08PF?f'&<  'F?f!P''`'h. h.F?f'&P@@<@T 08PF?f'&<  'F?f!P''`'h. h.F?f'&P@@<@TU F?f`'h.yAF?fF?fF?fQAF?fF?fF?fwAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fCF?fF?fF?fAF?fF?fF?fAF?fF?fF?f$l F?fF?fF?fRmK!F?fF?fF?fX`hpx$•F?fF?fF?f(08@HPX`hpK$F?fF?fF?fxsL$DF?fF?fF?fD$F?fF?fF?f (08@HJm F?fF?fF?fPX`hpxY$F?fF?fF?f$F?fF?fF?f$F?fF?fF?f$sF?fF?fF?f$F?fF?fF?f$F?fF?fF?fAF?fF?fF?fmF?fF?fF?f$2F?fF?fF?f $F?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?f$8LF?fF?fF?f (08@H$F?fF?fF?f $F?fF?fF?f$F?fF?fF?f$F?fF?fF?f$F?fF?fF?f$F?fF?fF?f$F?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fAF?fF?fF?fj N@O `&pgPoy"Fݰ?Kd'ZB ( j+*'J pD[+ a's5+ ѵP`KFU1a~ Z)-gSpt%%EV8dր;]cws@{h. . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.6.48.1 2020/01/28 10:20:24 msaitoh Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4!4 ( ̴ t)t)@| ԀԀ̴ t)t)NetBSD5USRffffVS%t)9s)t9u[^WVSÝ%P PT1uJturutzftt19sj1u+q 9vuσ 9wt>t9Ot.11uytuABg[^_Í 89rv*u9vPu2dUWVS%$9s)~*u+ҍ,  *u9u[^_]Ë$UdUWVSq3%l$,t$0y J*05D$F )t/uut,$`t)9s)l9u $t)9s)l9u`s$ם5D$D$D$F$g$% )$0D$D$ D$$D$Y$m$ $SWí%Iu1ƃItЃt$m{_[SW]%HuYƃHt(|$<$&{t?t<$ {tЃ_[UWVShshshpD* u1;t;1щ΃OvhpD*j XZ3h 9#hpD*螡 hpD*j j芘UEU uU HE]eUVS1ۋwtVPiNZYu wC܍e[^]US3PhxhpD*hpD*hxșx CtsPhxhpD*ߠjڗUWVSE tuhyURhc@5J*踅 t5J*hyj踶u!E!8 M!E!8 E!E!8 WVSQRP5J*h/yĝE t!E!8 RPhVy蟝 u5J*hdy艝1e[^_]U5J*QXUjhc 5J* t5J*h}yj1USRj EPS> xU:t Shyj芵]UWVSSuE H1ۃv->PWtLZYtCݠwuދݤwEh,}WKLZYuE FlEEPhc5J*  t5J*hyj 1e[^_]USnu Shyjϴ]UVS1ۋ݀xtVPKZYtCVhyj虴݄xe[^]UWVS ]u} Shy } ~Shy+1}{EFE} t!vtt>uhz EEEEEE먉)t9WuhzjM9Mu7}t }uEEE_ESEEDEEċu9u}t }u"E}t}uEEEԅu.u9uBE4ŀx5J*hz֖ (}t}uuu EEUU9~uuuhzjk]lSXE_u h{j1}EEuĉu܋}}UUuuMMPh c5J*} u ]ETu25J*h:{j謮EEPE4ŀxhJ{E rhR{G^ElU9U|@J*h@J*h9e"TZY sCPhj7"<_Xj U^ sC>PCPhg{  sCbPC@Ph{  ssC4ŀxh{ה CdPh{辔ZYuXEn1e[^_]UEDK*]UEK*]Uh~jUh~jUh~jҬUh~jìUE E