!1[0.[.+W [2- [&[8#[6 40r[@ ѵ `P0K@ `P0X0K0H` L0 !(K0 KK0 0`P% 0  M(Kd@`8 8#4`#/ 0-@LP(0S00SP  0S0S0 -L C QP\@ i0#0 0Ps  0P d3U`# H0<000 0 pPm P N0@0 K! 0 |a ?0. Or|0 lKK0"0K#K P 00d" 00X"0 $KK 0 p0SH $K"p$00$0!#KK808  0QP!1LPQP% WPPU~pP:~#P0PPx 0 U !KQP 0!q# 0 0  <Y3 @0SPPq0S J rW#D0 9 qPp|p@ lP?d`ԃK   0 (Kd@ 0T pR00S ! 60PP0 &\0S.8#10#W00S Vl0S!0Bqґ‘V VlT0S 8lL0KZ   >P<T0S' V%K8]llPWll0P   !<0P0  ?&K %K&K %K) 8V084l0S!0BqґB‘(K,fHao/ -@LMP`K  K0 0PK@P &p0@ K4/@P9[V@009K K0d4/@P PV @0@ 080~K"A|ei@Ai^Ad|A4. -p 0LPMP0hK`嗌@P ,@@ dKT dK0W30K4@K0p VS0K0D0K0C0Kl0T@K@` @P 0d KTh4/@P @~808 000ɭh/$KA|ei@AdAp. 0-@@LPNP[010|fA -PLM@ `K KQ0 K0@.P h:`P`0p K7/PH D` P0 K5/P $$݌KA|e~iAiA 0-p MLP0K@P !` K K 0 KK`0KLK@ @ `Kp QD0 K8@04/@P  埌 K*Ai|eJA  0-LM!K000K00  ʎ K   -LM 0K # 0  0 㷎 K 0-LM0K00K00 !4KK⏊ K -@`PLLMd ` P@ @TcUPڐ`0S yP0T M  `03/P F 0qd  7/P p7 pT PP xPp TP xTp 8<0 X0K04Xp pT0KL KPK:/#PXPTK03/P0ST0 0Tzx 0SP0 00P0 7PP mx< (K`AvA p . 0-@PL K0h`8 8#4`#/ -@P@D0@@Lp1젟0@Q04``&c`j!@0" WV P @  /#P @@   t/#P0V`@ !@@*jd 0-@Li1@ @01O/K0hjA\ `P/0 !`8 0 0 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -LM0 \0 `0 @8#700 0S0 0}+ 0/ 300 @ 80P400,000 00 0S 0 000 000 0@0 0  - 0*K 0 R 0K 00K0\@K0K0@0K   `P` \@K0@0K K { P00 0M8{OwD+0S0S 0X0 `@(V 0S@((((((@(T~0S 0 x ($0P10(00 0@ @00 K K  @      @P _00S/0 3SH L0S0T 0H  0bS00S 00C0000 v@T 0(00(0( @j0@00@e0D0 (@$0;0@ @1+S0 @ 0101` h;@    PPh,0S3 00S0 h l0R)800 xw0 0<0, 80@ n !@P zT 0Bh0<h0 00 00@00 0S#T`%P@ P,h101jh@ @ 00S0 P@ 0S  .\0,pWpP #@ 0 w9)000 000 00 0<0 P 0@ zZ P 0SFl0Kd0 0d KL LKK`0 H 8 <0 @0h0 h0K0004 :/#0@?oU20S 0 @0( D0RP8L( 10 1S#P PY< RD RJ 0 0N> 000 bw?7l0 <0 ,0K<#0p0K040KL K8/pP u#0J?oU20S 0 #Z Z0Sp0Sh0PLZZ l0< 0bl0 l''1l0 S<0   N. &,0E zE cu0 Z0  0 0N> 0PP H+,pW @, 1T6倀Kl0 <0 ,0K< # 40KL K:/#P  P#P l0< Z0bl0 0SZ u00 @f1z0C1m,5gT 1 Tt #T 800, 4P t0 |0 0x S0x0  t K xK |KPt 40Q $(10(1tn@xft4pW} 0S0X p0 0|00x00T40S= , 4@ğ80P# @0! PD0TT0C1001008ࣟ0h000l000D  T $ ( > 0 00t3 0x30S0C<ౣ<\#00lh0XP P:ll0 00 0h0 ss8700#0 00 0S0@0 g& 0\F@#V@!0  rB0Ԃ`` R00 _00<S<00 @@4C0  0 A`000 0r0 S089980 `000 0r+@@&r8r/0@0 @ ,0K< #00K 4:/P#P00p  0P< R l0R  b N : S (K`8 8#4`#/ -LDM`X0 P`000<40 ' 5 H$(`ş !::00D00 0 H#KL0 P$KH %4X4 H 0 40 8#Kp ? <0 $K00Xs0H0 *|p":t T0 RXtD40d0 X8c 0HS40 0d0?#K'x {L x-P SRX@ 0P R 0L R 0T R%KSR`0H R 0-T000#K$$K%H0 `00&0Pp0`0X ?! X X<;00 840S`0D.040S3 (L0 0P0 0  0   0 48 0 <@|@&L0 0P0 0 (,0p40@0 ?@0|0@x 0)"`ASR:SR 3#,!0SX0ʌ b0 00 Z!~ x0Z &  8   (088 Hp(Kdx@x@x@4%f8%fd 0-LM@ P`0 0  K0bT D P0 dK0 0-LM|P@8  :8$ b0 00 !K0h K0 -SL4M`p@q XP1\ #K$SR P0S  P0 t0Rx!@@SЀ QP`0S00X000S(1@ `0T& 8 Rb18  410cS0`00N 0P00H0 00000`00X01814011 4 10c\ S@"b1 `<N 181Xb(Kd{AAQAA -L@MP` pX XL K 0R` 0 00:N@k`T 0 000꜀嬐 0R@Tx0  0S$ $  $0 J`00%`00C0@ `$Kf ddA.dA -L Kh%`f -@PpxL⌠1 :10X!0 L4 `P 1:?;1V>000 0`0吐0ʢ1 0 0 #4 ` :1P`V V 0 000 0001 ;;1;;1♢dAA -L$M@`LK pPO m?ༀX e bZ0 ?R0 5 0R00 000帀aV 0;000<@K0HK"RQP(04 R 0(0L0 0D00(Kd -L,M@0 0P`<KH D 0 T00hv S 0D0  @ K DK HKy @P@r< K414 bP`KPcʴ!0 S008d@@0S   0 0R00 p$1 , ,0K 0040050000@@?0S0 ?0 ?@?    SD DKHK @P l@H0 0D0 0(Kdd 0-QL@PP @Q 090 00^#D R0"0@@^0D# R0"00 0-@LP^0S l7K0h^ -LM1࡟刁u^0ASiQ@TS KPK 00 0^0 cKxD"K?*KWV  !3 !KQP0| R 0K"KQP(0l R  t0K00 R 000 ^ 040 0#@0SX0@U^[LL0< !/ #00#D^(Kdfdd -@PPL]0T00  T0  )^]0`@T" 0U4P 0 x?#0S0C046#0T D0 T0 @@Kh]fd Q0-L@ @Q<  0@9 0$0@0$00PP]$@]$0$$@0 0-$@L ]K0h"f(A 0-\@L0S }]007#0"0S]k] K0h"ff -LM1Q0S S-l1h1H0 KTaT<"K7I] R  100 1 KPP }]4`V 0T) `)@q0P0@ `|0K l0K0400"0P0]00pP@P]L",L]000 Kd0t@ t@f0A.d:AfP0// 0-L@PP0|0S L0 D U P6$K0hCA@t@ -LP`p@\T@\0 $KkP 0-@P0ML 00x @P@6h0 00X @P@,0@0@04 44P (/K0teWAfaAf.iAfrA 0- @LK0hf -LP`m @@V0T0T0px00tp|@0 d0T@ 0h-hNd`dX\P11 0&$T 0 f<%ffdPt@ 0-LMP0KP  @P0|00 K0 -LM`pt0|@SP PPPU 00|0 1_8 6008o<08t0S(0S  U 0 UKdf 0-PL|@Rt0S (0S y 0 (N@QT\XP P t0S8[p|0#fff`8 8#4`#/ 0-@PL[0U K0h{0[ -,PL@U 0,0s}1  ~[`p1S5!3!z [Kh } p-LM`\P40S|1U 0@ ui@S ,`V@0 080@0 0iiH 000! 1S00 00A4/@P@1U 7T1S 0 T 0 0N> 0  0@ (T @0 07T1S  L  DR23200#0   (TKpdAA -L$MPp` 5f4P@0Uzd$0 00  \P/$IV   Q d$Q  T$P   B ,$ $  $  P@  #  <KKiZ a@ ^@ R @ R  P  HFQ9t....l.0  #RHL RT a`  ` , aR  R :e0P0 4  $ PV   #RHL RT a`  ` , aR  R e0P0 V  ` P[ *o PMX @ @0@0P2O `!101JP! # <  0 3SHL0ST0  b`00a0 < 0b S00S d P  4    D @ H #D@ P<X00PX00P(K0f4f#f#f#f#f#f#f#f 0-<@LP " 0"0K0hl0f#f 0-@ML HY8 dл \P\00P0 D00(0 ,00p0K0f./BRAAA 0-<@LXH^YP(~pK0hzf0/f 0-$PLH@NY00K0hYf -QLM 000 3 K:0P KA -L=<;:9P``h p@0 0 0d!S p  lKhKpK@Pl@V V1#    V00 0 {P+P  h p0 00a S p pKhKg@P LSiP Pm a00 B$S<0 dH@ 0$Kd0KL0 0LKH0 (0d0 c?< `0 R p0KLKhKE@Php 000bS0p0  l K pK hK@Pl n0Q"P Mh p0 00aS0p0  l K pK hK@PlOP3 @ nAP0@0P0000R p1ohp 000bS0p0  l K pK hK@Pl 0Q P _ 1Khp 000b S p  l K pK hK@P cH y@aV+ Z `@ R 0]P \TK0 T ?R0"X @1@X00H0 1X00H0 YX 00P0 0P0h040p0D0 P *00(0\(K#f#f#fx@#f#fAAA,Ad 0- L$;DA -LMPs堃堓% 0%T@T 0S 0P4 PG0Z-00 , $31S@` S10D`T0T0`Fa``a``p0S"00 !X Œ"夳< V`Z00S0p0 0  ( t0R l"4N  0 0 0(0$ S 10 1 00 0f0 R 0dSd0(0^,`V[ 000 00b  aS0( RI0  0h l0R?0 wcP9 1 00 < 00@@  :/P Pp00#PP 8004 0 0 0(00dS(0d0(0l00Sl0p@DT000  0Pd@@pp@U8[U@Z0H0`0000W@00p   00 0000C00 0 `UpppU`E! 00Pfpp`p@0 00(KM0 0SЍ/ 0- |@Lh0@P\0P(0S (PPH0,0\00 PU 00 K0h 0#fh#f 0-|PL @\0xPP0SP@@\0PT K0h0 X0-QL`@ \0^P(PPE(P\0PU0Khh#f -`pL0C |P(@TA Y "?X>Z <0Z0 @dDA@\0+PY @T 0S , 0$0,@\0P@T@ WV@(00(0\0GP \0Oh#f -L$M#K`0p000 #K0|PH (0S=0 P0SY@0K#K`\0OV ,0 QP$0 R] "`00V( 1"T \0O00(00@0 PQP0  0 @`܃K Ԁ$Q,$HQH,@0 < < @0Q@0000000@000(00(00@`\0OV (Kh#fI -`0|@P8L`98(0S% \0DO0#90#00 ,PU VHP PP xPP,0S,  , 0\0KhdO 0-L@ 4DpP 80 S8 % @0L00$P0h00< $l00\D `}H T X d P0pp0 <08 NO $pP 0h#f`fdhfdf#f 0-LT@ 4pP 800CS80_$N oP 0h#fdf#f 0-P`@L P0@R a a U 0QcP\0@0V.0A#AR  3SH L0ST0a`0 0b0 < 0bSZY0`00 00  ` V -L`@P P0 2>  ,(~{ 0 u$0# 0 n0(,0i0$f4 c88`<@]@HZDPWHXTL`QP1$L 1R01C(@0=0S00 504 / ,$ )(8&,@p 0H4Pp ڬ8X<`p Ь @t@T@ -LP@Q`p 0d)  3SHL0ST0a`00`0<0aS00S X0@ 0000h00+ 3SHL0ST0a`00`0<0aWS00S XX0@ 00XX00d00@h#f -L M` pQ@P0  弁)  QHLQT``l `QQ X @  h00: QHLQTa`l `QQ W @  d00,:(7H4 P1X.`+0 0@p(Koh#f P-L P  0S00co0S0 o p-L MP@`y$Ky KP"8$娧$勧L191L^yKp.@-|0< b a<  AV añBT ñ<  < 0@-P|0@< R "R0000@-P|0@< R #R000@-p|0`<  a< BT ñV añ@-|< BTaPV P`Vp@PPT"@-p|0`<  b< BV bñCT ñ@-|< CTbPV P`Vp@PPT#P0 H R L01H0 P P// /`Q П/t@ 0-0@Lt0StVP K0hh#f#f -LMP008 < 00 V00`(0fS40 ?U40S0 0 b000000p 3SHL0S T0`0g0<0gS00S@ _V0@p0 00 <0 @<tp   0X Xx   #RHL R T a`  ` , a R VU0@0p 8  pp Z8 VEQPE QZ 8 H [ / Q3HLQ/T` alqp& #R7HL R3T @` d@@d@ T @!   0 0 d@ 0Y  Qp UfYpbTp  L @b@00PeU  R PP  #RHL RT a`  ` , aR  R oU0@00 pS0  00f # YN0 #RHL RT ` b`rP0,0RP9UfYPSP0p 3SH L0S T0@` 0d@@d@0 L0@c@ T @! )0p d00000@ 0 000bS W 0004 000(00 00@(Kh#ft@rA -@L M3 0K#0 QX00K`8 8#4`#/-// -LM`p0PK` 0@0 0KT0 0P@ 0 0 000 0D?o2P0S3$Kd p-L M|P@`80S@@T0  K @ 2K(TKp -wL@ I181I(` PP9W0SP9 ᡤPP '1p 01PP 0 <WubIqzW VI181IdA -0L`(@- ,PP@  -LM(K@`p p(PP P  H/o``" *P@($K/ l0-SL $0R3 Ԉ@ p-LM0PS" C  0C?S R000K`P0\@@ K @P `Kp -L/ 0 040*f,%f -L:0 Kh -PL T08D 00 000bS0D0  @ K  8K@P@  xP 0 08K0K@P <TPU <0S 0S @<xTZ8 DZ0 00hU8 D0 00hS Z0400D0 Z4  @K8KoPP@00|0x R 0<Z0i 0& #@P 0 pb/? 04;$0   0 /? 04;T0 4P0 %K! EK0 /? 0+4@TPR 0B" @P 0  $ 0  0$  0$##$0`|0 <SP<3S4 aUW.L0S0T0a`0 0b0S aPW*400004 H0 4H 0P000H0 w0Gq qG1(TWT HK4K3PP Xs(Kd#fArA -p#@`LPP|||ßʀ`0!``a `0```) ! 00cS0000`V700 `0#g<`oက0 !`!0    !0 ,Yڌ22 X@<0P@@0 00SdSd0D0  : 0S:8 R/ R,|| | R`| S|0| R(|   $ R/ R,xx x R`x Sx0x R(x  ( R /  R,  R* x S00  40S$00  80 S00  @0 CRt000 S0400S00  `4 , R``V E00STP  KP 8X0 ( deeāe#fdAA -L4M3p0`S (PX nRP 0P00@Q10p 3D0 0 q? z?H0 K `0 0 SP>C22 0D0:|0x000$000 0@t0@0 0 00ቪPo< 0 00040|0x S0 c0?o0c00 04000S :D000 @0KPM  PF@0 \`:"p0  t0S         0  :(`t0S0t0L00L00 <K`p0p D< KoCqz Q P(KdAAAA#fd dA -L$M@Rp 0GS(`/ V Q <0 ]P00 ~0P000 040PP000|0 0x0$00(0@0,0D000$0400TP #\D00D0 D <0KUU@,   8PPP #RH LQiT``la, aU #RHL0ST0  b`00a0 < 0bS00S wL,0000, <0 , <0 00 T 0<0 }0040K0 08K0PK0|1 P1 P RA0$Kp 00@P(0t0S00  R,0 4O9U.L0S0T0a`0 0b0S )LU,0000, <0 ,< 0000<0 0EQ QE1(T UT <K,KPP FO$K#fdrA 0-@LPA0S K0hSA -LtMp`0 `*0|`P@|0| 0|0D  00x0 x h0KTP jY@X  8  #R>HL RTP ` bPPeP, aX,0 3SHL0ST0  b`00a0 < 0bS00S KX0000X h0 X h0 00T 0 h0 咸X0 3SHL0ST0  b`00a0,000cS00S [KX0000X h0 X h0 00 0h0 |0T`W@N`?P}x0X0  #R<H LQTa`l,000cX)X(LQ0T0` a0c0S Xh0t0 000t00h0 t0H HPt0 01T0K0`0K00dK\pK0 p0 zPPY |0\d <0 000bS0d0 @P\d |`000bSl K  .0Pt0 l  `` NtP| T808|0|0V|0_X3L0S0T0  b`00a0S JXXkX0000X h0 Xh0t0 000t00h0 t0H HPet001(TᗷXT hKXKoPP|X 8PPP   bU8T hKXKYPP M l K  `Pl v `MP@`Q HLQ T`anUUHL0S00T c`00b0SXh0t0 000t00h0 t0EQ QE|0t001|0(TJUoX0000X h0 JXbX0000X h0 X0 hKXKPP Q0 0<K>`P<0|0  0d0  X2 0Rx  ?\ d0 00iS0d0  l K  (0Pt0 l0 #K 4 0 $K'K'KD QP tQ SR@00l?o2x0 0x0 \d P 000bS0d0  l K  0Pt0 l [`P% 0 0PK0Pt0 PY|p0SX0%(?o< K2LKP x0SX08pX0 @ ``LT 00U0SP(K#frA#f -LdM``0Z 0`` P\ U$H&t00t0 |h0K    U@T  8    QRHLQe`T`f` `f`] `R@ QHL0ST0  b`00a0 < 0bS00S HT0000T h0 T h0 00 T 0h0 0SLP?`T    PHLPT ``n lR hKTK`P Kh0`h p0 yp0B! !B01 ᩵`0K0d0K 0X0K0\0K00 041 `P aU Xd |@000bS0d0  l K dK XKPl b3 0R@p@ 8Xd 000bS0d0  l K dK XKPl E$K 4 K( SR00p0 t0D S #YX@@ `oᩒ@Xd Pp 000bS0d0  l K dK XKuPl  PP$ 0d K0XKPK[P \FK`PpT|p0SX0%(?o< K2LKPYX08X0\)KP| U808|0 0 ) þ`VP<RThp 0`000h0 0p B! !B1(TRT hKTK`P L0S0T0a`00`0Sp Gp R4[T0000T h0 (K#fd#frA -LMt0S00 K p-L MP@t0S |`P = 0 hKp 0-@D0L p<00CS0K0h<f 0-@0L|8(<60 001K0h/H@@f 0-@0L|8<70 001K0h/d@@f 0-@0L|8(<60 001K0h/H@}A 0-@H0D L0S0K0h9P0A -LP0PE_oSRPUi@|0 0 000 p}Pb  APP P *00 KJPP K|#QP@0| R U 00 0} 0@ 1UP8 0 !Y Z  KP |0'KSRT+000 0H00;  L  L <$ H 0 0K t0`S  8  P Q9HLQT a`nlU&0 3SHL0ST0  b`00a0 < 0bS00S A0000 0 0 00 00 0T嘮YD?P80  #RH LQTa`l,000cZZLQ0T0` a0c0 S   0P 00 00 $0J J 1 U0K0ؐK0K 00 0@81PP0S ` P0 0 0e S  0 0C?oR20S0(F VB 000K `PPa0\`0S+ ` 000bS K  SPP  0DU0S  /VP0 00C?oR20U00S `0(0PP T-PDU3HL0S0T0a`00`0S @U(w0000 0 00000 00 0t0E! !B10(T UT KK|PP Z/ 0 KKrPP; !QH @ 000bS 00 CP)C K  `P  CPU`h V V3j?gD@Z0000 0 0 0 K`P@  000bS00  K  PP 0@?S`XCHPK oPPP 00  P 0 0 KPPP` @ 000bS00  K  GPP P 0 0 K-PP@ 0,K` 0 "PP` V  T)PCH0: W000K `P(ύU00K `PP B^0\`0SF ` 000bS00  K  PP _P 0 0 KPP`@ 000bS00  K  PP s<P 0 0 KPP@ e,K` 0 0 PP`[0 ?o2R0S  `B`tZ T   K=PP   (K#fdrA p-L,MP |@`,0K (0K 0 0K0$0K0 `0@P A$EBKp -LlM|0 `0x /0|`H0@0H0 <D h0K ZX   8ppp #RH LQaTa`lY, aW #RHL0ST0  b`00a0 < 0bS00S >X0000X h0 X h0 00T 0 h0 婫X0 3SHL0ST0  b`00a0,000cS00S r>X0000X h0 X hP0 00 0h0 pH=00 t 8=R014 p=00 ,p<00 $(! 8@p XHPp N 00`0K0x0dpK\`K0 p`|0  PP QZ \d |000bS0d0  T K  jPT g; 0R t <\ d0 00hS0d0  T K  MPTJ0 #K 4 0 $K'K'KD QPt tQ SR@loᨂ\d P@ 000bS0d0  T K  PT  P3 0 00PKP `@ P|P@Y|@t0SX0%( 0< KLKPXX08@X0 0,K@  0 0@P `@PU`@RW3L0S0T0a`0 0b0S ]=W8 &X0000X h0 Xh0t0 000t00h0 t0Gq qGP t001(TRWT hKXK*PP0XsX03   #RHL RT `0 `0c0,000cS00S  =X0000X h0 Xhp0000h0 700.  #RHL RT `0 `0c0,000cS00S <X0000X h0 Xh 0000h0 00 0sX0 2  #RHL RT `0 `0c0,000cS00S <X0000X h0 Xhp0000h0 (600 p- #RHL RT `0 `0c0,000cS00S s<X0000X h0 Xh 0000h0 000sX0 2  #RHL RT `0 `0c0,000cS00S @<X0000X h0 Xhp0000h0 400 - #RHL RT `0 `0c0,000cS00S  <X0000X h0 Xh 0000h0 00"SX0R 5  #RHL RT `0 `0c0,000c S00S ;X0000X h0 Xhp0 00 0h0 200,(- #RHL RT `0 `0c0,000cS00S ;X0000X h0 Xh 0000h0 00#SRXh SR04  3SHL0ST0  b`00a00,00c S00S f;X0000X h0 Xhp0 00 0h0 4081@.c 3SHL0ST0  b`00a00,00cS00S 1;X0000X h0 Xh 0000h0 440 3SHL0ST0  b`00a0 #f#fT@#frA#fd0,00cS00S :X0000X h0 Xh 0000h0 00$SRXh SR04  3SHL0ST0  b`00a00,00c S00S :X0000X h0 Xhp0 00 0h0 40HP\ 3SHL0ST0  b`00a00,00cS00S :X0000X h0 Xh 0000h0 4-0 3SHL0ST0  b`00a00,00cS00S \:X0000X h0 Xh 0000h0 00X0 3SHL0ST0  b`00a0,000cS00S ,:X0000X h0 Xh 0000h0 00(K -L M@|0s- P|0s 0 QP$SR0s `0(0"p`SR|J `ASRzt R02pQP #SR0|s0s_ 0".(Wk""a!"081 1;P  0^ ;X""QP #SR0s`p tQ0 1Px0 10 QP X X0 ba0&s(Kd -LDM`0T $0|`P pT0|0T0 D H0KWP4   8@@@ #RH LQT``l, aT #RHL0ST0  b`00a0 < 0bS00S 9400004 H0 4 H0 00 T 0H0 00<0K0T0DK8K02 1 |@Ps WAP 8D 0 000bS0D0  @ K  <PP@  P 0 0 0K"PP < <@T%8D 000bS0D0  @ K  @P@  P<;?@fP@ 0P @P<;ZT8D 000bS0D0  @ K  @P@ _ P<;H@;WT.L0S0T0a`0 0b0S h8T1400004 H0 4H 0000H0 00DA AD1(TFTT HK4K:@P> (K#fdrA -LTM`0`T   ?P ASR0P0|pZP0,0d0 0P\0 X0 VN<68&X00X0x0d V0`0 H0KZ@4  8  #RhHL R 3T b`  ` +, aYU0 3SHL0ST0  b`00a0 < 0bS00S 7400004 H0 4 H0 00 T 0H0 Ϥ40 3SHL0ST0  b`00a0,000c S00S 7400004 H0 4H Z0 00 0H0 T0 bT0^`[W`T00D0K 08K<0K00 031PP QZG P08D 00 000bS0D0  @ K DK 8K@P(@ $P 0D K08K00K@P00P0 U <{:k8D 000bS0D0  @ K DK 8K@P <d:PS@ X P0,KD K0 0 0 0e@P00P0 8D 000bS0D0  @ K DK 8K\@P@ x0@P<3:HP"P D0KT8KfP <&: P<":\0Z`d0\0 OoX0BS@T0`X0 `0S`î \9 R/HL0S0T0  b`00a0 S 6Yz400004 H0 4H 0P 00 0H0 y0I I 1(TYT HK4KPP Q(K#fdrA -LM0 `0(P@P   A00 `AWV10 <0 |0@K0 }+@0K000 0P SX0400 00 00 00 0SjPT0Sp` |p X0pH0`xO7U+0 V0b0 000 0 00 ?oR20S 0b 0000a0 000 `Rp0`0 00 P ߾0S @K(000C00 @0K`00S@KX@K.)@K(@0KO0 U 00x6p R6HL0S0T0  b`00a0S 3Wkp0000p 0 p00 000000 0Gq qGP0d0010(T啠Wڐ KpKT lPP p0 3SHL0ST0  b`00a0,000cS00S T3p0000p 0 pP000 00 ! 0pp (KAA#fA/d#frA -LlMx0 `00 '|p@p0PL0p0$ H 0p0 t p h0K TP T`X  8   QHLQTP`aP PeP `Z0 3SHL0ST0  b`00a0 < 0bS00S 2X0000X h0 X h0 00 T 0h0 ՟X5@?PRp0X0  #RH LQTa`l,000cZxZwLQ0T0` a0c0 SXh 0P 00 0h0 _0J Jt 1 ᐟT0K0`0K0x0dK\K0 0 PPvTO`5| T808|0Z.L0S0T0a`00`0 S I2ZX0000X h0 Xh0P 00 0h0 0J! !B1(TkZT hKXKPPd Z0t hKXKPP \5\d |@000bSl K  j0Pp0 l  `F5pP@1ZX0000X h0 dQ0d0 (2 0Rp`tp 9\d 000bS0d0  l K  30Pp0 l K 4 p`dK(SR00t0 t0D S #WV@`p``oobp`\d P 000bS0d0  l K  0Pp0 l l@P& 0 0PK0Pp0 PW|t0SX0%(?o< K2LK P VX08X0T000U0SP(K#frA#f -0ML00 $ K -L|M`0p0-|`@x0P0x0H  00t0 000 t0  p  h0KTP Y@X  8    QHLQMTP`aPPePE `Rw0 3SHL0ST0  b`00a0 < 0bS00S 0X0000X h0 X h0 00 T 0h0 WfX t0P QDHLQTa`l   bU1U0HLQ T ` a b R<Xh0|0 0h t0 ~ |0tE1 1C!t 孝Y7 |X 8PPP' QHLQT`anUWT hKXKlPPZ@3`?P0PX0 < #RuH LQT``lUiLQ0T0` `0c0SaXh0 |0 000|00h0 |0EQ QEp|0 01IT0K0d0K 0`0K0 0\pKp0 0᭻PP=Y2 p0\d |`000bS0d0 9 0R | ( p0\d P0 000bS]0d0 Y`P_\d |@000bSyl K dK KPl t `(3 P@p0V| 808| 808p0|0T|0R7HL0S0T0a`00`0S| /| RX0000X h0 h0X |0 000|00h0 |0P||0 0B! !B1(TRT hKXKPP U0 hKXKzPP 2 l K dK @Pl d `2P@`m/UX    X h    bUlX0 3SHL0ST0  b`00a0,000cS00S \ d0 00iS0d0  l K dK Plm.0 #K )4 &0 $K'K 'KD QPt tQ SR@00l?o2|0 0|0 \P d 000bS0d0  l K dK yPl -@P$ 0d K0PK_P!PY|pt0SX0%(?o< K2LKP |0SX08pX0 @ ``-1-U+X0000X h0 T 00U0SP(K#f#frA -LM40 1 0000 0 0 k Kd -LtM`00@X0 X0 0|`\ <ST0 X0(0d0 0Pp `0 P0 XZ4 `0S X0 0?R*:\;X+000H0Kd 'T0S4  8  #R?HL R PT b`  ` H, aY,0 3SHL0ST0  b`00a0 < 0bS00S G-400004 H0 4 H0 00T 0 H0 M40 3SHL0ST0  b`00a0,000cS00S -400004 H0 4 H0000H0  X000D0K 080K0<0K00 081zPP /QT0SG \08D 00 000bS0D0  @ K DK 8K8P$@ P 0D K08K0KP00\0 U8D 000bS0D0  @ K DK 8KP </P@ 0 00$0</8D 000bS0D0 B @ K DK 8KP@ 8 00h 0 G0 0i00 00 0iT08D S000b S 0D0 Z X0190 0|0 0x K00CT0S  -PZ T08D S000b S 0D0  @ K DK 8KP@  0p t0 ԇKKS0D0  @ K DK 8K~Pj@ K0@S<P/HPKP0 Xh 000bS0h0  d K  XPPd  \5@` @X h0 0 0a S h  dK ;PPd00 L0K`ɨPPL0\@0S- Xh 000bS0h0  d K  XKPPd %V P Xh 000bSST h T XK PP VX 0,K@  0 PP<@ \P0S Xh |000bS0h0  d K  XKֱPd h84 0R  >X h0 00hS0h0  d K  XK⹱PdK.0 #K )4 &0 $K(K (KD QP tQ SR@00l?o20 00 Xh P 000bS0h0  d K hK XKyPd  pP) 0h K0XKPK_P \JPPY|0SX0%(?o< K2LKሡP 0SX08X0p`p\(\0@?S@\HP(K - LM0P#L|000 t0S厵$+@,!Džp1pl!0!80 x` { H!80FFFf` ` 00100 P000zS0!Z 0 1 000 0VP Y 00K0100 00P@K$͝ (KAdAa@ -LMP0|pSPt R@= S ` 0K00 1῏P@* 100 P0S  K5P0SP0S K᪡P@ 0@S8:8 7P@ 0&U$KAd -LMP@`0` SOT`  ` SH0S|0P0St0S 0 pPÄ@ 1 1 00000 00 0 lp WWt0S 00   KT t0S 0 0 JpT|ሄT ᄄ sq(Kd -LlM`0P`pA@~%000|h0KD 8 @@T @ #RIH LQT``l, aT6T5L0S0T0a`0 0b0S 8 T T0000T h0 Th0t0 000t00h0 t0DA AD0x0 t0x0!(T+zTT hKTK@P T0 3SHL0ST0  b`00a0,000c S00S  T0000T h0 Th@0dK 00 0h0 嶿᳿尿0XpK0\0K p00 0 0 N@P AXd |000bS0d0  ` K  P` 2 0Rt x >X d0 00jS0d0  ` K  P`|h0 #Kc4 `0 $K'KZ'KD QPx tQ SR@00l?o2t0 0t0 Xd PP 000bS0d0  ` K  ᳮP` <(P! 0 00PK☞P/PPY|Px0SX0%( 0< KLKƞPt0SX08PX0T-X dP0 00eS0d0  ` K  vP`P \S @0q夀  iP <@ yyq`\:(K#frA#f1u 0-LMP|@ 0 00 j8@08K0 -L MtQ |@80 `000 `0 1 8081 = 0&8@08Kd -LMt0S 00 1 Kd -LM8p PP9/02 @` 0,0@Q00@aP0 09/0`,VyL`@,0V0P 00009/0,0@`T@0(K -PLM0,@`A  ?v 0AN1 刁R`08 p0`B`Q0ad0C00 00!03b0P8 0 040 00 3!U0P4`@  0 00e0`00000α@ `!, P RR00@BAA8B0aX3\0p`0`fP@ ^  0$塱(KU }@|@*A@@mA -LDM8@$K2D0 D L3@ 8 00S 0T0<0 0\%00 5R @0P\5 S08 b 8  8 `p 0T  BT^40K0000 00BPF400PP5 R #R= 0S: 0P x0 S ?000 \5 SU0`VR 0 xxc? ?Y0Et0YB*4>@08\54` P Sᑐ k^` h^ 0  ?%`p8eKᑐ MKxW^eK` `T ?` B]00K00 000 00 0"Px00l 3#\Q-R ( h3R\$K 0 K ?Xu`pV?00/ !. 1R R  \"/ 00S``0cppBaq /Pp  /P`@@008 pp唰``000 HL劰 c0?oc`000S 0 0qv000 0xS L @0 徘L @0P0,x<TQ 80S  10CB>A>A!0B300/ !X.0X0 ( 00C 0 RD L30  B 0: S 000? 80L#8202<0P >4>4>08 4P =0P =<Z(KTU dT}@AA -LA>A!0BR #K ?\P@@ $K^$0A0$0 I ? I00bL30  @08D 0aS0P 00 `W  P 8 $00b$08I PIL30  l 0 C!000 A 0 AL3`000\%2Rm=SjT`嬐 `Ff \\0Pu<0 < 1RX000W D0 ;I ᨠ L B\L  @0 .I@01# (I2\D0A>A!0B304(Ko-dTU }@AA -L,M`p t0P@80 ?sp < Ё>\ <0Q  0T  BX[00K0000 00?P0h 00\ Ó\ <8 0  R   ` 0 I0<(KTU -L M@PU `80 CST [UP! P0 TU ? 0PeP K -LM`Pp@T Z ? 0幍᜖Q0 0C  S R0 Kh -L$M`p @3@R`8P0 0K 0[r0 QP (`p800c`#KKr` Y"8P0 0S 80 00(``Yf r0 00C0 A R0 A L32  B \%1Rr=SoT0 J 40 Z!0pS80 P5X   S4 @ D0 G`Z<0 G<01#GD0<0 Z<0@ 8!<0 QX b```S4 G ᨠ 8 Z8  40 xG401# rG<0{Z00C0X0 QT0T00QT T 1 ! B 0 0 0 (KU T -L4M8P$K2<0 L3"00@S00 S3 T\%4`R 0 0T  BY00K0000 00W>P 00T$0`0S Q R0Z ğ\PQ0Z7 00 00$KT#`Rp T00A@DBNANA1@BD@80SZ0 p0000 cT0R3@_@00 00008S`0?8080 T0Z p 01WPSpPR  00 00$Ky p?p 80P0S10CB>A>A80B30j$0A 0$0 A ? A< L30 0 040040T#R T00A@DBNANA1@BD@0: Y$Kp Q 0S  10CB>A>A80B!30Y$0A0j$0 A R? A< L3 W0  j 0!040j a0C4040040 `T#0Rc T00A@DBNANA1@BD@l0S:0P 9(KTU dT p-0LMSPh`@ 1\0!0k?0x  ẹ1 00k?00x0֫KpdWAOA -L M@0"K\:Ѐ 8PEΟTQ`şU @"K  @Ho؀AR  a` 墪 $KvAAA -L,M`$K 08 P<0 ?o1@\!Q-R ( 1帠R\ ?ᵟ o#K400 1>4 `0pS7 00#K ? $K0Y=S   K0w0p0 QP405005 00 080T`\  0 L30   <0: S 0?0C0  R0 L#00C00T#0R T00A@DBNANA1@BD@(KondTU A)}@A -LM0 8@ 00PS  A0 TS!凩\` AWA> C`p< D4@Ĕ1#c 0)o 0R0= CP0 000 rP 0 ?o 0  ?o0 00000 P00Ȅ0S h0h ! ?! 00 00 (K&A7A F0 -LTMh0 |0d ` 00 8080 000T0L0 80; 0 `0: SP0 008@,0[ H0 `0n04  En00P0L0. f,px 0bWL P4 X U0`QLb ^p4X`U0n? 0sn`4pV00C2S0!T0 40 SJC0ZUp4< GqE WpRKK 00X? In$KR0K܅K0D @ X" $K06n<0PS< PR<VPP1UP0 ?n 00HQLÔTœ ^ \QHQ.0RLÔTœ ^  ZWHU02HQ L40\0RL4P0c80 ,?WV`#p#mP0 S80H30 R R  B @h0@@ 0`0 0000h0 L( d8\80(K30_AmA -Lp0P` 8@  ` U'\ 6CQ 1J1SKt ?V0  ?fm8 ?,Z J P  ?Um P?Xmv,`CP A?Jm0"SL P00 8 L#" P0S8 -Lp0P` 8@  ` }U'\ BQ 1C0St ?V0  ?l8 ?,Z H0  ?l P?l ?l,`BP? Al2\ L#  0P800S L#" P8 080 -L,M`p@P ?l\%04R0  0T  BT00K0000 0 0w9P030PZ #R 53 ( ?llh3`Z`pT @ p/00 S` Vb KP  0 00C0 A R0 AL3 2  B  T0R380  G0y5@00S10CB>A>A0BQ3  80R8 `0 b`V3 <0 P! 8 $0 0$08A>C CL30  0< 00C0 A R0 AL300C0V00a`FBnAnA1<0 40D0 <08`BaP\04 80X@00S  10CB>A>A!0B30$00l$0A>C PCL3 2  l <08 0Rfa0P0D s0T0Q Y 10CB>A>A!0B30 05(KTU d -LM@P`P80pZP 0PKhK=}@ -LMp,~P0@PPPh hh`P ,p    偺:0pK B0AA -@`L P U 0000t wP:U إ pPU00-U Q+I,$KkdA -L,M܀#Kp0!`@#K2#KP@ nPi#K #K@ P_pW#K @(Ko PX KT0T3 SR0 0S K0 S @(Ko00X  0 00 T" 㸎#K `@0Tg0SX @\000 (Koµ(KJ}@ -LlM8@;P` CRA>< `CD4@Ĕ`p1#c 0ejP0 000 嶶P TeUx9\%R01'#K 1K#K0 "K0( $寥T0X0 G0SK ?0jX 2 x0 08`0bD0 L3 "T0 0D R S $40K000 0 0 07P 08S9@0 <0@ L0 \0 ?'KԇK#K\ 0 R0 ?R00T0P0 \%7pR 0  0T  BIR00K0000 006P000p7X #Rh7h'\Q-R (K ?i$K 7TX`?0T0 0S̠ $K ?&K@0S&K&K 0&K`0/0 T0!.&K 1R R P" \08܄K@c'K 0&KQ&K&K 0&K`0/0 T0!.&K 1R R ^"l 400C40@0S @0c40040P 0TS$K ?$K@0S+܄KH0/0 T0Ό $K 1R R 0" $0AΆ0C$0 L R0 Lx L30  B $K 0$K0T0Q Z 10CB>A>A!0B30P02cK0P ?2P`p0@ 00SD0 h0h ! ?! 00 00S& T  BBQ4P؃YX  0xC 440D 0 0.j4040 , 40 00S0gg= CP0`ˡ0S`< D4@Ĕ B1#d 0hA~ GR00`m2` 00 0 P0`p009Sm 0t0Si 00SD0l h00h0 00 00S T  BP4P 340 00 b 0i40%40 , b40 00S `RS'< R,D4@Ĕ1# 0:hAn FP010S ܣ0000S ѣ00@ 0勣`|# 00#K! ?!X0S 4C1P DB(KTAV}@U dTA F0d&ASAA&A7A -L<:G?K 01 jE?KP BWV8550`%`0@55`0L05`009S t0S00 # `G?K 00S 0 !-Kd KE?K  R0(K@A00S/!/P11/ -LM`|@8PpP +B90 KS0000 0T`P  00 0l[9 S#` K -L8P`p "pp00p0 0$0@` AT BAHp0p0!"000h P " -LM`|08p<lPU 0 o%p@ Tp pnT B/` /0 |@0"T ZK褻f  -LM` w0 P @TB8p0T@#)K K @D Q/` O/=KC A)KR0+ 5 ' a3S$x×h#l3|和K# tC00 4ԊK;$p$ R ԊKR 000S^   B\ ܈K0?0YX P  CC 1R0 3P100V0  0$ 00R`00`0010 0 0 X 00Y (K R0@|0 80 0K0|0K0(K0@P`2!20R=c0, K 2&CP . 0 + 0, K02X  0T)K)KT@ F0S 00Vt|00S0  !0/  + 0 @0, K@2 K 0 &CA%@P0儠, K2X 0b 0 )K!)K 0)K0S)Kw011!10R/ 8V0(K |x@P `(K B@P 9Sڜ09S @T0 RC D@ @~000V (Kd,,ff 0-L@{0@P @0  @@@0 00-@L0K0h{-/ -|PL0@ `V V `V 8ctc 8E0ȟYX S  P 0S E?01 000$KkE/ ! -LLM@ P0 峑0` H P@P- p0KT0 75d4D 10#K R0%K0 @L0 T #K R0 0< 0S0 !01'(YKP ?00K 0 0 00 0 0`PKt ?5W000D M 0&KL0S&K 0h 00 S:SR/Y 划#K R000S<  1 0< 1 00 0 0 00D 090S&! 0L #K R00& #K R00< 0S@0 @P0 0@00P0D 000090S  00S0 h00h0 !`a 00 09S`H0 P &`i00ToC#K R00W0*#K |`P @E p#K `P 9SH09S `1V0L R @`00fTdW (KdQA -L4M|@8`|41D0 0Pp 0S T 0 0R000 0R  0 p 0 +) 0 0#! \ ]pP 0p0p0P 0R 11KKPQP0R$`  S>#KQP## 000#K]P 00Sh 004Bh0 4c! ?!00S0 PqPQY X0 B ?UK$KX0fP  >00K 000D0 2 00000@PO= CR#K  0ptPU<0PhW=00 00@0  P0SRK 0@  &`  =#KSR # 000#KP 00Sh 004Bh0 4c! ?! 0  000zp0dt0ß0 60 R d0X0 00 0(KKI0dx0 -LDMP0 p@H "00!D0,0K P#D @0 \$R80S 0H 00p00\000L @0$`?6/PL 0屏}8|`0 6S \ 姏8`E/ 8 0!S Q E?01 PEa0D08 2B0I> 000=C ?TP 4=04 K hP @s 0#K4_Y408 1L0 D0B20I> 000=C ?TP =L0 8 gP I 0 p 0S V 0 0000`8 ``L00L0qPU[^(K#dx0vAAAAA -`0Lp@0 PU 0`R000 0p Rp9S000Y_000OV   $Kk[x0 -LTMp`0|@`0X 8P00\0  *$K=T C<K0,pK0'X0Z X0؀$K R 0R%K0aP0 `0 -*8%0@KK%Kh P1 R0 `0KK T0 T<$KQP:KT0 L< ?KKQP*@ET0cD0L@@0p0@$K  000 080K040K0p@$K8@ P<0 @b ThZ0X  #^P<< <P \ (K -0x L0@S0P`?S JU0 ) ) d l p t0sS,6U0 ) ) X P  00 -LM` PP  0 WVc0S 0$ 0T 0 #R0 ,[@P 00KC-8P`@@8\ T q 8 ^ X | pሀ}@@@ -`0LS0000@o01S00 0030B!0!000V:A -0`LQt0T0@000o0 !B1  2 P" 0_A -0`LQ 0000BB A -0`LQ00l0`0BBA$ŐG-\}l@hS@ P RP^N౮pQ` RP^N౮pQ`$pPY!Uࠡq``a`FBnAnAΡ`Bf ^`BV  qpGepPhA!_ BB.A.A B pW`````"Y`i  X!V !! c!^!0c1$5 @ pG I R0CS P#1Ѝ -PL@T 00040000 0= !` J<:T A>`CE>`p B'`pa< D4@Ĕ1#d 0QWV`Vpb 0"0, ? R0#X  ?#$ 0$A -L$M@#K\%1p`RP K?Q Ÿ 1! xQ ?  0  ?.(0K ?_Qx ?ZQ` 90T   B900K00000 0 0AP- jp R`8@ "#K# QY#K 0 0q0Px0400|p(d0L0 0L04(KT@%f\%f@ -LTMH  0 P3p Q0 `PD0K(P$KH_@P $KP H0|@)0R ԄKQlPQ`0@hA 0A ` 0ttEQ 0 !0h0S.!0+ $K%K0L0 0QlPQh0 !!00%KU00S 0!Q !00S000|0000 0S0Xt000 %X0S0p000 0 R d0X00YP(SR Q0( ' H0K  _% \0 00 R l0P0\%d0R<K,AK04 0L *H{ 00@@(KT@@AAbAT%fX%fT"f0@-h0VQ # 3 QQ]0  B PWBT4L \QN@AJ QG QD QA ,Q> \Q: \^x" RQ0^PQ &QT^8P@T@`@^H~L ~RQU R  P 000T -PL@P   0`K0&匙0 .jKpvd -`p\%1L@RPl=Si0Sr,P0 ?" C΄" " ? ? A ? A? A 0?\ $ ̈́? L( ? E΄? L`@ 5!00 5L5s0P5000000\%0S΄R,5S 0 H   ? @L  ? /? R00`SR 14S9Ӭ4հ4S@0Ӱ4T p-LM@0`S@|P@,K O#"K0 ,KBK(0 PKp -LMKbP0KtNo KA | -RL t0S \00S R l0S  40R z  Ԉ@ -LM,K0  O"KP0pkP10`|@帙Y|0P SI Et t00K "Y\%P0R,5S0մ Ѱ ն0Ѵ0*0y00@@$K@%fT%fX%fT -L(Mp `R=4KO,PU+@,0U$*\%0R)'W 0T  B680K0000 00P8\ 00\ Ó\ F x嘐 U 4K$KTU 0-LM p0Sp+@0 00@@ @@@?P0 00@@ @@@1T0@0@ @@@0  $K0hK0dA@%fAA 0-@ Lp00CSp0 (@IGK0hC0d@%f -L4M(0P< H v  ]H0<  9p \jW@?n0h/0 0F$40K0p4+ 0P80 C qp4 0N %84! %.\%RR p-P h Y  Q$$%Q,, Q p F$KL#L#P#P#H#H#- T#T# vN p0 00aP,(5 0S,0@0@0,0T`$KkS> ) %< 1S (030ن(0E 0X4S 0 0X4840`A55LX)00p800X40pfE>p CT  B440K00 0p0 E0P4 0 D0 ND0480`$5SP00K04K, S$%!0H0< 8P 囇XP 00PPg\P W\5!|S ? L b1,dK@00@0 Kp` ?$KDD ?@0# ?.&`0pdK ?Kx ?K` E40T `dK`p B840000 0 0`P aW8` # 4 4TW0V08(K@)ATT mA4AAUA -L ) %< 1SE 0 (040H(0X4S 0 0X4ph00 S.000 P@00@0 = CT P B?300K0@0 04000pP040$ R@000 @0[0 5  0@0S000004pAq3$5D S,0q0H0 n0L<0 <0D S/00< 800D R0< b40 E> C<0T  B200K00 00mpP00 0 2L080<  0p 0$5SP0, S$%0 , H K4PS9Ӭ4հ4S@0Ӱ40T3L0`000,000(5 0S,0@0@0,0P000 040(0:(0,0<,0L0P0T0 0t0D0t0 c0?o0cH0T0 0CL080P004080Z@0S (pF @\4S  5  0 00(00 G(0pHL nppT hm%0P &V P mPm00p(K(@TT mA4AAxA`A -LM0Q0TP1 K/@P C00K00`p 0h0$`0+4P2 5h q1 5000J000`\%R=S04, 030304040 50J0" " 20 5X p u4 (KT -L,M@< 408 A1p PLU,800`T 0W40`e BE>C;100K00 00` 0^P0 0~J<00S8 P8Y80oP 0(K -LMR@q0 # R (P/oAQ" R`e `XPU  $<40 K,P00t Rp0;UP U 00 S p p0!QP S000 00S0 TU,0(0#1000#S0Y00' 00壔0eZ(0U$( PP0X 0b0veZ 0PPn 0X 0b0ce0SP=S,0 (0 P P 0 (0 S 50ó 5=S,00000(0=S# P h,0 5< 0!00(01 T000000\4S (0 0S0H0S? 0 000 8`Pu/ 50 5=S 0 00C^   N~ pEX$E> > (0SN `4(01(00 S ```(Kdl@ mA`AAdAAA -@`<1LPqP 00 P==S VP0 t0S {W QaR$%0,RL1>kh;kP 6kTK/k(0:(0d -L$M`p@=S =S s4K+W00W80 00P,Kp)<0 X4+P 8W P uRW0 0  < bPPpR4r+W 00T RlX WpW bPPc=S 0080CN  PP(KX@A0d 0-@` L( #  |  Q  `000P05/T0-/ -LM|@p #K0 P80 0` ` ( 0 00YS*9  0 00 tP9 ;909  0 00 dP9 ;900X 80S@@0S =Z `0 }00p#K1/ a R0 0X } W `0 0 00(Ko/ (K -LM00|H0 0 @0 *  60S #K K*QPt#KR0oK0D0 )QPfD0SDc @08 =p0 00|0 `0(0@0t0 *#KcK=؀CH0K#KR K0 0 0  0pp0S00L0 D0`hKcK`p#KV0cK 0(K#KR0GKP0 0 0 P0K=0 &KSR4 K#K ԅK  SR*  0fqL0 0H00#K X0 #K pP0l0 |0S 2cK#H0`0#  0c0l0 0S @0  )p؀=C00`0f`S`1V (KX0p(KpX0ppWpL0"0 0  0 p>0P`pp0 0%KK#R0 0pW  L HpP} Kv |'KH0 0L000 'K1/pEvWe H0<000@0 0)#pKR0 0p0l0 WKt0Sz(8 8\0 I8X0 0(C8d `0 K%KSRj 10  0 0 0 bpPV #p0Sp m#K0H #K#00 `J`p0x ȟ` p0 0 #K  0bpl0p 0D00#K H0@ (K! 0- 0L@PP| P0K0hE0 p-L M@|P`a9S ʸ;S ` ( 0 0PQ 0 SL0L0zPOu|`|P; 0 zzKpD%fH%f@%f-/-/-/-/-/ -LdM|@t 0X )UTP *UTp#*,0K\0 0\ 8`0"\ @T *$K &KK$K R0R&K0pxPK  0%K#K0 P0KK ?,$KSR:0PD08UP@50LPP850pp0 p d00cP@1d0 &KR0K @K,$KSR\0PX000$K"%K R0K ,$KSR*p0Dpp@5pL0p\0PX0000 080K040K0$K8p Pp<0 PbTU @0d0 MpP< 0K#K 0 0 KR &F0PPC 0'"`Ym1PP00p 0$K ZP TmRT0`F`%K R0%K  0`p |00  ` %K1/8m|04 K0 P%K 01/ `@0UZ$K ?KR0 K06#KR0 3ҡ0ã3¡ 303PQP8 @8R _ (K\,f -LM@`p|P`0 0001/P#P*WV$K -L MPp|@``9S2 9S#(0 *000S  0( 0 00P00)9+ 0 00 0 0 `0000 8/9 ?o209S&0Q 0 !0 h0S !0 Q#`؀h@PЁA$$A`u v$K輆@AbA -L M0c0@`,(0 0 @04/KШP6gAX60@-`@,0@0S00000 @@PD @bTSl0h0d0P  0 S P 00$0P000AAAAA -@`P00LP0  i<  b<0`0,0@09#60 -L0[=0[S< [.RS#QP QP00; [.RP (K -LTM@1`0P0 `0X 0P0Yp1\0 N^1@T0 G^|04 Kp0 @#1/ XN ?K&KHP0TK "#K R0$KK&KR0&K$KD0S $KK D0 10$KD0@U 80K0 0@D @0000000 @P0 0 08 S X0PEP00P0P0 \]T](Kd -LM `0pp0 0|@p t0 0`0 00l0 `0,P0P0 0h0t 0h0XTP890  `0(0 `00CSP6p00H0K0000  PH0 S080p00SPsS080`000 0 000 R00S00 00000 0\0 `0D00C0 `0S\P Њ? SP :0`0 d `d  00 `PK`P @00 `0 0 l00C 0 ?*K܊Kl ? +K29l00 0|0 x0 h0 l08#80 `0 R640 `0PP c0` PK00?P \0Sd0 0S|00|0 \0Sd \0d0 |0 P00d0ഐY 60S d   P %`0Cd0 0i )U\0S' 0S 0S00000 0cS 0` S\Qx|0|0 S 0hx0 x 00\0 0S' R  R  0 @PP0S0  R d0`x 800h0 0\0 0KSdo m`0d h0 0 `0d Rh M0S0`0\00 00 CPP 0S `0SA08S=0S6 9S3 t RP\0S  jK+K`pC8l0h0 `0\0 `0`S000cTT0x0T0h0S0h0 0h lP l0X0`0S 0p00 P0`S*YX |"00S0 00 0PC0` R00S l0c`0\:`0S70SQ K`000T0cT%K$K#QPCLp L0K DK`EPTt L`mRP9 L |0t i0 t݄P? GCPB0` R00S t KRP+%KK#K#QPP- L0K <K`DPP&%KK#K#QPFCLp L0K 4K`DP p0L000  PL0p 00SL(KddAA -L,M@0 `0|@,p0`<0 0P*QP 00S0 00 00 040K000K0?Pp0@080 pW Spppppⴠ 0g Z0p p W0p 8  Rppppp0g D0 8D0<  R R <0 ?P<0pZpő Z0őpɑkr80S0   0 84P 0PP0 0P ? SR *`@ 1/(KɆ@AA -L4M @R`p0O`0 |P,0刀H0 0H %r@K0  ?1/P8  ?*Q ! 00 0*Rb@0 0 0@ D 0@00H    @8@P@<Kc'`0< K00P05/T0 (K؆@A p-LM@P|` $0K K @0?P8 $0@$0 0 l?P) $0R    U 9 0C8C890 00 0 AP 0U@0 0 0 9S`00003/Kp -LM@$K K`P pP& 0p`0,0@ 0  9 0C8C890 0$0 0P 0@0 00 9S`00003/K0@-@TPP@@D@@TP@P@D@P@A@_A @TPP@@D@@TP@P@D@P@A0@-p@`UT@@@@UT@0@P@@QP QP00 -L@M K  40K c K@ -LM|0#| K -LM|0|| \ |0 00d K -L$M|@P)|@`|@\yᰀ @|@@H@@ p0}d K|| 0 d -LM||)@0d K 0-@LP0S ɗK0h p-L MP@0K0!  `P P` >R|T0 00 Kp 0-@L,E|0*0$R00 -LLMpX @L H P `Z{@|0#SR[@0M00 p`0D K @ P`0,0@2P[1P[U#[0R0|8 QP$K Q0@&,@ P0K LKXA#@YP8EP P @P@t0S @|0*0 @ (K.. -LDM`| < 80 9 @pSf0t9|0)0 | 00 0 `000P05/PPC0XI0oW㪢@0 \0<0 & | 9S209|0)0 | 00 0 `000P05/PP | 90C9|0)0 | 00 04 .j |M 0 0 02P44 LjUc <0S | 90C9|0)0 | 00 0 `000p07/Y0 X  0|P |09#60P?|PPX00 S | 90C9|0)0 | 00 0Y0|9S "0| 9| 0`0< 00 -  01/0X0 0P00P0|0# |0 0|0c0 |XW^0 P 0 b 0 R0RQ U U RH `00 00D0 0,0K #000K 0 ?P4 0 P<0 00@0 00 i 素R`8 , @RH0 80 @;PH0 <  R jR P@ 0 PD00CP@0P0P4]0080| 0PW|009?o200 0a P| 90C9|0)0 | 00 0(Kx%fA p-L MP @ 0| u`P |0QKp0`H61/ -LM0 K @ $01/P00K p-L MPK a0 ?`PbC@P 5>`Kp-/ 0-LMP0@ K $ 1/P 0P0F0| Q  Q0 >0F0K0 -LMP 0S 08 00 000  B;g0 KdAx%f/ 00CS0/0ghdx%f -LMPp00K08 ` 0`)@Pl0BP 0=c000|@ 0 0 009 R0  09  H10!0 000 tc0  5P9 ;900 0 00 R d0X0 0`000`06/P h` 50 0 8 7hZ000 0 90 000 0t= (KT@x%f 0-@LPᗻ0S {K0hл p-L MP 0@| 00T ^`P0NKp p-L M 0"| 0@0T F`P00 0| 00 0NKp0|0 00S @o/ 0-L0S`0|00@0 4/0 -L M`@|P t R02& `0(0$ Q 00S  W~ t9P Iprr@p0 !b0 O~ K -`@L`0|P00p0 7/"!#"9:#:0900 000#"00St00C'S0 ( 00(0 ?#00@00 ?$00P00 ?%0 $0`00&0p00h ;$0 &S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 04;00400x00|0t0S; S8`0D000t00$) -L MP0S10s.!p`SR(bWV$00s!(SR0sx0s|0` s|p \40S9 ` (@ @  0#  @#88S 0t Nb0  w}PZ:|0 8000 R d0X0 00 0| x30S z0s( `0(0|@z㰠t@ 0@  a0  B}P0@0S0t@@0尠0S0p 00 00 QP t00CSL1N1L1L1L1L1L1-@`0(00 0SP#SR|p QP&SRx@Hi`0(0a0Fd 0 a0 @ |P]#SR `0(0 00 0$SR 0 ` ( 0 0&SR Q#0p L `0H 800@04/P )`0(00 |P 0 ta0  |@P 9*:#: 9 0@@@(K@ p-L M@`t0S | 00S |p0 0S 0T0PPnkT::Kp -LMp` |000 ?PP LL|@L!9SKP@(! R KP60 8C890 00 0`000P05/PP e 50P 0 TP 5eU 9 0C8C890 00 0L(Kx%f -LMp @P|TT T+ T3`00@T-@@. d`@00@ b0  b0 00 P0 @d 070 @i$Kx%f A -L0K020K`01`K=`K00      01/`PC ?*Q ! 00 0*YH0 DK0/HG`P*`0 0009/`P0 c H0 0T 0`0 dV K9 0C8C890 00 00 90 00 0L9(K @x%f -LMp|`|PV p0S 79%9S9S B@H #P 10S@: 1@0S4@0 T @P, 0  m9 0C8C890 00 09 0C8C890 00 0`0 00 -  01/ 0Hq8$K -L\M0pd0 `0 PAP PeY U@@`at 0`PKX0 LKT0KL0 H`  L B A< >,{#A #p(KorAA,f 0-P@ LkLP$0$00 00 $0eK0h -@LP`"v$0S000  Kh;C-p^P P \0*U @` AT &@ AT`3`#T`3V` `N A q H\    LL\@ -`LM@$Pp T80K< K800Z `d0<  80<  0f8` 80`@T00@ 40 4 00K4 K.80K< K800W d 0< 80< 0j8 00<  T< 4R80<0S08 a80@T80(K -LMH` puV@ n3R:#hPh\^#\P%X\X  %V 0U 0U*  %  0D cPHkm  "Pg0S` " ~PP\ 0S0 00000;00C0KD  !! !R   1   0S   h!p(00CS00000(0 $00Cs(0K0 0D0S 唱(Qw0HPD000000$K -LMP0(0 $0@S00S`p0S b000$00Cs X(0K0 0 ( K -L(K -BLlM ®p@`K\PK((  Rl, dp ` , `( ,4 R( , (P0 ;P|l塮d R4p pR `,`@ 4 R0,0 Ѯ R@ˮ@* 0  P  P R @ T   @l    RT @W 垮LYd 4pR`,` 4 R0,0 匮(K%f0 ! 0/-@ !! && -PSL`@!V 01P 0 ` 0! 0Q000 0a !  !AR !  B / -LM@P`p0@@00@0 DK -LM@P`pݭP00KhPp0 #K / -D ML 8 0 *0 0 00 CX K|1A(f -LYP00(f Z(f -`L@T) 3S& 0S 刭 0SP PPhU0 P 0S 3 (n30330C3ᩭ,fA  -L` P P% p#  PP @M0 03`03D3S9<倭3 03 wT s,f 0-@ LP M0 00 -@L`T& 3S ~@P PU 30C300K 0@3 03حT9D 0S40 (X00CX0+?@,f,f*f p-`L MPK%@T P0P0 P P@@' P Kp -@LP`LḬ8卭00Kh ,f -LMPQ  6 K0s/)0@-8000CAT <01D A@ _@!R UT  !00 -L M80P`L#AR0<0aEDp@Ap!1ȟR YX V00  OQ@P !00 R!@A@ 0#PQV@` T000T00C00S0 S   R(K@8e -LM#K0P0`80 0@p> p ၣ`F@80X/0s& #K7P40#00bP#KCP 3@03303303 0X Tp#K*0#K0Wpp0 `F@0S #K*0#K80Xn 0X 0 #Kt7@P@#K@P p;圫Y 303303@ 030 !0 00S40#00 P7!巫  KmZ 3 ; PKp\7`囫噫 p03033@03@po(KAA,f -L M*0P `p00  0hAc80 YXmE@c80(A0UP0 Y$ cAV0&lGp/oVD0"9;P@ Y FEP<\U800800 0 "|'100S d ߪXE1PP @1@ASH H0L 00L0@C(K@*fAA$@*f@8e9eP/ 0-LM\0\@T LP\   @A岪0 0,0@@0 0XFNK0@*f@8e5A -L5P  KhJ -LMP @4 00 v#zf 0-K-p$cvK#zf Ԁ` p#P0U[4 00v#zf-K V0"ƠʌC !1,?R0  <Y9K4K 0 h0 |0Kd 00 0 0-K -K-K @0D̠K0 00 Y |0KXo 3@  -KP000P 0S-KR0`-K5-K*0P-K@ 3# Y 0帀 0 0003AuA,f<@}A -L@P M$ K@"ş 6, K  %:&p, `囩V V vL厩,3S50ʩ,3 W, 3K03$K,f -L,M #K0 1#K#ARR`D00 0H0 (2><0 A280 40#2>D0 B2@0 H0VZ@ AT8 0L0 #KP0P$KPR0PU(#KSRP$KSR040pq0SP P0 I00 P0 B P R ROL@`cKR` @Pp?#KKP0 < P\I@PY ,( X 0iX0(Ko1(K@8e,f*f 0-LM0@sM PI(ۨH0SL L L0H ШΨPU 3 030 00!(0,#64x 0 .#ARD @#9<B.XK0hBK0@9e,fA -AL ᆨ@ATĨ`ZHPU T幨t#AR0`p,D R-@00S `YX\ Q00P ` B@<0!Y00X0S `p#V0`P uFV U @'@U@8e@9e -L0#600 1<0 00M0ԡK 0 0 0 1 |< !0     0 K %K1/P80Hp0P0 4180#RP &L "/0 Lp00WL0 庥L0#R 80S ~00l2t5L0 L00X0 00 0D4P0 PeE3P0 U^80(K*fdAd$k> -L4MX 20 P4bP5@0 3@C3 U@0sY !#K܃K00" 00|"KP KK 0$K R0"fjD 1 00M%K0L  T  00 0;9L0C1X*< T0 0 KG0x.#H #0T0bx1|1L1VDDa0 !0000CS0AX00/ 1 0 <0 <6 00 0(0S, , ( ,0 80S< < <08 0@ 3@ t0 0 @0R04@0@@040 X 00 0000@0040@00@@0(K*fd,f$k> -L,Mp@`&10P@0 #KU) 00K0`#K 0P T 0A%@@0T00S  TTtU0 (K00TKPc   (K\@A -P`pL$M@0KT 0 0@ 0  8 8000`p@c(K 0-(0LPS" @L(0S R*2:8 R<<8< ( R,,, (  K0ho0*f 000/ -L$MpD@@p P` 0p q@0SH0 @ K0>P@00@0 @00 SK 0 4<` R 1 8 , 4 0 ( $QH\4 -H\ Q \  P ( QH0ܣ800X*@DaP004  R 0 R4 @0H0<K5/P Kh@ 0-LM K0" K1 0-@L塣000K0hݣ  䍣*f 0-LM@P匣0S0C0K0hƣ偣,0 0,0彣P0p 80S< < <08 ,0 <(娣妣)@K0h=*fA R0-L@P 哣U 口T K0h<0 -L,Mp@ 0P$`@PD0  H ##K?&P 0HP@0a" 0K#20#H0 <0@ pcD0pU2H0 U00S%1s" K0 0 0p)pL ! 0L 40& P 00 HX_2*0PPP00 H~(K A -LM@`p %P@x 0!SS ,0T 40#00SX  0)p JPHtt奢h@T #WV 8@Dܢ@<00 P@(厢Q( #WV/ 8,0 0,00 000,0嶢q000寢j,0 :,00,0P80,c8P<0<<嚢0嗢(@<$KN6*f*fh@AP 0>0>0000 0, ( S 0Q/d*fdH,f -LMQ,(( 0K {_P K*f 0 k`*f -pP@LTf _+0 O@ 0$Kk$k> -L 0 Kh$k>P/Q  R0-LP@ T K0h -@P0Lp 000U  p  `P  00aS0500 U$`   ` 000 -LM0pQ`0 H@r@@ T 0PU0 0PP 0T033 0 P0+P0P0K3. 63Pp0     X 0T e-00D aP(K*fA 0-PPL D@000 1  0R000 +00*f -LM`00 0Pp0@H{*0 0S0000 0 pP &2P p t{0p`dV ,303,8:V 0 (K)A,f -L M@0pH0P`4*3  00Q `P Š,3 3 C03 2P `, #0`(ꬠ0S ,3 3p03s,phޠW (0,#63 c3C030 (K,f5A -LMD`0p000PS$30 !h2l200h2l2P3040 @T* 3S @P# 3 03000 Y 0e 0"0002 Q0\"0 0' 4W  0`C*@P  0>0001P_ / 01x0 0x0 @P0. Y* 3 U P@@0 0 6<,,1Z *13 3+ 3C03ZY  W 0DcV 0000Y Z U Z(K*fdAAJASA,f -PpLCM `@K3 0l] K K K 1 L-0 p 0Q ,=0S P 0@   M K|:N@` @ 0 @tKP 1S08 4 C@4\K[ \   K K0  K( [R$ R1 KcP 00 0  000  . +000  H$pXWPP U [R \+LP & Pe%PQP1. b P  l2. BR    K P 0ȐX` c 0 K D`K0UL 0B?o20SE X 1S 0S # X 1 ƞ1#R*4  U @0S{   B uWn 0" A?K妞A?K 1/XW060 0Pe0P 0 P0`yH01 10U0BSlK 0 P0Z !R01-010U( Y% Q" ^ `*坞  01 '0 Q[0ÃQ 00;P, K!@ rfQHK @P #T7 0/ 0 `3S 0[S000 8 0S0H@ P K (|V`0[S$ 0S!0@0K,0K P#K K  T@P0@)03A0300C0@0 &0000 S0 0Ã0 0 KKz$PUy 0 `V ʝB 0 K  @l K04/ P@S/PP )-Lu岝00000 00"  @L RlK0 K1/ R01  0,K1@ H0Js`161 0V90V 3 Y %0S?e g)夝0Y003030000[1 Q 0  & 1 050, K1@`0[ S00#100V0K 3!h20h2m1HpK!l20l2 7#0` 0000 0 ؂ c000L00`0 00K00K0 0:/P #P3 0/ p@ @P- KWX` ݜ0 Pٜל(03 X 0DcP KmVk Vh `0[ S4B00000 000  1 R>P3S 0[S000  0Hp0P73 d3K 030l00+0$0K0H0 0KK@P0vp0     0 3 53030 KKo@0`0K#3 "3 03 H 000h(僜aW(KdHf^A*f@,fdjAtAAԈ@AA -L M, K`pO PPMS,@ U,0@0Sb([%P 'PjV*( KP,@0 V:@0U L8,4,@@U *, KA,f -@P`L  Kh Q-L`pPWppU*0  @P U   ZT 0 dT 00 0d` -@pH`^NLP@  .0  @x d -L.  M.  K.  .  R0-LP@ 0D0 DcDK0hY -L M@T0 1K -@0ML040  0  ; =F0 KdA*f 0 G*f 0 yG*f 0 G*f// -P0PpD@QD0L`T D0D0w~Khdd0@-EP@0 C@@0 CCP@0B@@0 B1P@P@*@*D0@ 0#6TP0QP0@d8d*f -l0LAPƚ0U @0000ct00h0 @"0 Ndx@dA -L" Kh0 -LM0SAL N3+l0KK >#[&&'=$@.63 K*fAD9f? -L$MP@ 8 UY p0E0#T*TWPSZE(QENPc@@N@TH#`~0p<0 U: <0 040K00@0P C/o T" R& @N@ T `J3h U148  D0 `4D0 000K!0PipP  V(Kd 0-@0L @R ,0 P  P 0d:f -bL@MPpAvp1 0 1UDK00 1 000! P  0 0bP< @001QH1 00$Q0  P SK 0B/ \1BP:>000 0:00!X1P0PY0 0x0wy0l0x0: 0 0 p DDW$Kd,f?,f$k>'A%APA@9f$-70)7 $BP1f3 -LM >R(',' @ 0 N@  0 `p PP ||J0@@#U|3P0  00 0P J K複@UAA -LMP1p`H10PP0@c0cK 1 p#KT0, 0$P 3 030 00U$VPp$4Z lۘ $\@ PW <Θ8 0X0pgXp(Ko (K,fd$k>A,f,f*f -LDMplKW*P`pV@@U@#T !P`ZgoV !$@p(K$k> -L. .M   K .-@N@L`P@ W  4 Kh -L,MPP000 01`0 N  n` 0K PG0E1@08` Pp5AZ@0 00<0 0pgD0 80S)  0A" P@0S 0 0 D0S )P h'3z03k!@0< [80J:C80 $00(K,fdA$k> -P^L$MP00KIUP5A33`@0p80 V& 80 0 @@@0! PX F'0t0   0"V 3jF03!@0  z 0000(KAd$k> -P`.<0@N@ L 0 KhUd$k> 0-D@LP |WPxW @/T#30d -pL`zV/@ 0SP P0 PUP# 0BQ30S 3 B0#33SQ0St#U ፗ`FKh臗,fA -`pPLUA73S u@3Sh303"PfP@#T 0 0pY,f 0-PPL D@000   0R000 00*f 0-L 0@ P40S ""%#0,f R0-L@P U T K0h0 -@LlMP`0 H0K0l \ x0 Tm l0@@ 0@ H0 \0D0 l0<0 <x D<P<@ND04pd0 d  00b0 S00 500 $`<<` <0080 00p0 D0t0 $0h0 H0S 刖0X0 X0d 6p RH0 SR 40t a1`PK 0 P 3 Q3S40$ "000`40 HHKP y% #Y4 0/ k`H3S 冖 40HHK`3Su303"4s` 0S mh0S40} $`H!0Q @40P L " `LK PK 01/UPK HK!40L  b" LKPK 01/P #P2  0/ |HKXY ӕP0 `ϕP03 Y 4D0Dc}P HKqZo Zl 0ZPKnP  kP00C0 = H`2堕1X&0 0 0P1ѕ HK$HKwPT V 倕3dC003yL!H帕04p3(03ᮕ 1嫕h H"X00S 埕<P)@`0c0S0A`(KP3 P0|3  ?Pc!`~9P !HxP 303rX0Sn X0\ 6@c0\0 gdA,fAd4fA -`L4M#K0VyQ0,@K0fS00$ p&0 Kp 0  00 $Kt2Bdt1A -@LMpKP` `  K\ 0p 0 `  0  d0@?o2P0S0S 0000 R 00 gUP (Kd -L@PBp 0 R 0  R Q0b Rc0R R 0B QpbO0P*  U S3#*f -L >P0T04f -LPp`@T j 0H@0P 0 D c"&0m$P 00S 3/000D00D   @0@ -@ppL`៾0S !S PC0S W|000d 0-PL@"P 0S ־00000; 0- P@L00WK0hO\⹾010/d -Lp ,f 0-@tPt0 ML 00@@@ @@@Xx<<0@@0@ @@@0  k<K04fAA-00 S0^* S Q05:^!0 S Q* Q:00000 Q: Q:0S00 0 0 -LMP0`S8 @@`80 L 8R:XV0=0 KP U V000'5U00 08 0@S0#03R0#S0` 0 8Kp P V 000 0S00 !R000 00P 00bT8 0dS000 00 080 00` 0 08K_p P PU 0T80pV Q*W \ T  SW Q * TQ Tpp P S: T V Q  TPSW{S*V  dS S*8 P` 0 8Kpf P> 0T8V0 0 00d80 08KpR P0p J 0T$VPPV00S  TP 0TV00V0 0 00d80 P` 08Kp) P 0P 0P P V00 S 000 0 V0 08K0 `0d80  0p 0S00 0800(K -@PLT HP 0 D b00"&m00 $00S 3/`@ -@PLM1P0L S@!RP1U@1( KaP(00(0 (Q*00 H0$?oP20S bQ 0d 0 a`p\*l `Vp`)⺼ K -P@L M`UHP0`U @0S P000圼000Pv HP00pS 4 R @ R  `0!0D !6S{ P`V 0<4V*40SPU@0S00 80$0S 0 00R@00@0010KH`V, @0S `080 PP 1i04 R@  B@ 0WHpV 40S @00CS@0 pKP K*fd -P@LDMD0 KP0L0 KS!1Z!Z p1p! yP0@D 0 Z0  Q @ R  Z0R D0 00CX0 W{*H`$0V@0 T D0 Q 00cT0 0Z 0g0gL0 L0<0 0H0 L T00< 0bRP0 8 D0P\0 PP- 0S* #'X R# 1 1111 1 RP0 P0#R#R 3SPD00SH00HP 0<0:C<0 H P@0Z P1S "#K@0`帎@0 X #Kf Dg0 @8/@pR(K,f -LM` KP@pP 0P T *R 0T:400 @  K 0-@ PLx000K0h贎 0-@PLDD0D00 -LMHP`U@4 T 00P i0 4 $p0 U8 Pa SXH  R 0SR00ZT00#$0W4 40R8 80R< <0RL L0R@ @0RW 00"QPxX  0PWp 0 00U000U0000C00  0  YX D0D0H0H000000IP00 SF  \B40 % H R;  RX6H R30 Z0TT  "+$ W(44 Q$88 Q << QLL Q@@ QW   P0SR?X  0 $P 8X00S 3/W   R 2/  R   Y    B    X D D H H 0  0 X (K -@L ppP`00DH0PPPLp`PP咹R  $Kk3̇@A -pP`@L 0 SA00T  6@0@0 -LMP`p $g9@p0 K7f -@L 0Q`D`kKhp -`LM LP"# p0 0H@00 Ts <0Sm22d222 00 0b0a00 0 t ;S 600P 000H0S 0@0S 0 X@0SH0 S6 2S0 00-80 40 0#00000 00P 000HP 0 D b"&0DH00 $00S 3/00$000@@`,00S R 3/$Kd 0-@ PLP000K0h茌 -` H0L@SP`f   DD'00 $Kh " 0"$0S 0S Kh/ -`LPp@T  00000   @0@KhD -`LPpe@T  000P00@0@Kh& -L,MP0%$S@8 ` yPrv 0 K8P 08 0S000  * 0R*000 0P08  80K 0 00S 0 p<0圠Pᜋ5   Z Sԋ 4<0 0 Q<0ȋ0 T@p84PX8 0 QP 0P0 0c 0 00P !#(Kdd4f -LM`( K@pPyPP( 0S0V :(0W 0V$0SH0SU  0QP0  0(0 I00P000U XWP0Q00Q0000C00  0  e 0   f 0(  $K -SL M`P@p207. P0L( KSP!X!XP1(@P@ 0S* 0S 0PT 0S * 0S 0P& p#T @08 $00 0%K"H000T00T0D0H0T @08 00 0%K"H0$00(K -LdA@ :f -LM00Aʌ . 0 o K p-@LM `EPPEP僆U(0 0000S R 3/0S PP 0KL P% P oK  2Kpd7f -QLMP@0 ~ PQ 0S \ 00 0CSP#*T 0PPP P 3 @ 0K 0 刘PPKBPА T@    0Hp@ h`00 00W T 0 0dR|08#hF0 H009 $#0000H00S# 0K"  0P S)#"Ft0000$K!F*K"F+K!F0 00f r0 `"S0 T"S00$00 0 0H00P00 L&F0 &F"%F@0D0<0,00<0L0@0400808004000>?L00    L 0@ 000L0   0L0 000 0Fnp00 `qݱ0s 0s: P P 0 `Z-`0S1!p00 W#2Y 0dR 0 !P0pP0 Y  SP 00S 0 P~P(KhԈ@h@$@ -@pP`LM| 0K p| P ]K -0pD@LP `R!S00S R 3/0000L PP`Lp |`D` $Kk?d -LTMP000 0X0 0PD 80 P0, K 0"$6 0 )6 D P800y 8@4 K P 4p pg0Y 0Y* 240p00p>40040 D00@0 D00\0 40T0 0`0 00h0 0P0 L0 H0 00d0 4@ 0Rd0Q `0S 0@ R*#400 @0 0 0400  Wp pg400l0 {@P H0840l0 0i0  c0\ \R # 3\ R0 0$P$ 0 00S 3/40" 0"40 0 0  8 4 48  4 8 8 < < @ HPHD D 0'D b"&h04 L0L0`0ST00T0L00L0 00aP0P0 H0S@0 @QdQ R40 pH@ fZH00X00K0P08D 0L0 0 06P@RPXy 1v0@pD @0 T 0 R  YT  pT 04 4@ Q# P! S 4  T0 54 4@4 H 4 AH T0pp5X00S W00S T 0P7 400K0P08D 0L0 0 0@įT@ @ @@@⶯Z  0P [X0S8D   (K*f -LMP@`080 P0L S@!R`1V@10 K0P000  0T 0T* 0@00 S  V0 \8 [ $ \P ` ( O0p TE 0VB 0V* 804S 0404408Y j0 400   0 o00 $ 0S40 0 0@000Y0S 00 0P p@Vp p (KԈ@ -LM0D^ K 0-L8M,000 $00@P`!30x3 000`(P @ @p0$0H3 00!830 00`,P(P@ @0,0N?$02 00!202 000`(P @ 0!202 000`,(P$@ @ @~ 0,0p2 00!`2 000`(P$@@ @Pi 0*,00 !2 000`(P$@ @@ @PT0,01 00!1'.00 0`0 (P$@@ @>0*,00!x1 000`(P$@ @@ @P*0,004!!,1 00`0(P$@ @@ @P0,00 00!0 0000`0(P$@@ @P0,00 00!00`(P00$@@0 @P0 $Kk32rAD9fzA*f(32A.2AdAAdAAAdAdAp -_LM⥏K KK@ $K4``A```` `a`abbbb`c`c$`d(`d,`e<`e@`fD`gH`gL`hT`hX`i\`i`j`kokmlnlmmnmlnx`c?Kn```_?K`C```[?K`C```W?K`C```S?K`C```O?K`C```>`C```>`C```=`C```>`C```>`C```>`C```=`C```>`C``a>`Ca>`C a`a<`Ca`a!>`Ca` a">`C$a`(a#>`Cp0``p4` =`Cp8``%>C oK?#K` /TĂ R  0S0!2 0` 0 0 000000(K*fd -LxM@|0KP`p` T0 <Q< < 00 0 0000000tK -LM⬁@P`` K0 0 K\ ̀ p\1+[1;[P 0`(\̠ $A \ 2(1p3B(108C8$YKW+K^;K0K  0T  0a0 00 0 0 0 0K00  0 0 00  0000(K@0 0>00 : "F< S3 S:LSr*Q 00C0P 0D@ YXY  Q'(Q' 0  0! 40 P 40S8   2/3T3  / O 0D '6S0S 0 <46R*v000 000 00@P 000   (K$k>d*fN/N/ -L$M@:0>0>0 T< *0!P#6DpH0 D 0H 0P@0 |?0 KwP+ 0@0 g <Pc <P%<$`Q 1L 0 $H0S80  -~V )~L0T$:V e~80S `~00000 000Q9Q R* QL0T*JP80S 0DaP 0!V00S 0 00c 0 JPD0H Dd@(Kh@ -LTMX  0T 0Q@TH0 @  zN'z@@NP@\K  0g*H0 DP S:L Q3:ST` S  D!0P`@0 6/H0S D  @XH %H0 5PH H0 H`VX``T00<0 @0   K0PP0  0$0S] D0K 080K0<0K0@0K0 04K$J0Pd@01N@Dp0U  LQ0!03P U03S T( KP(0P @@eX 000 + K -LM` :.#:  . R `c01@VDp00LPU03PPVP!P3U 0K P`A P K@-0*>"*0b .01  QD00L@PT03Q03S@00-0*>"*0b .01  QD00L^03PQ03S0&-0*>"*0b .01  QD00L^03PQ03S0SC2C2C2C2C2D2D2=00 -LM000ʠ>0,ʠl  Q00DL@T03P@Q03S XP@DP,FT@P"*0b .01  QD00L\03P Q03S 00P KQ 001@ D` z/ -01LDpS,0,0 $0. 0ab/8dd -L M`0PS@D0P@09/@` tP T 0T 0 0@0 `00000 a0D$K -L M0PS`@x0D0Pp@07/X0T @ `  0 0  0 DK -L4Mp8 P0@`0:  0:0Q@0 * 0P*0G|<0  W0w W:80L0W*X 0pG0<0SPXp ,0K  #0(0 f 8XPp5X Xp pD! 0P @0 Pd`\0RT-00C0 0R0 00 3030 0Ԉ@,+f(+f$@$+f -`L0S:0 0B00 4) 0R0\*fA -`@pL PP 0S xj)  P PP  +P@T ,,fA -L Ma@0QS⻷0>0>000>0000N@NHV@ 0fT ꠀp0W᣷W|)0@@N@N@T *(KPH 0 (尲J(0T KdX9f=A@9ffAA$k> -D2D"DRLM0 04 8  9w 5w2 p(2 `@[P ~ ``h@1 pR  @ D 넠 nh200 Ba<00  p1W aP0 00  00 P E0 5000` 00  00 C$x 40>0>0008 >000D (00 ,  (K`9fd,,f,f,fA*fPX9fd -LMK  p , K8/ -L,MBP0S0S bpdv0U80 Lv0P@0 0E 0 20D0 2<0 1PL0 0< 4K1000 4 0K1H0 80\R1P0 !0P00SC Q Q8 4*  Q    8*08 4*  0 Q   8*0 8)0P4 \0H 00D 1L0PU<@0P`AvU @B(K*f,,f,fdX9f0 N0 : ›,,f -LM`8 <0 @ pux2xP8  00"600 u1S $t  l?RQp R _R@ ,Rr (R! Sk@TW W00K0 0PWU0pKp 0 P p 0 PD 0,'0!T p  p pQ  ҵ ŵI 80 `#(0<0,00S0  # V   #DuT #W # 8Vu (K,fd*f,,fAd$+f -`@ PL Pp""a Kh - `L@VP HU  P $Kk -LM3P0S 2 Q00~uP 080 00 040 p00aP2 0<0 @T 40SԠP Q QAAt8宴P'0 t 0#! P @!    R   @ ``       J@uP$4 t4<0<0 P @Q@$$yXpn Q D 00 p000 0 80S\00(Ko~t(Kd*f,f,,f -LM K ay K3S/ 3-0C8L#8S3 00C0*f 0-@LlK0h 30-SL@ 0003030*f3S/Q303830388* - L  -8L  Khg -#L@R/ PU 3030S 3 B# 030 003 ᅶ3:#033S 0Sc$Kk PU t0S PDP v3$q尃S0300C0PP 0`8 xs030! 1 0S1 A  0 X00$00$00 10PA0004000Q(00ӵ0µ$Kks$+f*f,f,,fdd -p`PLUA0Ds 3 3 03 03GP - 0LS0S s -LM@P0S  0R dp0& 0K # ` Ƶ Q &0(cK:f*fd 0-LM@0@@@0 KK@ t\P  r@@ @P0@010S 3/@TK0dd:f,,f@ -L:f*f$:f0 0 0 o3o2,,f -LM@0@ 8  R00  Q SPUpp 0`qqT P ,(0#6FPTp P`P` Zf80W - P@EV`1 00M0 vLV0`0 0 W0 qgCq,K -|p|`Lxp0SdY6PL0PP-qHp@0@8@d&q0p۱qd*f,:f,ff -x@L  P  P X00,0UP8@00=0""  ,0C# K0,,f:fAA -,PLM0d@(0 `@( 0pS4@ 0 0,0F$(0K0@0P0 0 T( K:f p-L M`00PS@||x00Sp T`g\X%* KlhP@], 402"P`$@Kp,,f @A*fAAA9A:f -LM`,K!@PPxepP*nZ1 80 R00S (,PX100 0! /P CZ$1pWpGp,0 `&&T,`3XF,F@Z80 R 00f 0,0R$ ppP0P&` ,0P $$X  0`f `<PP(K2@\AA,,f:fXdAA*fA -L(MP`pcKp`p(K`#KV0H$HH@f$F(@ g0 0 00 1/0F`p$K 0-8 ML  000 000 r KACf -L'P00Cf OCf QP-LMP @`pa Q  0!  V0 0!ı708` pa`0@ VP SR/!R0 0!ı! R bZ:#Kf#KV 0I 0#Kdf#K!0 ` pZ#`(K -gpLM@V@@+K|0 R 0S 4\Q 8<P<< 80H  BH 80 //Ef*f\0 R 0S (Q, P80 //Ef 0-`@LPU R0 P ` S  R   0 0S  0 (0 `800$ <00@8@@H00H0Ef*f 0-H0LP 0 @ST000 0Ef -@0Qp00P0L0ghP0e(,P (,ҶP $0R` `e000P0pPpe40t0S 0``FV`&`4;040P "-oeL0pgLpT0$ 0bT04PXX8e, (#0HP*f,fEf\dHfH@A 0 &Ef -L(0M 0 0  f K>42 -00ML06 0 0f K>42 -LM600 p1!Pa4 P80 季@P  0  V? 6%:V T[4<0 6 S  7(!<0 !<06  !$0 000H S0| 8P0d0T  T eX 0 040!800R0 00tXdP#` u00S0d0dl(K,,fdHfd!Cek2 -@LL D0RH`P000L00L00PdT00T0d1\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -`@L$0  b00b0 00C 00S0 0S   R0 0S0< L00CL0000n$KkEfFf -LK"pPt0S !0S  0!;"P 1x(0,P`0d00041L  L P P*aP8PP0P 10W "U' `aH(P `uP`P 0l`P PP{P X (K*fGf3e\fHfUAA,f-AAfA9A^A~AEf A\d2Az@A -LgҌ}`PU) @T$ 0 4`XP# p ` J8 <0R0<0<08 H00CH0V %8@ PT2<`0,KopA`W AGf,fEfA*f+B -L MLpH0PSK0 SQE 00"` `V2 @T- 0(  0 0S"0Pp 8<00 Q<00<080800<00@800 00 0T00T05`(0  8@ `0S00S$`(K*f,fEf -p`ppL_X@_ 0 080 0P@T@@`,f*f\d -`@@PL_( X00eX0$0$Kh_,f*f p-L`P P_p@( a0 0$0e 00TeTKh_,f*f00 [ 0-LM`Pq \00\0 @0 6KI@P(e_X00CX0_K0*f,f -LM@0q`DPP_@N@N@T( @0lЂ QPpp\p#p2W {_ + Ό&. T( 0 0p0 b(KppP `_(0@c0$F d/(0@d0$FC@N_$K0@-D0S d0&0bQ*10a#Ơ@0P08 @ &!6*U\00/R/>0 .0 0-09 -LM#Kt0`@SP  @ 060p#K  #Kp` P(Kon -`pLMP 0g@P0 =# 00 0 0@P/Y^Z3 Y030 0 0ݠt^ 303 ›P0#10#0 S#0@(KAA -LM#K( @p` ( @`pGQ W,0 PER Z $#KP @#K*R0`pG#K0 PR Z#K*0#K`V#KmP @0`(K -LM0@p ` 0`p]$V W   0 00  0] Kk$^ -@L`p]dKh^H/H  /H   @o/ 0-P,0L@T MP@0dd0/dd -L 0 Gfdd -L M`Pp0P@00 pP0 ܉PP0|P R @@0% KP000P8"U4P@@ KGfddAhd 0-LMPP$ 姉P 0xS    KƱP P 0S0C0@@(T$\|K0GfAddhd-/ -@Ld`pPs\P@ @T@ U@  4/@`忉Gf@0S`00/0PQ/ Q   /0P P P    // 0-@L&,00$00 000 0000訿22ܿ22?oQP0@-2 R 0R 00D$T0000 -`L@PT`@000 P# pW#  P  P0@S p@ P  P@pW0S0PPP@P P  /d 0    /0PQ/ Q   /0P P P    // D00-0<0@040L0(0 0s000T202202hP P/d -`@pL 0 ^c PUP!0 T0@  @0 00@ep c 00 0 -ML MP`0S A 0C0 0pBK04 @j IT  T1#ph0 P+000C S : 0CR X@` 0 @0$j* @ (K -LM@p`vP0 0K ,P ( p0 l h K 0-LjM@L1 P0@0K K|PD0.K0!>KF? K1"KK|@P1.K%0K?KK0LA@A -LAMP  00a  `!  d! !1 1 0  04q8<@T ġ ȡ p̡ С ᬡ ᰡ ᴡ ḡ4A 00 0K  c 0 p 弐 0Kg @tx0|0 [0x0x0 1 t 0$0p0 :[l h d ` \ X 0k T0 0K|0\#00KGK1@K< KK0n@P0$#0GK0/GKF@P ZpW U4qGK8P @ Z 1T 0q0K` <l2 0 0;K40 KT:K(V0 \0 0 0 KKKK)KjKѾIKѼIKѬ@ K K K@K@K @ @ 9Kx40 K!@Pe1V1bv0c 1 尐0 !  p00AK C/Kh  3@PC ( K(0 K` X!@P;0S @1 1  1@ @@   0@!@PQU 0 S103!PP U 0SP  "!P @W VP01 (K@00>0R @p c pP@@$400(K22\2 -LMP`4PopKx d@TG 00 0$0 00 00 00 00 00 :0 0|0 0x0 0t0 0l0 0h0 }>d0 0  0`0 ` 1\0 1X T0 0 0P0 P 0L0 y 0D0 01x@H 1T@0 0`@hP<0 `P_8P0P00TPg 0x00 @FrP @@ >rP@P@@$KP Qc55/d  0-PL@P 0S 1(S3 SP00RA -LIM0 P3S(pP*1S S``2S P221 10 0 @P0,0(040002P""瀂R0'0CS@7 l0 0 0@P]00CP01 h0 @T ,0K #0 14/@P0 1   ! V  0@H0 `0 ( -QT@10 S T! 3L0P*Cq@D@0" 0T @ 01 00 0S S0(1  2Y$000K0  00. 0. D0 (0101D0 >0#60KШd -`L@V 00 X00  0 PVp  =p d -0b`pb 0L@RP:000U@ P 00 0000 d -xL@$ 0$0SP` 0U*05# P P0J000 d -LM0@S4  *. 0:*` P0q`"P#L0L00L0Q000 hqn `  0 D@P 003/K p-L$M00Q2@00 00 0 )P`  0S  D . . Kp 0-LMP@P 00*"*0b000b0P0  000. DPK0hK0 -L(M0K02 0000 0 PP K -LMT0p $#00<0<001@0CUT@@@01<@<`@p0bPg 80`g` R 0b 0Es 0 0000 00P0e0P 000PP0 K d\2 -LM0`@00Ѐ@P! P0o/KPWp WPT0$ K0 02A 0@!P 0 $K\f ]f]fedA]f -LM0a0Ck $̀RS0 SR2 K2P\Qzw2,K@0!2P 00@0*DP (PD0 x 07 h\AT TVPTKbP`4KP PKPCGP ڰ0[/S,0K`0p0F@K00T00Sp )'ApTT!0P0 -0`0K` s00K0d K0KkP<HaP@Q 04 T0   PbkP$0 0C /P 0 0 E P0dP  KP ` kP  KK 400  tPph(K@ 00P(`$@ @@@ @pኟ0,0h? 0\?0'>0P0(`0$@ @@@ @u0,0? 0?0'>0P0(`0$@@@@ @`0',00!> 0 <00P0(`$@ @@ @K 0,0> 0t>0l>0P(`0$@0 @@@ @6 0,08>,00>000P (`0 $@ @@@ @!0,0= 0=0<0P0(`0$@ @@@ @` 0,00x.!= 0 <0P0(`0$@ @@ @0 ,00!D= 0 <00P0(`$@ @@ @0,0= 0 <00P0(`$@ @`@@ @Ξ0,0< 0 <00P0(`$@ @@@@ @ẞ0,00$0`< 0T<0<0P0(`0@@@ @ᤞS0,00$0< 0< 000P (`0@@@ @᎞0 ,00!; 0 <00P0(`$@ @@ @y0,0L; 0l; 00 0P0(`$@ @@@ @d0,0(; 0;0;0P(`0'>$@0@0@ @N0,0:0: 0<0P0(`$@ @@@ @9 0,0: 0 <00P0(`$@ @`@@ @%R0,0D: 0<00P0(`$@ @@@@ @`R0,00$0:0 09 0<04P0(`@@@ @000R0,00$0X: 0 0|90<4P0(`0@@@ @000R0,00$09 0 090<4P0(`0@@@ @ȝ%0,08 0 <00P0(`$@ @`@@ @ᴝ&0+,00!8 0 <00P0(`$@ @@ @៝(0,0D8 0 <00P0(`$@ @`@@ @ዝ)0,07 0 <00P0(`$@ @`@@ @w*0,07 0 <00P0(`$@ @`@@ @c+0,0`7 0 <00P0(`$@ @`@@ @O,0 ,00!7 0 <00P0(`$@ @@ @:-0,0;$06 06 060'>0P@(`0@@ @#.0,0t6 0h60'>0P0(`0$@@@@ @10+,00!6 0 <00P0(`$@ @@ @20,05 050<0P0(`0$@@@@ @30,05,05000P (`0 $@ @@@ @Ϝ60,00$085005 000P (`0 @@@ @Ṝ70,04 040<0P0(`0$@ @@@ @ᤜ90(,00!4 0 <00P0(`$@ @@ @Ꮬ<0,00$!@4 0 <0P0(`0$@ @@ @8 y>0,04 0800 <0P0(`0$@ @`@@ @d?0,03 0800 <0P0(`0$@ @@@@ @<@ @@ M`3080 0 <00P0,(`$@ @`@@ @8@0,03 030<0P0(`0$@ @@@ @`#A0,02 020800P(`0'>$@0 @0@@ @ B0,00|"!\2 0800P(`0 <$@0 @0@ @C0,00$"!2 0800P(`0 <$@0 @0@ @D0,00!!1 0800P(`0 <$@0 @0@ @˛E0,00t!!`1 0800P(`0 <$@0 @0@ @ᵛF0,00!!aT3,Ap 36Ad>AGA 3NAp9e+B{5UA_AmAuAAHfAHfAAAd3A3A1BAAAAAAAAAA&Ad35AdAALA(@SA3XA$ 3VHBD3!B`AhAxAAA83Bd3AAAAAA AeA 3A3+A33A9ABAHfd=A 3AdHANA 3ATA.@bA6@mA3wA0 0800P(`0 <$@0 @0@ @<G0,00 !0 0800P(`0 <$@0 @0@ @&H0,01 010800P(`0'>$@0@0@@ @J0,0d1 0l10800P(`0<$@0 @0@@ @K0,01 01 00 0P0(`$@ @@@ @O0,0202 0<0P0(`$@ @@@ @К<0 0@00\20P,0<(`0$@00K @@ @`Ớ<00@0,P(02$@ @0<000K @ @`᧚0$020 K 0<0,P(0@0 @020 30800'>00ፚ;$0 0 0<00 K0@0,P(0l3 @0x3A0'>0v30 K 0<0,P(0@0$@ @03030800'>00_<00 K0@0,P(04$@ 04 @0800'>00I0 0<00 K0@0,P(0`4$@ @0l40800'>0024 0800>0P0,0(`$@ @`@@ @4 0<00@00P,04(`$@0<@0 @0(5 0<00@00P,0L5(`$@0<@0 @0<00P,0@0(`$@05 @ @05 0800'>00ۙ(K 0-L8M!1@P`000 00`,P(P$@ @ @pἙ 0,00 $00!0 000`(P00 @ @0 ᥙ0 ,00!T00`(P00$@0 @ @0 ᐙ$KA0 3d3pAA -LM$Q (R`p@0 R0 R0 R0 00 0K` 0 KT 0 0@00 0 0:?o2P0S R08R 33 33 378870$KHf -LMp0P`!**@"&9 !|0K ` 0 KL 0 0 000000K3e -LMpP`K0` @0 ]0K\0 0 0 0`@000 0Д?o2P0S  (K ]f -LMpP`K` 0@0 20K\0 0`@ 0 0 000 0ᥔ?o2P0S R (Kd/u -LM@KP`p ` 0S S$0 00 c":0 &$0Kh # l0l 0 0bS0#610 0KT0 0@ 0 0000000^$K:f*f -LM@0p0PS` 0"(K|0K`  0R RK Kl!00L < 0 0 000000)KTde -@LMPpK` ` K\ 0 0   0p  0 ` 0?o2P0S 00  P00  (K -LMA 0 `PpK` Y+0\P T0 p 0 0  0 0ȓ0p?o2P0S00  pPp0Sp +\0, (K8f -LM@ 0 `{PpK` +0\P  0p 0  0  0?o2PppW0S +\0 }(K8f -LxMPK@`` p0X0 X .1D0  S00Ө?$0@D0 DD T eXh0ը 0 0 0 00000P00(@DT$K9ed -LxM`K@P` p1X0 X ; U(R( D D0  S00ө?