EE]CUhjjjuhjJ*J*UhjjjuhjK*K*Uhjjjuh jLK*PK*Ujjjjuh,|jK*K*Ujjjjuh#"TjxK*|K*8K*W%XuWh}j=SSY_u Shj蔪xxuSh]h[jjh@}EPzuu뺋K*P t uh PK*WPZaK*t/#=t K*K*tt hXK*ƒt!uh!Qt{K*Lt>!t.t K*K**K*K*{h?j膩K*e[^_]UVSK*u4$K*dK*(K*,K*hK*lK*;|K*wGrm;xK*s=c 0K*M4K*E$K*)ȉEU}t 13A}ujdK*$K*hK*lK*(K*,K*Xe[^]U(K*,K* t hK*lK*]UhR~h9e"j菨UUhP~h9e"jsUUSQ 9v SZSPEP6ƒ 1uE]UWVSp(w-Ë@4jjVP ǃ y hj/C4VP{(Xe[^_]USË@4URs(PZYts$h9e"jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@uׂ8uK ]UWVSu]ShK*j@F4uu v(P(藂8jSj@$胂8e[^_]UWVS`K*}t hK*lK* xK*|K*EUu}}u1K* t(119~ yt9wJ*J* t(jRP5K*K*P Bu@u 5K*hOVSh`K*E왉U }H|wAU u5K*hȀE菁8t5K*h9e"jAEEJ*E J* tQEK* K*5|K*5xK*QP4K*K*K*K*J*J*]EUK*K*E9EuAE9Eu9E9|K*u E9xK*tK*K*K*K*zK*K*;}u;utbK*t%=J*uJ*5K*hڀXZK*t5K*hj+u}5J*=J*hK*lK*+EUEUhK*lK*5xK* |K*9Mrw9ur uME EtURdK*)P5`K*[$ hK*`K*dK* J*J* t8K*K*K*K*SQRP%2 ujhww#jA= e[^_]UWVSxJ* J*tjhtY j= J* J*tjhtY j< jEP&>iueEӉ|]i5L*%L*L*Ӌ|U)ډ|UXZE |uDž|E5K*5K*5K*5K*5K*5K*5K*5K*hjd]S1H,PSj;K*K* t=ƃy# t QRPhjdSȈ1HPSj;$K*K* t=ƃy# t QRPhׁjdSz1HPSjb;$K*K* t=ƃy# t QRPhjdS,1HPSj;$5K*=K*iu|RP0RPjhu|3Pjhu|.5PWVhjd]S螇1H$PSj: e[^_]U]9U1uIjHUUWVS8K*5xK*5`K*h`K*u} ;|K*B;xK*6r95K*wr 95K*AS5e[^_]U塘O*tqP]Yy6 r0P5`L*h%hpD*xhT0APO*`L*tP_5`L*`L*XZO*O*O*1U塘O*t-Pt\`L*YtP5`L*`L*XZuvUjhQ*hC* g yjO*O*O*O*1O*@=uUSEU dL*O*dL*MO*‹] É)х~ O* B[]U06$1D@11D1H1H1w1 Di1 H [1 H M1 H ?1 H 11H #1H1H1]UWVSӃu]1|L*2L*|L*@ujjh|L*h|L*`thkh9e">Y^|L*L*L*L*`|L*)L*󤢃L*1|L*2L*|L*@ujjh|L*h|L*thkh9e"7>XZSjjh|L*,>e[^_]UWVSljր:0B1=XZCuCDŽ@u1Ɋ1 CuA ujVW; e[^_]UWStL*xL*L*1jPQXZ1QL*Cue[_]UWVSxL*9tL*tL*ujjh|L*y5|L*=L*jjh|L*h|L*thkh9e"#<XZ1ۊ|L*2L*|L*Cu5L*=L*ug^uL*vEhuPC&1~hLjh9e";Y[thh9e";XZxL*=xL*~tL*PtL*|L*e[^_]US]=tL*uU QxL*tL*=xL*xtL*PtL*|L*[]U=tL*uUxL*tL*=xL*xUtL*]UWVS hr[E8Íu‰ 1=L*u>1ҊE1ۄ\É}AuEtȀBuVYEth h9e"0:XZEe[^_]USP*9P*M*P5P*aZYu[j0螿Ph\!hpD* yh!9M*HM*uaM*tjtJjP*P* M*u M*ųu١P*PP*P*M 1]UWVSRUP*=P*P*su1;U t619~, 9uK9~@19E~@1FЋńtP*X[^_]UVS5P*P*P*19~BtP* tP*1[^]UWVSfEp E}u.htY 5P*$_Z]tjEP Y^uD1jHhtY R$^_NPQ*Zy }Lu PPP x E~P*| tf%C*uh7X먃u'h+R$ZYuuh.