+(0@D0 DD T Y ʀH ؀  0\ 0 0 00000`00Ӓ@DT$K9ePd -LM_@`0 =pK ` 1 K\  0p 0   0 ᣒ0?o2PppWP0X ?oX20S00(Kdd N 0-PL@ H0T GH0 -@PL0a ᕿ 0!0 D!(0:0L1 00$0Dҙ$0$$̙$0$P0(00,0(0S0 04000$ t0 l  ?S Rp 0 S080t0900S  @u0 l$ 0 0%<!0 \0X 0`00d0x0h0PQl lKh*zd@d@@B -pLM`@CPK ` |0KT0 0P@ 0 0 000 0?o2P0SC0P$K -LM@apK  ` PM K\ 0p  0 P0  0@?o2P0S&00 0 P 0R K◛<0Ta)K ?)K Q 0)K$000 K0[(Kdɚ;6e -LMpP`K` 0@0 0K\0 0`@ 0 0 000 0l?o2P0S0S\0K _0`P 00l@P0`Õ뾎(Kdd -LMR`p@PK A?K` ᳾0@ 0 0 000 0P '?o2P0S$K -LxMP@K`p` ፾T ~0D 0 0@ 00000 0$K|f p-L MP`.`00@0S 0 Kp\f -L,MpR`020; @P[FL0K0P0 0U& 00T0 Z X LKT0  0PH  L0 xd~F LKH4FZ H @P lF @g@(K ef e -LMQ`0 @ Pu R 0\T@@p0좟P0 嚒w pE2Xb `0ScEOP&FO00 rpFWE EU010#pᔠ0 Z' 0YS K F F K9 P  jr $ E Rf Z4!0p e0C0 @4 ETrV 0`fV` #*2 U0 M @ ( J,1E00 zrP 1E |EU010#0 Z" 0YS ^K iE E K P `E R Z4!0p e0C0 @4 E<0MEq] Eq# R<(K@00`0(P @Z0,0<$00 00!0 0'>00`0(P @C0 ,00!|00`(P0 <$@0 @@ @0 .(Kဌ/L@AA@AA7@eA,^fAP%3(]fAA -L0,0$@ @a@ @P? 0(00 00,$@ @a@ @P. 0(0l0,$@0 @a@ @P0 $K%AA*A:BA.ABACB1AB5AA C%K̕<`>C'K R00t'K`Qt  R0='K t t|k(KK K 0'Kht Q 0=A'K At D1t|0 41şK ($00,༟K@0<AKwL z`H @l0 100S. 0#K@>0 40K0000000 00 @0l KPP  <p K@0$:m(KHf?Bdd@ C "hpP0ZP0P?P09Up/kpP 8 (! ` R(PWPpP 9819UW L"fQPx. 40P J/K01 PPk(` RP(PWP4U01[0'pP PY 0q 0 0 1 2- CK!PP I0(1 (t0S P7 K5P0S PUK⡞0 *K`0  00S 000 000 000 K().0EK$ 00(1 1 0 1 IK 03/P( (uUPY V 41 (K8f@10Pa1?1?1` @P U 0-@PPL6@0<0C@00S  0 6K0h6:e@-!2 !@!$!!!r!E0!311S -A`LP 0-LT0p@-!2 A!Q!5!r`R "!P "!001Q!AA 2S^0C01p20Q 0SQ0CQ p 0-@P@ Lᷭ6 @0 S:T6pp00@00 S0D00@5001:60:ed AXA:edQ-  1 a>Q " R q 0o`0 -px0L@T `0S@4Pm50 S*P P$p050:0 WD  B hUڜ1S Y  4B4 ! h<00 6800! hۨVڌf401001-q@t1(K -@pP`L&100000d140P11@ -x0p@`!L0Q P Z `1 2!001 d -5L0M00 0@P00 RPa1 r10S10:(1 <0 / 0"1 40 280 4 108  1c0P  Ys 011 R40  040  %;00 0P P P10nX <0 0(Kd9eBA -4@p1 P1 mL 00U 0Kh9e 0-`P!L0q b P R)0@P 1RU cP 0 PD0 㑍0 0, @d9e 0-@Lv@ !00 0-@L0@K0he 0-@PL40 h@ 90109e01 240g✡d g☡ -LML2 101482F0@1=40 /q1WPńaՇ0PcU  !`Pn § I  jUPɒ0âZ?҈1Ճ?Ҍ1 b/c> !S !O1 11P11080 000 U880Z1 `V. (Q1UQ'< /0 < 0 /Uڌ0 00`0 02"!!!r!E031 P4!/(Kd9e -L M11 B01`000 PgPXP`pU!Z P  R 00 (\ ```  BU0 `P^X 8 ⾦Q020?SڌEP !㖿011QPoQQ ᡦ ?10a(Ko(Kd9e -LP`p@ P" 0t1 211 t PPR @0 @0 @PE d -0LQ0a4@1Sڽ@V4@ B1S PaQ`1U0S  R R    Pd 0-QLp@T@d T l`.}8PPP.T <0d108PU@vt@ @Y0!#4# 11 11 0R!  P 003/0P00  P PY⠜@0P 0<00@0000H0 03/P  T 0+0<  00 +50 40 *80 080+0! *8008080 R080040 00@@0@@0@0u$0* *000 0]WU XY 0(KIf Q-L`@ 0NPKU`  0-80L@DP * 1T0 1  T0  K0h*0 -L M<0 ``Y@pPDQ > d020$ ?"P*80$080 0`$`90 0*,@*Y!<  DKԡ0 t@0 0v:0<0 0#K00Dp 8 ,0 i*DKop *W$00$0$`$`Z*$K -` @PL}P 0U I* -@0(@P@1L b})1T ʄ1 Q @1S@ 10S@*)48Dd  -@L`0PT 0T .VP ,6\\V0G@TV@0,G@PTUPP@ 00 ;V@k If 0-0@L U n) K0hIf@3A -L MPp0 f 0QSb A UwPPP `VR0s  UJ@Q% P@S0@0~` j ΠY    p@`@0 $$` 0d 0cC100R  00(S00 0U(KIfIf 0-@PL) 0S& @UP U@PdU0PU HU0 PP  P}U00If0S 0H0/(@ -LmM  ! PNP (0S "{ 0S 0 mK 3/Pmm?K 0`0a 1 U8 Up1p#p@1K/K4/PYKOK21 0:0P @ 0SH 9 000 0 9/P90`0C01 @T1Pg01 V1`'0S 1   4P1 21 0S iOKeKp1    PP aOKX Ο0`L1 ,(0A 1 0p1 @0Sx 4P 0S eKiKPy #Y L(0|1 0!x1 0 _?K0@(1=1 ''K?K!R @8  !T|!x1R 00|!x1 0!S 0S eKiKPڸ(@@  B@  Q   8  8"  1 'H  2/'8 1 Y! 8  !  p 80 080' '' 80 $#0  #0080 0080 0 00@@0@@0@0W''p1 KK @4/p`'^'101 K?K1 10S  Y R1  |x!Q  |x!1O''W p @1 KK4/0! b1  (Kd -LM,0 00000 00] K8@ -`@LT H0 0P3/P @ -L0L1 R1Ma& P  6Kh-'d0 }? 0-@LT0 0T0` 忭01 "劷 坨Hd lP pP LzZz 0PK0h9dIf8f 0-PL@&0T &0 0'd0 )d -L Mp`@4 K P:/PePWe4P 00K dDP ?P@00S 0A03/00`@0@`(K\f 0-@TLlMpD0 l0 @ h #< lK~0P`XP+ Pd!DtQ{"Pw"$%Pq`0(0`l$ 0;0"ѶPbᢹp0K02 0000  0 ᜯPE p a *L ,!P (1Y51 h :/PD0P S#*L S :,0S004 @SR%lP lpP ptTX  @Ḭ"ᅶ ᖧ`(KIfd -L0k?0h0pp000K02 `00Y00,qa00p_W 0p00rS^00rR]00K00pIW0000P 6 z!000p 200!0D q001j!10 0S l0l00l000S0  0@00\0|0|0S|0|  0|@0 1 R @@0g1uD03/ ;!<Jv00000t0(0aL00n! l!j!  Ad!xMlM@0<  0MDM @ Q!e(KAdAAܾ3@PP00 ᑘ`<0  X <0 U@$@ `V 0ʺ0 ` 9PP0P001 K0K 00800 PPQ  0K:P`10[S80D}V 0៺T P(Kd8f3:e 0-|0L@S d3/0|0d00 -L\M0at0 P0@Sp  .  m @1S t0P LST030 SD0h0 h (00,0>0#6000040>0#60@0>0#6000800<000qP  ܡ 01p0 X # 3W R l0      2/ p l0 左" 儰 嗡WN/0qLQP ᢓP1#k p ⡗q( 0/S+ -Rx $xph0N ̀@0 c0/`1Hh <1d1D1,0K4#p 7/xpQ l8 0x0WT1<cT0  81\K\0 <1X0 @1T0 D1P0 T! 9pPh70S P W0.,1000`0 9`0p0  pFl0 pw<00l00l0u0h0 *0 0 $ 0P + +pPp0Pf0  0  pWpW`0<`0pW @prpW00P 20p 00 5 h0 0,03/h00S  3/h0 $p (0bSWl pp Xm(0XelYs003/4,K P000!l0p4 00 0 їpP9 b003/\Wh %Kp0SH KLwr r4 P$h}H 塸lP pP t0S J hl  \3l \\\p0 \(0Pwl0DP~p0~p @09/,K0)003/3 0000 0 DdpP\01 003/H 1S  Ih00q 00S l0SE8 CJ80l  8 J0pl0P 1S 8 R h S 2/ 00L1 h0 000S 3/h0 01h !D03/t10S JZlJp0SdgJHqh `10 S0 \KF0\0 0P0 0L0 L1 \K00 nRd0& ,K000 帐0( X N0(0t000C0 `\0 S MLzq q0 P(K8f\f@  R001 d    0 0x000<00$0<00(00 -L M@ `p PY /3$33333333x0S' %P@ t0S 0 S 00Z 1010$0S0@0CV D``0 t0S U 0000d0 > R001   00x0 00<000<000W PX <;0 P9X <X/P0h 9 y(K -P0aL@T T /$ 6$0(0S0C0_Y4A 0(P0S0S/t B\R R  B 000\00Q0\0x0D10S  0 00S0  00/Hf -LLMv0AP0T ptd0:d00Sڒ0K80)d0H 8f) ,KKP  0 0000 t P 0P 0C0(  ] 0 1111K0 t0L0S K@1S $0P0 Fy18xc080HI,>̡尀180S 3/Gp0  YSl0 00l00l010T: X! 4<0Z0T0 uT0 S  ;Ol % d YX  X #QY ̛ !%ŷ' 1S h0/ 30P T " P 0T h 刐  h #+h  Q Q 00h P Z  $1S(!(!$!(1 0S   1 R @@00ㄠt00000T 0S  0 00S0   0@0`0 x0S;\0S D K  DK AN0<0 7X #{ᦸ _(2 Lx0P *$p' ZD1(p5D10 tp0C000000PE}i_#X]HfA@P\  t0S\00\0 0U0`0@ 0h  hP 3,Kx 000*\P\ t0S\00\0 0Ux0`@0h  0 HP X `XZl0S  R#P p px t0^ t R p"$t0p0d " p0 x h ` $ V! h P#+h @T@"@\ PR \ K \KLj1tR@< P  `P <T T <6<X6<<X60S X <xX <0r ! t R  B R x="e" R 0@~@w7<9nlP L -H$C;" B/o0"S R<0p 4000pv(K@  0Z d` 0 0t 0000( 000t0(0?`00ܠSx0 000 0l h0 h00 0 \K/0\0 0P0 0L0 L1 \K00 WIH0 (K:edxdJf!AB@AGAAAHfd @`1<<S81ʀ !` ``&!4  4 !`!`000, !  !0(0(22(2z??P V40?P4?Ph1S d9eeāee 0-LM@0 0h0 00K0P0aPP @7t0$  $ 0 @0K0PA3XA 0-P@LT 0 3/@0 -L@`P@ P ` P00S0@0S   N  d 0-8@L0S R 2/0d d 0-0@LP 0S   ! 0d(00S R0/0/d dd -P`0@LX? P?Jfd 0-P$@LE?K0h?Jfhd qd -P`(0L@T 03/@d Zdm 0-$0L@T 0 3/@0d -LPp ` @P  p `5E40 , R @@0@0 drAd 0R 00 d P0-qpPP`LP00@T 0S 0 [0 3/0@T 0S TKhJ 0S 0 (B0 3/@脊@8AdAA 0-PL@J0T 0 0-(@L 3000KfA -PL,M@`pPvP i   0 4 K   p00 @0d@pP vN 0S 4GP40 P00 xZ?`p 44Vt 0V 440(" `!("4 (2<(24 (2@0(24 (2 0(204(0<V 440 U400(K`dd -0LA0P PtL!Qh(2  XP`0HPT 00R5dAAKf8A -LP\T`0LS@ P50UKf 0 :dEA\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -0LP0S-@p`YXW @ 00Sp0p0ɩP `@`)\0P@P0P@P T 0@0 ((0S $00(0000K0hB -`PL@P 101kl00 20 201D0S M0 !!0`1\0X0T000, !  !|KhdeeāeP L1S 4/(00S/ -PPL` @+PPh !bD010Q V@ @T Q@= -L 0-PL@.0T l0 0-@LT t0Sl02l0++|@0 p-LM 0@T P G0 ` 0Q00@ 0000x0xPt10 0卭h0 0@@ @@@0~ݡ 00KphK꼋@;e;e0uauAuhMfB`k4A 0-L8M ,00@P|`!萟0 000(P$@ @ @Pp6E/0 ,00!0 000(P$@ @ @Pp"E00 ,00!P00(P0D0$@ @0 @Pp0  E$KpMf8y4BBh4B000/ -0L@0CS0DP $`㧐(Kh袐Kh;e - L`0 0#@T 0PpW 0KhPp90S TpPt0$ R@ @T Khi;e;e(f<0 0 0 P//;e -LP t00CL 0 0#0S  PP///;e -@hPL`TdP P 1@0@S@@;e -XRLM0 L@ @b 0R * 0 j`@ 10 T R 0 < 4 @ D0 8 4 0 \ 0<00@p0#pDPf 0-80L 崞0t0@?0x00hMf0ThhMf 0 T勩hMf0 T墩hMf p-L M@`PUPUPU 0PK0% P o Kp Q-L@P& Q 'Q Q "00CSl4l4k4l4`0崱Vᰱ@0山T 40 00CR0P d 0r -L\M@P | 0 p  Dx Ic\K@PsU UlT0Ppl0 \0Xpl0 W@eP`1t0 hP W Ut0x l SP1Z# 0qPKl0h 0l0 x0h X@p0 d0 :`0 d0KL0 0H0 0JLK$JJd$K<@ 8 q LK WP,p00S@ P|0 0RS@3@f 0 p 10$01l0 0S T! R  X!0\10T1 0^00t1!  U0t1 0[/0N000 -@PLM  /㤐 堐 圐 嘐 唐 吐 匐 刐 Zh 0!04 `"08 p"0< '#0@ #0D $0H $1 0%0e< h&\0l00p0`~Bp0pdxBp0phrBp0pl|lBp0pphfBp0px0t0D1x0010,010,0'0*0C0@(R- #0b/ / A< 000 !R A1 1c5h gV1h쐄00t0h1t =C1k1d1  <[C8000 0k>1 9 &? Jp ? t R 01KJ00 4100 8100 <10 0 g KNg10S0BRS00 R*D*08410101010 "& @0 "&0 c0  ? 0`` !(0h1$Ap0pP0000(0S 0400$ t0 l  ?S Rp 0 S0i1t0j10S  b0  0& 0 A0夀p`KS đ堠 ȑ p̑ `Б ᬑ ᰑ ᴑ ḑ 쐔 쐄夠 娠 41YV p `  M$0 |01f0010 0Sh00h0100Uh00h01d1 0=l0 100S R   0%00t 0BRS00 R|*=<0 KK(11<0 }%0110K00 0X 00K001010101<f 0 J`V )؉ 0 R 0 J) 0 JK:4ad ? ` ? A\ ? X ? AT ? P !? AL ? H "? AD ? @ #? A< ? 8 ? G<&p `0 K0P 0 S=9C K =C0 0P20T2(Kȋ@@(@D@X@d@?B -LDM@QX@ @ T0 @x(Ko<@0ST0@00H0 0SP0 ^3 Z^.9>4 00  `^&040 9>`00 ^@ 040 ?00 ;9㨈~㤈1@t`0PW@0 D0 080 0L0 ?@A&K\p T80S \0AT 080 `0pS@t0S 60X00 0ΰPZ C8|4<{4D{4P{4d{4{4{4{4|4x110$P(vl0  Q10 R 0S 100Sv.KSR0尭0嫭0尭VP0妭 %p80S 00S0PP0@8P80 <0 H0X240P 00R0S* R~/ e< ~r<  400C40 \000D  X01X4p\0W8D00D0 H00hH0  L00L0 <0S pW00 8pZE0@0S @ D00bT 0L R pL0T G=009 ᴇ~㱇:<0S 0S    409 ᜇ~㙇9(K;e -LM`@pP?v010 .0Sv tv ,m0 000ï@P v 0 ^K;e -L `0B<~ 00,(`$@ @@ @40 000!|>P0t> 0<(40,(`$@ @ @4; $00!(>/.0 >0004 ,0 (` @ @4 0!= 0<0400P,(`$@ @@ @4 0!=40< 0080P,(`$@ @@ @4 0!8=/00=8400 <00P,(`$@ @ @4 0!<04P0P,(`$@ @ @E4 0!;0; 0/>@<08P4P0P,(`$@ @ @-40 400!h; 0<0800P,(`$@ @@ @40 400!:/.0:800< 0P0 ,(`$@ @ @30 400!:/0: 00< 8P00P,(`$@ @ @30 400!H: 0<0800P,(`$@ @@ @30 400!9/098 00 <00P,(`$@ @ @30 400!t90p9 0/><08P0P,(`$@ @ @30 400!(9 0<0800P,(`$@ @@ @30 400!8088 0/>@<00P,(`$@ @ @k30 400!P8/.0L800< 8P0 0P,(`$@ @ @R30 400!8 0<0800P,(`$@ @@ @;30 400!7/078 00< 0P0,(`$@ @ @"30 400!,7/0(7 00 <08P0P,(`$@ @ @ 30 400!6 0<0800P,(`$@ @@ @20 400!l60d68 0/><00P,(`$@ @ @20 400!606 0/>@<08P0P,(`$@ @ @20 400!5 0<0800P,(`$@ @@ @20 400!H5/.0@5800< 0P0 ,(`$@ @ @20 400!4/04 00< 8P00P,(`$@ @ @w2 0 400!4 0<0800P,(`$@ @@ @`2 0 400!$4/048 00 <00P,(`$@ @ @G2 0 400!303 0/><08P0P,(`$@ @ @.2 0!3 0<0804`0P,(`$@ @@ @2 0! 3038 0/>@<04`0P,(`$@ @ @2 0!2/.0200< 8P0 4`0P,(`$@ @ @1 0 400!t2 0<0800P,(`$@ @@ @1 0 400!1/018 00< 0P0,(`$@ @ @1 0 400!1/01 00 <08P0P,(`$@ @ @1 0 400!T1 0<0800P,(`$@ @@ @1 0 400!0008 0/><00P,(`$@ @ @o1 0 400!`00\0 0/>@<08PB=eB4ABZf4B$48ABB49B9B B)B2B<BjBIB6AVBbBiBAtB4}BB0P,(`$@ @ @610 000!L0L 0/>040,(`$@ @ @P10 000!0 0/>040,(`$@ @ @P 10 000!04,0/>(`0$@ @ @P0 0(K -@TA$"V ?P )@0S !|0T@V`)@0PU `0SPf)@a)T@D@ 0ѡV1T@ P@\ SRā tp SRā SRā@p @J(K8ddd9e -LMQ`@\0HSXPPE UT pWQ KuPL0 }0P;0S 0K` 0 V pK@ VX0\p  \  0K0 0  ]0P0 0 00 @000 0) 0/o"P R0 00 L 0(K 0-LM0P@ $K"P$0K 0K0 -@L@@`uPpĀ0U $Kkxd -LMQ`PU KPz0 @P  jq 喊YP @@0 נ@PR0@0@0 .0+j0K` V 0 `00 000 0\P (0@?o2P0S*0P0 妠@P!QP`@`TPV 00S.0CS`4xP @  U b@ a(K8fNB 0-<0LP  @ cUx U0=e 0 A=e0@-c ;   ! "!   !^!      !1 !( @b q,(0 0  00- @ L"U00 0 0:00/00cS 00 Q 0:C: 0/0ZU -L M@pP`hX (KJU(H%!QU1 U(  U!0( (0$( (0( 0 0 R ` 0`:C0 0:0 K -LxM@`pPU6 X1 K,(KKK0K  KUSY U 1 #0K`  !S1Pb S1! aR $ 00a$00U\ K Ke$K -0-8@LM PP ̍PK0Hd 0-@L!.  0K0hE =e 0-@PL PT 9h00l00p0000@-A@ bP\l\RA@P00@@_@\   @_RA" 0"00 -P`!YQ 1 a  0R bL@@  fR bp0 @ @ @p-,  "p  !0/ 0-$@L0SPP000HdD=e -@L$M,K,K@*@)8 0 52DRU RHD" p * 8 0 @PP8P 0P da`\<`Vn 0@S<0 08 UH0 0D0 p0" T#UP P! @Ql0S6> @0 7ZP@0 xp( '}`p W 1,#@ Sx0@ 0Wx0p ) b P Dp08 E -L`p @Pd!AT0 Dj@4@`AT o@=eD=e p-QLtMP ,@xK xK ,xKxKK/ KV`P `X00S L\,0< S;# KpBB[f[BHd@=eD=e -5L MQ`P- 4Q 4Q 4Q184Q 44Q 4V%4 000  P" 4 000 P 0\D 000P@00 o3V 3V 3V 3Vj3Vu 3VC,b`3V |3V, t h`\0S S@4C,b0VSpp`0C@VW@3@#*p`p0S SB,b0VS`0Cp@VX@3@#*, )O00,p080 0X00`00`S`V  &@PFAk,bV@b %@Pp, N00,08000X040`080%`PAH0,bS V l 0R `y@2`V  %@P h"  R@ TUP@  A R+#0S@1@!h0 XHJL@@@ KiRjR @hReR@lR 0 ,p(`$@@ @\$0 0 0!1 0'>0,p0(`$@@ @H$0 0 0!1 0'>0,p0(`$@@ @4$ 0!H1 0'> 00,p(`$@@ @ $1 00!0 0'>0,p0(`$@@ @ $ 0!0崠 0'> 00,p(`$@@ @# 0!l0,p0'>(`0$@ @ @0 #(KE BB0\fBB B\fB"Bd/B 0-@0LP4@TKT0 02000d0\f -LM0@S@1 T  pWG$Q0@z>0[oP@0EP` R>) 0,Q(pr^ P,50S(  00`rNO00` h0 00` L0v00` 00 00`Kd|d<BJBXBfB -PLp `Q@0 T 00aX00X0Q00T0?T0;0Dƒ1Q  > PP000(2S$00$0 0T @ņ>W0T 40 TTKh0Ifd 0-Lk  00Q    B ("R$  B$ @?P ; @‚!T@ RA"4 P Q0a0?o"RB  0 //(` 0L\S000X0S$07Ó7Q$0 0 \0S\  0S\\ 0 R00$07$00`0X0W= 0-X0LP0 Q 0?S0;0Cƒ1@=00T000d0If 0-L00 R m000@@f0d0/  ⳄxB -L 20CS 2$"R  -LM,0 0S0W00n KS0?03/(00CS(444444444} 0S $@@ T $@G 7S 0(0000@@+ 0-@0ML 00 00@@@@{0P 0x00@0@ @@0{PPL坽\2 42 ,,K0h&4B?eB@eD454A -H` QL[ 1BT0|@  0P8+rH?e 0-[L@BPm 0K0h|0?e -HPL`8S T0 |@  M+BH08H@Kh?e0G-H @T!T@0D0H0L000000000 Q  bpa@w@pbpawp@bpawp`\`%RR`Qq0fa`@\ `Pd0 0d00QQQQ(Q,100Q4Q8Q̠ TP00000 -@LJP`@T o 4A p-L M`P@K`$ @   `Kp -@LMYHP0 (q40 00 ,0 (0  L `"   ㌑$`K`   0@\$0(0,0004` $pK`' 8p  4K`0aa 8aa`02 Sb0!!!!!!!! $K茌@ p-LM`P0A`+,Kq?41($0 `LKPC0U@0 00<0 x0040 ɋ<00 ,P P ( 0$0 E d0LK8 ; Kp 0-d0 L1d00t0000@00d0 K0h蚑0 -T1LpQ0At0Sd0S 2d0(%0S` V 0 {4a-d0S`AP 0Sd0St0S d0S00C00(0  $Kkd@e@H0JS 2<  < 8  8 4  4 00000 <0@  80<  408 040 D 00000 @P*$04$0#Y D2 !h  0 ]v  l T X0 > @10S3/P @PX H02S S !x0Sڈ01 h  l 0 $>@d01d0!@ᔁ(K@e@ -P@0 H`L{pAd"001001 0010010  E2 1!U ( !02$Kk|ꌌ@ 0-@P0Lx ({x y K0hBB -LM0APd0p  g$08$0` Tپ  L%z!% :d0$`V HV$08$0?7$0q4a0S 0 00堎  I00C0.000 p@0X`qd1% 03/0`S P {k?V0 `x dzTx z Vd02d0d0 :d0íBB@d@ҍ@ -L4Mt1`Ap!0Q唁R H0p!u2kX021S `1P 0 \K@PK1儁00  \KoP  \KJ 0\K렀0S P 1dZ \0K :/0S \0K  BY \K^(Kd\f 0-x0L !@0!H " R ,5,5H5H5<00S K0h/K0hxd@\fB 0-Ppt0d0L1d0>`0S 00C0@T H(0S0S V $0  `(p000.4A 0-\0LP10A 0x0Sh03h0 >`dQ K0hd$ t0 l  ?S Rp 0S/ -L@` pPU W0P00P`0 R 00@`  000/0Q0S/ S  0 0 0!< 0`4 0 ,   !/deeāe -`@ LP@A @T00/ - 0@R000 L 0$ 00 $ 00 (Q(RR 0(Kh;t0\ 0 b`00`00 `)s00(0P9KhE@d0If 0-LLA  0( <00\0K0h0d0If -x1xaLQ0Sp fW= $0 G$ 40$0@2 XP- <TppW $@冇@D 0q B@P 01 W@P 01HB0@@ 0S 'X a( X@|(P #@d\f@ -P@`pLQ 0ȀS-@T$Kk 0-P@LU K0h0 0-@LPS0U 0SK0hK0h躷 - L@`Q`Uʀ0!`` 0X T   !TV ^deeāe0t0| xR  0-PL@0T >0\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -P`L@T 0SP00:#003/0:#0$. 0.! 0!X@d -pP0LAbP 000(pd -L Mp `Py @0Y*0PYMv0C# z?@d l0 \P0 H x 0'#p qaQ(KD\fdBX#5 - P0L`0P \x00S 0h 묇000J 0 800@KhWd9e%5ZBD\f# 0#/ -P@Lb 00XP(0'Kh3 -x@P$ML40 `@0000 0p000p 00 00 00000000噲P ov0d0 0 ov  x0P0l0d 0 _v@ 80P0 04"  (KobB@5lBfBmAB -QL` tAR  @+D40 ,@Pv1@p0 g`| 0 bv 0 o0 j0pV U Pz?  z<<x0PS* 0R SB"   $Kk} 00|D\fddBx@:BB@ACB<80! 0R^ 0 d!/d -x0L`P@0  p  0*  @X @R X Khd Q Zd0 D\f -P L0   x  uudB -L M0A P`p(000 p0倐40 0p01@0(20S 0000  000  0040(p0(Kod//// 0-P$@L 0<N0@0S J000$08$00$00€0S 0(0Khs(RR 0( ` P$0(0P0KhgXB - aLqպ1@T/ `0S@ ʺ`00"t R  BR  00t0PU 1U F$ 38$0(0S 04Q ,@场Khغ@800 0sP3`   0 4 S *  P00 0  04`00V40P0 ' `8 0 /0 0`.00`0 Q*8 P@R `00R*8  P08080U  4 0R` 0 `40K040j0 @p000 4 0 U0 4 . ;0P 0B`0 00``@`0 c0+- W.0P@4 Q8 R  `` 0R*8! P`0  R 0S S\0[00 S \000%K#\ ;00 D0H0080P0S@0(  S( P00 00 00(KqBXdBb -LMP0 `4S $Y 40 0?"'000 '40 0  0 00 uP '0 0S 00000 00S:  R0  0000 00`@00S8PPX0@S`(KXd9 B -L$M`PQp 04S c-00K0 0s H@T'P" P/00V+1S(0S i5h5h5i5h5,i5@Wx@ Wl@ d@-P@L@00 `0 Pp 0 4/(K` Bj5P5 Z5`5]5k5 -LTM0 `VPX0  0B S< XKP 4T@K!XpP,00S 000@00 0X0Kl@V  XKT @T0S XW 3# K\f -LMp04SP`@ c3T1 0`0S0V0S)`0 KP#U -0 0 K0Kp P0HpW  0 0 @`0`0 0 07/(K B -LtMP0$Rp @` bm0SjQg0sd00 0K0K PZd0SV@ "( P S  PQ ( SF011H R@ ,0Kd # dppB!NP@0p 4@800 p`04 R#80S  P @D RT0`00 0S X_Y`0 |P ``Y i`Ip0X(K B -LWMd1 0R` ph1  `VBbv`d1S0d!0Qn0 404`1S,0\1 0X1 XQ YX  \1 \! P,0K 1u Q 0s Kl1 P@l1?N?@E@CuPP PE, K !  1(0W 0 @ @ @    W W W$h10000K꼀 h1开 0 $00 @`p0@ @ 0 SK,0KV/K(a#  Pq @P  K(aXT1pK0 @`p>K K P@0K5'PD0 R0 sRP`1 RSPPd1SPU ,0KV/K(a#SK S@P0 TXA 4\8`0`p`W  RX1 `1RX STa p|PU_PPx @ZPvo@ (00 0`1pP0QP R000pP R0Q P0S` ?aL  P0G/KpS0`1 0 R!h! 0P∐`1  h!'`1!((.X`1  00 0 0 R 0W0C 0GK q 00C 0  ! 01QB  (  d1ST1d!00S$ TQX0S 0X0 #`ΦpP  '0Xp70T  K8` `@(K B B B BK B --L0M0 00 @ T?p 0 0$ K!0s j $0KPD #pK K  W@P QTR`㄀K `开 @'40 $0K0   $0K@# @`p)BP@2 84P @ \ 0` `VP 0P S0  XP X00SQ# =PP 0 XP'0 XP' $K -`L$ 1V`04S8@P`p &`6  `0#`@4 8`0D"S *` Q0Q 8P@PT8P 00S`@0P 0P 0400080P0SV$Kk]fXdy B -P@0 L_ pa0Wt0 T t@h_T@ P_@@_@0@D_p`Kh_ B BAeAC@ B -LMPJ @TG 匐K`  V& 0 S3P ! 0 0` PqF1d  0 40 00 0K00K= P010 P,0Kd # ` P 0` `xv0 0+(K]f -L$M` PS00 p00 ,@K400 0 00 0p0m@?oV20S 0@X @3@#U000(K -pL\`@P!_0WS T @00R01 )@00- B@-Q@pppw@(-/0 R  0/ 0@-@ 0UT   0 @  0 0  0/ʚ;  0/@B 0/0_f 0-@P0L3/0c00 0-h0L@P\ 0 R @!QP @$03/03/@0d 0-@Pp`DML!l10p,`0(P00K$@ @@ @P +00SG 4p0`0 ,00!1 000(P0$@ @ @004p0`0 ,0@0$00'!0 000(P0 @ @004p0`0 ,0\0(P$@ 00!H0@ @000 0(K B85 B~5 B4_f B -LMtQ@K`@ 0 0K` #%@p0 0 000 00\@ Lp 000oᨂPX4 P. 0S0 R  0 oP pW ^#`P$p03/03/@p@0S)(Kdd8_f -LM0 S@Q=Ѭ P0p`@?oT20S) VpP" ! 0 K0000pd^Z  0h0 KZH奬 0S0@`Ppc$@ڬ P(K8_f0_fd mA BA -L,MpH`T@P0PpD0 z P n$0PS@p  03/@ !%<# QP"0S 3/.0QP   0 W P0W(Kdd -@LM$K$KK -@LM$K$KK 0-@LK0h@_f -@LM$K$KK -@LM$K$KK0@-(PP@ 0T P0T0d -`,pL@PP sU P0Ud -`,pL@PP jU P0Ud0@-4PP@ 0T P0T  0@7d@_f0@-(PP@@0T P0T0d0@-(PP@00T P0T0d -LM@a 0B! 0 *1P0P0 S 0 00]] S  0 0]P0 @$   PR0R !SR03/03/@G(Khd0% BT BHf| B0_fd8_f c0-0L KhYP_f -LP巪!@0S S $ $0$ S P` 0p000 0ڪ0 gmm只0@T "?o2U0S$AĪT D00"*0 (8_fd0_f@l0'x0LK &Kx0؀$KR SRK*$K R0$K$KKR 0$K%KR0%K 0%K 0 %KKp -`P?o@2!P@@TLp<PyP$巢岢`_f -L$M@4 K0P 4K K -01PL`Ep?o2!P@@TDPG1S,兢0 S 00~`_f p-QL$M`P@!*0S PP 0! <Ks"K!$ #K 4 NKp`_f 0-L M@0Q 4K4 KP 4K⥻K0 0-LPhF 0@   S@ߡ0S@(0H0h`f`_f -QL M@p%00aPUPF RW  (:/P( RR ,  B>R\aHZ PN@嚡 0 $R  ^ Q0 ̡FH#6Q0 W  T(   T  , 0p, tpppl x 0x 'a|0 @@D 0 T`pp pXpp,@K 4$ 甡 (Kp_f`_f -LM0p K -LMpYP `Y`PPܐ!0 0SYq 01SlY &0AT,U P|F P (  GR0p@夠pp@@@0 @0W 5 555   , Q@PϠPTQPX $0 H W W<KV<K#K4 X00X X0SH  X = U oG(K`_fp_fɚ;6e -L(MPpU`@0T0S DK*P  LKLP H0 PT D KC$K -@LPT` TrV` `p4"\0\0 0S0S=`pqU 0\ X0`p^1`ep6X% 0%^X 0%h10X000S0@S eX R1#e(6,0X  RX X R 0 0 `$V 0S h0S 0S 0S 0S0(*($KkF $Kk!`_fɚ;6eh`f 0-01L@0PS% Ο01@T U PU h00P@T 400P K0h0`_fd0@-8P@ T0 R000 -PL`@ጟ0V ʟ -2LQ 0@|PP```Qo 0  0  bRGR RC RC#   R RC RC#   R RC400<RC80#<<< 010R0 RC400<RC80#<<< 01 " 0"0 p0 00Y7/ PR  P000$KkCd -0 L@pP  0   aR 0  d00`00d0@d@$Kk `U0  0 0 0`P `0 0 00d00`00d0@d@d -L{80 `` d +h Rhl00`afd -LM@`T 8@Z0-``0d0( h0000S 0P"P](p/0l "P 4PpL0x*0D P P(0@m*@K褵5Xfy B B B B 00 , 0  !$00/d`af00/ -L@Pp` p `Kh1 0-LP@ K0h% 0-@L00    0#Q000P T@R0 -@L Mpq0# 0    0000aP0T,0V) W /- 00 0$ 0$l000 pܝ W 0T0T p2pX  (Kd d B -L@`P` PKh 0-@L@$A@0 0-@L 0@@ܝ0 0-@L@ӝ@@0 0-@L@ȝA@0 0-@L000K0h蹝 -1L@o0`P00!h \ dhdlPldhlP@Chȑ, !\ dhȑdlȑPlȑdh(l(P*C!*h \ dhdlPldhlP#`pP8 003/PTP1 V vH(Pp`Y P PY a0, R,P(p 0 0( W(pY K 0R Dp @P $2S d@He B -L M PQ?000 ,0@Sp`& 0Q,   Z R T0P0000(Q  ZX  V0 `F00 (Kod@He -Lޛ@M B0 R uL/xe B 0-LM PR 2/P10<0  ? (0S$ $K3/@P0[0C S0[0CS0[S0[;S0[<S$KTL00@ <0P0K0d -L4MKP0 00TKL%KP0 lL0d"#K 010K0<K4K3K00K/0KLK4RP0S   %K<K @PcKw? R0K@+%KV%K/ P!g? R000S%KV0!0' 0xK`  0`M`@0 <KV X44K%K#K040 00#K$K?4 Q`qD0 `Wʀ 0! `! 0    !LKR 0!!`q0    !@\K(Kf . Bxe B> BQ] B| B B Bdeeāe B -LMP@U ,K0<0"K R?"K 5/0S `P0 <0`V 80R`p, KL0,K3/Kd -LMH@0S $K"K0 P $KP $KKxeB -pP L0 0a@T 0W@U m4Uf4P CV`f -LDM 1Q0@P @1*pl0d!(0 0 40K0,p$@ @@ @`w 0!14 K0,00K(p$@ @ @@d 0!04 K0,00K(p$@ @ @@S 0!04 K0,00K(p$@ @ @@B 0!T0,(p0$@ @ @@00K4 K1(Kdf!B`5)B1B8BbB -`p@LM0 P Pㄡ  @K` n0K\0 05Y;h0\ 0 0 0@ 0 000000 0@T(K<@ 0-@LK0h 0-@L K0h -@pL@dP` QP00T00S d`4!M!Ѝ/0M0004  Ѝ/ 0-LMP0E S#*@R$K31[ :#:91K0[$K@0<<0K媲P@UK0 0-PLPEU@20T:#:90D0T@0<<0D0 -L(M0$00 0 00 00 00 00 0 00000000 nJ K@B -L(M &4K4K I KQzA -L M @K !  0 "$  "$    @ RK 0-P@LM Kt0000K00K1[000K00K1[0000 @  S K0 0-LMP@ Kb8"8#4b4#0! K.+000 P  U K0 0-P@LM K/ b8"8#4b4#0000 P  S K0 -0ML00 @ Z0P    K PK K -L M@01`kk$NuPpU0B03/0R PP0B0  3/0R0 } (K -L M@01`kk$NuPpU0B03/0R LPP0B0  3/0R0 I (K/h0S/011t0?aQ/00/ 0-PL@ኗ0T ȗ0 -@0`pL!DM,PK@%(0 000,$@ @a@ @ 00S) 0 V0 0 00,(00$@0a0@ @\0,(0P0$@ @00a0 @0 (KE Bd@Je FB)B5qB -LMp0@0PP`??|0K ` 0 KL 0 0 000000xK@Jed -@P0 LMH"KPU Td"K PE$Kx h p  Q R/h R/R 4 4 4   4  4 /@Jed -(0L@ CSR0SX0P L0\Ql 0 KhD9f/ 0- L@R@0 B 0SK0h0D9f 0-@LT 崖4A0 0-h0L@S 0; S :#0K0h螖0000000/He -`0LP @I0 @0p b0S`9`0S @0f P #n KhjD9fHe//00/ 0-00PAL0 00K0hSd/// -L M 0Y`pP0P 4 00 :/@P004  H09/<FQPV 58/(KX6P6vBC@ -LM!Pp0 P`GU3 @!Q 80 4 :/PP4 80 0P 0嗍V 40V0  ($Kk.>f@eHfBRzA mAB$0$$08S 0  zHf,5ff 0-@LPH*T 0T 0AT (0@@]0Je -L Kh~ 0-L@XP K0h04 / 0-40L@00S40040L0S 3/P0 0-40L@  00S40040P0S 3/P0T0S //T040LP 040/ 0-@PL0P0L᲌40`0400S "RD @ R0 (0SKhٌG @I 0-L@ P X0S K0h/0X/ -`L@zp40P 0Sژ!Q 0 00oQ| th00C0\ P`Q@ 00(01&-0S@ጌdq @s w 0-@PL;00CS00Q 7K0ho Ž@/\/ 0-40L@ 0S 00S40 040`0S 3/P0 0-4 L@  0S40 040d0S 3/P00h0S //d00\` h00l0/ l00-SL@ 3/0\0`0d0l00p/ 0-4 L@ 0S 40040t0S 3/P00 0-40L@ 0 00S 40040x0S 3/P0x00pt |0/ |00-SL@ 3/0p0t0x0|00 -PDL`P@ D0T*H01S 3/@ -H` 0DPLS  P 0 A%0pS!!0 @D0 S!702:DHpU % -`@HPDpLT 1S1G S @ R  @T: T lD@H@Khh%01 -@LQ L`@000000!@ @T! T%\ HSR3Q SR*HSR3Q\SR: I8$Kk0P 0P Je 0-@L彊0 0S S SP(P$PP0S PP00C00 RPP000 0R0 R̊0Je -PL`@P P @ 0-0L@SO00K0h -AOL0|P0St PPP`  P<(P8<@,<HfQBAA 0-@LK0hm 0-<@PL*PU000C0C00K0haJe p-LM`4KPP 0 R R0@P4K?@4KTh0 \p=P V R  0$KpeaB p-LMP`4KP@  U 4K @P 4KKp -LMp<KP@T# T ` W  `P4` 040 0S 03/P U4`<K@<K_$K 0-LMP,KKP@  P ,K,KFK0 -LM`@ #0` T ! 4K$P@ 0$0SP4KpP 0 $03/<P0S4K Ke 0-L M0p0 `"@P"@0 LPP 0 0ht0@P pH0 8p5p,0  KA85855H5|B -L Mp`@P#@0 PP tP h:PP0\ \@P 0 0,<0]P KBH55B8585B0/ P-L $o/0@-^$ RP 0|@ 5S0\4C0200 R @b<4P000 T0 B 0 - QL M@0 `T1T00!Rp#H140 00Z V :T0 `eV T0 `T0A040pZ !(K -LMP @RJ R#b!r0 "b0   R | 0W  `` 00G40 0Z$0s! UW X40 0 0p 0Pe0PUP5V*49000UPEP(KB -L b1 a<0 9 00B -L$MP" `RpUPPT P ~    SD *0  0T9#BiR됔# 0 !8 0 傡 H< 0 R( S%* g4  U1r|59X  0<0 00 0 Pi pR0500000 8040(KBVB b1 a0-0 RB  -L$MR`p P0YRdG S#R"180 0   R | 8Y  PP 0j됥# 0 !4  I@@ Y$ 4008 @ 000 40pj 040 <00 R  S * h<  W1rD800d00@0 004(KBB -pP `LVP2b1R1:'!0@ p`PJ!0A 0-@L !K0h! 0-LM@PP 0 S   _p  e K0 0-LM@PP 0 S  K0 -LM Rp@00 P`v V@D T00U0S= 4  @0S2 RR(Ko00"B`#180 0J40 0 00Y0S 0s U:@40 PdP40 P80p `(K -L M@P 0 S 00` 0K -L Mp@P`T@!@ vX R dU Ki( 0-L@PPT0@@0\ ᑟP 0 -0LMP$@K0$0`̀pW 0 P!0 Pph(0S 0 0@00 0(0P (00$Ke mAAЈA -@P`pDML 傅 ,0K@# 0,(P$@ @a@ @P p 00S 400 ,0L0(P$@0@0 @a00 @00(KhfBlfH6B -@P,`LQ 0 P@ 卅hfe 0-@L\@ PU H~P < 0T00  T0  n0hfe -ML M0P0 ` Sd<`\q\P1@T U oP X  Q@  U@@@BK+ @zBK+ @h,BK @ Y X6PPU T @ 04`03/(KBdhfeBB0/0/0/0/ 0-@PL0P $ P v0 0-@ 0-L(M@ S 00^ᇚh0101D0\8<0K40 08 P$ 00 (0< 4KD0BK 0 K0$k>dd 0-L(M S! 0@0T Wl0101D0^ !<0K40 0@P00 0 008 $ D0 4K< BK0 K0$k>dd -pPLW7 P3 `@T0``0C0 0W@1R 040 90S0    oP0pd0000d000d0  0 $k>d-@T0 pUTT#*d/ p-L M@ KP`kP0 5@ Kp p-L M@ KP`UP0 O@ KpP  dP  u/ /////,/Q :Q  4@o/49@o/4/4!@o/<0/P8/@/ -0LoP@- 00 0S@ P000QD0@0 0 S Q000DeHeee M~ꀂf -LM40 p4 0RP@0 0 tA~p4p$`< P80 Z7Q 00P P R R R_P[RXX PVRQQPLX00 40 1xE~00XB 0Sh#h3T#0S !R  VS  000 S.R S  P b!<02 0Q@@d~00Sl"l2L"0< P8 S !R R`S  000 Sz.gQ S  P^ a!w<01 0QU@P4X<0 < 0UP$ P!`P40`F<0  E<0 P  00/ `P 0ȯ080T0`800P0000s}0 @l @g(K耂f e eHeeDe@@YBe@@tB e -P`$@L}L}耂f0 QP 000 P00//DeHe0 QP 000 P00//ee80 400S\ 0//DeHe80 400S\ 0//ee 0-@L|T00T 001S 0 00 t|00 T  R 0S H S< AT@@|0耂fDeHe e eee 0-@PLXt| P0L00R0 T@  @|00耂f e e 0-@PLXT| P0L00R0 T@  @|00耂f e e -L MpP@? P0|0 U  `V. 00  P00# RPU0 B R|00U`K|d001S T  0@0D:|P(K耂f e eDeHe -L MpP@? P{0 U  `V. 00  XP00# RPU0 B R|00U`{d001S T  ɩ0@0D{P(K耂f e eee 0-4QL@P({$1%T0U 101S 1 00 {00 U  R#\ 00\00 1S $:@:#F0_&0@4P`,<0 ,@ $P @@P{0fee e eDeHe 0-4QL@P(9{$1%T0U 101S 1 00 j{00 U  R#\ 00\00 1S $:@:#F0_&0@4P`,<0 ,@ $P @@P6{0fDeHe e eee -@PL\pz`8{V 0 $Kk/耂f -L@P`pP 0 $Kk/ 0-@LP000$00 00K0h/e -L@P`pP  0 $Kk/ -L@P`pyP  0$Kk/ -LhP -L`P 0-L@PWP 0S K0h/0 -L@ԀP`pCP  0$Kk/ -@PL\p3z>`8pzV 0 $Kk/耂f -L@P`p$P 0 $Kk/ -L@P`pP 0 Kh/ -L@P`pP 0 Kh/ -L@P`pP 0 $Kk/ 0-L@PP 0K0h/0 0-L@PP 0S K0h/0 -L@P`pP 0 Kh/ -L@P`pP   0$Kk/ -L@P`P $0 Kh/ -L@ԀP`psP ( 0$Kk/ -LbP, -LZP,/0S 0 0:/ -L$M`(, p!pI၆Aa0P(0⠡ 8 40 唡+408  | p :/##K$0 S#KP:/W#K ?4#K:/$00CσS0Ġ ? 0:/U2 W$ (0R,cKB08 `p0` :/8 0 ,@`pP 0 0   08(Ko/(KP6@@6BJ2BBBBBBB -L P 0S -@L`P `xl x0t0p0P0 0T0`\P 0-@Lf  j X0 -`lPL@pnxHQ@ @ T 4/@x 0-@LXo P 0 0f K0h 0-@Ll@x`K0hAB @@0,p0(`$ @J0 00!0 000'>,p0(`0$ @5`0 00!\0,p(`0P0$ @0'>0 0 (K衹A6,AeH{6EB}6(6B 0-LGM@!< K0MKL1P-@G 8a K=H0|0 P0x0 h0t0 p0p0 0l0 0h0 #(K"&K"%K" 0)K#%K$$K$ 0(K0 D0 0@0 0K<0 080 040 000 00 堅P0pe00@唘 (K蠃ffe -L$M`@p"0P@0K0H0 U! Z0S'W@@  @KUV 0  @KH@0K˙0@K00K R`0 @KS0Pp@f`PH0 HH0@(K褃fe RP // RP // -L 0- 1L@S  1S 0 0 10^>$ 1  S//1S/0^> -LMP`ASpQ03/(Q 0<0 000 08KD` 80 D0K40 @@ V8K6p& 1Q   013/ @Q 1 ;(Kd60R !##F0 !10S/ B0F010S/ : 0-L,0@Q 0 K0hd^> 13/  -P@L Mk0 S6` 1p`00 ܠX0ʀ !` , !! 40   ! !40`1000  !01000(Ko苌Oedeāee -LM`P (pN@@_뀐N@ @ `l $0K( #RPD D "/"(P ,0@$KOe9ed46 -`@ML@ _ 00   0ZKOeh6B 0-@ 0LP  0Oe 0 Oe 0-@Li0 0d٣寋Oe Oe 1/ -P`L@  4/Khd 0-LMP,0K( @ K0Oe (6T0 0e -LM  T$0K*xP Ke -LM`p0p+T@@ T @ Q @p0h [@ @PT RT00X P 8P0h $ KABB -LM  T$0K*P K`4fT0 0`4f 0-L@M0K #0,(<4@P$  A ,K0\65B -LPM|B0R01 P 000 CK0`p@1 1!T~ 10Y{ hCKT0 0.Kl0p  0/K0 /K0< .K0D -K0H -K0L ,K08 ,K00 +K04 +K0 *K0 *K0 )K0 )K0 (K0 cK(K0 cK'K^) !?'K0 $K1o1 1\ X K 0#K#K 0#KgKfKfKeKeKdKdK0 CKP@ {10(K$e 0-P@LT 0! 5/@0B\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -@L`P]00p0!00P0   S<<< S8@08A?@Q 0 SS@`fpf -LM@p`  0 P zXPP )#KW΄! #KSRX  R 8! 8! !. -L M4 !P0 ∁@iT@h!+Rx@ WVT   !  WP aW΅ WV WT T@T 8A8Q@^ }W>CC tW0k4  Q<<@(KdXf -@`tpLW00 1 100 1 010 pR!U`tPU hhPPx0P0@0x00SHNU@ K0P00@00te%5`fpfddf$e -L$MP`dp@P 0 00000 0 000000o KPf 0-LPdT`0t@T D1H0D1 UY,TD1(0CD1z@K0hTf$ef -0L@0Sژ00S0 xs PT0pa101<181@1Tur$Kkm9e9e6 -LM`0@S d3/P tpUP'0$`K0&0吀 PQ 8 00R0| 0cS:< D00b, S: m T(0S (K$Kd$e -@L`7TP0 ;S@R@ 0T08Q ;P0L0P0aTPP,TP0,0CP0TTV@fXf$ef -L -@LSD1S ` 0R 0tPx00 poo *T2S00"TᏏPU Q 00 Q 00=U ,VS$KkGf$eXf@f 0-@LK0hpPf`d / -LMp`@Pᔀ0p00 R BT1 0( 0  0   Q0 `0( KP( Kd -L`Pp@ᄀ0p00 R * Pp  0 $Kk \05 5: Pd -1`0L@S 0P V00S 0`VP000p  >>PW 0 V   T T00T00S W 80T0?o20S 00Kh/,pP@7p @@p@p@  P@0'@P0"5h0    p  @@p@p@@@P0 0`00L LR kƣRQD0K0B S S1 D0K0t0d0  P@0  c0R  R0 0C &d0U T0Cd0  0d00   0@Pd 0@@B D0K0h  % c$".@P t L@ cL Y p ,0Kc@L L T Xd   d  d \X dSQ PUX   al l RP R Z ` HZ # 3Q R  H P x0 x0l  BX P RZ7` HZ # 3Q R,,l0 H P% P RZ H `/o"Z!3Q 0 H P0l0 H Pl0` Q R  U0\ dPaUP R Z ` HZ # 3Q RH P0l0 l0PE0PL @bTP R Z ` HZ # 3Q RPH P0l0 l0@DL @S P R Z ` HZ # 3Q R  H PL0 L00d P\0d @bT^P0S Z `0H Z0#03R0SPH P b@Dp0SH0 003/X(KP@a@WBe --LM0@ @@ 000S@ @ K f --LML0101l  1 0S 000  0 Kd --LML0101l  1 0S 000  0 Kd --LM00 0 0 K --LM>00 00 = K --LM-00 00 }, K --LM00 00 l00SR KKD@ 0-@L*K0h- --@LM0@ @@ l000S@ @ bLK f0Q  BB p-`LM@P 0P A000S   7!Kp f -0-LM@P@P 0S g9P P@v0 0 00K0 0--LM00 00  K p-L Md0@0P` T 0@ 00` KphKpHfA --LM  K --L M00   K --L M  K -LMPx0`0p@@WU 0P D0 pP$00SKhKHfAdP KK2[ p&KrKGeP$K 0-d@P0ML@PD00P00 P 0PuK 0 00 K0PeBuA 0-L@ 000 0-@L K0h - 1L@PU=00S  0 0`100  5KPD00D0@0D@00mKU0 x0p  TK PP (  0@A RK00d 0p-P@`LM00(@ $P Q 0K ( KPK (KW 0[S mI I0Kp9eP 7,/0 1\S/ / 0-L @BI000 -LB -@RL``7I 0SpP U !R Ppm Q PQ  cP0 00 0aTIP87 -P`LI0S@ p T 0V* @ 0AKh4I 0-@L@ H0 -PL`H@T 00HP0 pS   0U* iPIKh -`PL@HP@ 0S@ @HP/0S / -L M`P00 H@pT 0SIHH@X:H )0140 @xH@T X *00A0HH4 ! R !N00q0 R    HHT (Ko00A0(KoH(KB -`V0L!V0 P x0Vp0pPPEP  X0@P 40@ Pcd@Bd -L$M$@K4K˜"KKR, 0K0bS0 P=9K =0 K -LM !Kצ K K -L$M$@K4K␜K"K R0,"K`Q  R0"K000 Kʚ; -L$M$@K4K<K"K R0,"K`Q  R0"K000 Kʚ;`0Q R 00R0S ,00Q0//<//?Bdh0Q R 00R0S 40 ?Q0//<//ɚ;d 0-LP@P@0 p-@PLM,`K՛ 0 0| 0Sl   "KP$ 00bS0P,   ;Kpɚ;6eʚ; -LM`p% 0RBGT0"!0 4P Q40Z$ ЏO,KBG1 0000 P `P Ab10 FV  7P #GLX0`@ P@G @ P#K 0P0@ UT+ a ??ᜀ!@T PUT ݼ0 UTϠ !Ҽ0l !ʼV Vؚ(KK7A@ 0K # `00R 0S =?>5 Kp67d -L Pp0 ` F`@`@ P l0P0 PD00 PP@P |dd 0-PL@>000PPK0h> -Lv>|Pt@0S "QPX(HP04`0>6/[>" 0"QedQed 0-P@LP0XT3/@H>& 0SR&D K0h}>QeQe -LM@`Pp.>Ѐ""KK"QP  W`P@ 0(4 "K 0"0x 0  0,"K 0"0x0xB?>$KQed 0@-LS<70<7<7(<7   B -LM0k?0h0 ``0 0K00`00>.`P l{ :L0S :p / `LP,`Pq:0U :0 (0?0t0e 0: :KBBdxE7 -LDMX2X`0 0Spq82@ 1lK0ARPL0?S{P0Sx d0Ss `0SpY XP P PiLPUa  :$0S H WL0Z:SW:V $0P80 0@ lKL 0 @ 0r'zW0 K W  *O@P   >  $ 00  @ 4/@P  >   $P@Y  V񟗣\Z7Z7Z70[7<[7X\7\7\7\7\7\7\7TZ7Z7[700@S\*@20\:@0 K %0@m1 10  @n#0000 S Mu@@^ 00C 1,`K 00& 0 03/@PM0  " 0, K0" 0,03/pP0@ 0, K@00" 003/pP 0 0 00 003/ 0  03/@ 0  00 0 0 Kt03/@00 0, KP0" 003/@@;@(Kd~f}f3{f@|f 0-L@NP p0 0 0-LP@?0P 003/@0 0 -LM@KP K7OK -PL@`P (00CS^7^7^74^7-@ 0S<@0 ^@@ -L M@P 6 (0S -/0 `1K0#K"K0S S S p rKᅒ 0 040K0 2KP 000 040K/@K -LM@0 ` T0f 1 R 0R0_@ P@Q P V (P @P@-@I0FS0t00S `BVT`7T`7T`7x`7`7a7@2@0 40,`5&@T P@ 0q p0` P` p`pV 0@V0P 40@0 0@@ (K -LM0@0! yK c 0-LM@P bP 0 0 0K0 )NPK0 -L0MpD D K<  P8 0U`101@P ,P D0( @$0 ! 0 @< K04/@P,  U tT00#T0S@D0Pb0S @0 p 0PKd\f p-LM@P`P 00`  Kp -L|MR`  PP 0~Z (0St0S| 00 @Pu0剁|Y Y@l,0pl0K 0 uL@P0` Tp0|!` 刐 !x0 |0 0!D t Y |  | Q?R=0`$1 0 R` CpP  `ᝫ 0  @ K0|4/@P|0 Y tT  #T R@ 0cV0  R @ p@W @ (Kd\f -0ML0 0Q K -L0MPH0 L0KD0 0a@0 00 1U01pD0L 4P ,0 @2 0 @D K04/@P 40U tT00#T0S@  T  0lp/31 0gl340PcD00S @0 o 0P$Kd@ K -LM01P`0 P  0 @f p00,($@@ @}0 0 0!1 0'>0,0($@@ @}0 0 0!X1 0'>0,0($@@ @} 0 0 0! 1 0'>0,0($@@ @} 0!0p 0'>0,0($@ p@ @};u`P @ \\v@@(KB|dReRe fBBB@eBBBB@s7A Q' 0 `Re -@PLBoP 0R00 PUP 0 T .zKh -`0PL1p0a.00CS@ @0$N@.T P⹋d -L M@p 0` mLPP6}.j@PpP( PP0 P p. P1S!!1! pW 02 0 0w T s .(.0o KSe -L@P`P (0SU 0@*.@ -LMpPP4 K@P ! 0KFP00S,00C>S04`S@ 0S@ 0Kx01048.mK 0-LM@( KP (P $Kѥ!.V $KGK0 0-LM@ $KfFP( K$PP0S ( $K⮥( 0000--Q  $K_GK0 -L$M01@ 80 p0` KPP4K0KPP 00(    8# <<0 T 0!$3PPP#*Q 8 W@  RR R0R0 0z@ W-0j/ 0S0 T 0W`0  7,2 0$0?(0$2 0 0@0!2 0 L1@@0 )-@0pP @d-  _-P\00 0000PF K- PH< R@D-PA<0 80Ppᇞ! P<0P@5-1vo᪁rτn0pSk/1@!@-`04 8p4 0 T V (KP@0 00-4 08'8@@eB Bo ReSe p-LMP@ ` P  ,K9EP,KAKp -LM4 Kp@IPPy4nD4`(0 SR,0S% T 00K P 0@ 040 2 0 0P"  #P<#P*4@T1  c0?o0c 0A0P00 R4 01S1 B"!,00C,04 TS (P@4m, U 0  E?oW20SP   EP-(K -LM0K000@iP00K 0-L M@PP  $KDP$K(0K QP(00K0 -LLM83p RP0W S: Y 2 @ ZD0Ph0   hp ` K q`P`rlW(`w `P(0W(`hpq, $0R! 0S \0K P 0\0 `\ P 0 #P<#`pKX `  0hh! @` 1@1ᨁ` 0S PJ00000@@, Rp`0pW px Rp 0 \Kh0 h0| P  L < 匀,0`0,0` A0V `s+ V G W X@"+ \K__+( 0  @@(K@eRe@W0S $0 B e* @P$  @P @P $ $00(0S @ C* 0-P0AL )PP 3*06 ,*0 0-@0QL )@P *0$0$$ ( R @ @<@ *0 p-L M@P0a )0 K@ )TQ  KWC@Kp -L0M@p?T`$0 LK0Q/0<0 x0@@ 40 H0``0 0 ) ) =P@ T LK[@ ))K@ PAPQ 0(T 1d p-LM0`P1VLa0A '`P (PQ,K  ,KOZ (0,KEKpd -L M0@0KP K[AK// -L@X` 0qDP '$F0S@ 'T @P0S e-D 000/ Q 0CSr// 0-PL@^'0T '0 0-@p`@ML! $PK@%(00p,`$@ @@ @ u(0S( 0 00!0'.0000,p (`0 $@ @u 0!T0,p(`0H0$@ @00 @00 u$K Bf7 B7,A -LMPps C0 `&0㨀 S* @!R 04K+4K_Y0T!'ĚU@ T 1@P@fs K B9ef$ B -pLM`K@@(Kd9e@@@@Y 0$00QE0!000 $(K9edf@ #W: 00S0S <K0PX0 P`@j# 0h RT1S@#pS@#:TQl`pT#0W #@n808 E\X\\pP (Kd@Sehe1 B -LMQ t1p1 210Q``@>@BBAWPKaPZ   ;0PN ᪚Y   ;0PA រ0X 0  ;0P400 0 00000/oZ" R0 0 <0/oY" R  <0/oX" R  u<0 KU 0 0(Kd p-L4M@P`  <KC;PSpPH0 ,0K #U0A@0  * VH‰:0S0S`0 H3 l0 03Q +0S 3  l0 00S L10 R5yy phpx?o20S k0(xP h0WtP SP tPWPE0Pp 0P 00 P00 t0hpU 003/C4A0 00 I00Z(K@ 0-P@LP ;P0^: 0-P@L ᙑ90 00,03/P20 0-2LPQ@b 1Q^ 0CQ@ 0Q0[ \1Q6 1Q1#30Q R1Q 1QD 1Q< G1Q8 x1Q5 p1Q>0S1::1&0!S0 0 0!!00t R:0S*00 `0aR 0 TK0h TK0h0!40iS 0\0 0(0@01K0h/0 s@{f@f@s@}fwt@|fsvt~f|ed -dLPP@`S0  b?" 1R@0@P1B @@V(f 0-@PPL<3$1T0$1  T0  K0hg(f 0-@PPL<1T01  T0  K0hP(fQ0 !88S0 00C0C0CQ0C0C3+C? R0/ -pLM`KP` @ѐ0K\0 0`@0 0 0 0000 0Bc?o2P0S(KeQ  P// --LM0 0 00 KYA\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -L1LP@$  0 000T1yxBPytP UA T1 >coPPPe x ~P`  ? 0000PPPVSU! N U <  0 000T1 Px P ; U  c?0S-   0 000T1 c0 ? R7 7777 770xPS0CL!B00000 (fA@ 0-0L@ T15T1T!"20# P0 @P U 0@SU^HU?@K0hA0 0-P@LT 6 30@D0 0-L@P 0S SI_D0@0\H0P40(0@000̒@@(f  - LVgܒ@ -|1LS 3/ 0-@,PLd0<0K0h(f 0- 1L@Rʘ$Io0 p-L M@^P a @` KPP  T K` KPP  E K0 :0c?N Kp -L M!T1P R@dTcoO \YB/E BR T!P ? R9nR13?@= 0\ 5p*T1 >0(K0PP (( KiT15T10:0PpPeUPPUJET [ 0 :0\600C0 K@[ B0s S0/ -pQL@ u`uL!PQ 0!? ~0B0Q?0P?0~0B?0S0? ~0B0Q?01 -PLM KR KN KJY`V K^K\KZ`.xKp@@\Kx@KKK@pKx@$fxK-\K+@K) K(f -@`pLX0n@P@00 ]⤍P$G 00S (fe -LM00@Tp3 @T2 @TP0 |PU" 0 S*  Q` 0S`  MoP``  0S @Y H03RRR Pd2 `ket a 0" KO KHT  `x k?0 X"K> KH 8PU4  0Y (0S S 0d K L0!0!dL0KK0S G41 Q G0`4Q0 KK`P3 L1 ?0!TC0U0P#T1`PE 8k60W0  x 0 Q0`0`Pa00  ? 0P00ڼLppGT10W?0< p9#0 PPPw0W4*? "Y6 (K(fd@!BF!BM!B 0-@QLRP0 0!!!!0S1S !1R 101! {Px$ts< 8@6x4(4`l IK0h\@ |L y;0 ,00@Pp!X2,K@(0 00p(P$@ @@ @Ps`;0,0 0 0 0!1 004p0P(P$@@ @]`000;0,00 0 0!1 004p(P$@@ @G`000;0,0(0 0 0!L1 004p(P$@@ @1`;0 ,00!10` `0 04p0(P$@@ @` 0`!0 0<0K0p,`(P$@ @@ @P0K0@ `|0 00!l0'.0d0,p(`00$@ @80K< K0K_(K(f77JAU!B\!B`!Be!Bk!BGBe7q!B0- B, !1 S!1 0 !u 0Me(f 0-P@LX,0T00 P00BI _0[0(f 0-@L$ 00  (K0h 0-L@P TQ @Q  c? > 0>;0 0<0Q x$IK0h0 0-@Lpl0 R  g/0@000P000U 0@0(fd@;0 N \1 S S RP1  P Pp p0 P P"l@p0 P P V  @ X ^1SSQ Llj1 S S R  7aT 00 S   1RUQsM VPGXU? Uc X1U Y1U Z1U   U 0 0@f:0 S > 0  :0/_X1Pe_oSRPU  0PiUP#U PE0   d!e1R$Kk(f@ 0-PPL@  @G0(f -L$MT10K2T10@9000 000K P090K 0-T1L@ T1T 0h1Pi1S0 -`LPp A@@P 1R@ 0P1B @ T Q X I (f -TL@P`8 U "R0(f -LDM0@Sd `30 `#K44 1` P 0qi T1T0  a1 Q,l ) S& X4|?Pl01 0S, ` T B  NB : |`w V T0<X0 Ci1h!S\ 0R?dPR0 S7R[P R ` R <KaSPP0S<Ka0P0 LKa#KKP d40D` ckk` P`0U`0 .  kT0S@0\0 %0`P!B @P00#X0 d0  L #`0 (`$ h1S#VI V#VT {0T -h \l0 PPl0IceoQP h  R T0 QT0S6 `P1p -X0XQS00Q00S#8 ᘌ`  V0S X0S U X1U Y1U Z1UT0  U000! [k0SH1  dP x> P000P1 1S 3/P000 (Kdd(f@PD  D<  @(<  , P ! !+V  X+V ++V ;V 0CV8 0V 0;;V 0Vp+V  BV ;V H;0S8+V ,+V}  BV  V y;VC0 W*V :V 0V0 h:V :V ] _*V. .*Vp $*V :V: 1|*V t:VH N 0S000:L:Vl L0CVF 0V6,=:V_ 0VG ,*V 9V0CVQ*0CV0L9VI D9V 9V ,9V  90S   0;0 & 0 0 0b0PUPP 2 hP0' TS 0H0HS ^pP  0D 0 0 p KycPP n^"四P喌d^U@T, R00C0 8ែ08W R R3l00 0S00c8W ! Q#l0  0S00V ! Rl0$00?v P19P1070S P6V`c ]L 0 1S 3/PPw0P1$0l1(0p1(0S @ L6V# T1"    2T1`@P? K`KT12T10VH10L1T1  0;; 0T1" 00T1 G v00P! 0X nK0 03/0 3/PP 0 03/S؀K 0T!  %0000n0(fX/X!/ 0-H1L@ - e1Pa_oSRPU 0\ P!<0oP 03/d1coSQ 0<0|1S $J|13/#P0(f/ 0-P,0L@T ~P@0e/ 0-@LP%D0@PP  80P00S 00 0V0(fe 0-LPT P0@T 0S808 TT 00 0@90(fee 0-@PL 0,0$8 TT 00C 0K0h"0(fe -L@{P3`PPp P煁Q &~P|0000 00d00S  R  080, @R 0?(f@e 0-LP P 4ew!Be!B 0-@LXT08 TT 0S 000S   0(fe/e-D ʠ ʠ ,!|!R  0/e-D ʠ ʠ ,!|!R 4 0/e ::# 001/e -P ::P`#L0L01@0003/000|QZ(fe :0-:#h0@ 0LR1 R,P@ < PH P000$0@800ed@T@(f -PtL`P@@@ @T @ R@X 0APRTAL  X0 b@?"W(f 0-@PPL<,0T0,0  T0  K0h(f -PPL`p0@@ R  @ P0S@ Q@T ?" PP @0 0@9 0X (QQ  0"(f 0-@PPL<d0T00  T0  K0h(f 0-0L@ 0#*0*"6< $0000H0^K0h0e -`Q`0LP#*0*"6p A00000P00P0 ,$<4 $4Khe -LlM0`S} 1 **0" qP뤠 @) 0 PX 0P0+@P^@]  ,Q,#R₆U Q@T 0HQ0݅IQ L @? Y< j@P 7@xpÅ@T$0@ dRd #K@Pڈ KE@lT  00T0S0@ @@-#@(Ke(f -pLtM@P`0 ::#t20hl @p  N T Rxi R& TP"UdRd #``V`! KPvJ @0``Q V`K P`K qPP?@ `HU TT   n\!<d ( 2/ PUp R+dRP1dP#Q KⱅP2 @ `KR  P R ( 0PP@0  0WPP#@ @ D44"Zn 0 PP(Ke(f -p` ::L#(10Q A@ 0@ @ R  0 P R0@ Q0S@ 0@ 0T 0?o2 AP0RT1#400S@ 0@ T Q X , e(f 0-h0PQL0A TpT 0S|A@OoBU @T@0edf -aLP0S4@P||N0UT@ ሞpD=0TU@$x{ T ! |0p@ p@d f0pX&T]` , gx 0AT `G TD!0 a6e!BBdf - J0JL$FpPx0x0aP|AT XL0D|1p0003/T1;T1@P@Q@e(fh8 Q0-L@0P0$0S@@0edf 0-@L $T@ 00dfe -P.@SRL ": :d#&`00a $5 ,$4- Kh(fe - J0JL$F`pPPM4X0101@0@`p1H10L10T1KStT1S0 00k0 $@04/p@0 mp@ 0 d1 R@F QpT1  0 1W0CW15 : 1W d0CW 00SP0@0P0H1< e1Sd100C?o2 @ S P0@ 0 0P0S P0@ 00P0 @$Ke`t $8it_t f@(ft tptu ut\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -P@`LOV` UBE00 0P 0-@LP 3P 0QBQ)0000 0-@L0SP!  \P 00cS10CB>A>A0BQ3\000 0S00000CS0000 -LP``pV0S 00shST @@aV@ x0`dp0d00@ 0@T00 -PL`6^@2 V@@lT @@l)0L 0c" @l dR  0S  q! BB.A.A BW" @S  0 @S  dR 0-@PL0S0000R0  S0l0lU0 cPc0S00 0U R  K0h -@L`0 PSS 0S P0000`  BQ  1 R S0C>ౣ>!03 R S0C>ౣ>!0300 0000S000!B -L M`Qp@]x0 0 ST S+0S 000$<唰 PC0 PPP` P`0UP w R0`ep000P 0PU00V& 0R! C0ࡁH P ⬑5!0C"!'*N 10c00Z 0009(K"B-0S00QSt0CS0 0Q^ 00cS10CB>A>A0BP3̌hf-0l S0 0 ^ 0lS10CB>A>A0B\3, hf 0-@L RP @Q  BA0 \P 0nS10CB>A>A0BQ3\R  0 0-@PLp 040101l 10 P ᗐ/d0-P0@l  P00g -`h0@1L01l  10 PU 8ᓅ0 ӏ@d -`h0@1L01l  10 PU 8r0 ᚏ@d 0-L0@01l  10 PU 0S  @ۑ00 0-L (0l!  P | Q  Qh@D0!100R0@@llz0K0h訏00at @GK QKPK)`P4 /0PS 1[S $GKp1 H1S0S`1HQ:1CK3/PU P  $YKp 0-L@L(PT^Q^0$ a^0 K0hZ^tfA8TA8 0-l LP00P0\0@T P0U*$0S 3/,PX@ 0 K0hH^tf edf 0-p LT00T0`0@T P0U* 0S 3/,PX@$0R[K0h$^tf ed -LM" Q"  "  R㴢c@P 0" 2 H`PH 02@22 T 00S (0SPU 1"R 0"00R000 0P`2Z00Y0Sw p00000?0S00  0`04?K -p2 s 2 "   @  Q0c"Kd2K K BRB/#s0S Q WK BRB/#s0\1K2K& A0 K ?K'0 A0 0 #K -PPt0S  0 U 2 J =2 0Is @YP<Y22S22H(K:e:eG-Q pQ@P`0@t GoIQ  G 0 00-X00L@ X  #R|01X0S 3/P0U*0S 3/,P<0 R , 0 0 0 0c00 etf,ff4f0f -LLM0 0@Ppl!2 000,P(p$@ @@ @P`hI 0!X2 0040P,P(p$@ @@ @P`I 0!2 0040,P(p$@ @@ @P`oI0 000!1 004,P(p$@ @@ @P`pZI 0!h1 0`108040P,P(p$@ @ @@DI 0!1 0 108040,P(p$@ @ @@/I0 000!08400,P(p0$@0 @ @@ lI00S pPp`ppU*P 0"S@ T (Ko(KyA\f'"B."B8"BE8CAXPBtPB`f#P401X0S$00S PX0/tf e -LP0 S * aoR \,0 0P0-L@ P0 S* R T T \RP \,000 0-L@P @0S K0h/0 0-L@P <0S K0h/0 -LPL -LP Kh@P0ӗ/4@ Q0-@!@3PLPP@0 -L0 S d KhqL@>"B 0-LP@KP  H0S K0h/K0h -p0LP c2P D0S $Kk/P`U 1 !P @TwPe舀X h bR !wP@U1!V`` 0- L@0P  K0h0S -`PL@P(Kh+0S S S S S +0P`S@ S S Kh/S S Kh0` 0Khê Kh Kh 孪WBh"Bo"Ba"Bw"B~"B"BQzA"B -`pL0L@T P0U*0S 3/,PX@ e -`Qh0Lp@ T 0 R X@P0U*0S  3/,P e808 0S0C1 S1 P #/d:f0 0 S / -L M$0 K@4PK$k> -LMP`Kp` @yp 0K\0  BR-:00 00 0@` 0 000Oo0 0BBP@T$Q 0S S SlP0QQT<0P 婤 @000000圤(KxdfZ@tdpd -opLMOK op 0_Kd$02 Ә` p0P 0 00000|B lb 0 0B(KfP8\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -LMP0@T `0V*(0S 3/,`X@P!0p("a!(" @T!(210#(2ODT 0Ks0S 3/0K Hd <匝PT 0L00H@40 400;`00PX\00<0` 3SH L0ST0` 0`00v S0!0  gR ! h0P< 020020 02002(Kj#B#Bf#B -LM! K -LM K -pLP@PJ $1 000$0&H  0  00 00HLCbH0H0hPU w`P `  0  d00 00HL%bH0H0vhP 02002f -L0K M#W@P @ 42042Kf 0bS-LPp9:-@P4 0  0  | pb,b0X`!W01V`!0 (h0fpf0000fS00``PUXXP982082f -`0RLMp00 pA0@0 08 PP8PG@Pf 2ᜡ(p20000K<0 W0YY @P Q00@0`eV`!fV%d 3PT  L  $ $  P X H@`\ h ) V1# V Y<"0X000`0 S 3/g<0@ P@80R<@ phP (Kf -LM K, 4P K -L M0PSI NpPD 0(`X@`c1000 Vd 0巛PT 0+40 4000P0X00H@L` \00  V + (0f0`cV 0P00 U000@Mp(Kf -LMP`Š R @ 80V @`cTV0S@T0 4 0QHLQVP8 pf !RPR 0P  0S ``@g^P R8\V 4!\ 0 \HPL\Tl` c ̄ n\\  0 \000u0 3S HL0S0T0lH0 0 0c0SQ 0X00g0 0000 ef0pgp@E0 E0 PPR 1d 00 嶚PT  L  $ $  00HP0P `X \00)P' p .f0pgp 00 000'00P@`Z`(K#Bf -L` aP@! PVd dPT 0L00+40 4000P0X00H@` \0Pf 0-@QLPP P@00$00$/$0S0$0/ Q0 / 0-LK0h 0-@QLP$@T Q K0h0R$P 0S// 0- L@PP e0 -@`Lp$PU @PV0$000@$@P`0$0/$///-/-//-/-/-/-/ 0-@Lvt-0 -Lq S-P1P!L` Up@g\ U l l  wkPU: -L M 0`P 0 @pP( X01 0!00000P X h Y 0 0 0P Y i0P`e(K-/-/-/-/-/-/-/-// - @ L`p P  \0 bdWp   dUP  d` -`@3LMQpP 1CQ 1CQ0S 09X@|`   80"@KP 0  9 0SyHBT@ D@DT KPKH@အ$2W2 1CW 1CWPoDKT0p HB T D@DT 00S H@T]@Q(1S90001S0:0 jKT> (1S= 01S: 0 -Ka@P)TKa@P P! KH K?0  (!P0R0%W B0 4P1PPK,4U@ PU 5/ Ki -LMp PPP `@P 00 `0 PP_(K -@L`PPPU c`P 0-@$LP ( <څH010WK0hHSed -PL`00CS0@,0$00?o2@T  -@PL`b b$00 S9 (0S9 :0040080 00 '0  0'00P0:0?`P@@z -@Lp`-(P$@lUT  Khk 0-P<0L@@T $yaP@0Se 0-@LᢸP K0h 0 0-L@PᔸP (0S h@@00 0-LMPK@P0sT@ 00 0S ⍰DK0 p-L M`P$KP $@K00$. bKp 0-LMPK@P$0S@ @T@@T ꡷K0 Q-L`P 0@A40P@80P -@QL`p R^PPEP00 /R0S /W`PPᛄ P0W[ P0WkGY#  ቄ<㄄@ /` ⛯0$(P0000R48 [@?#BSe -L@M@P T[ oq @@@@=0PPa 姫3; w@00@p`0T!(0 0 (0K0p,`$@ @@ @o81 00!10'>( K0,p(`$@@ @[80 00!0,p(`0$@@ @0( KI8d 0PPL`PU @/ 4@L:$KSe@8f|8A#B 0LP. P U0Z@*  Q:@ LR @0@0@000L0 H@ aLP  0P00@@@ H(K@Se8fTe -LM 0000 00^ K脚 -PLM K`pcP, 0P  00S $0K ǡ@P $  ٭@V$ #@ T 00C 0 @@ v᫵K0 0-LM@ P$K PKP0 ,0Q$0K#P<K0ɚ;0  800b80@0Th0 0\3/T 00 R   X0  S R h0 2//@000 S (Kd -LpP@ 0` 0S⠨P @@0H000T 808 ,0'&xJ@PDfHe*fd 0-@ L0HJK0hd -L Mؐp0PU( 븠H0` T@00 p. n@N`@@fw! $d N !00PS$W NDf$k>HefLf -LDM@00 X P 000 0   Z8 0 (Yp  !@  ""2@0  0 |20|20S`0`30d0 \0dD0 Pn!0bX4a  00 ?o2Y0S IX0SH 0c00cP0\ 8;P Q9:Q7:S8Q   0SS 0 (Dk  .D P+q0f40 Z00KP0  00 000804 R00S 0PU40`(P P0`<0 40Sy PH 4 R  U 3Rn 40T0 0T 0Sf 40 UP!UXH0p~pp~pph0PL0 P  H0 d0 JP'v L@L0W6`0 H01dj0 `T H0L 0H``P:\@#*0T  L00P L#4004X 00 0e0000 00e00 R0000C0U400e40 $4 fY00R0S 0 80S 00S|2 0[b U P00400e40 aP0P`0p(0P(PPXJYP` 00000 1:@ R! !Y;ö1\0S 00 D0 03/ 0 @`X 06/@0S101Y1;ö10P00 40YSY`p 9'(# 0D= 0P 0S  Y P[40 SP P<0UP400e40 80S| 00< ?oR20S0e 000o(KHe$k>$84f I0-L8M ,00@`'~!1Q 00$@ @ @000(`p /:0 ,00!0 00$@ @ @000(`p / k8`@$\ҥTϥC{ P 400$Kkء8Df#Bp8$BXe $B$B$B8A -<0ML0000 $0P  K6$Blf8A$B P/P/ -P@L` 0 Q )/00 3/@ -@LP1 40X aS 01?S0!t4 0003/PPatHe10 1 0 00/5/ 000/!  000/9/%/ -1L@P`1  0 Q 0 0Kh/ 00 8P-/ 0-@L21<1ZXVK0h p-LlM@` P+1@01  d KqW, W0 00S z0403/KKp 0-LM@Q1K0h`$0S P 0S 1 < F0S 1 < E\H1US 9UK0hIK0 -L M0 @`P 0PMU  P P/; _oVRPU )30S+.0V0a 010@41娞D<01Yx0D1 ``003/PP 101iL@(K蜩88 -L$MQ`0K8K@qE0P5$. 8@0 A!$0 @0  ( 0"p 04Kq@P 18 0040X0!*!0008 10WV408 00 (Kd@ 0-@5L05 00$03/5P0C8#85?o2P0S h0 -@L1 ,PU4PU PU( 1P  1P]PP!00x St` 1 1 PP 0S 0003/L0101 d Q-LP@ 0 `q@DT0 0Kh/ -@Pp`L U p`Kh 0-@0LP &x K0htU -0L@S`P 0U  U P P  -L 0KM#  K -PLM@; T2R 0S 0S  3/0 SK SH SE  CRu@S0S4  S9 @S) S5  S%!S7  BS?  S  BSU X|!S6  SM P`!S  BS- BS  S ? B S@ 91 30,0 1(0 +!*(4S$4$0P4! ,K`aT|0p!<K) T00$ ,KE]P*PK dd0 -QLT -L$MP3@Xp0P@0  UB U? U< U: U@U6 U U肟U U< U+  U  U2U0Ub U` <K`PV8PU!`~\2;U<0QS1001p@K`5Vh@0S1PPQa@K`&VY@Q`Uڼ1U U 0CU  \P0;0E7`CP1;1 ;0S@0 5@0050S@0 5@01/ <KX`V&܃K40 L0 P; bH H;P 0H L0((00X0S0@0 0@ U@001*`*VV 0S 0S  3/P` *P`,(K dd  -@LM,K 0,K6,K@,K K -@LP@`0(@S 0@0S 0S:0  @ P  -0LP S@P 0S`d PT 0L00+40 4000P0X00H@` \0`R S00f -L M@0 T:$Kh趹 0-@D0LP0S S \0H0\0 1H0H0H000  X @,X v0\@<@L@ -L@`PPP H0_101 $0\V000Nd 80080@0<@0 H ` 0@0/ 800b80@0<:  0K0hQpf$R4400440,4(<0(0 @ 0(0</Q$0( , R$ B$4R$ B$< @0R( @00@0< 0(0$0/// -LMR@A``X0P0X0p$㢸,;X0 P0 TX0  (0 ,Kh/K1M/ 1 01 ! !7 $0M/ \ 0-1$PL 00U@1# ( ,0R1  oK0hH!: (H!!10 !A ,K0h/ݟK0h 0-@1L0801͟K0h 0-@1L0>1ὟK0h101 0-@L䭟⫟K0h觟  P-L2:@̀P`apVʀ 0! `! 0  , !|0 ,0Od0 0!!`a0    !deeāeXepf 0-LMPQ@l00U`0<101@0)  <I@P 00PH 0UDPD0<0RH0K0pfdXe -RpLP 0(0P`V 00S`8 <0@0bD  `S0Q<0@P P'PT 0L00H@40B300P0 X0\0` 00 "QV `0S `T0S@L@T@P` Y$B -`RLp$ 0P 岊X`V D@P%  P`( UP ( @@PT0SPLPT@0S@P@@T@zPU@7f$B -`RL@ l0 0SP0 8<0@P0nDeS0RP0S bP_T0S`L`T`PPx$B -`@PpLT^ 0 0R`V 0SUD 01QT0T0T04U8 0#! RQ.  3SHL0S T0a`00`0<0a0S1Q0>P 00080 080@@L@P@0P000p@V U 0`` $Kk $B 0-@LP L0T00 0-@QLP T0S@0L@T@0Q 000000 K0hb0Q/T R 0 0S  TQ -@QLPL`L0' S  Q Q`0 R000S0T@@0Q 000000 Kh! -L@PT`ppLV(T W80 O@p0V0f00008 `f8``c^7@0ST-@T L@pL0SP0  RT0Lp$B 0-@L@0S 80 0-LM@P1 < < >0D0K0 -0\`LP@ U[<S!p P  P 1S010SP0 R07Pe -4`$0L? RPH1S,= P; (!<0R 0(1,11:11 011 `@P# 1110111101 0 044T0T001014141<1<1D1D100 P 0!01111001>010 >00 0003/P V 101Qt 0-LPL@U0L0L0SP0T0lEPP0 -LMP U`` Vp0 40   ``mR ]@PL U7 URPT) 0L00H@40B30P``PX`\`0Yd 80 巂PT  L  80H@$ $  +0P`` X`\0` 000P040000 0M gM(Kl@$Bf p-PLM K`@P   NKp 0-P@L0T S@ 0 0-X (PLX@@,\  yꍛ0`T  -Lo -0LPd 0-0LS 0@@K0h0hf -`pLX00X0W(@P !@]@0U T #X0( 0X0_ -P@QL +0`T t 00S/\f 0-@PL~0U K0h[0 -LM@00` 0 (K:P#r(  1:1PP ($. WppAD 0@ @0( 0 0(  $K萑@ 0BS0-@LPP  (0S0#S0ĕP00$B -LM0K0@ LP00K p-PL M` K@P @uKp 0-LMP@EKPE/KK0 0-LMP@KҢP @OK0 -LMp`8 @fP (0S :&0K4KGPP 1000P*X A q !p !* $Rl ,k@Pg!QDT  5 $DT $U R h4 Pp40 ( P Ġ4   8n@L外LT 4Q400004"10 0岣 00#. Υ10 40ᰡ-@@#@@ᤡ<00 410咣X  (K}?Bd@ p-PL M` K@P8  1%@, 2@P 0!00 S 1$ R M 0@1P pP 0@4 101t@$@ @ MMKp 0-LMP@EKPE/KK0 -L4MD1P10a0R 0p 08 K@KH 3P=@08 K<K@80 40 @0H&P)<08000  PU X 4K3P0 <K4 @G 0 < 4 @ڢ (Kd -pP@`LW W T 0 R @ R@ @D@ @@X P Pp -L M0RXpP$``0    R @ 00 ` V00PU@@dX U @T R` P 0 c(K$B -L|M QRP Q O 0X  a R R(PmplpK Rp  XPPt lpK  K0 x D | t  R || ^ZPX !P 'V@@T l @~J|0 0 0$ 00 K4Q05/ |0P0cPS 0 pP  #P R+ TTP P R P lU @ 0r 0X@ @Pl0KW lT(K$B\f -PL M@ K`p"P0 0 0 00p0000+@ᕟK 0-LMPKP @~~K0 0-L M@PT  T00 R0S'0 K4KɟP!0,KT ,K440@10   .   l@P /,KCK0 0-L(M 0PS  4KSP 040 8 K<K叟P)40 S%,K80,K 0<0!++!<@P40S  S 10 D@P 0K>@,KK0 -EL$M@`Pp@X d18K10@0DP@K 80`4K009`P>4 0K@K1:18 1:1`P/00 А0@00K<K 8 (  Ӡ`P<04 p p( 00084r`4V < @ ꗠ @ᓠ48@(Kd@ 0-LM@KPP19@ 00003/@zzK0 0-LM@KPP k 00403/@``K0 -LMpP`P@& C0 0   KkP R@U P  0R 0 H4 pPT 00   Kf@K$B 0p-LEM@K1d0000P0` P 0#@P P2P ᝝Kp -LMp @PP  KKPKK0`K1f000 0P 0#@P PP oK -LMpP`P@& C0 0   KP R@U P  0TR 0  PT 00   K@K$B -LR<PV@PT 0L00H@40B300``P0X0\0 ` EP L \0 U@ 0 R #R Õ` RP耖@ -LM  0 PQR00S Q 0$  $  a R R(@hplpK 0Sp  @P0lpK0 0 x0 0(K00! D |0 t S |  | \R0QQ 0S0 KN@Pb Rm0S 1P  0K;@POVPPU Qh PE00AQ00 K0 0|4/0@P0 |  X tT00#T0S T0 00  Ā0 @0bU 00S 0@ 0T  hl0KW hP P @(K$B\f@(K舻fP/ P9 -L,M@S`8  p0S 4R0PS  SPPU0C#1$00 40 0<0 4!4 "D )F0H @0 00S@0p@0 8H0S*T##p4P P (0SP ݓ p#4P P./PPp%  A> 0@0 0 p0 RL0 D0 7 ! H >@0H #004@0 4uL00p40Z <0<0 堓W H#W!0 8@0L00H@TP400040PP1   0` X\0 pW1S SG SXC80S1 8p  8pP 9p) t0S=p! `P!@0V`  1y@0 BP   17p0 13p80SK 'H0SD @ P  @ Q@T  P@ 1S S r #0!,0 b0000!, 0 (0`1 <+,0 ( Tp p w9p(Kd\edf%B@{%B @-LPQv%B 0(,꠻f(00,꠻f`0P t Ru`// 0P-L P  -QLM0 | Qe00 Z 00p 0hW0 01h0#0  Rn_WPUia0嘠 @Tb W  X R@F  0     K$  K ( K0 KKK KHKKLK K K] R 0T 00S0 3 0g  HrP@# L # 0Z\P `R (K褻fff\ `P/0 !`8 00 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe/P 0%h%#3/ᠻf T0R 2"0@-   1# A@T_ AP  0蠻f 0-@LPPQt00_Qht_ P0 0SL P`< Sd  qr h0SP0pef%B%Bd -LP'30l%l 5l !p 蠻f -3S#LLM  tx4h0@S00   4 4K0 K]*Pd_uPPT3 0 S0#0380 0003PP0 P0Pn003PP0 PP0 n pԒ] X(5"0"< 4u8"` XQ20P㗖&0<0nF 00 PPgxlplW` 0(`VP lC2 SL0P,00! !(00 0 0P$` ` `1 00@p'!ထ1 000P,p(@$` `@@H1 00!81 000P,p(@$`` `@1 00!0 000P,p(@$` `@0 00!00P,p0(@$` `@0 Pw(Kef39%Bd%B:f>(B%B0f&B &BtexeffD9%Bfte79&B$f&Bf#&B f2&B -$L <0P  bt29fA&B000R@-@T P8(@01S iUT P   t0蠻f 0-@LP0 0 -P`pL} @ȗR*Q 00S0t#:0#0@ hT UXPBsP0P!0R 0T`PV蠻ff mBdj&B -`L`BB ,ʠ,V X\ 0$00 0 0P00 !T00T0Kh]49 0-@LT`wLt 0"00000 00 l00  | 0q&By&Bf!Ce -P`p@LX0p S(:l S8@T?[pl0 0a#2 aS:8@T @-T! 0(0% 0`>P0`p @ n@P S90H00XA 01!,10R;i0  300  00> 00t0  S   $ x P x x0t U ou%$L t ކ꠻ffd,,f 0-<0QLPm@P 6UP000蠻f 0-@L⪆`K0h覆 0-@L  0K0hm꠻f 0-@0Lh堆05000  00;0Y09    Q *  # ! RS0SS  0 Sڤ0 1   PP 80 3/0P =U0 %$ 0S) 188@Q <   0  0000@ 0b 100`900000] 0S l0 CSl M 0K0hm0f fػff -P`$@LKKhꤻf 0-@Lq0  r<00 0E PU 0 00K0h/0 K0hK0h&B 0-LDPAT 0R01 K0hd 0-L@|P 0P0<0! !@A(0 K0hK0hdf -`QL@P 0Uf QP $00Q0S6KhKh. -@LP`T P$0S@@T@@ӛ Kh 0-L@aEPK0hP 8 ( Q 0 3/0p峿屿000T0!x20x2#4塿0<0߿K0hꤻfd -`L@V t0S`oP 9S 8 (0R PPP00P00S (0@ P U) 0)* 0*0 0060 VT0 =0}#叿 0!x20x2D0 =0VT00T0~U000RU`褻fd  -L $@P XP `0V0f0 0PP 0e0 0$0蠻f -`@0PLT p0RP@蠻f -LM`pK` @6HQ\ 0R0 KK\ \       0p 0   : 0?o2P0S00 R0dS) 00pRl  aRplRp  bRlC T埾H@0lS`P$־+ (Ktepeff -L MP`(@ @T ^o$0$` `00 VG p17'pc0P40 d_P! Q✾ c!x R B!˃⏾Y V 1 !0560pW  010#d40 @(004l @f@T@nP3 8@00  4/&@pp Q:lQ 4  N tP@@PJb!"R(#R ! R!\(K&B0fdf,,fdf*f 0-PLp @P 0P:0H0$($HRtt xx@0 0?0褻fff -`0@LPp+   Q( 50l0V0l0 U ` 8 l0P CSl SL0 jV ᒽU00 d,,fff -LP`p|) 0@P 0 P p I0P.  j@P  0P '0E( t\txA(8@` 1x0Dp`p8` |Pty0  P H+t0Sx x x0t b00褻ff -pMLpp`P@P* 0 0U600000Px0!t20t2U it0S`YmP U( 0() 0)Kd p-L M `PP  2@P 0 :@P 300Kp -L M`p P@ / 塼PPE0X P ؼ10 wh卼X̼PP 0 :PP 00(K褻fD0S @ R D00D0@ 0D0 R 0S  0 0 0T R P0ST T0P 0T0L R/H0SL L0H 0L0/Te 0-TAL<1D!,,l 0l 40 l 84l <8l @<l @DDl  HHl $LLl (PPl 0dTeX X- Lֻ -0L@S 08`00P $@0 `@ @00K4 K(KxfP'BW'Be_'Bg'Bo'B -@PL, 0SP`' Q 0S  0 \PVQ 0LS  0 \0( 0000 0`0pfe -@LPT L`z 04R00 0 >\00xf`ff -@L`T Z @- 0 SxPz۵0S0  Q    8   Q 0 @@fxf`f 0-P$@Lᵵ00C0K0h`f -LM#K0@S0f 080 Q 0Z cKSRT Q cKWV0S   0 ;\a0 0SPzo000 0PS00P0S垵^ZP ,#K 00000 00 00 00 0000S0  80PpA@(Kpfexf`f -P`p᐀LXh,Z@ ,0`000S0  0@00 000 00pfe -@L <00P1S P ` WVR 000D 0C0 00C 00 0C0 0P$Kk0~fev'B -@0`SLP 000P Q0S0SP 0S5:// P/ -LGMp 0`01@QP8 0241 01 1 @TP4@p6n6<m;W01 T0$1 51SPi  C! / P C]4!$?EP]0$1 L#0E/KFKP0GC;61S C! /  C0Q1 00CTS000;0 T, `0 6X(  6;P 5Pz 5 t0S 0W2 1 $  KEP 5 Z PPVV ! P 5U 5<1 1A/KFK0 10  ID5Z1 01 :PW *KPOK  U\N 0 KK C?K0 00 KK?K ؠ .K Q P 3,0K# !K0FXP 0KK )P-.K KK bXڸ^^Q Q O?K SR  bW"#* {+ n1S  Mc:5 (Kf@ -LM0 ,  o K80 01P80o/Q / -L,M@ T8 < T.JMpP, KE"pE0`8 @ D 00T300@ p W0<0 ` 80pcM"(K -LMP00E40 0`p0E9P804 K0KD@tFT t*40 C4 /  C07s4 K00p0E04 1!S @T &p 4`P44 4Pa *(K 庲hf 0-@L0廲,0$ R @@00hfe 0-L@L姲H00S S0S   @ @ٲ0hfe 0-LP<匲80@T 0S 3/@K0hhfe -PL`TprH0@T 0S  3/PP@夲hfe Q- L S 'S !CP-/ -@@PL0S L` )00`0 0S 00Q \R xx cp !C0\S0S 00Qc@'B'B'B'B 0-PL@@0S 0(40,@$@a@ @,0 0@0@ @@@ \T0H@ 88s(KodBlf\9)(Be1(B<(B8fX@Dj9A 0-P$@Lmd00Cd0K0h話f -PL@|^`V 'P h`` 803/0@Sh h0l 0lPd0@@ 共ef 0-@L|8d0Sp00S S h0Sl l l0h @03/`$@h0@@^0fe l0-L`0@T <0S d0<0d0I<03/$d00Cd0h@K0h 00  0RHTa!WV40@0! 0(!8 KF0@0S0S00,P 48 Q8 0 804 (@40080004040Y0 @00( ( 0 ( 040  (`(@! R0!(040 Y40@000(0! 0!P@"P !P a!a`p؁`YX`p a`Xp`p`P@P P  x  DT 8P  P(Kpfeed 0-@X0ML0L0 0D00@0@@@X$PlK0$s9,s9\(Bpf 0- LGH0@ YPP0 G00008f -LM80 3`p刡0 @; 01<0 T h30T0 O/008 P0P% @ P@4U<0x` m<0 k?000(_/ 0 */0(/0'4000{L0!0 `0 P/.d4@PUL0 `0(  P/@.3P 0K0 k=PP ur0 7SPm PU80PPg R 0 b0000  b 00 0P 00S09000T# 0  Z@030p  3W 0.:T G@0.0K p ?WT00t R 8 0$pY    pP 0.T d30t0Sc.@p@,3 03P(Kdfb(B X0-PL  P  P 0P $$^@Pxf(B D0R P *20 R/R20/ 0-@$0L X K0hF8f 0-@L F @  0 0-LP@P 0+P 0#0 -L@`PP 0+@PP  Q0-L@K0hP 00 0- L@R(0RX00008f 0-@LP@DT@0 lX@08f -LM0 0`0 0 0 00) 0 %RdP h a h`@T-@@@00S1 0. 0 00000000000 0000p0 P 0 $0R    00w-0P_x? 1018p @T 0 8?@00 0 P 0 /R P U0P0  !"P0P  @ N0;-0S! |>㈁P 0S 001 @1@#@>0S 0 0S t0S ,@T 2p0hP p 00 00p00S00p00< 00 0p0 0 /R;p 0 000C00 P @e T/Tp@@^p n/P@ /P a a R ))Q))  )  R  .P.Q* * hd0Kh K6@P hP ,000000d0S0 o t0SB0 ;0S> 0SN x0 0 S*R00ȗx0 "x0   x"x;  Wx0 0 0=x000/S 0dh0 5,0d0 p0 00Sh0d0 0h0 p0p 090)S p00 hP ),d',0000@00p00  0p h 00S,P ,d0h0 0d0 md0S\  ShP S++0h0 d+ d ,Ld 1p00S! hP d `` Q p  P +d+000d0 000p00S; :S@8L [ R 0CShP d0P ++0h0 d+0000@00p00dR=p00 hP d0P++0h0 h0@0d006@ 000 00b 00SUh0S0 T 0x0 0x0 8Qx0$0 S$ B0`0(0( 0 n:0P0 hP e+dc+0@00T0S. 0)@000O+@@0?@008G U` ` K;L  KLK\0 8 <0 H l)0LK Z<0P0  U000 00 (K -LM(0 0 0 $ 0 0 0   $Kb K -(0LM 0 00 0 0 0$ 000  $KK K p-L$M0@P P?\/PPV`(000 0P4P,P (P 4@ $P ,0 ,0 ( < 4 P