׋L*jEP- [_eE L*9L*M*=}\SR貴ZYu[g0Ph\!hpD*[vh!7M*HM*M*tjfjLL*L* M*u M*uΨuًL*EHP*P*8ox d#xtދQ*PRR yɍe[^_]UM*P*P*P*P*5P*P*M*HM*ZuM*tj|tjfUWVSPP* t u hB5X 7ƅu P*8u@P*?5P*jË=P*X9=Q*|^SzYt=P*tj jsPE UjjjRV;EtGSZyh1e[^_]Ë D*Q D*y ;0D*| tD*J D*UhD*PvZYUWVS}1ۃ=N*tW* OyWQ^tPG `5P*9d P*M*؁}UtVQͱZYU5P*P* M*uM*tjtjP*u P*C4 ms P*9M*؁}ULQM5P*1ZYMUuN_d0hPh\!hpD*rh!3M*HM*u}M*<tl> P*P* M*uM* u P* QG @t0c0ܸPh\!hpD*Hrh\3;tP* P*1P*0=P*t=P*ttNe[^_]UWVSu mNj5P*P*EQ*EP*P*Y=N*tzE Q*11҉UuqEYUUM*5P*QZUt"?tzDQ*PPjBƒ u- M*t M*tjWtjA M*u M*uݨu]]u}!ЋM;M „tt hpD*hs&=P*t$E;E u E P*uhpD*h`iXZP*t=P*t };} tCu P*M;M u5P*5P* EP*=N*t؍e[^_]UWVS];!uhZ CPh=XZS%hZ Pqpƃ u$oa0xPSh%hpD*ohSu VYXxp;!uV?V'LZt1a0#PSh%hpD*ohF0$=M*uWh{hpD*ao Q*+E e[^_]UWVSu] }9tVC=N*t VPzVPthZYt`0苵Ph\!hpD*nhƉ/1e[^_]UWVSQu VX[=N*t1;uVtRW]ZuZW95Q*u=P*t =P*u BRUPu xËUF?륃=N*tuX؍e[^_]UWVSPu]>!uh FPa;Y_Vu Plnƒ u$j_0sPVh%hpD*mh؉VuSRUǃ xt>!UuR=RJZt,_0PVh%hpD*mh>.*=M*uWh{hpD*^m tE)؉C؍e[^_]UWVSP11 C*yhC*J_C*PC*^=Q*9 P*M*}U|WQZYUu`.^07Ph\!hpD*lh![-M*HM*M*tj j =Q*P* M*u M*uɨu١P*0u P* t1fC*9t[؉Q*JC*@td]0mPh hpD*kh,f%C*P*t P*P*P*؍e[^_]UWVSWP*C{ u)ÃEP*FTRPl Y^tEL*9}\L*M*ށ}VRS_Zi5L*L* M*uM*tj, tj L*5P*ljD s} usExtP*M| th_+Y1vEL*9~VL*M*߁}WR藨YZ=L*L* M*uM*@CL*25P*NjM}t/s2PR_ZtL*D } )s!L*9 L*M*؁}tVQZYuV[0#Ph\!hpD*ih!G*M*HM*M*jh5L*L* M*uM*=@L*Me[^_]UWVSQ]utuh&fXZ} 9EF95X)}hD*h"A#a^XP^vs\Dt.ˆUPh+'ZYUtF-+4/ҍB000CQ<\t빸 1e[^_]UEH!M*EPhht@jM x$Efv\)EfvX)U=P*uEP*E Q*P*Q*9~ 1;Q*~h#G(XUWVSQ*}t~} t 9Q*~[C ~KQ*tISPZYtF=P*tj jvPjjjWurxu19Q*uh='X؍e[^_]UWVSP]U u h#'XS19Q*~BPf%C*P*;u1P*BP*: u)؃u ;.u{ tԍ<M*SZu# M*uoM*tj(t[jQ*t PbFXPPj1ƃ t9uP* M*M*u른e[^_]UWVSQ]Q*x;Q*|1P*rM*9t9u%WEVǡQ*Q*XZUWVjt0 u M*t$19Q*~CPSjE0 u)ϋM*tjjWJX9P*M~V6S.S$VYXMxABq P*19~Q*)@ÉQ*=P*t R7XZP* M*uM*CJ1e[^_]UWVS}5P*ơQ*P*)C=Q*Y9~9 )C)EE1KM*VYYu' M*M*tjt|jPE%ZtEGQ*PPj.