P@0`$0P    p@0V  0P" A&ef -L`pף0@T [PP h@ Pd0t0d0`P 0(0 @/0N0PX0$ ` Pfe0Zf 0 Zf0 Zf 0-LMt0PSS@Pp0Kt!ySPSP@@8%K0 0-LMP` 0 SP.t0S S)p0Al&pP" '0 QP 0K P ,@%p0A&P@@ P TV 0 0PK @0S#/ -L`p=000@

R@ 4 U4 <KPU ,FP BP(Kf mAw+B+B+B+B 0-@L3P K0h+B 0-00LA 00SK0h0d 0'pQ!l1 P4 K000K,p(`$@@ @*0 0 0!$14 K0,p00K(`$@@ @0 0 0!04 K0,p00K(`$@@ @ 0!0P4 K000K,p(`$@ P@ @70 T0@0 ,IfB(KfAeAE-BO-BX-Bf -LM`XP@p8 0 1PDV,  8/P$ 90 |Y@P t,lXh@T& 0 |IP03 0|300FD-\P x 47$ @.$K f  -LM`p`0P0 t, Μ 0 00  0*1P5lX )R0| 0 @P t { h@T )R0|0 P x 8ڜ,a @ќ(Kf  0-P@LlPt00CS 0p0!Ñ"h0|0Sh0|  0h@0000 -LM 0 0\Lo K -@4 <P$L$M`pdKğT!p 6(:`80 6<0 #K 0dK``p00K0 0 .LP0.0@(K -P`$@LKhXf 0-@XPL H0  9H00 S0 1 0 K0h00DPK@P4 K P ' X *Pg`P # K Ko@P Ki@P uG m P}Pg;P$KVe 0- L@3000 0000p0`0P0@0x0|00 -LM@`Kp0$@0 K0cKKШ4f -LM@`Kp0$@0 K0cKmKШ4fP 0/x@,B 0-@PL 0'K|0S  KK0h.0A@ -`MLPP@P' 0P .p&lPU 0|  K300O0S00S LlP Pd>VP,T0S X_lP-U K褻fb-B~-B -pL MP`]W  I @ 0 `ZA0 (Ko] 0-LPD帙@0@T Ph@d00d00fe 80P0-L@P%  p0x000800)%*&(%)& x t+pKN+ j0|00 -L,MPp@ <0 Xd 0W!018`1 08 SK ȡ E?, K00"0 3p D @0 0D 0@00<00` V EF08D  1DP`1`! @0 B E@0V /f40K 8V 4P`V4 t0St0S@'S! W! W 0SYl ,0R0pP d0K(0 K0`0(  '0@X03/+@@VU (W@(0X03/@@@d0K(;(V @0K( /( $K8  -LM1@1P,K0qP;00 0 0 10 UK @P*@0K(`T 'TK<00 80K 1P[0K[P d'@PeKd -LM1a@1p 0AZP 0+㓲@PSKp@PNP1 0S <$MP  @:00 00 0 1 11 SUCK f@P)0SC?K(@ '0P2?.@K00 80CK 1P0;;0 0K '@P$ @(Kd8f\f /B -LLM\5@pP K `PPJA8 P0`P `00X0 /W0 LK LKP T4Q LKLKz Pf0LKL0KP0PX0 LK)LKH0PX0 Pp0`0  0SX 0SX00oS  &(p000H Sp%P##*(. puPPp: 0S 5P` `@0p0XVPPL0 PPn`ẓ(0 M85 (00P(0M8(0#U 0S RP 0  P0L  `@(0\0 20S \0,0 -P  0VPP-PP| v( M8M( 0&(  ,000,0  2, 00(00(0 0 ~PWP  pb PU_,0 (00(0( M8(0,0A ,;SS  vU1\0dV+ P0 P#  D(04VP0 P  C(00(0 00 0X PK PP`0S XPP 0S 7-\0(Kh@@A}//BW/B -LM 0 0 0000 K -LTMphKP8080 h0< d `0 S4 dKb@P hW(P`hS`P'&@@0 6U@P d(0 L0ZU Y@ K -LMp KR @P ^Pz(` @0(0"@(0@0(0ᮒ VK -L -L\Mx3@t KPt0`P0 S99,9d999$9H9p9999@99, dK` dK@P,  p dK` d K@P dK׫@p$ dK` d K@P$ p( dK`  pKᤪ@Pd KpK@P(  pK`啪@Px( dKᏪ@Prd KpK dKK@PgdK@ dK`} dK 9@ dKq@PTdK @ dKf@PI dK #0000@ dKR@P5p KdK@P/ pK_ `@ dK@@P#dK @P@ up @=+`+@P @ >\@tA Kh@8f -LM@ ,K P,K K -L$MP0!Sp88! @P[0Sd!8> @TN P =?,@K00$0 3`8 <0 勽<00<0 0@8ܽT  =)0080 P 80崐 P 00/S Sd+0S@ +8 =(0o80(K8ff(B p-LM@T0P` KP 0 00 `p@ Kph@ -`PLH+ 0@`P r`+ p-PLM K`@q^P  04 00!0`8@^Kpd -`PLH* 0@`P :`* -L$M80 01Pp@<0 *`@ p0K:0@0 0oP UT*0 080P0 3/0P,@P P@Y<080P 00 80`0PU@0 3/0P UT0 00p0 @080 h*80(K(B -LM0 000 K -L M0p0K]PC00@t0S" P +?PU%4KPWU4@p`VO#8P #0S  VP@ p P5](K -@LP0qQ `P hP .P_PJ%0Q8 R 0$Kk7 -LM0 0p00` RP(K:]P(0hP\t0S@"< @"TK 8\ K p-LLMP` K`4P"T000 `04 \ X0 P, \K@P `H0`0t0S@" @P "Kp p-L M0 K0A`P 8@ Pj 00ûKp p-LM00a00P@ QP 0 K@P 8;Kp -5LTMPp@`B 0pKtK8j^P;!0 0 P0D @0 l h Op0T< 0 ,2lKl@ @P p t.^0S,P0 pK_Pp00X,BPp0 t@P "p t q](K -p0LM`P K$0 _Pdu $KL\@P$0 0 0000$0@S [ K -p0LM@` !PP  (0 j@Kd -LM0K00@0 cP00K -LM0K0 0@0P00K -LMP @R@` @ 0BT`p 0  0000 K 00S03PS0K -L M,`K& `Pp0@@T@3:(0P00 0pPP ,((K 00-0LP@0P 000S  K0hF0-0 0AS-L`( pPPP@@T@3Vp T V '`P'f p-0\ML00P !PP<hKZP7T000 h04 \ X0 SN, \K(@P h'H`hlKl@CT `K@Pl0K 00S03H0 @Pd `0S@3:l@lKp -LMP0@!b!000 0 OPeUP^  \KK\PZ K pa@PGKE@T?t0S:  9@P6  @P. Ki 0K*K @P 00X  X 5P0  @Pb 0 [ -@ J\P (Kd -LM x K p-LMP000@` IOP$ KP K$@$tT 2@ tKp -LM@0KP KDK -LM`000P@p OP$ KP K$@$<T 0 0 0`@ 7K p-@ ML`P& 0P00`P$ ` &Kp -LM`00q00@ NPB/K@P$PP 00 1A ܐ 1 LAK @PuX0 *Ks8010:j#: V0 $K  V0 0   V0  V )0  V0 0 0  0 0$K 0Đ RSKp`QP)R)S )S S3A/KAK0K( DA?K(` @P  A/KAK0K( H@Py  @@A?K(Xj w X d >$K -0ML 0 cH K -0ML 0 ! ; K0-00 c3 cvt p-LLM`0 11 d0KP>`K/@P%0P00 `0\@ 4P X0 'L\K, :@PH0S@dt0S D`0` R@\0K( @DD `d @\0K(DDDH0P HPKph@p@ -;ML 000c0  K -LM 0;0 00 K0 c@ 0c:07 p-LLM0`KP5`04` \ 00 `0X0 K, \K@P%H0S00\0K(DDH0P HP `j\0K(P D@P DD `YKp0 cc0`0 c[ -LMP : 0-T0LP +@ F0 0t00`P00 fԈ@ 0-@L  0K0h+ f@o/ -LPpa}~0P0Spp@0T) 00 0S0p0P0 pR  |Q    !匀 @ 0~M~$H~0@~$KkUe@Ve 0-L@PP4~K0hp0 0-@LK0h 0-L@P~K0hX0\ R\/0S/We \ -RL04 4 BR\ 0S Kh{@/BVe -@L}PUpW00 ~P`}p,CV ~K  0-@L8}}0S6K0h -LMP`P @}d0S}'t0HS2}p0(Ka} 0-P(0`PT T LU P(@T ?$K 0-0LPS@ S@@T00 @}0 0-@\0L0\0\0 0CR\0 S0S7}00S00 x}0 -RL$Mm040 8P 0` p@ F$}FDP H` ``2 `X2P0@0 p80KQ00S0pp@P吀X6  R p p@ Q D0U`L PH0PL 0t1l\1   }+@ @0S 0R00+ RZ}P  R R` P | 0 |WPP| t|0 `V H0S @|4|n 0 00IBAe@Ve fdUe -p0L$MP8 08K@ <0 4 0 ` o|8K@P 0S A |_| |P P@h |Pbc80K 04 0  E|8K@PP1@! @00Z   p|0< K (@  0:/P  |0@!0`1T01 T0  ,0 L00L0:yP{<00{080A,A4|2|@(KUe f@WeWe -`0LMpP02PSP0   `,` @ 06/`P {<:0S $`{ P {{S0@1 ! A{,0 L00L0@{{080KA,IA{{@$K@We fUeWe -LM@< <K8 40 0,0 00K0@ (0 p00`@0,00(00 a{0KPP 3P0@1! A<K<00800400 { KUe f -LM@< <K8 40 0p,0 00K0@ (0 ` +{<Ke@0KaP!{b{00W0,00(000 @! T TA@!1U01 U0  KUe f p-L M@Q`Q z1@!1T01 T0 P00000{P K  P x |0z\00d0L0 00L0zfKpUe f4f@We@0B/B@f -0LS T  BRT  Z, KhD@@0B 0-L@=P P00 -0AL M(lz P `U$@ ? 0PS@ ?`ؠz@0S#)*0P%  00Ky  Ez0p@000@0PUaV 01010aP0mz  (K fUeVefd@We -LMP`@ p:0  K 0-0LSt0S # TQ 00@SR ,@y0娮.z00d@   0 c0@ 0c  0   -d2\"0LMS@P <2, l1r,20,0  L0 0,0 ,0( 4  (`0D0,0 P o P^V`. P* V(`Kb0Z0 40 040 0KȀ iPN`L[ 0P0Z0`2\t0S0 0t0S.     P$K' 0K*K P ]P vX00X0v  -Or(K d -PLP@`} vX00CX0v APS  -L,M`pကP@PUT0KL0 0H0 $K 0T P@ S<@ 8p LKe001D040  LKG@PW0 LKaw<0Y@000P0S@X (K -Lv\s Z4<0T <0T &00S ,K00 3/P#\0Z\L0 `0(  \ u\0 00 v 0@c0@ (K0f -L4M@$0K(#D0 0`@0 0Pp KDKH 00 4 @X000 D0K- Tp W04 0b0 K -L0M@p0K(#P<0 0` K<K@ 80 (0 , |@@X00 <0Kb T`K -L M P`pX=0 1 -P@0 0@ @X K 0-t0L@Sp0SruUP+uU p0SpP0K0hS00 001/K0 0G/Kp0$0@$000-TV0Kl@ -LFMPp`0 GK岏@P0I/Ky@PGK0 0>K0 0G/Kp0$0@$n000-TV0Kt@ -LFMPp`0 GK偏@PIKR?@P$1GK@t0 0>K0 0G/K0p0k@>000-TV0K p-LGM@P`0 GKQP\0.KPGKD` 000G/K @ -TVKpl@ p-LGM@P`0 GK)P\0.KPGK` 000G/K i@ -TVKpt@ -LFMP`p0 GKPK>P 1GK@ 00G/K0A@y>-TVK -L$M@0p0 KP)`,0K00 0@PU,0PV,0 `c(0K000~P P@( ( ,0000-TV Kl@ -L$M@0p0 KmP)`,0K00 0U@PU,0PV,0 `c(0K000CP P@( ( ,0000L-TV Kt@ -L$Mp8K<>P+`80 40K00@PU40PV40 `c00K00P P@0 0 4000=-TV(K 0-LBM@P0 EK+PP0F/KP EK0E/K@-TVK0l@ 0-LBM@P0 EKPP0F/KP EK0E/K@-TVK0t@ p-LCMP`0 GKPK=P 1GK@0G/Km@^=-TVKp -`L0L@#2000FSP`VP V`0P `00 -T0LM% K 0  0$K@ Pd0 K03/@$KL@ -H0LM$0   0) K(K@ Pd0$K03/Kh@ -LH$M   0 - K0,K@( $ Pd0(K 03/K脙@ -LH$M   0 - K0,K@( $ Pd0(K03/K蠙@ -H0LM$0   0) K(K@ lPd0$K03/K輙@ -H0LM$0   0) K(K@ UPd0$K03/Kؙ@ -H0LM$0   0) K(K@ >Pd0$K03/K@ -H0LM$0   0) K(K@ 'Pd0$K 03/K@ -H0LM$0   0) K(K@ Pd0$K$03/K,@ -LH$M   0 - K0,K@( $ Pd0(K(03/KH@ -LH$M   0 - K0,K@( $ Pd0(K,03/Kd@ -LL$M, "K 0K!K01 K@( Pd0,K003/K耚@ -LL$M, "K 0K!K01 K@( Pd0,K403/K蜚@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K803/K踚@ -L$M0 0D$ 0 1 K00K@, ( |Pd0,K<03/KԚ@ -T0LM% K 0  0$K@ fPd0 K@03/@$XK@ -T0LM% K 0  0$K@ LPd0 KD03/@$>K @ -D0LM% K 0  0$K@ 2Pd0 KH03/K(@ -X0LM$0   0) K(K@ Pd0$KL03/@( KD@ -X0L,M40 , ( 8K "K !K09 K@0 Pd04KP03/K`@ -L,M\"K "K 04 9 K0 8K0@0 Pd04KT03/@8K|@ -H0LM$0   0) K(K@ Pd0$KX03/K蘛@ -H0LM$0   0) K(K@ Pd0$K\03/K贛@ -L,M 0 0\( 0 0$ 4K0 5 K0@0 , Pd00K`03/@4KЛ@ -LH$M   0 - K0,K@( $ xPd0(Kd03/K@ -H0LM$0   0) K(K@ aPd0$Kh03/K@ -L$M0 0D$ 0 1 K00K@, ( GPd0,Kl03/K$@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , +Pd00Kp03/K@@ -H0LM$0   0) K(K@ Pd0$Kt03/K\@ -T0LM% K 0  0$K@ Pd0 Kx03/@$Kx@ -D0LM% K 0  0$K@ Pd0 K|03/K蔜@ -@0LM! K0 K0@ Pd0K03/K谜@ 0-p0LM% K 0  00$KP P d0 K03/P00S@$K0̜@ -P0LM! K0 K0@ Pd0K03/@ K@ -L,M"K0\9 K$0 04 8K 0 0@0 00 yPd04K03/@8kK@ -T0LM% K 0  0$K@ _Pd0 K03/@$QK @ -P0LM! K0 K0@ FPd0K03/@ 8K<@ -@0LM! K0 K0@ -Pd0K03/KX@ -H0LM$0   0) K(K@ Pd0$K03/Kt@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K萝@ -H0LM$0   0) K(K@ Pd0$K03/K謝@ -L4M#K0dA K,0 0< @K(0 0@$0 08 0 00 00 0Pd0<K03/Kȝ@ -L,ML"K "K 04 9 K0 8K0@0 Pd04K03/K@ -H0LM$0   0) K(K@ Pd0$K03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , vPd00K03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , ZPd00K03/K8@ -D0LM% K 0  0$K@ DPd0 K03/KT@ -LH$M   0 - K0,K@( $ ,Pd0(K03/Kp@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K茞@ -L2B -P@`xP0Lt0@00d0L00L0 0 (0P 0P@f 0 //0L0/ ///0/ -L{ -Lt 0-@L][P 0P aP N0 0-@0L$ @ S0 -L^2B -0Lj -$0L@0j/ // 0 //0@-0S  0S@@0S  000C S؊:::::::::: 0(  0, 0 // 0-@PL#j0U K0h0[j -0L`p0@0 R R\ \PH P PH 0P@0  00X02(㈁0 @0,KUPP ,0(K0,000IPP (D,(妝PP (M(,(q( P$P1 01, 101--p@( 0,0 0 0 S ( 101-0 $0 S$ , 1 01-00,0!Q*! $R4S( 0S (10S(P{(0-P(U( $0Sa(0-P(,U( Kd2B2B 0-0L@x0S(0 p0$ 02B2BC@ 0-P@LT !0Bs3@ 03@giK0hg,f 0-| L@000H0 0mH0+ R;H00e 0-0L@0 ggK0h9 -LTM&K @ 0h0 0S|0V0 < K $P1/cKKt0婗)S 0`0l0 L0 0 40 L l0 V0p `R`0SAgT00T0gܥ0H $` 00` 0000h0S0H0PPP00H  02!20R0H P0&K%K/ 000D0L eK`Pp0ZK %K\0p#KSR&0S 0d bT0 P\0K gKZB KL >D0K040K0@0K 00i P P0&KKQP00\ Z00SH` eTd ` b\0Ht0 ) L NԅKXl  #K 0#@V H另h0S. H@`a崠PV㰀ʀ 0! `! 0    !H03/ 0!!`a0    !h h(Kd,,feeāe -LM000 $P@0  000 0P0 90 00 00 0 @f'K ?KR(K|\K1/K06%KP0  @bf܅Kt0S 0`0T00à'K X00 &C6 0 )KV0iKK0`l0 p0 'K 0)K0L-60  0p m0  P 0 KR vz1 S0 P5 0S 0S e#KR00SN L0KY  #(K 'K 0`|00 d K (K1/ h |00 \ K (Kn@et0S`0(0o`0 (03RSd|00 0S_ 3/\0Q  ,0KD # 0 'KP0  PPpp0P 10Cs  01S000 0 00R0S !LKLKn`00 O;e`xeV0S `09S 0*8 03/P{00 0S  L0SI F0 K?o20 'K R0":0 10 0000p0K0'K0 S<0 p0 0S~ T !#@P0S 0Sf p00S 0S\ p0R  0p0 'K KSR00 pp RppW   Hp ,0K( #  )KLp0P 0S( pd00 dfKp0 0 t0S 0`00 0 40 0 8121 0S  0P0 `0 060 )K V0pR0``0p R`0 00$``00000` S600L7 000@7 0000PfU &61z3'zzg@ 0 `Pg)K'KP P P 0S 'K K R0"VZ13@K000 0 P S:# 0RK0 ` Kgl0K0T0K0h0KK0 0`P0 00 l0K 0 p`'K P0V0 0 Kp`h/K'K 00LP00 P pe'K  Q0?KP/K !#@ 0%KSR7'K 00$p`K V0"&z0 b|0 20 00 c0 eR R# # R0# #c00 .)KKSR00 R00S㰀   |  0 a0 )K gK`Vp ᭯%K0h'K 0'K00a0 ` ,0Sz 0S ᛠ`0V00S! 0S` |0 1 000? )K1/`Pc0 R!0RJcǡ0wPc0 `Ipp0U*X% 3/o"## @03G0U0U0S 3 ᴥ3@ 3  3C03PHc0S &cP 0!0S`E 0V00S bV pb` L0KY  0 00 0S 0S 0 8 03/S 0Sh (K=#3Bdk2,f -L]MOK 0P0t1 ;101 ;0!0R41 ;0l1 |0X1 04!S0 0p1 0H1 0K0`1 |0K01 pWH0  ;H0l0S0Z H1S 8 03/ U Z% 0" 014!S` BpP lb ib`@5`0T 9 @ P 0  H bT` 0oob 0 1H* 0K?KO?K PA& 6:!#/1$1 ! I?KKK R000x1 H09 p+  d!  S00#3Bped*f: 0-@LP]0S 6K0hX] SS-L`Pp@ T W yKhs -LMpXp`P@{40K0@ 0 4/@P 0T00S4 i40V_ S_ $03/@PZpX@P00K0@ 0 4/@P 0T00S0 >00U2 V2 4P0P 40t Rp0S40P 0t0Sp0S P 4 0 0 $0 40P 4P @@@0P <@ @4P 2(K -LM `@ 0 WT  W 0 0004040X0000< 840 00(0S 3/B$AWEV -LjMd$@V   BV*H$V B 8$V4$,$V: V$V  #V BV**#V' #V# #V##V #V##V BV*#Vp#  #V # RH#V   l  p2Ve 2Vv 3V~ 2Vj 2V] 2V0CV*2V 20S20Sf/oKE/oKoK|PI070 0zDpP&2H"VV!)*8Ÿ*0 "6 0p$b& `p0 `6,:0 &00 Dp070IR0P55 0P 80A80A:o_K8S5E/.PIP@ |@I0$0 0S0 oKLP`oIPU 10IU $Kgdwd~d({dЀfdydrdAd@edAd@rdAmdedAhd |dg~}d(@~gd -LM@`Pl -z&**0"6 p0$a& `p0 `6,:`0 &00 B`P 0P 0${0<   Ki03 b<0V   `0 p`00P 00S V0t0  0P00a 8`p8V KK4BnAY4B4B4B -LM@*ZZ0 %6l Y|`0␀Q0 pH00 SU0=X0S 0 $Q 0p 0 01/0P )50 0BU 0 WUT0PTP  WP0PPP00U 8U0S T P00X0000 H00(K -LDMpQP; @@0<@ 80 d@ ` !  4 dKP-P`tX@!p0 ­@P"@P"@P 0+H X00X00gH" K/ ::#0 P057#/Df -@bL-"0\003/b -LM`@P 0S0hZ PP P ဦP0PP 0  u 0`(Ko3 -LPP 0SUoG`GP!P@ 0!QP@A`GGB -L M`p@P> 0S:U_G帐`G P  P`";+Ġ QP  0xx[ l*"K-#K"K 0K8/```GG$KB5B@"5B -LM@P7`PpB 0SA0h0S= p0 05p60T 00T 0T*0W h0200 Ki@h y@  @0 y**+* y K}d(@td@zd@vd -goPLF렑者p?@P_ 0S p51 CS!1 01 #G00$00孆BG0hv@FT0]ᖨ3p pPG၅'}F0000000 0H0H0$#0h0p0!"$0Pp$00p0FT00T0FIF$KkF;d -L@nPP0 0S0h R00'$ R$ jP 04P #go`F101pF$KkQ$00$KkJ -PP`L+@0S00go09F1 CS!1 01 0 $&cgFKh p-L M` KPᗫP! @P   @P  0E 0X  X :F o 00Kp -LMp@P/ 0S+UoE`E01S0d0S 0K PP0 h d00d0P W,1(100,1(1,!(1001`EEK 00-@L |JP K0h0E@ -RLM`@ R2 4K 4KUpP( 4Kt0 ` 0 B ^##\ 1p0X`ß% v #zf0( 00  $K p-LM@P`?P 0S 0`0 0 FKp;; p-LM@`$P 0S (0` 0600FKp;; -@L@`qqPp0T*0QU@WuP0oP0q,00US $KkմLfDf -QLM`p0K␐lPDt@T W 01S @ E$K aw K[wEK 0- L@d0SP0CSd0 hPh0`DUDU 0 -L`@P 0SU_D`D V,1(100,1(1,!(10S01Kh`DD -PUoLpyD0ATDD`iDKh -P@aL Mpp0 0` U AT Q`P00P`pV[Ip^hm]go10D~1S 101 fD0  ῧ0  ầY 0 耄l D p00Cp00S   0 l>DpWDDp0080<00pCO :(KDfLfĥ@@b5B 0-LdMP0 P`  4K(P0*R0Un:#K@-ᜐ堀***+0 <0 壻0 ⛐p0 ]o⛻ א} K g? P0 C>T0 l080 CH00t2Q *$K+%K*$K+dK&K R0`p 0fKdKR0$KV 00 S%K R0`p 0fKVdKR0 \$KdKSR%KfKSR<容P8CY6X3 0L 000o8s `V PZ`<L0 D 効PD L0 `boY 8Cp080Cp00S  0 MCTqPCpb9hP# HdHo 0o8Bp080Cp00S  0 %CTIPBp:9 i` \uP &0 d+/Pp @Xa5: 1 a!00*kp@^@ @`<0 T 'Np0P 0p0t0 0t@0BZ`Z90Z !D jD0< Z0`< j99@P(K;A;y5B|eLfDf5B@5B7f -LM0P1 0GK p1  1 00!CKlD 01 BBt@0K␐T+ 1S*0S#`z Kt K0e0K0  t*%K+$K0K tE/KK`P 00 0@``p00MB$K -@LRnP|p0T*0aV YP UP 2/ 0 @nLfDf5B -t@L`%n@T*QU 0-P(un@@ nnDfLf 0-LLn@@P0T*0Q  @K0hRnLfDf6B -LAQm m1P PP / mPP`0U"*Q  R 00 0 S h0 0P (Kh nDf|e6B36BPBPBTfV6BPf 0-LM41@L0SG $Q m K P8K KΦ P1  P  '   P R   PU 0 3/P  m P 8Pl(mK0|eDf6B6B6B7B<7BPf -LM#Kp0PN``p@d@T h0@d@00 @00K AY '0p&  0  b0 $0 0#K#0n !~` x@Td00Cd0 0@(K -PL M`pl븐0X%*0AT 0 000 00P*SR+SR UP 0 0 $W m(KLfDfd7B -L@PP`D@00#4VP<P 0ĥ@@`8 8#4`#/ -LMP` 790@ 0@P4 04$#4 8##<004$#48#x#<00p48 40 80 0 $4"40#4 0 0 $4"4 0#4 0 048 4 0 8 00 4$#48#(<R=0#<0ĕ ĕ0ąą0 8#Y!!048 40 8 004 40#4004 40#402Q W0!<30C(,00"0C!0CR0C X0KⰐ$0P 4"$4(!4"(0 ?< 9 P6PT3TX0X\-\`*`d'dh$hl!lppt1tRe0 lP lPN1 0EK1 @C?K0C $ $ C?K$ $ B?K0C$ $     1Q[ Q0 q0K q0 %K0 %K0K0 1 qK5P 1 `upgP 08j5 (KREMP7B7B@B7B7B -LyMPpPw50@P " ?`P xP0S W:`/rZ_K84_/K&K KT 00S1 DP0X S1   4 ,L`//H0/! 1 51G:!d51P @! 0 `P  $ qZ0K0pa 1 V`{Kץ ᢼPD wKΥ &sK~w/K&iKz0 2 2 ጼP27@2 , p0K pK" 0 R0%K3S0K6~8 iKpKLP]0KiKᇴPB0K 101 1p1!ST Y|0S >  Q#&-- ##?0<404<0 00080 X`00```0 (0 00< !,0 $0@000(040,0Kh0e$AWEV -(0L@#0!!`P 0S00/꜀=00CS$0"08 Pp$Rv:WPbSP1`0W     0PeP0005=$Kk|0e - JJL$F`!ɯPP+ 9@A0tpD< VL0@L@  VH0@H@L H00SP0 ==D<`啬@P3<0elf - JJ<$FLaY(p(0Q< ჯ@PU <h3  `  ᆮ@P< U `0V0S 0S 0t`Ul< WL0PLP  WH0PHPL H00P0< <0elf -Lp´@t`M4>; p-@ P  LM!P`?P 0S 40` 0600<Kp0e>4>; 0-<@L 01;,器P K0h00elf e9BpR d0R \0RX0PR :D0R/-/P-//|fwt@t,@{f@~fvt 0-LP!6@ 0 cP$ 0 -@ :D:L M#640 /oP"U R Q   B 40 SnH;I;I;HJ;HJ;HJ;HJ;HJ;HJ;HJ;HJ;J;J; SR ^PX0000 cP` L1jH&jzfWp!:0 0 u000 y  : _v0y:0`WV: #::cSP1R  P  0S00 R  R00  Q #,0zx(K$k>WeXe -p`L dB:0 ڡ@H0*P0v,P3y(0 @ɡdXe$k>We 0-LPM@PT  0TK1 0 ) p x0@ R  TKӶ@ 6[PP T PK0d9B 0-@LK0h -P`LP @0@ iXe -@LP` r\ 4 <0$8!  : 0蜧@ A00-LP@  R ȷ00000SYa/კ p- ::LM#P P`  0 ``" 0" K$K @P 80 @` 0 $< KpPeXȩ@ -P0ML00 `@P5@@0 VP* ` p T00PU0S U\# 0P Y@T  0 >`@0 00 00(KXe -L,MpPY ha j@T0 SP7PU 1 ! 0LK LK⻵P PP0UP00P0 P0S 0 R,#S 0 0 P ~@P P0R RS @ 0#@@ H(KXed9B 0-@0(ML 00@@ @@@ P0 0@0@ @@@S$K⦌$0  "00#0#$0  0$K_K09BXe9B0S  0 00/ 0@-@ 0 @  0 A! 0!0 -`@Lb8PU 00P@H0P00P`88@ 0-PP@LI8 ?"6Q  ?""R0PP{80 0-@PPL/8P0T0P0  T0  K0hc8 0-@L80 0R 00(0,000K0hO8 0-40L@SP 4dy40,0S S 00 000pf p-L M@P` ု7Ѐ& 6!:  0K$ 4 <0P K0 #0@0`0qt: 07 Kp@ -P@L70pAP!`0!x 70S60S50S0S pP Q 50S0, t705077tfdhV; -L M@g7 #7D0S 00 H PKhw 0-@LN750S0500S K0h7 -LM K$KpPP?z900@<00@P`01x00tƘPPPPPPP77dPd p7000`S 0 ,`>7@ 0 $KpfqdAtf8@ -`@Lp⥋ 0R\650St͘055076 R7 00 0S#P> 0 0 0 ( H/o6"Q R  R   BpPP #P 0S PU  P 0 0 P 6 9P60 00006 0-(@L,0S S 0  EP 0S K0hQr0 0-p`PLU V4@U@1 FPd`09B -@hPLp`E6 0S$0C(@ S  R (0S$0C p`Khr6pf9Btf -p@LMPK CoKậ`  p l 0` 0   0  P p w0?o2P0S(KpfQ; -pLM`KP` @ۭ0K\0 0`@0 0 0 0000 0L?o2P0S  BP (Ke -LMp0@0 0 x0 l0K | t0 pp ,@ T(K(@DT <0 S R| (<4  0 8Q 0S K3/ KP`a `WK00p00pg! 0Z ``!PV`0g?0 h5 0PPQ 0S 5,  0 )P 0P P60S5Io  00 00  qP03/Pn5Y p@Tq @Dupf -LCMP ` p 2S*   0S0 @(@,IK➬2I/K0000000$ q Q * KZ; 0 -LM 0  K> 0-@LP4 @T $@DT 0S (@T 0 0 0DBoP00h,5T `0pf f;d@9Btf:B -LDM@P T-xQ 40Б 1 @@Q묡 剑 ,0K@# p` 0,p(`$@ @@ @ 00SC 40p0 ,00! 1'.01 00(` $@0 @0040p0 ,00!0 000(`0$@ @ @ׂ0040p0 ,00!`0(`$@0T0 @ @00 (KpfqdAXeef[;1:B[;E'B0c;<:B -LdMQP ~q gQd000 0Pp0 ZX_VPUPHA30SPD @Cl0K00t0 T> V  W R- ( K,l 4 Kh K5 0g K6 Kf K8 d < ` \ 3 R< K t Gf3@V 1@ #lKgMP  f0 GrpSP @Cp 3Pp(Kpftf -X`P𝤀0 !`!800 ,  , !deeāe 0!< 0`4 0 ,   !/deeāe -P`\pL@T 00`0S 0003/lAKhf -L4MLCL `!(21(2T 93PX@ Uv3s00 @KP0 Hk3@P\p L0pW Є 0S S :S2P S :sS\2P D2 82P  2 P 2P0e H0 0YXi:  Yh(>0eY (0Z 0 0j0d<07L nPU  L尪0HpPP(p$QP@3*80@PS 0 U 0 APP220:03` 006/U P `03/@\0P@K ( X0T!(210#(2(KdXepfff -LP(d2$q@aTq@DT W20S 0S040@22@T m8 @T $@DT 0U$00(S P 00@@(@$Kk]2tfpfXe -Lp8`T@PP200(0$0,0d00 p 0$0 0$pS( (0  0 p `$Kk+2B:BpfXetf -L M0  "R:0 0 R  0(0\ $@ @PK>Z; 0p-LAM@K!$1 01 0` 1 0P! 0K囩?Kp -PL`0@ 3SH L0S0T 0H  0bS00S 00C0 000 ?0S  (  ( 0S 0 0YKhZ; 0-LBM0 0 0 CK>K ! 1 l K -L@P`A(000S  Kh/e040/e 0-@LzP K0hq -`L<"1@T(`1F 1tP101x00150S0500S pG1}A100000P =P 8 P 3P 0000囒P11 Atfdpf -L,MY@p1`01x00050St⭒P5P09W G9WF 0CW x9W p9W| h9WL0}9L9W& 0W+ 0CW>000>9W 9WU 9W* 9W-&8Wd 8W 8W#x  勰808W 8W0<0 0CW 0W 0CW060\8W P8W0@0 <8W; 08W8 (8W 8W8W 8W 8W&100PS0Pm0P[0$0"00S0S '0 S 0S 000PPO00SXP XX QB pHP :P Pp +PP`pvPP//䀔`ό~00XPxu/0S0i4 RXPP040Q/0S 00J/0S 0!H0 (21(2L 5 pW. Pᔥ$pGW* 0H R0S 0S P"00 @KP0   +IPsP0 @K(pW $pGP \4L!(210#(2\/Z/0S8 R2 |0 `V/ $`FV, S R (`4P300,0`0,0p0,0S  ,0,p` U  P0P40 PP^/r/0S  PPh /0 0Q 0A Q0S $3 P0 F0 0A0CS…R$PEUC pW(PU<HP0(pS`VP  P`` s.0U S 00,0P0,0`0,0S  0,`P.PPBЀX0Kp1WGl1PᏍ@P 01 0@1儍 PU0S0 010( 0, 00 !&(00,00!80000080<0@0e.0D0. H HPP7P(KdkB@|B@iB fB@hB tB@oB@f@wt@{f@kB @oB@{B@dd~fyB|f}BlB gBzBvtfBwBlBepfXetfL:B?B/P/ -LM K`8 8#4`# K0M0004  Ѝ/RQ/Q21 //0-00Q:cPaQ00 P^0Q0 Q    ( 0 0-L00Q:cP0aS00 P00 0000Q:cP/000/ -QLM`i P@pA0=S IS" %S S S SR P S SK 0@ S  Sx SAPS S7 S9 0@c(Sp $S  S Sc +%S 'S &0Su ,S -ST5S <S 4S dS !LS ES @S_ DS 0@GS HSE TS MS PSf `S aS \S@S |S lS tS 04CS4 SPS S@ S S SN S 0@$x 0Q" 0Q& aR " *0Q* aR @\ @X *0Q* aRS( KS( K *0Q :S( K(0@S1 @. 0Q :Sz( K(0StQPPQ @ 0A 0Q 0A 0Q 0僑 0T 0T 0T 0 T:T 0 01@@eU2 U.  @@$E4E 0o\@ 0@ 0C@d 0 S* 10U *01 3/R$K -LXMX0 L0KT0 0` \ ` KP0 { K -@PLPp pWp 0E S*10S0Sa<  10L\ ꀄ;;;;;Ѕ;0@St Sq S)Sm Sk `Ss0Sp*3d m0Sj*^P\[ \X \U \ 0\ @\ \M `\J p\\ \NCA0S>C0 S S S0S @S:  Y UY, 1 !0 0U' U#0 1 0 S @S T \ S0\ * Uu@@ @@ F/ -@L M$PK`@%(P I+쀟0pS @T 0&S QP,,0 \( P0Xe+,P  0R0(0  0 ^U+003/ Kfe -LMp`F `@* 㔠0PS [ R.+10 0(Ko/00 0  @@@(Ko+fe/ 0-(@L *+ 000f~:Be -@L`*0lP0@T  0LR00 0 *p7/*Kh*fe 0-(@L*00LK0h*f -LMP0p嬀OK`0c U*0cN,K` ZN&؇PN,K Z`2`7N`5,`KY:`3`5 \L,K\5@ p-K% (Ka@:B p-AMLM0PS`@ 0S0S08  ,BK0 0B>KKp:BAA01(!("/d0!(21 (/d/QP////////0 00/ /Hao/  0-L@ᓡ< 00 -`PLMp@KP@0K f\V\P E0S 00C SPU60S 0Ѐ0@0K@T  &P  @0S P  00C ^ R0 0fSW@0[S <)@K'$)Z@@K(K:Be f 0-@3L08@}j8(0PU (0S 3/XP0 e -L M8 x KD7e -L M8 a KD7e -L M8 J K6e -L M8 3 K6e -LM8  KD7e -LM8  K6e -L 7 0-@PLP 0S00P00C060 0-@L()0 -0pLMPK` @0 孠\0`K X`0P@ 0 0 000 0\` s?o2P0S(K蔋; 0-@LF*(K0hq) 0-@L(7*K0h(0/ -PLTM` P P0P 0<0804P0,`(p$@ @ @}v 0!<0<8p0x04P00<,`0(p$@ @ @0 ev(Kԍ;ߧAD;]A0;;8A;A;:BlA:B:B -X`P𝤀0 !`!800 ,  , !deeāe// 0!< 0`4 0 ,   !/deeāe 0-LP@K0h -LP pY@0@T 00S `3/adX@Kh e -L@P(p`S' 0Rl507P00 000SPPPP000~'U( 0 ( ) 0)3  -PL@U y2`S 0C8C8S25/o0S 0$KhՈd -`P嘐LXp@T 0S0000C0JT %( 0P% 003/03/f -L?C L 0 H;A|;|e -@L &P0 P`0&D LH`@ 80P MKh f@Xe:BXe:Be -L@M 0K #0,(T L$  u 00S  K;:Bd -LM0   KA -LDM0 S$3!^00@p`(0200p,`$  00KtP ] 0!00K$  ,p(` tP 0!`2$ 000K ,p(` tP0 0 0!2$ 0,p(`40K0 KtP0 0 0!1$0'> 0,p(`40K0 KtP0 0 0!x1,p(`0$ 40K0 KltPD10S Wp50S ($p$ 0 SS00%000 P @   R oR 0R<"82oO@`?S `<2S?82<2_S<2O@0,2 "0 2"(K:B; e@XeeXe f6edD7e%5 D3-QL@P 1Q 3Q& 3Qp 3Q 2QN D! !2Q g0CQ `0Q@1 2Q 0Q 2Q2s΀!LSRi  \` @\ @` \ 0\` `\ \` `\ \`(`\ \0`1 0`13J'3 1`1 3`3: 000331H0@00 ?$8 h8 ch X *u`$SR L0d0S t4iui iivi ~iiipd0LXe -0Lp0SoCP 0SHB<2S oCVD@DT 0 R H@T&P 3 P 0S u&P fp; -L@`P@P @ -0L`PU_Ep0S`6`V 0YK$Kk+hf -LPpH@X`"40 0 H ( pHBT D@DT &$P H@D0CS   Q H0S$Kk0H2L0T v f& 0-@L  K0h 0-@L  K0h0P/  Xe0 R0/e -LP 0Rp; 0 - 0 41<0R4"@ L(R /.\1`1  DK3(p  WP0 (K D ` 000$KHfLdGdXeLf;B@ ݆6e5dD7e< e -L Mp03K3PA0AS`0 2@ Rt R R RA R ,K@0,  $K  0$0K^0"0K0# K0!0K0 0K00K 00$0K0 0)/Pc0@L CK 0 %0Q3K@e 0 u@_@`L  04$#48S 0  $K⬎000 004$#48C80CS=P23K@;0   ,$KⓎ  30$0K#0K0"0K0!0K0 0K00K 00$0K0 0P #Pj@i1@ $Ko0 43K[/@R3[S0 )0(43K00 3SH L0S0T 0H  0b S00S 00C0000 p$0 00S$  $K(  ( 02 [ 1 [  *T ,K ,10 0 0KDO P 0Q 7@0P <$@K踨@;B -QL,M`pA!(21(2P @KpPPT@ 0Z 80S @Kf00RZ@K_\220 0I 0t\2TH0 t" %\BT@KD@00XBpT 00 ẍ ඍp@tpH0 S 0L0 0P0\0P@Lp0 H0 @KH0pT P("! "("(Kd 0-PL@80:H T0 "" C C   C00@0a@ `f 00-800:00@10 L@$0000%0x0 %Q 0 00#0x0X2H0t 41<00(0K0h/ဖ;;@f 0-@x0L0p0003/t-XRU 0S  0 i\20C\2t]tQ0%5f0<P  0# ! #2" ! #2"/Ḩ@0@-Q  @ T 0.0 RQ0@-@@Q 00A S PAPEU07009Qa0AS A7A00C Q PAPEU 9S0|0S0|  @P0 0-@L p K0hl 0-6LP@@,03/ 0&@P@ D&! R!@A00006@/0S   6@ H0600C0/ -@0`0LP 6/P >0|0S0|  P@ -L`MP`@XK4 pἉ980"lK Tp .%PH 0P S6 00p0K0 0XKT 0P6P4 P1 R- 20 4 0`p0Ѐ0`% R 0`px0f06;0 +  & ;00X0p  0}+P00p 00$Kdd$ -@PLT0S PP `T0P`P0CT0 0- L⩶@P ;0xfXxf 0-6L@ @& @0@03/PsP ^sPx00Cx0x0PSL0S 3/H03/0Cx0>0 -`pLP(=0 3/@( >T3(=0 8/`(=V @x00x0= -@L=@T 0S` @`0V 0QU pu=a=P $Kk=xfhf -d@LP`p^=@T 0S$0 9/@ $Kk=xfhf 0-PLL@P0  S 0(0<0 0@00$00800H00;d;p;;; -0@`PL=0`0Khs=xf80/ -@L`p=@T 0S @0(< (P0(Q=U P K=xfhf 0-LM0@PK0%0(< TP |P@03/0(,=P |@K0|; 0-@\PL<0T00 T0 =H0K0h/xfhf -@Pp`LM ,K0(,p (` P <, K\z$P |P@03/0(<$Q |P403/K;<0/@0/40/@0D0/// -L0,00@001!`Xʀ0 !`l!0d!`  , !8巾/@;P P % 0%(`ph@7@>$ 0R00027@% 0%(( ?(P0S@@0@00I@9 `vP<  0S40pS00000p003/ @Tp@ Y Y!  P 0 PPSY !0@ $X&P@@T@@ p 6i(5i -P@ LP u` 0#U0V00 yu000<" R R0 0/0/@@P P /P Pu//N//0H00fXe -`LpB @ R @P0Q@P0U PP|l P0L X0D7!P Pႂ@00@0pi@O XeXe -P@L`p P0L Q@0D 0@P !R R 0AP  σ@00C@0@h  XeXe -L$M0("L0 @1!("H0 Pp@@KD P`@0PV*0 3/` @KL0H!(210#(2(KdXe -L ~ 0Xe0d -P@L `ᬐPp0U*P 0P l=LLPEN`P0V0  )L0$Kk 9eS K0@-@ S*@!0`@P@ -LMQ`p K@ t ` P0K` ᒀ0 0000T@ DP 0 00 S`ע$K<- 0S0!Q\ ^010 BS   " pf0 S 0P* \// -0LP@`T  !@PP& 00 00 00P`0@pf"0000 ( $#0 0  -@LP`p$ 0 0  \* Y000 0e PA L `0S@1: 0  000 @ `` -L M4r@`0T@PR UU E^} eY}`X*0V FS` `hUᨡ0S` (` R do~` 0` @ P@YTB0PA@  0p 0 P~ }0 0 KZ00@S`P ヸ 0 SPU:`0 0 0dQ`F`eoo`bPg10V0 00 0TPÆʛ(Kpf0eB|f >B0e*>B -`LpP@-)6,P ` 000q100S0@@P -@P0`LS   00$0@ᴝ 0R 0AKh`hf1/1M/ ( --LMP0(0 0`@T> !0R81S R2P wP* P oP"0SU 3/P0 2P 0 )P  +(P@U 0 )P($K/0 z0  z -PSL`p 0S W1 8@ 0 0 03/@P 03/W@ ]9@ -0LS TE>BQ0P//@-0@ S0 0 P44 04:P*@ `$z -LM40@0P  \ \ S R KK ᩀoK 0-@LP 0P P 000000 f -00L@SpPU 0S 5`vP 00F0 -0`LPU, @T' " ?R00S   0 0R0 0 8s03/P徨0S0C08ܲP0$$ $KhcfdfP>Bd*^Yef\ `P/0 !`8 0 0 ,  , !/deeāe 0!< 0`4 0 ,   !/deeāe -L8MPp`cP @P 40 8rP! 0W! 4 PKx0PK LP Kf 0-@LLPQ Q ,0 P L ,00,0P,00,0LL@<0S0P0K0h0 0-PLLP 80S 3/@P 0 p-@QML  @@ܶ`0 0@`00c00@P   @D80 0 `0@@p^l0 (d0 `0@@T @@Kph2Yeu>BXe,<}>Bx@@XA>B>Bf>Bf)<A? 0-@L8]4 ,00S TK0h0Ye -Lp`Po 0S @P0P@)@P$`P40 \H0HPD@@T L0S H@T D@DeT 0 0R > )`P {q@L -,0L`SP(U @P UXPPW 0Q FWX 0 U  0 rP@ 80S 3/@P 000,@S 000 0-@LP P 400 C 70f 0-PD@L 0 PR0;00 K0hYeYe -40L@ 640|x`PPpU @D`T0P`@10<`@嶵@YeYedXe 0-<@40L@P6400DP0T0CK0hYe -PL@ 0P 000P 40 P %0 0f0 &WV&ā 0-@PL8M4 HKv04 HKD0 00@0 0<0 H0S(1040 L0000 0 K0 -LM`pPU|+@P`000P 00c00Y0P  徰  `00@P  v0 p 000 @D0R 0K8eYefx@+<>B@XAd*B/ -Pp`@LT8 0S0@S   0 0R 0 0  0S0C0x( ,v|0`P "p00S0  @ P 00 0@ @ 000x@P7>Bdfzx u/0@-40@ CUTP 4000f 0-P@PLP P0 -0LPS`  Q@@ jP  0-L@PQ P 0P C 0f -@LpP`P hP P U 00U00PKh 0-L⣞@ 叞0$,< 0-@LPP P {h0 -L\M`pP  0"PPP P0S@T TKm|K@PP3 U (P H$QP&PP7hK&P P@KW R R hKPh K hKkPh KPP hK]P  R h0K4Z U  P@K&PbUX @KT|K @L X  R PX (X  8/ HPT|K qhKnU H0S PHP 40( S0 040L0S (0S  3/X@  R@ 0@TP @P|K7@K` TK](K -LM@H0 `0 (0 0 L5!(21(2 0P0 0 0PT T  T-jV  K 묀KT` {P  @P 40LP0U40 ,0 P,00,0(0S 3/D$Z(10(1 @8,n$ A 0 APU 0S   0 0R 0 0  0S0C0W/V 0 PZ8m PT`,pW00 P K KP pP00  N@P s0600400V0 0K 0 0P P 0X P 0 00SPעmPLp<0S0P0$QPPS;P 0 0H0ἀ W1 `P vK}h坢4(0S 3/0S KK:Z @8bmPp A 0 AV  K묀KTU` sP Z 8Dm 7`0S KP`3`P`pK(0!(210#(2 (Kdff>Bffu>BXe -PLTMptK@`Pi  $30#P00Sx cPA xX ?0P7x0L0V3xP 0S 0S40 A)  4 `Kr0, K@L0"`K8@ \p XP T 4` Ax R4@Px @4  4 ȠxP XQ0 fX 3 Z  4 `Kr0 D0 `K0\p XP T v tK+(Kfff -@Pp`L8M4 PKur0 PK(0 Lp H` DP K 0-LMK,@PPcTK0 0-LM@`P0 PQp R KpK50P L0V TA3=4 K)r0, U0 &0  KK0 ` p @P Up U U (0S K3/Qp K p-L0KN0KP`K4[ :K0[:1 `V Qr0PK3/PPA` 0P  dxKEL`T`@T< q0@DT8 80S1<0 Y S R*d dK)X0S X`0 :/Z  Z U  dxK)0dKxK F `P0 dK4@T0@DU \0x`d@S pW `07/ xK xK  (Kf eYe -L$M@`K`@P0pP \0dS Z `0 :/@P0 ј 40  ʘ (KYe -PL M`p0 UV 0RY0WV0WSUVOW W JU 0SEVG 0SU 0S;V= 0S694@T; 0@DT8 80W<00 SX0SH0 S 40 x`P40  Lq`PP0 S 40 f`P40T _`P3 kl1@(W W<@ "@lM|P H|P@E B|PD? 00@ 8p<000D W0 W@0 0P0D0H  L 0@0 0P0D0H  L 0T0 HY LY PY TY 0d\00`0d0ٗP  @P {DP {l{(KYe -pLPW` U U l{l{@P l $Y0d8P`000\0S  L0 R 0L0 `0:/ H0d@K A4@T  (K:0@Ye -p0aL@T1 0@DT. W*80S1P S0PPXUoP 0̀0兕0 D@3/0P040S0  004 0P00 4@id/X0S@0@zD0DzlzYef e P-LD`P@EBf]EBfp̉-<0c (0 1 , P'008吃0i319 31 0a$K 0-0L@S 3/<K0hp0- P, 0C 00/3ep@-P@R`0 d @   ` p@/@-@0n   @/ -LMP  `p0H00000YVP P h T0#03V``VL00V@0, 00T0 $Kk/$K<0S:0Si6KQ 00 U!00AP@` QS u@P@SUQ @00u0S0@cT  @ U0S0S030C0A`(K -L M0`Si  P0@p T0S0S01T Q1 00 00 THUPR000A  Z !8 1 1+ 0,0 88 0 00088 00<00!  R'tR 0Q   0 0 0 00000(K/00SR080// -QLMp@uR㡠`bo Z! 0W:d%  40 0 9/0 P40P0h(00 9/P00 U0g*000 0  BS0 JQPpG0W#:d(  80 4 9/4 P800e% PERP40 9/P40  PQe"0Ud(PB0  0 RW d(K0 R R0/ၹ@R0@- @@0PACPAL PP \ l0S d  000-@ A0@S0 AC^ 0SPc 0-L MP@P0 0S  ?o2 P0S  e! 4KIx@D0S  K!0 0R0 0B@ 0S K0 \0eK0蟹@@-0M Q+\C0 ܍@H̍^ SL \\P 1N0C0  QS\Q Q܍R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@H P//R@-0 @\ 0ct ^00 0-L MP@QK0hE0S0 RQ!  4KHtPE0S  K!0 0R0 0B<K0 \0 0SdK0觹@8@-@PDD8R- 0\ n 0  -@']LM@  lyH8 uH 0<*O* S47 0:=B>0CS)嬁<:0<: R *0010#210  Sl2l"cq'0&F#~`0D"`p 0SR"0F"0F)]  0 g<:0<:` PSZ0$p0`)00 00SWPU R0 tL<: 0<:R 0## :0:pGw R0) 2<: 0<:R 0%"P!:ؠ0:`̐p: S 0 0) S  0 0) <:0<:`VpPUP G< (K2f'C@1JB?`JBJB@̺@JBKB -<@L8`, .0P P@3eAR*0S  b/-Q*  a0@-Q O @ S A @PUT0C0\8 C @PUT \@0 R( ^ PL_UQ)@A,à0@8 0@ 0@ \\QPAQ  Q00@000Q 000 -L MԀ`@PQ4PKT0@Kc0 QZW Q V SR:SR0S"00 SR"0305* SR(K -L MԀ`@PQ4PKT0@K0 QZW Q VR V0S"00 R "00 V(K 0BR"S-LMp0妀P@ `D TV``0-TP@` +T@P00T00XS 00 C R A BRP@pW0Tp p ?"KD K?D00 D ^@a DRW@DA DR 7@DW#KQP 0 pY SE00\00S(0, ,2".0@0$K@fKB -0BLMR"S8 < 80xx%@P E UX0-U@P +UP@00U00XS 00 C R A BR@PY0U X`q`q ?#K|D? vDX`p Z` ipj00 E \Pa ERWPEA ER7PEY < R@ S@D8@<0@9X P0,QP00Z00S#004 42",0RV0QP00Z00S004 42",0P0<0S(K@fKB 0-LP@0000 0c0  2 /UUUU3333 @-A/ 0SAS/0-$(0@# A  A A A0/Q1/Q!/Q1/Q!/Q/Q/Q/Q/p@-@P`+ VPpR00WA B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/ -pLPW @@`P W P ?P0@- R  0P@^^00T0Q@-D R  0 B 0#01,#3 P `eP  P,, A ,| ,Ġ 20 ">< 20 80?"10 ?8 "10 ܋K+K " 0#80< <30 <8 30 ,K " 0#$K܅K&K " 0#܃K K%K܆K %K " 0#܄K 0܈KKV&KK(K'K)K &K'K$K&K$K$K%K&K#K%K%K#Kd0` !   ! " | #x !    ! "# ԍKlK `& p'  ԎKhKmK!`& p'iK`hKK !`pԉKhK`& p'LH! LԆK1 HnK L Kp'H`&L H K !KdKK`pK !hK`p`  0'K 0'KT0P #>21 ">T 21 P0?"11 ?P "1 1 A?K`C?K p'P0`&T <K31

 ~ b>p ]>0P0H >@ >Kh -PRL@`n @$ p`UP: >$ 0QP$$ 0$PPg` {>$Q 0Q$U@pP &gW$$+0 SR$$ 0$pG T> $+0 SR$$ 0$pGgW#SEU  P9>0QSU$ 0$ -`PLP B@ @@T = 0-@PL @ ( > P= 0$$0@]P -`PLP @ @0T = -LM@ p lK=p000 p000 p00t0 p0t 00 p000 l0ctc00?SPp@p` @8R?0UL@p gKh-8 p-L MP@0$`KS  !1" 0S h0~? S P U 0 # !1" 0SKpzKBX@ 0!0 00/#EgvT2ܺ -@L\M@ lK70 lp0 0# hd0# X 0 :  b{p  ` " " \b)pak#!c; ȇ" !b+h,!lˠ (!0Thj0 0# PP ` \0*0#L  j 0%0#H e[隀0! 0#D0a ) " 0@ ic9 . P pmvmzNS\lˠ p p p' h`  b,p!pp'``a`jp"pp' @b+ lɀp& pp'fk` p,pp'llˠa p p p' X`  b)p!pp'`a`fmp"pp' db+ ˀp& pp'8fk` p,pp'Hlˠ p p p' P`  b*p!pp'`Da`mp"p p' p4b+x&0 )fk`' ,g{â0) 0#  =D i ,\!`lˠ`f # "phc;p+P!XP% a iZ" Lb+`%`&00ciP0e[ ,a͂T` 0& 0#  b .,4ğ ",xğn  #, \ğ$ 0!,0Dc> .,᪃$ " ! ğ0n #!  Ď<# 0 * "0#c> . " #ꪃ  , "n#  # ", |#ā 0 * "0d#c> ! . L*,.0a #. ā0 .$0c=  *  b+) ) Ł (00|c=  ( `0b+ ( < ( (Ł0 (p0c=p p'  pb+ ppp'0P3: /M?0VG@P eKh / 0-@PLMK " !? 7R8 bx b8K  X K0h.@0S *0@,Ġ@@,̠@/ 0G- P @@M`p hdp`pRl`0@S0`. `0`&`0n,0!0 , 0 " 0*p0&00#0ꦠ p`0! 00#0`> `"``&` `*` `&` j #  " ꦠ ! 0 " $0. 0&00#(0`0*0 0#0,`:!`"``& 0`ꦠ  )4 鎠ܔ #  "8 0 *  " <0*0(00# 6   hꮠ D    + 0 3陠0  00 3ꮠ0  00ਃ$0 0 40|#苠 00   X3 陠0 0  00 00#>    (#    8"苠    崒)  0 0匒>   ,d   <<苠     ) 0!)0> p(p'q pp"p'芠`#`& p a(ᘑ`0`!`&0(`>p `(`&`aX`p"8`p'芠 `#`& p a(`0`!`&0$`>p `(`&`ؠ`p"4`p'芠 `#`& p `(ᘐ`0p!,`p'0> `(`&p``X`p"<`p'芠 `# `& PȌ@P @@ЍyZn000 0/#EgܺvT2 -@`0!L0R00?@P`000Vp>0P3: -*?0V$@P eKh, 0-@PLMK  !? 7R8 bx b8K  X K0h,@ -` a!`.4 a !  `8 8#4-`D#0`.p|PL0 40E h4PE 40Ed^40P00EE0E`VP@p@$DfC-p00 C Rh0S@ P 0 XR@P@P0 `L 0C YU8@CT\2"0 BUUP0C PH A@PC.SR^9* 0S P1 C S\<T9 g^ ^ ^R05,1:R*08<R08<4 Q b8"8#4b$# "40"8",0   a0CSa0A00c"0@ Ѝ -LMKwP K/ -Le|KB-M Ѝ -LMK2K K -LM2 KQ:P:/// -L@p/@-HX $H%X&XhȠ&h"Ƞ!&H%Ȏhx$Ȍ&  -oO "L R0# M$K0!P2K P!KQP:/// -L@  B?QR/ bQ20" /PQao@`/0`o `/P0aPo a/Qoo /@-p@/ ?!BC @@- p@ P` !LN3 !@A801  32  3231 0S00  b0/o/ Q-0aLP( P! 6@KB 0-@PPR0LT0( T0! 0$@KB000 0c 1 2  ?/UUUU33330` 0@-tP@  P00"AO\#Q@ P0 ".!2,0   0UUUUUUUU33333333  P-L  `.@ LB QP-L p8@NLB P-LP@Q QP%t t/?` !`bcQVʔRV( 0a~V 5B@LB -QLMP@P`pSR!B SRQP9% l $ R0%Ǐ0"K & R0'0#K"KR0#KR0\ 5#PP#K q("KP0@ 0 r0e("KP0 5$KL@LB P-LPQ0/? !@bcQTRaT00QP -L B,QPP-SR%0$o P! " R0#0XR\pVV  r0(P 000SRQP Q-0LP( P! V@MB 0-@PR0LP0( P0! 0`@VMB P-L ? cj@MB QP-L / !Pt@MB / RC/A 0\R#R! R/`o `/` `! / // -L Mp@` PU"*T 4 0 }00P 0P4 @ Q !Q P@0W VSP(Kyaratcid0S/0S/ 0-LP @P  0P 0 -L` v@P $pPP $PUP g000000/ 0-0L@0CS00SP$Iq K0hC0 H0-L;@P 00a0 0-@PL P 0@0Q0P/0S   0  /P/0S000// -PLPp@P U *`P P 0-LPZ@P P00 0-LPW@P Pr00 0-@PL00S 0Q0S+P 00V0 0-@PL00S 0Q0S P 00<0 0-L@NP0  S* 0  0 -L M0@S,0, ,0((0r000KKZNB mA=BNB p-L M0PSh0h h0dd0X@@DT@` 0T*@rHKphDKpWZNB mA=BNB -P0LM@40 pW `80K`0 K QPR 80SX@=`<0K4 KC800`P04` 4S S ;Y U80 4 6P4  4( Y U80 4"NP4   4 PY4 vT4 PP  4Pp(K -L MPS@`p @ 00 P@ roXO@ 0j@ K 0-LM 0 K 0-LM 0K@0 K0KPP 0R0 R R   P K0 -LP`j @P -LP` @P -LP`6 @Pp -LP`w @P^ -LP`3 @PL 0-LM@0 K0K8P 0 R R  $ *P K -LMPR@`  00 P pWO @ K 0-PML@P0 P TK0 0-LP@PwTO0 0-@LM0K@ KP 0PU U -K0 0p-L M`0 @PP GPOKphKp0= -@p0ML`0 PP *PO KhK0gnts0atad0rbmn0loob -@LP` 0Kh{ 0-@LP K0h> 0-LM@00 KjPPT K0loob loob -L@P`X 0KhG 0-@PLI K0h 0-LMP@ K@04P U T |K0atad 0-LMP@ K@0P U qT bK0atad 3atad -L@P` 0Kh 0-@PL K0h 0-LM@D0 KP PPOT K0atad -@LP`{  0Kh 0-@LPm  K0h 0-LM@00 KPPT  K0gnts 0-LM@00 KPPT  K0gnts gnts -L@P`U 0Khv 0-@PLF K0h8 0-LM@D0 KdPP TPO T K0atad }rbmn -`LpP(*aPP%  @P x0@l0W d0WV@`eV`T yaratcid -L M0p10@0P 0P!PP  ) 0*$K.`0!  1@P` (@P(0H%V Kdyaratcid p-LM@@@P@`T *0 0` 0  OKpPBPBte0 qyara0 3e0 htcid0 3eQ_/yara003eQT/tcid003e / y/ 0-@L㦢P0 @0000迢/// / 0-pPL0@0S 0 `V  03/P 000 0PS 00@ 0-L@PP00PP0tcid 0-L@P 0P00loob -PL`f@PP  P  0-LP@X0P 0PP&0-QPrbmn 0-LP@oX0P 0P P0P0rbmn -PL`@PP  P -PL`@PP  P 0-LP^@'`0P 0PP00 QPrbmn 0-LP;@X0P 0oP nP0P0rbmn -PL`&@PP  ?PL -PL`!@PP  +P8 0-LP@`0P 0'P& PS0Z0!QPrbmn 0-LP@X0P 0P  P=0,P0rbmn -PL`@PP  P  -PL`@PP  P  0-LP@RX0P 0P@P0P0rbmn 0-LPi@2X0P 0P @P0P0rbmn -PL`T@PP  mPz  -PL`O@PP  YPf  0-L@!P $0P 00gnts -PL` @PP  3P@  0-L@P $0P 00gnts -PL`@PP   P  0-@RL P 00 0-L@P 0P`00loob -PL`C@PP  P  0-LP@l X0P 0PP0 QPrbmn 0-LP@L X0P 0P P0P0rbmn -PL`n@PP  P  -PL`i@PP  ~P  0-PLG@PP Pn 0 0-PL5@PP P\ 0 0-LP6@ `0P 0KPJPw0~0 QPrbmn 0-LP@ X0P 0(P 'P`0OP0rbmn -PL` @PP  P  -PL` @PP  P  0-PL @PP  P 0 0-PL @PP P 0 0-LP@Q `0P 0 P P 0 0!QPrbmn 0-LP@/ X0P 0 P  P 0 P0rbmn -PL`Q @PP  uPw  -PL`L @PP  aPc  0-PL* @PP }PQ 0 0-PL @PP kP? 0 0-LP@ X0P 0. P- @PZ 0a P0rbmn 0-LP@ X0P 0 P  @PF 05 P0rbmn -PL` @PP  P  -PL` @PP  P  0-PL @PP P 0 0-PL @PP P 0 0-LPi@P P 00 0-L@{P% $0P00gnts -PL`C@PP  yP{  0-LPJ@P Pk 00 0-L@CP $0P00gnts -PL`$@PP  APC  0-@QL dP8 00P0/@ mA0@-\ӤP P? P P00P"7t@tDT\@@@P\P( P P" \:$$  ?o23NP0T0 NUT:xx0S000 -pL0@0ŅPV 00d  8 bWP@@V<0P0ŅPZ X?4@<PQ< 00 V0 4[<0 ŅP, 0S- @0 S*R00P c@l0<V>0@0ŅPV 0 8 d40 "W40PX@P @VŅP Z@VŅP,040 0 Q<040 0i 0S, H0S)Y P<0c@0@h00 0V>0@0ŅPV 00d  8 VPY@P@VŅP000  0 Z 0S H0SY P<0c@0@h00 0V>0@0ŅPV 00d  8 VPY@P@V=00ŅP%Kd 8 VPL 0@VPS# 2Z H0X:Y<0 Pc@0@h00 0 V>0@0ŅPV 00d  8 nVPZ@P@V#00Ņ,0 P40 00 RD q D 0 FQ :Q =Q SDbQ fQ| MD0 $H 0  SQD0& Y P<0c@0@h00 0V>0@0ŅPV 00d  8 !VP@@V<0P0ŅPZ C<4@<Q  R@ 0<  V< 4 [@0 ŅP) 0S. H0S+Y P<0c@0@h00 0V>0@0ŅPV 00d  8 UPY@P@VŅP000  0 Z0 L0 L0K X0 %KP 0%K 000 L0 0S  RX0% Y P<0c@0@h00 0V>0@0ŅPV 00d  8 UP@@V<0P0ŅPZL 4@<Q  R@ 0<  V< 4 [@0 ŅPT0RvD0=S6 0S) H0S&Y P<0c@0@h00 0V>0@0ŅPV 00d  8 OUPZ@P @V=00Ņ P @V=0><040 000 000 0S R@V,0P)H RY P< b@ @h0  V> @ ŅPV D0 00P d 8 UD0Z@P  @V0ŅP0 0S0 @V#00ŅP,040 40<S @V>00ŅP@0 0R0<040 n D0FS"(KNBAB 00-LM@0@K0/ -P`L@ 'T -`pL@P T -p-PL`@  TKp 0-PL@ DT0 -`pL@P T -p-PL`@ TKp -`pL@P T -p-PL`@ TKp -LM Kx K -L M`d ,s0@ S( 00 @p@g@`F$p`pdt'PdPgV%@g@e%F$pepdx'PdPgR%@g@eA$pepd00u'PdPgে% 0CS P S S 0\ 0X0TpSS S S0|0x0t0p @XSV S S S0L0H0D0Fq0@ \ 0" P L@ Pp@g@eF$pepdt'dg৆(@g@h(F$phpdx'dgূ(@g@hA$phpdu'dgে(\ P0 L 00T0\0L 00p0\ 0L 00@0g0e6#pepct'cg!0g0a!6# a c("cb!0b0a1# a c%"cb '!0 (Ky7@0-P@  P 0S RP0/P0    PP0/0/;; --LM 00S R KS//00// 0-P0L@Q P 0< 0 P0 0-PL@AQ P0 -@`PL 0U* P P<P P >Kh 0-LP<@P /P P >P K0h0 -@`PL 0U* P P<P P /zP >uP Khn 0-@LPAQ <Q >Q &Q 84rP0Q0OBNBNB D0-L@^P ,hP K0h908@OB ,0-L@xP K0h(0+OB 0-L@P  PP00,0 00 -pQL@P b  0@0S63<P 0S !S0-S0E?o 2-R0SP/S PEU0S0(0P(P` P 0B0S0300#0>R/R  R`0aW0 X P0/S0P$0(0S0$00>S 0>S0 000 0?0S  0@0S<3  P   0@0S0>300#=P00S P u b 0"Sp0 S 0j "P P0b b  >R]000@- PPU <P: &P0@aT @mT@pT6@;T3"lTtP,;P)<pT$oP!sP;P' gTtP;P>Q ^ *SU0qT 0uPoPtP;P"0 Q-L &o p-LIMPIKj`@ R 0 P @ T@K?K@J/KMKIKyP' @,1 MKIK(A4/04a  MKIK3/P4101  `K?KJ/KKIK_P 41 0K,1IK(A4/P 0141 0Kp@ -L@,hPP, `@@ 0B0S63 @<R p P 0>SSSi XP  DP @@@BP @OB"OB1OBK -LM0 IK0a00S 3/@0P P U7 5/50KIK03/U` 5/V*  V V$p01(1 (Q00S 3/`0@ P0JK03/PT 4/T 4/ p003/0K0 IKPK -LP[@P) PP$0SP 0t P P PP  0`P{P’+OBeAP0/ p-PLKM8 IK< GU0nK00@P @[0 P`000U L fl@呙f -$L0S 47 Kh@3e=f 0-$@L - x 0 f@ -`@PLU 0` q|PT`PE¥PT ` 0-@LK0h 0-P@L@EiP00,S<S?(fff 0-@L 0f0 0C0| p-L M@P 0R S ḏlz?1`P` 00 CP 0 0C0U`Kp f -p PL`n@P U  !U @p ၏ -LM@p `iPk 0P080  xPP (0SY+0  kP (0S$PU00 (0KP (0 PT6P  0P P0$ P $K@ A = -PPL@` `0RVp P@@Vl@ 0-LP<@*P P K0h?0NB 0-LPŎ@P ,00$000P00 00== -`L@&0S|,Ko0lP> ?o2S7*@q0S3P 00 0$+0S& 00R"P wP P -P P 0  03/P PP V @  00C 0 0U* wP P@ @l@ A 0-@P@L 0 0 0K0h -@PL& 0R$p`PP 0U* 0兑ᅡ   0兡 0P 0000l@ 0P-L 00RP 000l@ 0-@PLY000K0h 0-@PL 00RPD@00l@ -@PL` L0RP.0S@#*4@l@ 0-@PLT $0R@@j0l@ -PPL x0R@`0V* 0upP `pHWAl@ -@PL` @0R P N@+l@0P ?o42 R  R00 S5/l@ -LM@P 2R0p0 K  PP @,0S *48 PP s1p  P,U <UU@b!;P`   P| tYPP \KHP8BU 0QV`P` VP 00 80 J P 80S0C00 ! F 0P 00 bF@ b!7 00 0Q 00 1 000000@k(Kl@3e=ff(fff@ -L@TP`pᗌT I 4P @0 $Kk7000P- ?o42 ^0S00 Sl@ -LM@P`) 0R%P0 K0P 0 p`  b! 00C0000Kl@0P/?o( 2\0S/00 S/l@0P- ?o, 2^0S0Sl@P/ 0R/@0P- ?o, 2^0S0S@ P-L`Pp7 @TP* ;  6 30 S @T 000 0  00 0 0P @pn 0-LP@P cP奋00 03/P hP P0 -0LpS@P 6`P $Q`^0P1 `Kh|@ 0-,Lt9@P d00 000f@ P-L 0RR o 0-@L0P ;:0f - 0`SL@l,KoVPR PL `V$0PpU("#1 '# P?p< P6   P0 p P* `FV,KoDVpP(1 pP '"020 P VpQ =P =PRA@ -`L MP@(("pQU A \2̠ <Q0 K =QR  PC 0 V=,=d==U`T5*iU X,i Œ@`U Xi @`U T*i@`R<Rp BQ=R +V0Z@S" R V===`=<  L<R R BR1"  @(K @ -LPpPU@  `P  ` P 0-LP@P0P @000 -PPL p0R@P 0000  0S Չ`P  `@P/ 0R /@ 0-PPL H0R  P 㲉@P  000@P/ 0R/@0P- ?o, 2^0S0SH@ P-L , ^ \o@ -LM$P`U@IP 0!P@ 0S=  K 0$ 0 R2 $0KP) $HPP# $ 00 0KP $0 R \OP @PN pWPGp$0 0@K@RA/ 0-@8L0S ()0$0T @@03e=f 0-0@0PL0 00f\@0 Q{;OB6OBP/?o4 2\0S0SP//\@ 0-@PL 0R00\@P/ 0R/\@0P- ?o, 2^0S0Sj\@ 0-0L@S $0S 0 ~06OB00C0/  0P0S 00// -`PL yPPPT6@P Hpp߽0 P`000U ~f|@ 0-@L.K0h* P-L`Pp, @TP* ḽ  ᳽ ᰽0 S@T 000 0!0 0!0 @ 0-P@L@ኽzP0 p-L M@P0 S R r`71CaP` 00 P 00C0`Kpf -p PL`ԇ@P U  !U @p  -LM@Pp` P000L  P (0S @( @0YP KF A= 0-LP㎇@P ,00$00[0P00 00== -P`L@0SIKhP@2 ?o2S* 0RpP 00 0 PP 0 03/PP 00C 0 0U* _P P@F A|@ 0-0L@P 00Q 0 Q00000P 0-@P@L} 0 0 0K0hӼut -@PL 0Rpde`PP 0U* 0 0P000ᮼ|@ -LP000 0-@PL 00RP2@厼00|@ 0-@PL 00RP@y00|@ -@PL` L0RP0S@#*@\|@ 0-@PLT $0R@@C0|@ 0-@PLٻ000K0h0 0-@PLɻ@@@$#0 -@PL` @0R P㴻0S 0@A |@ -@PLP`! 0Rpᙻ0@0S@ 0 0a000@޻|@ -@PL` <0R Pl@Ż|@ -LP`U@p P Kh 00 -@PLP' 0R#`50 Kh荻 0 qQ0R* 0 P0C0000xKhq|@0P- ?o, 2^0S0SD|@ 0-LP@P XP嚅00 03/P ]P P0 -0L`SP@ aP $0S KhzF A -`L@P ᔯT 0-PL@ ᇯT0 -`L@PD zT0-!00!! 1\1 0000000#0. 0#0000!R0Q000! 00000 -@`L1SUP&T1  ! R   R  S   1   0T6 @``@T   S Q  Q      !R  |1!000Khr0 000 0/ -`PLpU  @` 7/P Q -@pPLU  `` 8/P @QT ` -@pPLU  `` 8/P @QT ` - Pp`@LW  `  9/PW  q0P R0 0  R0RQ1, @@ppTP     0000W @0@0  0 !Rho 000 -Q"Q  1`0!R Q   \c Q c - LP`@0 ^ R\  0TT 0\00pR"/o"`pT0#00#0000000^000P0T000  " `X  Pp```&T`\ \ 01T 00000000, ,0 0 0000000 T0V00 $Kk T 00X0000`00`  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/ 0BR"S-LMp03=P@ `D TV``0-TP@` +T@P00T00XS 00 C R A BRP@pW0Tp p ?"K K?00 D ^@a DRW@DA DR 7@DW#KQP 0 pY SE00\00S(0, ,2".0@0$K@fKB -0BLMR"S8 < 80xx<@P E UX0-U@P +UP@00U00XS 00 C R A BR@PY0U X`q`q ?#K ? X`p Z` ipj00 E \Pa ERWPEA ER7PEY < R@ S@D8@<0@9X P0,QP00Z00S#004 42",0RV0QP00Z00S004 42",0P0<0S(K@fKB -0BR"SL`0ll<P@ pD TWpp0-TP@p +T@P00T00XS 00 C R A BRP@`V0T` ` H 00D \@a0DSW@DA0DS7@DV P `Y RE00Q00S@  @@fKB  0S S/P/$(0#   @// / ////H-M 0ЍH-M 0Ѝ -Lp`@P6& 0@TP0@ -LÏO " R 0#M0!P`$p$ P!$K 0RR! R/P/0@ 0A0S}*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/ -pL@Q`P 4xP  `P10r 0 P 0-L@\% ^ QRS  T00)xLQ R S "  T  00 00 -LMP0Qp`@00 U S "0 0 00S`p`R?U 00S  0 0 P 00S 00p0E 0 Reo0`01s?o/o0bS00Sp`h0 c7s6 8U) B00S00  TP d@Oo@d 0d7t6G?oo c!0 S S@ c7z6?o/o0bS0 Soo < 8 cK`܃Kp`pD @ dK`Xp0S` p00 S`(KQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ -L1|KB -LM00K3S ?  K  K`  K K K8 K0K0K0K 0KCiP[ K 04 8 < S $S $S ` S $S /Q 00/Q 0/ //PP 04 8 < S $S $S p S $S $S//Q 00/Q 0/ // -LM R 00S$ 0 +$9S 0S0 @ S S! S " SS# $ KyAyA 0-LM@P (Ki /*g z/K0yAC@0!(21 (/d0M/ \ 0<P   /  ,Ԣdd) -@!1`pL1P86;` C(R1 S00Ӳ!111; S Q 0?0$Kkd -PQpL`{PW@(d x*PT 0L00+40 4000P0X00H@` \00 0U0 p` nPk0P\Pb 3SHL0STP0b`PPVX 0`V.\0SX1PUV :p VcX.X  U=@>X: A BR40 A BR  00C S(0C-S X$0B 0bq 0 AHX V0.S 00U S  0b0ACX 0ᤋf,^f -`p@LM |PK.K( .L`K( .(`0K /KTA0!(21 (/d -LLM(@aP,p` 00```&` R0S1く"44"8P#R0 #0 3 0 @P r R6 0lKS 0S0s000P (01H0[ X  0"P (01H0[ X 070S +P -6"%0S   0 &4"4 8#8 ! R 0 1  &4"4 8#8 A&4"4 8#8 1 0(KC- P0HQ" <`p,X\00R0S  P0S @@YS  00R  e -L(M%(22(2qkVJD?.ja\Gf)}0 Dz=,Q`vyz뭛넢C8lw뫕?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_8N>O> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    p q @:@E@:@L@:@ AS@ r@S@ @@S@ `@S@ AS@ X@S@ \@S@ `@S@ @d@ 0h@d@ PmwAd@ pl@d@ h@S@ p@t@ mAS@ x@t@A|@ @@@@@@@@@@@@@@ @@0@@@@@P@@`@@p@@@@@@@@@@@@@@@@@@ @@0@@@@@PcB@`@@pA@@@ @@@@@@@@@@@@ $@(@ ,@(@A0@5@9@ >@@0v3B@@B@@PF@@J@N@oAN@S@N@X@N@]@@b@@ g@@0l@@q@@v@@ {@@0@@@@@@@@@@@@@@@@eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfafafdeaedsdeppmz mA mAt@z@ mA mA~@@ mA mA@@ mA mA/A*5A0.01.02.03.04.05.00.510.0} } P6_bus_dma_busaddr_to_paddr@&@&@1@?@M@`@u@@@@@&@@@@VA @i>2PVA@i>2VA%@i>2AVA@i>3VA@i>3 VA@i>3pA @i>3qA@i>3qA@i>3qA#@i>3qA+@i>3A5@i>4D <@ti>4D C@4i>4i K@h>4`RfS@i>4 i Y@h>4qAa@i>4TrAi@i>4TtAq@i>4TtA@i>4TA@i>4T A@i>4TA@i>4TPT@i>4T`A @i>5TE`A @i>5TE`A @i>5TE%V @i>5TEWV @i>5TE i@th>5TE $i@4h>5TE0$i@4h>5TE ,i@4h>5TE0,i@4h>5TE .i@g>5TE0.i$@g>5TEAi2@4g>5TE!i9@g>5TE !i@@g>5TE)i9@g>5TE )i@@g>5TE-iG@tg>5TE -i@@g>5TEAiR@f>5TEAi`@f>5TEAin@f>5TEA |@i>5TE A @i>5TE`A @i>5TEJ`A @i>5TEJ`A@i>6J`A@i>6J`A@i>6ZK A@i>6KPA@i>7ApA@i>7AA@i>7A/A@i>7A?A@i>7AA @i>7A/A-@i>7A?A:@i>7AOAG@i>7A/AT@i>7A?Ab@i>7AAp@i>7A0A~@i>8ApA@i>8ApA@i>8AA@i>8AXV@i>`A@i>XV@i>?A@i>@XV@i> A@i>@X/V@i>)B @@@@%@!@.@*@7@3@@@<@M@I@R@[@c@m@c@v@}@@}@@@@@@@@@@@@@@@@@@@@@@ @@@!@(@/@6@=@F@O@X@a@@@@@ @@@!@(@/@6@j@@@=@@O@=@@@ @@@!@(@/@6@=@F@O@X@p@a@@@@ @@@!@(@/@6@=@@@@@@@@@ @@@!@(@/@6@=@O@@@@@@@@ @@@!@(@/@6@=@F@O@a@y@@@@@ @@@!@(@/@6@@@@@@@@@@ @@@!@(@/@6@=@@@@O@X@p@@@@@@!@(@/@6@j@@ @@@@@@'@.@5@!@(@/@6@j@B@I@P@W@@@@@ @@@!@(@/@6@^@b@f@j@n@r@v@z@~@@@@@@@@j@@@@@@@@@ @@@!@(@/@6@ A A A A AA A%A ;A\A mAA AA AAdata_abort_handlerbadaddr_read@````` ```pmap_map_chunkd  A A A A: AJ AY Ai Aw A AWA ACA A AES-6600 q  H!4!!d!AA mA@AA mAAA mAAA mAAA mAA A mAA#AA4A=A mANAWA mAhAqAAAAAAA mAAAAAA mAAA mAA A mAAA mAA+A mA<AEAVA[AdAuAzAAuAAA mAAA mAAA mAAA mAAA mAAA mAA AAA A1A6A AA6A?APA6A?AUAZAcA mAtA}AAAAAAA mAAA mAAA mAAA mAAA mA AA%A*A3A>A@*ACA mAaALA mA]AfAwA!{AAANAA mAAA mAtAA mAAA mAtAA mAtAA mAtAA mAtAA mA mAA mAA mA mAAA mAA A mAAA mAA/A mAA@A mAAQA mAAZA mAAkA mAA|A mAAA mA@{AA mAAA mAAAAAA mAAA mAAA mAAA mAA$A mAA5ADA IARA mAcAlA mAcA}A mAcAA mAcAA mAcAA mAcAA mAcAA mAcAA mAcAA mAcAA mAcAA mA@cAA mAcA'A mA@cA8A mAZABASAAXA mA]AfA mA]AlA mAcA}A mAcAA mAAAAAA mAAAA]AA mAAA mAAA mAA A mAAA-AA2ACAAFACAWA`A mAqAzA mAqAAAqAA mAAA mAAA mAAA mAAAAAA AAA!AA&A mA7A@AQAVA_ApAVAuA mAVAAAVAAAAA mAAA mAA mA mAAA mAA A mA  A A mA!|`!ă!4!!|`!ă!4!!!|`!ă!4!!!|`!ă!4!!@!!%5%5x!%5ܫ7N63%5r A mA A A mA A@ A mA A@ A mA A@ A mA A A mA A@ A mA A A mAA!A mA!A@!A mA>58>,>=>>=8>,>Vĉ>>VP>D>HAHA܆>Ѕ>IA KAs@h>\>P>>IAwA>t> >>%  8  @!!@! ! #/ ''w0 g'' c0c JA KAs@HT JAJAzJA,JAzKJARJA KJARJA JAYJA`JAgJA`JAnJAvJAJA@JAJA@JAJAJAJA KAMAHAHAlJA KAJAHJA KAs@KAKAJAKA*KA@IeII1KA6KAI0I0E`JA>KAIKAOKA@&II  IWKA_KA`JAfKA@"I0mKAvKAJA-/{KAKA{KAKA{KAKA{KAKA{KAKA{KAKA{KA LA!LA(LA{KA7LA{KAMLA{KAeLAsLA")LALAuE o@o @o @JALALALAPAIA KAs@@& 3BI@LALA @(#0LAMATB eMA-MAAMA2'EMAMAMAMAMAMAMAJAzMAMANANANAJAMAJANALAkNAtNA~NANANANANAVVwh{KANA{KANANANA!LAOA!LAOA(OA~NA1OA:OAP8soo P q q sMklttNA~NAtt3SOAZOA hCxOAOA h&FILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!Zׇ)BPAPAPAAQAQAPAPA`#####%5#%54#N6#%5FTAXTAdTAuTATATATATATATATATATATATATATATAUAA@d@c@c@2@ @?@ "@D@Q2@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@`1l703% `dU `dU `d  2 @@   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u    :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F    u ;u )%u&5Fu 3 4u&6F  0 1  2 5L5$X6$6$9$:$%58$N64$%52$1$2${3 ?pH$G$TB$ ?$H?$5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;<=>?@ABCDEOMPJQNRK 8?$?O,?$?.?7ʽ?$?O? r?Z?$?A$?F?ֹ?J?P? ? ? j? Z? NT?Hĵ?X? ? ? ? ?bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>.'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| 9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm \A]A]AA\A\A\A\AQ$hQ$S$@P$O$X$Xn$e$e$f$g$f$f$ f$uisdata_bio1W 1 Q  n$ n$  % L ln$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ H!4!!4!F  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |2VZP~" `"'`{%1@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d P@9WPurl_int_miibus_writeregurl_int_miibus_readreg B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn /t$jdAqdAF hF 1%41%0%,0%/%>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IXkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q@D@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH@@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH@@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@@D@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_r/_@[ ,Κ;qLr!oADSgEmV1JBچ8{ Bieee80211_setmode@P ,    $ 0H`l     $ 0H`lieee80211_media_status , $0H`lieee80211_media_change   $0H`l  $0H`l_ieee80211_crypto_delkeyieee80211_crypto_registerieee80211_crypto_unregisterieee80211_crypto_newkeyGwAPwAZwAgwAqwAieee80211_crypto_setkeyieee80211_crypto_encapieee80211_crypto_decapccmp_setkey?xAĿ&&@&&&@&4&ieee80211_hdrsizexAH&L&P&&&X&p&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkeytkip_decap[yA&|&&(&&(&<&ieee80211_hdrsizetkip_encap0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-yA&&&&X&&&ieee80211_hdrsizeieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_lateattachieee80211_node_table_initPieee80211_encapieee80211_mbuf_adjustieee80211_compute_durationPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update A A A AA AAieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupAd(H((x(dCX(|P(xP()@@T(d*tP(pP(+@*d)lP(hP(p*@b)w)v)d(|P(xP()@dC4<|P(xP()@<d)C4<|P(xP()@<dsC4<|P(xP()@<dC'|P(xP()@4'X'((dC(|P(xP()@(}E#(D(@AAA==A*ip_output(((D((x(<(0((((D(((L(T((\((( @@@@@@@)) ))tcp_ctloutputP))H))())L)X))),)@)D)D)x)@))))p)h)<))\))h)8))\))x)8)$))vtw_control_init""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwp*))*h*<*)<* *)))**))*h)*A0*(AX*5A|*F4B*AA*LA*icmp6_reflecticmp6_erroricmp6_redirect_input_icmp6_inputin6_get_llsol_addrin6_update_ifa1in6_join_mcastgroupsin6_if_link_upin6_if_link_down^generate_tmp_ifidin6_ifattachin6_ifattach_loopbackget_ifidin6_ifattach_linklocald)* 1*/*0*d:C\?***1@6*d[,**T2@lR,d87)**p*@*w)v)d),**1@d<X"*d+|:,d,%*dC̨<**1@<d)C̨<**1@<dsC̨<**1@<dgCM+*1@P7+dC),*1@ (,ip6_get_prevhdrip6_input(@AAA==(A*ip6_outputnd6_initnd6_optionsnd6_resolvend6_rtrequestnd6_na_inputnd6_ns_outputnd6_dad_timernd6_na_outputnd6_ns_inputnd6_dad_startin6_init_prefix_ltimesnd6_prefix_onlinknd6_prefix_offlinknd6_rs_inputnd6_defrouter_selectnd6_invalidate_prefixnd6_pfxlist_onlink_checkin6_tmpifaddnd6_ra_inputprelist_updatend6_prelist_addin6_ifaddx:,$,',$&,', %,",",$,\$,$,0#,#,#,8#,@#,87,#,$,2A1B)B)B5A)B)B:A)B)B)B)B)BGAQ,0P,0O,hQ,(O,$Q,$L,P,`P,O,M,,L,L,L,4L,?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!A A&A,A2A8A>ADAJAPAVA\AbAhAAAnAtAzAA AAAAAAAAAAAAAAwsevent_copyout_events9-47-U-????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?Pd&d&d&U@T@oW@sW@                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~X@EY@aWY@)Y@2Y@Z@Z@ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~PX-X-TF̱--PN -RRX-CEį-ST-NM,--CLl-0PLl-0RE@-@RRX-CEį-ST-SLl-RRX-CEį-ST-ERP-CEį-ST- :_@h^@]@/-pADf]@@j9h@<_:@<_:@<_:@<_:ؙ@<_:@$-@-,@$-H@<_:d@<_:@<_:@<_:Ԛ@H:@<_:@<_: @<_:(@<_:D@<_:`@<_:|@<_:@<_:@<_:Л@<_:@<_:@<_:$@<_:@@<_:\@<_:x@<_:@-@H-̜@:@<:@<_: @<_:<@-X@\:t@<_:@<_:L@ 79@<_:Hfp^@@j9h@l:@\:@\:@X:ؙ@:@$-@-,@$-H@,:d@:@:@(:Ԛ@H:@l:@: @:(@h:D@:`@:|@t:@\:@\:Л@\:@\:@\:$@\:@@\:\@\:x@\:@-@H-̜@:@<:@: @d:<@-X@\:t@:@:L@ 79ȝ@(:@:Lf_@@j9h@<-@:@:@t:ؙ@t:@$-@-,@$-H@8-d@:@:@:Ԛ@H:@`:@:(@h:D@:`@t:|@(:@:@-Л@:@:@:$@-@@d-\@-x@@:@-@H-̜@:@<:@- @0-<@-X@\:t@-@|:L@ 79ȝ@(:@:???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ蘔-h- : -@:-updatefatsUd@/&.A. .. fd@@j9h@<.@T.@:@t:ؙ@U.@hK.@`V.,@x6.H@;.d@x=.@:@:Ԛ@H:@`:@: @D:(@h:D@:`@PZ.|@(:@xA.@:Л@B.@[.@A.$@:@@L.\@|:x@@:@-@-̜@:@<:@9. @I.<@J.X@\:t@XL.@PK.L@ 79ȝ@(:@:AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zл.ܸ.л..nfs_sillyworkerܿ... @x@w@w@w@w@w@w@~w@bw@Fw@*w@ w@v@v@v@v@zv@dv@Xv@Nv@Dv@8v@ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  {@(z@x@///B4%fx@@j9h@<_:@<_:@<_:@<_:ؙ@hS/@(L/@+/,@v/H@B/d@0C/@<_:@<_:Ԛ@H:@<_:@<_: @<_:(@<_:D@<_:`@x00|@<_:@<_:@<_:Л@<_:@<_:@<_:$@<_:@@<_:\@<_:x@<_:@h.@<.̜@:@K/@<_: @\:<@lK/X@\:t@<_:@<_:L@\:@<_:8%f0z@@j9h@l:@\:@\:@X:ؙ@R/@(L/@+/,@v/H@(B/d@B/@:@(:Ԛ@H:@l:@: @:(@h:D@:`@:|@t:@\:@\:Л@\:@\:@\:$@\:@@\:\@\:x@\:@h.@<.