ǃ tP* M*u M*uu6kQ*@PX]EE1e[^_]UWVSQ] M*Suj.. u3 M*M*tjj19Q*~CPNjEpVYZ=P*tW0EXZE8G+]C)Q*5Q*P* M*uM*t{1e[^_]UWVSu 195Q*~@PEu|XZ1;]US_UCЋ=N*9 N*M*=}UWQřZYUu[L0Ph\!hpD*k[h!#M*HM*KM*tjv3j\=N* N* M*u M*uΨu١ N*ЋKS N*B9|^5 N*M*Ё}U\SV^_U*N* N* M*uM*OV N*f u u~Y[xmEHQ*M*5 N*M*HM*ucM*tjtOj=N*N* M*_M*uͨNΊ<\uFFBDtF9D ؍e[^_]UWVSE=M*u =M*t hi`jEP6£P*_XJE N*95N*M*=}U\SV賖Y^Uu[I0Ph\!hpD*YXh!M*HM*M*tjdjJN*N* M*u M*uΨu١N*!L<% {5N*9}u N*P*P*p5P*8\up5P*@9{ P*< M*) N*9^=N*M*؁}UtVW_ZUE5N*N* M*uM*jqP*H P*{N* x Q*؋5N*9~SN*M*=}VRkZY5N*N* M*uM*P*@ N*ߋ Q*P*9@GPT9=L*u hShL*ƃ1҉IMً=N*X9~SM*}W5N*謓ZY=N*N* M*uM*$N*)ދEHMt GD>D:P*BP*o Q*9^=P*M*؁}UtVWZYU[5Q*P* M*uM*5N*=P* Q*P*^z uh(Y1ӍS멉)E lO*9hO*M*=}UtVSQ|XZۋUuS/0艄Ph\!hpD*=h!M*HM*uuM*tjtaj5lO*hO* M*u M*uѨu؋hO*5P*ߋMEP*=P*tj jPSÃ؍e[^_]UVSP*< uhB^< u=pO*u$hƋ[J P*R t8t pO*P7Y1ۅpO*t=L*u PZ>j-vãpO*Xu+*.03Ph\!hpD*<h!WTL*5M*V5pO*_ pO*t+h'h@N*SP"a5pO*}pO*1ۉ؍e[^]UWVSVP*PP*M1ۀx%8Hu{P*=Q*hU[s9}fP*PP*Q*T0 P*\PP*Q*2< Q*P*M8 uQ*M*ف}|WRyZY=Q*Q* M*SM*tjZ;j@8uDHP*C=P*iu f%C*1P*| u:3Q*9 Q*M*؁}tVQxZYuV+0Ph\!hpD*j:h!"M*HM*jM*U5Q*Q* M*uM*Q*Q*Q*e[^_]UVSRu] P* u Q*$MP*< Muy8uBP*P*JπwN*j hP*5P*^ v3*8"u)h2$Xgu @P*1҉Ѝe[^]UWVS 5Q*]Q* Q*+Q*;Q*5<&E EE @E+E9؋U)ڋ}׉}M*=}<WQvYZu])0~Ph\!hpD*d8h!M*HM*t M*tjitjS=Q*Q* M*VM*uΨEωË Q*M 9M7MM@ډu<\E~wω<0;EE 0@E)9 ؉)ڋ}OM*=}<WQuYZ=Q*Q* M*uM*tË5Q* 9M~  @uh9|RM*؁}tVQ$u_Ze5Q*Q* M*uM*EQ*uCF9|RM*؁}tVQtZY5Q*Q* M*uM*"%Q*؍e[^_]UWVS] SݯZ=P*tj jsyCjPju?Gt1DžDž EQ*}t9M2 9M*ށ}V5Q*hsY_u[&0{Ph\!hpD*5h!M*HM*ZM*tjBj5Q*Q* M*u M*uΨuك=P*tjj  Q*NjEpSPP  <9~UM*}V5Q*?r_Z5Q*Q* M*uM*=P*tjj S; Q*Nj󤋅  9t:t t( t$jPjuD+ ЍX Q*9|`M*=}tV5Q*'qZY5Q*Q* M*uM*~& uEthڋZX_=P*tjj R Q*Nj󤋅 Q*f f؍e[^_]UWVSQ*P*HQ*