̜@:@K/@: @d:<@lK/X@\:t@:@:L@ 79ȝ@(:@:<%f{@@j9h@T/@/@/@ +/ؙ@/0@L/@+/,@v/H@ A/d@*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?l1la1@:b1ffs_newvnodeffs_reloadt0,00s00,01 ffs_sync@@@/0xAT%f@@j9h@<_:@<_:@<_:@<_:ؙ@_1@F1@G1,@I1H@_1d@L_1@<_:@<_:@<_:Ԛ@H:@<_: @<_:(@<_:D@<_:`@1|@<_:@<_:@<_:Л@<_:@<_:@<_:$@<_:@@<_:\@<_:x@<_:@1@0̜@:@<:@<_: @<_:<@L]1X@\:t@<_:@<_:L@ 79@<_:T@ 0@0@0@$08@0p@0X%f @@j9h@l:@\:@\:@X:ؙ@^1@F1@G1,@I1H@(^1d@h^1@:@(:@l:Ԛ@H:@: @:(@h:D@:`@0|@t:@\:@\:Л@\:@\:@\:$@\:@@\:\@\:x@\:@1@0̜@:@<:@: @d:<@L]1X@\:t@:@:L@ 79ȝ@(:@:T@ 0@0@0@$08@0p@0\%f@@j9h@,%1@E1@hQ1@E1@`F1ؙ@F1@F1@G1,@I1H@0d@t0@:@:@`:Ԛ@H:@: @D:(@h:D@:`@1|@(:@O1@O1Л@DA1@R1@U1$@c1@@W1\@Z1x@@:@1@0̜@:@<:@d1 @[1<@L]1X@\:t@_1@`1L@ 79ȝ@(:@:T@ 0@0@0@$08@0p@0l@/ 12AxAl%ft@@j9h@\:@\:@\:@D1ؙ@1@\:@\:,@\:H@\:d@\:@:@:@`:@\:(@h:D@\:`@:|@\:@\:@\:Л@\:@\:@\:$@\:@@\:\@\:x@\:@1@1̜@:@:@1 @1<@t1X@:t@\:@\:L@ 79@:ufs_inactiveufs_dircompactufs_dirgrow61614717171:1@1L81$9181 ...l11d1@1uao_put81ubc_uiomoveP11h11uvm_km_suballoc111uvm_unmap_removeuvm_mapvmmapbsy0P2`P2$@h@Ԉ@D@uvm_page_physloaduvm_physseg_unplugswap_offswstrategysw_reg_strategyuvm_swap_initswap_on%5%522%5%5ܫ7N63%5%5%52%5%5%522h2\2/2(A/<26ANetBSD/2WA/$2eANAAAAdeadcv/J39A%5%5%5%5U3%5ܫ7N63%5W3%5%5%5%5%5ܫ7N63%5}3}3%5%53{33{3ċ30}3{3{3{3 p33~3P~3|3{3333exec_initAxBBAAAAassert_sleepablemodule_builtin_addmodule_start_unload_threadmodule_relemutex_vector_enterself,@<@4@@t@P@t@P@@systemdrvctlB@FBPNB`VBp^BgBpByBBB@BBBBBBBB B@B@6Р6ء666%5T6%56N66%5pool_initpool_getpool_do_put|/-\0123456789ABCDEF0123456789abcdefvmem_rehash_startC7|Q7lR7L7Q7dT7L7L7/TO7@B7s7xy7{7`|7${7777ȃ7{3{3{3d{3r7Dr7y7|{3{3/t7BX7777d77l7l87@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@,7L77H7ttyoutttyinttybgttyopnttycls!B!B!B!B!B!B!B  8888&8'8(880*888t8N687%5 $88880*8%58t 8N6l8%5%5%5%5%5%5%5ܫ7N63%598%5P9888H:8%588N6@88%5jsockaddr_copyWARNING: mclpool limit reached; increase kern.mbuf.nmbclustersm_freem_freem(eԔ@~8p~8l~88 ~88888 8~88~888$~8,~84~8D~8<~8e<l9 @el9 @e=l9 @t8ؑ8p88$8888888{3{3d{3t{388|{3{3/L8#B`8З8`88@8l8sbcreatecontrol1$B$B$B$B%B %B%B%Bh9$99t99 99h 9 9<98899p 989 98@P@@ff|fxf2B-B-B.B.B.B.B".B+.B5.B=.BE.BO.BY.B`.Bi.Br.B|.B.B.B.B.B.B.B.B.B.B.B.B.B.B.B.B/B/B/B-B-B-BMA-B-B-B-B-B-B-B-B-B-B-B-B @` xA/B2AApA~/B/B/B vcache_reclaimvrelelholdrelelvcache_make_anonvwakeup V:T:S:LK:DK:R:Y:$L:{3O:2B @2B@ 2B@ 2B@ |2B@ r2B@ g2Bܠ@ [2BԠ@ O2B̠@ F2BĠ@ <2B@ .2B@ !2B@2B@ 2B@2B@1B@1B@1B|@ 1Bt@1Bl@1B`@ 1BT@ 1B @@ 1B8@ 1B,@ 1B$@ 1B@ x1B@ l1B @_1B@ S1B@!J1B@"?1B@#61B@$)1Bܟ@%1Bԟ@&1B̟@'1Bğ@(0B@)0B@*0B@+0B@,0B@ -0B@.0B@/0B@00B|@1q0Bt@@L@h@@@@ؙ@@@,@H@d@@@@Ԛ@@ @(@D@`@|@@@Л@@@$@@@\@x@@@̜@@@ @<@X@t@@@ȝ@@@@8@T@p@@T(B8@8f@@@4:L@t:h@:@:ؙ@t:H@:d@,:@:@:Ԛ@t:@Ԉ:@܈:@:@:Л@4:@:`@t:|@t:@:@t:̜@:@:@<: @:<@:X@\:(@t:ȝ@:@:::::;A2IчHB|nQn- q+BZIчHxA|nQn- q+xASFU0eCxAIчHNBIчH5B-чHq9B-чHu9BSFH0eC%8B@;@; F;E;C;%5ܫ7N63%5@;@;>;C;%5=;%5%5%5H;H;G;%5ܫ7G;3%5@M;%5%5%5%5%5ܫ7N63%5,O;N; M;d{3L;*C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jrt_initrt_timer_initmZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdrxx route_outputrt_msg1route_enqueuert_newaddrmsgeh&<'AP@@H@TA@@SA8@i A0@r9B(@A @@@5A@8A@8A@N8A@2A@IBر@?Aб@ IBȱ@'IB@E@@@@g@@@@@@@@CA@@@#@x@(NAp@$@h@VWA\@$XAT@^XAL@YAD@]A<@5`A4@aA,@1bA$@FcA@cA@mdA @dA@ddXd,ddȚddpd@ddddddddpdd$dЂddddddȃdpdXdd(ddTddd0dАdpdddddd ddddddtdHd̘dPd$dd̦ddtdHdddĥddld@d\d d5A5A,IB IBAi Ai AaASASA|GB,A]A5IBYAXA$XARAVWA}RAVWASA$@>IBH>A,A,ARAIB(NA(NA>AIBg@g@DIB@DIB@5IB@@@@@@'IB@@8A8A3e`3e@3e 3e3e2e2e2e2e`2e@2e 2e2e1e1e1e1e`1e@1e 1e1e0e0e0e0e`0e@0e 0e0e/e/e/e/e`/e@/e /e/e.e.e.e.e`.e@.e .e.e-e-e-e-e`-e@-e -e-e,e,e,e,e`,e@,e ,e,e+e+e+e+e @ @ @ @@ķ@@T@@L@ȶ@X@@@T@@ȸ@ط@ @p@@@ܸ@4@,@\@@H@@ķ@@l@ @@SAHBXAUIBL@,A^IBL@@a$BL@@L@}RASAL@dIBL@2AL@5AL@rIBL@AL@RAzIBL@SA$'BL@IBL@RASAL@dIBL@2AL@5AL@rIBL@AL@(NAFAL@|GBzIBL@aA@DIBAL@IBT%B,IBA?AL@i A^IBL@>IBTA>AIBL@L$BL@8Aa$BL@@iNBAL@IBL@g@5A@@IBL@@iNBIBL@IBL@IBL@NBL@5IBAL@IBT%BNBCDB     @ @ Zgg} j(sFK#(%strtoumaxstrtoimax0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG__subvsi3__subvdi3__negvsi2__negvdi2__mulvsi3__mulvdi3__addvsi3__addvdi3__absvsi2__absvdi2kNBBrNBuNB 8BxNB}NBxAANBNBNBpA ANB%8BNBNBNB5Bq9BNBANBNBNBNBNBu9BNB mAgntsT===(fNB F A=6OBl=;OBl=RAD=@X=AOB=NB`===rbmn=0==L==0f(NOBtcid=l=H====x= == yekd<=== f WOBf`OBf<iOB(f,qOBatad==0=ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/fyOBloob=L=p=yara==$===f OBstrtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALLNetBSD 8.2_STABLE (INSTALL) #0: Sun Apr 28 10:17:03 UTC 2024 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL @(#)NetBSD 8.2_STABLE (INSTALL) #0: Sun Apr 28 10:17:03 UTC 2024 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL 8.2_STABLENetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s The operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerpxapcic_scoop: GPIO controller unable to acquire bus. error=%d output write failed. error=%d ioexp%s: not configured. can't map bus space couldn't establish power handler zssp%s: not configured zssp: zssp_ic_send: invalid IC %d Sharp Zaurus frame bufferSharp Zaurus LCDzlcdstdw100lcd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctlcouldn't register event handler zkbd: pseudo power management module apmdevifzapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbuslr, rrx, %s r%d, %s #%dthumb insn %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusmachine_archWarning IRQ's disabled during boot() total memory = %s avail memory = %s single-skdb-k-aquiet-q-v-x%s: curaddr %#lx not in range_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: _BUS_DMA_BUFTYPE_RAW_bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID_bus_dmamap_sync: map %p: unknown buffer type %d _bus_dmamem_map: size botch%dKB/%dB %d-way %s L%u %cI%cT Unified cache %dKB/%dB %d-way L%u %cI%cT Instruction cache %dKB/%dB %d-way %s L%u %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-SARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A15 r2Cortex-A15 r3Cortex-A17 r1Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: Misaligned Kernel-mode Program Counter %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %ppmap_pv_protect: page not pv-tracked: 0x%lxfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vmapbufvunmapbufpmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)scsiverboseperiphtapeprinterprocessorwormcdromopticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typescxsplWARNING: not enough memory for scsipi_xfer_pool unable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer %02x DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter %s(%s:%d:%d:%d): killed sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA illegal length indicationATA volume overflowATA command abortedunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out %s:%d:%d: %s error (0x%x) wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: driver failed wdc_atapi_get_paramswdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d: error 0x%x unable to allocate periph for drive %d wdc_atapi_scsipi_request %s:%d:%d atapiscsinitq: SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed target %d lun %d: <%s, %s, %s> %s %sscsibus at %s channel %dscsibuswaiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %satapibusALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25read_cd_capacity: extra large block size %u found - limiting to 2kByte optical mediaMMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct NEC CD-ROM DRIVE:260cache synchronization failed no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectorsdrive offlineunformatted mediastandby immediate command didn't complete wd_standby: status=%s wdstart1: bad return code from ata_bio()ST506fictitious%s: (error not notifieddevice faultdevice timeoutchannel resetsoft error (corrected) wddump: try againwddump: polled command has been queuedwddump: unknown atacmd code %dwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %dwd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEFORCE_LBA48quirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors WARNING: block size %u might not actually work wd_setcache command not complete wd_setcache: status=%s flush cache command didn't complete wd_flushcache: status=%s trim command didn't complete wd_trim: status=%s wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS%s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x recalsetmultidrive fault error (%x) atabus at %swd at %s drive %d%s: unknown child %patasplatainitqatadowncan't alloc drive array qidlataactatdrnunable to create kernel thread: error %d %scnfunable to create config thread: error %d atathata_thread: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabuscouldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d couldn't read CIS can't change bus clock switch error error waiting for high speed switch: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x can't change high speed %d, error %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x %s: %s failed with error %d SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d %d-bit, C%d, U%d, V%d, A%dcan't execute SD tuning SD card status: unknown bus widthwrite-protected Default/SDR12High-Speed/SDR25SDR50SDR104DDR50: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> sdmmc discard countsdmmc discard errorssdmmc discard busy%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_hook: malloc failedconfig_connect: malloc failedconfig_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxaippxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented stray interrupt %d : Interrupt Controller intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d lcd_free on active screen Stray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacunable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL pcmciabusunable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout couldn't start dma xfer. (error=%d) data not a multiple of %u bytes too much data mmcmdunsupported bus frequency of %d KHz : MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentunknown error codeAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! Cannot allocate cfe entry CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for pcmcia_check_cis_quirks: malloc pfpcmcia_check_cis_quirks: malloc cfeSVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciausbevt: USB revision %s, not supported %s: can't register softintr usb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usbreausbtskunable to create task thread: %s usb_create_event_thread taskusb at %susbtask-hcusbtask-drpre 1.01.13.03.1usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_detach_wait: %s didn't detach usbdetusb_detach_waitold: %s didn't detach usbverbosevendor %4.4xproduct %4.4x port %d configuration %d interface %dusbdevifserialnumberusbifif%x.%02x%s (%#04x) %s (%#04x), class %d/%d, rev , addr %dusbdlyout of data0 lengthiface descusbd_fill_iface_data: bad descriptor(s): %s usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDillegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d hub not fully initialised, but child deleted?multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint cannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %s reportid %d%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidbusuhidev_intr: bad repid %d uhidev: input=%d, output=%d, feature=%d uhidreauhiddetuhid%s: was console keyboard bad modifier sizetoo many Variable keyskey code size != 8key codes not on byte boundarymultiple key code arraysattach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). ukbd%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umassdetusing %s over %s quirk init failed endpoint not found %u/%u/%u unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=0x%x not supported bus attach failed ATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumassuisdata_exec_command: large datalen %d uisdata_exec_command: bad command 0x%02x uisdataex%s: ATA_POLL not supported %s: multiple uisdata_bio uisdatablumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbcan't allocate link for drive %d %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: MII read timed out %u usb errors on intr: %s aue_send error=%s open intr pipe failed: %s failed to set configuration, err=%s getting interface handle failed auemcauemccl%s-mccreating multicast configuration thread couldn't get endpoint descriptor %d missing endpoint Ethernet address %s %s: EEPROM read timed out aue%s: watchdog timeout %s: no memory for rx list -- packet dropped! %s: usb error on rx: %s %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: tx list init failed %s: rx list init failed %s: usb error on tx: %s no union descriptor no data interface setting alternate interface failed unexpected endpoint could not find data bulk in could not find data bulk out faking address cdce%s: cue_send error=%s %s: %u usb errors on rx: %s couldn't get ep %d %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed could not read Ethernet descriptor kue%s: %s: bad register %04x %s: url_send error=%s failed to get interface, err=%s couldn't get endpoint %d urlwrite PHY failed read PHY failed media change failed can't read rxmodefailed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axebpf%s: udav_send error=%s udavunable to flush cache lddrain%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: cleaning outstanding rssadapt descriptor for %s %s: tx rate %d -> %d (%d) %s write fid %x failed %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list if_initialize failed(%d) Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s 'ns16550, broken fifons8250 or ns16450, no fifons16550a, working fifoAu1X00 UART, working fifons16650, no ERS, working fifoOMAP UART, working fifoIngenic UART, working fifoTegra UART, working fifois_consolecan't re-init serial console @%lx txfifo disabled unable to allocate ring buffer 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s %s channel %d: reset failed for drive 0 drive 1__wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xferlost interrupt type: %s tc_bcount: %d tc_skip: %d missing untimeoutatapollatadrdyatacnfwdccmdatardlNetBSDRoot hubOHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted ohciabt2WARNING: addr 0x%08lx not found ohci_device_isoc_abort: early return ohci_setintr: 0 interval , legacy supportohciabtohcixferOHCI version %d.%d%s unsupported OHCI revision SMM does not respond, resetting reset timeout BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d crypto_core_constant32[0] == le32dec(&sigma[0])crypto self-test failed: %scrypto_core_constant32[1] == le32dec(&sigma[4])crypto_core_constant32[2] == le32dec(&sigma[8])crypto_core_constant32[3] == le32dec(&sigma[12])block[i] == le32dec(&out[i*4])expand 32-byte kinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: WEP data frame too short, len %u [%s] unable to pullup %s header wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u %s: control frame[%s] Missing ExtIV for AES-CCM cipher not enough data in following buffer, m_len %u need %u [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt [%s] Discard frame due to countermeasures (%s) TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: too short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicatedata too short: expecting %uunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.ratesbad scan.rates len %dno scan.ssidbad scan.ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table 0x%p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %s: free all nodes in %s table %s %s table %s: %s[%u] still active ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set:%s%u start chan %u passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s %s table, inact %u Cannot allocate key index map with %u entries scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!%s: cannot expand storage not enough room, need %u got %zu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %d (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlinpcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechoICMP: redirect failed to register timeout for route to %s, code %d icmp_erroricmp lenforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailableselectedreserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblist(unknown)TCP: invalid wscale %d from %s, assuming %d tcpipqepltcp_pulloutofbandsynplm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULLtcp_outputsackholepltcp_inittcpcbpltcp_new_issrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscompat_42cwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesglobalmaxholesglobalholeslocal_by_rttdropiss_hashabcaggressivemsltremoteremote_thresholdvtw%s: af %dtcp6inet6newrenocubic%s: could not allocate %zu bytes for hash anchors%s: could not allocate %zu bytes for fatp_t array%s: could not allocate %zu bytes for vtw_t arrayudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)icmp6nd6_prunend6_delaynd6_umaxtriesnd6_mmaxtriesnd6_useloopbacknodeinfond6_maxnudhintmtudisc_hiwatmtudisc_lowatnd6_debugnd6_drlistnd6_prlistmaxqueuelen%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ENOBUFS in icmp6_error %d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: the prefix length of an existing (%s) autoconf address should not be changed %s: addmulti failed for %s on %s (errno=%d) in6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlprefix ioctls are now invalidated. please use ifconfig. %s: %s marked tentative %s: %s marked detached in6_if2idlen: unknown link type (%d) in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: never found a good ID %s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address in6pcbpl::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) mcast/dstbcast/mcastunspec/srcsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6accept_rtadvrtadv_maxroutesrtadv_numrouteskeepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedrr_prunev6onlyauto_linklocaladdctlpolicyuse_tempaddrprefer_tempaddrtemppltimetempvltimemaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxifprefixesmaxifdefroutersmaxdynroutesip6_init%s: off < sizeof(struct ip6_hdr)ip6_nexthdr: m == NULL%s: packet to an unready address %s->%s pim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludgeregen_tmpaddr: failed to create a new tmp addr, errno=%d nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu scope error in prefix list (%s) scope error in router list (%s) nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt Cannot enable an interface with a link-local address marked duplicate. %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s %s: preferred lifetime(%d) is greater than valid lifetime(%d) defrouter_delreq: error %d deleting default router %s on %s %s: %s/%d is already on-link %s: failed to find any ifaddr to add route for a prefix(%s/%d) on %s %s: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d rtpref: impossible RA flag %x %s: %s/%d is already off-link %s: failed to recover a prefix %s/%d from %s to %s (errno = %d) %s: failed to delete route: %s/%d on %s (errno = %d) %s: lladdrlen mismatch for %s (if %d, RS packet %d) %s: called unexpectedly (forwarding=%d, accept_rtadv=%d) nd6_defrouter_select: more than one router is installed defrouter_addreq: error %d adding default router %s on %s %s: failed to make %s/%d offlink on %s, errno=%d %s: failed to make %s/%d offlink, errno=%d %s: failed to make %s/%d onlink, errno=%d nd6_prelist_remove: negative count on %s %s: failed to find a good random IFID %s: failed to find a unique random IFID %s: ifa update succeeded, but we got no ifaddr nd6_defrtrlist_del: negative count on %s %s: src %s is not link-local nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored %s: invalid option len %d for prefix information option, ignored %s: invalid prefix len %d for prefix information option, ignored %s: invalid prefix %s, ignored %s: failed to make the prefix %s/%d on-link on %s (errno=%d) %s: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p %s: IFID undefined (%s) %s: invalid prefixlen %d for %s, ignored %s: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: %s is already configured %s: failed to make ifaddr %s on %s (errno=%d) %s: failed to create a temporary address, errno=%d %s: bogus mtu option mtu=%lu sent from %s, ignoring %s: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring %s: lladdrlen mismatch for %s (if %d, RA packet %d) raw6sa6_recoverscope: assumption failure (non 0 ID): %s%%%d siteorganizationglobaludp6_output: IPV6_V6ONLY option was set for a connected socket udp6 addr 0x%xiicintr: I2C bus unable to create intr thread i2c-indirect-configi2c-child-devicescookiecompatibleWARNING: ignoring bad device address @ 0x%02x %s at %s addr 0x%02xWARNING: intr handler list not empty WARNING: proc handler list not empty i2cexec,i2c_bitbangi2cexeciic at %smii_attach: phyloc and offloc specifiedmiimii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverbosemiiautmii_phy_setmedia: MASTER on wrong mediaHomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXcouldn't establish power handler: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX, BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyno media presentDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance no media present exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX, LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_common_attach: no memory kbdmux %d: console (%s, %s emulation), using %swsswscreen %d deleted wsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumbwsemul_vt100_output_c0c1: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmuxwsmux: attach out of memory %s: disconnecting from %s rasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660utf8_joliet%/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfsRRaArrAamsdosmsdosfs_write(): bad file typerename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad v_usecount%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%s%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inodefile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcvffs_discarddata drain timeout %s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on listffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %d%s: dup alloc ino=%lld on %s: mode %x/%x gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptorg.netbsd.kauth.systemffs_modcmd: can't listen on system scope. appleufsffsinoffsdino1ffsdino2, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: lost blocks %lld files %d %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfsmfs_rootmfs_ioctl not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s missing NUL in namenot roundednull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageanonpllivelockuao_getpageuao_getuao_create: hashinit swhash faileduao_create: swslots allocation faileduaoeltpluao_flush: strange, got an out of range flush (fixed) uao_put%s: impossibleuao_detubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectubc_alloc%s: error=%d udv_detachudv_faultudv_attachflt_noram5flt_pmfail1flt_pmfail2anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpgloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p %s: process wants to map virtual address 0; see vm.user_va0_disable in sysctl(7). vmmeterloadavguvmexpuvmexp2maxslpuspaceidlezerominaddressmaxaddressthread_guard_sizeuobjwirepguvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range ractx%s: swapdev not in list%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning of swap...stopping swap on %s failed with error %d uvn_fp1uvn_fp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initfork aiodonedcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)/sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinencpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfshwddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_ticksclockinterruptCondition variable%.*spid %d (%s): %s write of %zu@%p at %lld failed: %d cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefiledescfile2dup2EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMERexecargsshould not happenpspawnlwpwaitkernel mapping failed %d netbsdinit died (signal %d, exit %d)orphaned traced processincrease kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx softintpserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)swapperWARNING: module error: %s: can't find builtin dependency `%s'%s: too many required modules %d >= %dbuiltin module `%s' failed to init, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size %zu != %zuDEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'cannot unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautotimemodunload%s: %d%s: gonemodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentrecursion too deep for `%s' %d > %duse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class for `%s' (%d != %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %smodcmd function failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfmutex_init: impossible typeMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) %s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) %s: %s suspension %s (delegator %s) removed by %s classresume failed Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: class suspend %s: driver suspend %s: bus suspend %s: suspend enter %s: suspend exit Flushing disk caches: Suspending devices:%s: bus resume %s: driver resume %s: class resume %s: resume enter %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueprocplproc2proc_args%s (pid %d) changing logname from %.*s to %s rasplimitplpstatsplcurprocpaxflagsrlimitcputimefilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitrnd: source "%s" failed continuous-output test. rnd: source "%s" failed statistical test.rnd: disabling source "%s". rndsrcrndsamplernd: seeded with %d bits printfautoconfrnd: bad seed length %d rnd: bad seed checksum requesting entropy from dead rndsink: %prndsink %p in unknown state: %drndsinkdestroying dead rndsink: %pcacheht_timebalance_periodaverage_weightmin_catchtimesoftintskpreempt_priupreempt_prirunqueue pullrunqueue pushrunqueue stayrunqueue localizeowner/count : %#018lx flags : %#018x Reader / writer lockrwlocksigactsksiginfosorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d WARNING: softint_establish: table full, increase softint_bytes softdissoft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot md0 (default %sdump device (default %sb)file system (default %s): use one of: genericunknown device major 0x%llx %s%lludevice %s (0x%llx) not configured root on %scan't determine root device swap dumps on %sCannot open "md0" (root)sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards exceeded RLIMIT_CPUpid %d is killed: %s pid %d, command %s, is killed: %s /usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_createv: sysctl_create(%s) returned %d sysctl_create succeeded but node not found?! sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummyptimerplptimersplnanoslppid %d attempted to set the (obsolete) kernel time zone callout_init_cpu (2)late/%ucalloutwait/%utstilepltstileturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time uidinfoproccntlwpcntlockcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrttsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlers%s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x device-attachdevice-detachcfgmiscdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_attach: allocation of device softc failedFound %s (root)%s at %sWARNING: power management not supported root device %s not configured done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcprng %s: reseeding with partial entropy cprng %s: NIST Hash_DRBG reseed failedNIST Hash_DRBG failed self-testurandomarandomcprng %s: NIST Hash_DRBG instantiation failedcprng %s: creating with partial entropy sysctlcprng %s: NIST Hash_DRBG failedureadc: non-positive residureadc: non-positive iovcnt%s: block majors exhausted%s: character majors exhaustedwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table type KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-2048kmem-4096kmem-8192kmem-16384kmem-8kmem-16kmem-24kmem-32kmem-40kmem-48kmem-56kmem-64kmem-80kmem-96kmem-112kmem-128kmem-160kmem-192kmem-224kmem-256kmem-320kmem-384kmem-448kmem-512kmem-768kmem-1024not modular%s error: %s,%zu: %s lock address : %#018lx current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) page %p, nmissing %d, time %u %s: [%s] too large itemsperpage(%d) for PR_NOTOUCHpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missingMust specify a pool to print. POOL CACHEPOOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer entry uncontended %llu contended %llu cache layer empty groups %u full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p empty cache groups: (null)Skipping crash dump on recursive panic panic: %s: table is full - %s %s: table is full autoconfiguration error: exclusive accesspsrlzspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclocvxchicvcrosscallunicastxcallxcall/%uaio_process: invalid operation code aioworkaiodoneaio_jobs_poolaio_lio_poolposix_aioaio_listio_maxaio_maxsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s mqmsgplposix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqsendcvmqrecvcvparkedpsetpsets_max%d:1,%d:2direct_selectcompatposix_schedpri_minpri_maxttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutftkstatninnoutcanccrawccqsizettyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_streamseqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumsizemclbytesnmbclustersmblowatmcllowatmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)m_copym: off %d, len %dm_copym: m == 0, off %dm_copym: m == 0, len %d [!COPYALL]m == NULL in m_pulldown()unixpsemposixsemmaxsemcntksemsomaxkvasbmaxsokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dsocketnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamemsgcontrolmsghdrmbfreembdatambheadermbsoptsmbftablembcontrolmboobdataunp_threadunp_connect1unp_disconnect1uipc 1uipc 2unp_attachunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbflushbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestedcachegcncachenchinit %dnamecacheentries scannedentries collectedover scan targetunder scan targetforced reclaimsnamecache_statscwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkspnbufpllf_findoverlap: defaultlockfchrooted pid %d uid %d (%s) detected outside of its chroot namei_simple_convert_flags: bogus sflags /../earmzauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system failedunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... ILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT EXECMAP WRMAP WRMAPDIRTYONWORKLSTDIROPfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dfdesckernfsafsfstchgfstcnt%s: cannot reclaim%s: bad ref countdead but not cleanvcacheplvcachevdrainvdrainwt%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-namexattr-valxattr-listsystem.user.security.trusted.vop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad oplayerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_ioctlspec_read typespec_write typespec_fdiscard: not a device spec_close: spurious pgrp refspec_close: not specialdev %llu, %llu spec_node_destroy: corrupt hashdefault labelWARNING: %s: total sector size in disklabel (%ju) != the size of %s (%ju) %s: %ju trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%ju) raidframe%s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu) %s at %s (%s) deleted dkdrn%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdcgdmdidle%s: cfattach_attach failed %d %llu %uurandom%urndtemprndctxrndpseudoopen hardopen softbpf_mcpybpf_change_type%s: softint_establish() failed%s: no bpf_if found for %smaxbufsizepeersbpfattach%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#%slink#%huif_ifqmaxlendropsifnetifasdl%s: could not attach sysctl nodes sndqrcvqif_detach: WARNING: AF %d not purged UPDOWN%s: lost link state change %s too many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %s%s: discarding oversize frame (len=%d) %s: can't handle af%d ether%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_loopifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedpfilpktqsyncpktqrenqMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find our annotation rn_delete: couldn't find us radix already initializedrn_init: radix functions require max_keylen be set rn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d rtfree 2route_purgeifroute_abortroute_acceptroutertable%s: message too long%s: queue full, dropped message %s: unknown command %dkeeplog_movementslog_permanent_modifylog_wrong_ifacelog_unknown_network%s: %s not ready arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! %s: DAD duplicate address %s from %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s %s: ouch, empty static llinfo for %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Extensionsorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d curtainusermountuser_set_cpu_affinityextensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionscryptofssppsptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadzfstprofisvvideohdaudiouhsorumpblknpfdtvfilemoniscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmecttyphysconptcqmsofconsfdtunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseulptraidugenucomuriouscanneropenfirmbiconsdevisdnisdnctlisdnrchanisdntrcisdntelsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomsysmondmoveriosscomksymsisdnbchanepcomtslcdtwensmbwdcpxapcicpxamciziicsdmmcbuswskbddevusbuswsemuldisplaydevreportiddriveconfigurationproductchannellunkbdmuxcontrollerindexdackirqintrbase%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%sKernel RNG "%s" monobit test FAILURE: %d ones Kernel RNG "%s" poker test failure: parameter X = %lld.%lld Kernel RNG "%s" long run test FAILURE: Run of %d %ds found Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d <= %d) Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d >= %d) %s: invalid base %ddivide by 0/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvsi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvdi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvsi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvdi2.c/usr/src/sys/lib/libkern/../../../common/lib/libppath/ppath.cp->p_refcnt != 0unusedv6v7v71kv8otherhpfsadosfilecoreext2fsntfsjfs2vinumudfsysvbfsefsnilfsminixfs30%llo%s:%d: abort in %sstringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl %s %s SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... kern.driversinvalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@333Nɝ3ҝ@ٝ333 33 133344'4:4oT I4@U4f4t44@4ffsȥ"G~"444ȥ4444%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedforcemount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup 77ZqX3Ò871 33 1M1@&7-727;7E7I7N7U7 bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead. 77ZqX3Ò871 33 1@@AM3۝@19N1@3o:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %ssoftdep 77ZqX3Ò871 33 1@@AM1@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s 77ZqX3Ò871 33 11M1@/rBwBB B@BBBBBB @ܶ@@B@@@ @@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac[-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %drecvrpc: reject, astat=%d, errno=%d getport: %scallrpc: error = %d sendrecv: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %sWK~KKKLVLLLLLM7MKMkMMMMM$NINiNNNNO 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()~~~usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGBZՋ5a-[UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1LOCALBROADCAST pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtudfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%d%-*.*s %-*.*s %-6.6s FlagsAppleTalkEncapInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-z-dCan't exec `%s' (%m)Can't exec `%s'hw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpе@***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPASV%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20150113malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)usage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzD"D#D%D'DX,S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndadbticmsovb|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcupndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i@%:;%$@ %@$$%&.%KV$jy$_%@%@%@v %$b%ǒΒD%ؒ@%ȥX %$$0 %$-H$4$=E$`k$_$@ $@$x %@w %Ó8$Փ_v %@ %@ %@BLV_fu|Ɵ0}Ƨ̧Чاܧ&vhw.disknames2IчHȥZIчHG IчHp.=rGy=iG}3Dh&SFH0eC쬪 SFU0eC쬴-чHIчH&v-чH# (s*K>;' Hah!IdontNeedEFI      !"#$%&  X8%Y%[ x%\T%/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)51210242048409681921638432768FFSv1 [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] Installation messages in Englishen_US.ISO8859-1YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 8.2_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-8.2_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-8.2_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbols%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-8.2_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-8.2_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersSectorsInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit BSD partitionsEdit and save MBRSwitch to GPTSwitch to MBRSet disk nameFormat as RAIDFormat as LVM PVEncryptBootable flagSafe eraseUndo changesUnconfigureEditForce umountFill with zerosFill with random dataFill with crypto data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity.RemoveAddThis removes all partitions on the disk. Do you want to continue?Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG) Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. MBR partitions, if desired, must be created before editing the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID!Disks: %33sSpares: %32sRAID level: %22dnumRow: %22dnumCol: %22dnumSpare: %22dsectPerSU: %22dSUsPerParityUnit: %22dSUsPerReconUnit: %22dMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uMFile path: %29sCreate new image: %20sSize: %22sMRead-only: %22sSet geometry by hand: %18sBytes per Sector: %18sSectors per Track: %18sTracks per Cylinder: %18sCylinders: %22sFile path?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uMBase device: %24sEncryption: %24sKey size: %24dIV algorithm: %24sKey generation: %24sVerification method: %17sDisks in VG: %-44s %20sM EMPTY VG!PV's: %34sName: %34sMaxLogicalVolumes: %20sMaxPhysicalVolumes: %20sPhysicalExtentSize: %20sName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)? Logical volume %-35s %11uMSize: %33dMRead-only: %27sContiguous: %27sLogicalExtentsNumber: %18sMinor number: %26sMirrors: %27dMirrorLogRegionSize: %18sPersistent minor number: %14sReadAheadSectors: %18sStripes: %27sStripeSize: %27sZeroing of the first KB: %13sLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named %s) seems to exist on %s. Do you want to use that?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uDr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-8.2_STABLEftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/8.2_STABLE/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%cdisklabel -w -r%s -f /tmp/disktab %s '%s' -i /sbin/newfs -V2 -O2 /dev/r%s/sbin/newfs %s%.0d-tffs -o async/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d-tffs -o log/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /dev/%s none swap sw%s 0 0 %s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/dev/%s%cdkctl %s delwedge %sgpt show -u %s 2>/dev/nullPritableSectable:no_mbrdevice %s %s (%s@%s)%s (%s, %s)%s (%s, %s %s)gpt -qr header %sCannot process disk %s: too big size (%d) /dev/%s %s ffs %s/dev/%s %s ufs %scd0araiddk:no_partwindows,hfsefibios/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/dev/rcd%d%cCD001/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %sfsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700gamestestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD60/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgin/usr/pkg/bin/pkgin -y install %ss,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update%-50s %-10schpass -s %s rootpasswd -l rootsource for 3rd-party packageschroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %dMlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s%s -l %d%s -p %d%s -s %dlvm vgcreate %s %s %s%s -C %c%s -M %c%s -p %s%s -Z %c%s -n %s%s -l %s%s --minor %d%s -m %d%s -R %d%s -r %d%s -i %d%s -I %d%s -L %uMlvm lvcreate %s %sPartman device: %s lvol%.2dvg%.2dgpt remove -a %s-t %sgpt add -i %u -b %u -s %u %s %sCannot create GPT partition #%d on %s dkctl %s addwedge HACK%d %d %d unuseddkctl %s listwedgesdkctl %s addwedge dk%d %u %u %s %s (%s)Cannot create wedge dk%d for %s. dkctl %s delwedge dk%d/tmp/%s%c/sbin/mount %s /dev/%s%c %smkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=humanvnconfig %s vnd%d %s %d %d %d %dvnconfig %s vnd%d %slvm pv%-33.32s %-22.21s %12.12sdk%d: %s %-30.29s %-22.21s %11uM%s%c: %s %s%-33.32s %-22.21s %11uM(%s-%d) on %sVG '%s' on %d/%ugpt create -f %sgpt destroy %spartmanSpecial disk %s preparing error Disk %s preparing error /tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks /dev/%s START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dRAIDframe configuring error #%d cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %s (%s, %s-%d)%s (lvl %d, %d disks, %d spare)dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=humandd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=humansh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom'dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=humancgdconfig -u cgd0umount -f /dev/%scgdconfig -u %svnconfig -u %sraidctl -u %sdkeject -t disk /dev/%sdraidctlvnconfigcgdconfiggptdkctl-t nullraidctl -v -A root %sError writting RAID bootsector to %s gpt biosboot -i %d %sError writting GPT bootsector to %s Error writting bootsector to %s dkctl %s makewedges%s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d) %*s (%s)Extended partition, LBAFreeBSD/386BSDLinux swapDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%sdlsize=%lld ptsize=%lld ptstart=%lld disk %c/tmp/disktab.%sCreating disklabel %s in %s cat <>/etc/disktab %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:sh -c 'cat /tmp/disktab.* >/tmp/disktab'***************************************************************************************************************************************************************************************************************************************@usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipe^-%uusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-X deadline] [-x maxwait] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu ping6: wrote %s %d chars, ret=%d --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmaprefusedunknown qtype no address %s(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qRS:s:tvwWx:X:too many intermediate hopsff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified SuccessRefusedIPv6 addresssetvarcontrol_handle_datacontrol_writeonedhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1jUѡdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optionb&cGd^efbghiJjknl/mxnopdqrs't!uEvw`xzoyABCDE`FGHIJKL} MNOPQS~TU&V0W:XDZ~1S4\6W|_3~e}pnw}jÒҝh]L  (5Wo;AIN^default_configread_configrt_new0rt_deletemake_varappend_configRҩmake_envu["h#-6\yAscript_runreason0123456789abcdefdhcp_envoption 8hGr <Z*Pe *Tf~4Ji4 +:Jp+:~:!?^~$Iif_opensockets_osif_ifa )arp_tryfreearp_readarp_probe1arp_announce1arp_openarp_probearp_announcearp_new5( HPHHPbpf_arp( PEP HEHH@DCH``Pread_leaselog_dhcp2dhcp_bind%}I dhcp_openbpfdhcp_handledhcpdhcp_readpacketdhcp_readudpdhcp_expiredhcp_lastleasedhcp_start1dhcp_initdhcp_dumpipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_sendadvertisementipv6nd_expireraipv6nd_handledataipv6nd_handleraipv6nd_advertiseipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1w  '>IUcdhcp6_checkstatusokdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrebinddhcp6_listendhcp6_writeleasedhcp6_recvifdhcp6_startrequestdhcp6_recv '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_envdhcp6_dump%s_%s=%s/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version7.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 7.2.2 %s Compiled in features: INET ARP INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-7.2.2 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: is a NET/ROM pseudo interfacepicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type %.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix lenoption `%s' does not take an IPv4 addressinvalid IAID %sIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argument%s: IA_PD not compiled inunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactive(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeleting%s_%sTESTSTATIC6ROUTERADVERTUNKNOWNinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=trueif_down=falseif_up=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid= - %s %s: executing `%s' %sRC_SVCNAMEPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbin%s: %s: WEXITSTATUS %d%s: %s: %s%s: arraytostr%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed index uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s%s_%s=/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rt%s: SO_USELOOPBACK%s: SIOCGIFALIASnet.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6%s: ARP probing %s (%d of %d), next in %0.1f seconds%s: ARP announcing %s (%d of %d), next in %d.0 seconds%s: ARP announcing %s (%d of %d)%s: probing for %s%s: ARP announcement of %s cancelled%s: hardware address %s claims %s%s: DAD detected %s/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: waiting for DAD on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: dhcp_read_lease_fd%s: %s: truncated lease%s: extending lease until DaD failure or DHCP%s: extending leaseNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %s0.0.0.0/0MS %s: using %sClassless Static Routesip_addresssubnet_cidrnetwork_numberserver_name%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: waiting for 3rd party to configure IP address3RDPARTY%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s not found%s: if_sendrawFAIL%s: dhcp_makeudppacket%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: cannot add IP address in test mode%s: DAD completed for %s%s: op (%d) is not BOOTREPLY%s: wrong xid 0x%x (expecting 0x%x) from %s%s: xid 0x%x is for hwaddr %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: checksum failure from %s%s: invalid UDP packet from %s%s: server %s is not destination%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired%s: timed out contacting a DHCP server, using last lease%s: dhcp_openudp%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: needs a clientid to configure%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %sDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s broadcast %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsip6_address%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: sending NA for %s%s: waiting for Router Advertisement DAD to complete%s: %s is reachable again%s: %s is unreachable, expiring itrtpref: impossible RA flag %x%s: %s: router expired%s: expired address %sIPv6 ICMP packet too short from %s%s: IPv6 NA too short from %sinvalid hoplimit(%d) in NA from %s%s: NA multicast address %s (%s)%s: %s not a router (%s)IPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: reject RA (no option %s) from %sdhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s_nd%zuaddr%zu%s: delaying Router Solicitation for LL address%s: no IPv6 Routers available%s: sending Router Solicitation%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: DHCPv6 Vendor Class too big%s: extending DHCPv6 lease%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: DHCPv6 DAD completed%s: ignoring unicast option as not masterbroadcastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f seconds%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: %s received from %sINFORM6ITIMEDOUTBOUND6RENEW6REBIND6REBOOT6TIMEOUT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: failed to request information%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%05d %s%s: delaying DHCPv6 soliciation for LL addressSTOP6RELEASE6%s: dropping DHCPv6 due to no valid routers%s_dhcp6DUMP6Unspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ :     *    5@  %#!/etc/group/etc/master.passwd%s%s%s 646towlowertowupperalnumblankcntrlgraphpunctxdigitUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*ju,uappnduchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'NAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs30%llo%lld0x%llx/dev/%s%s%s%c%.*s/r%sr%s%.*s/%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed Inkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist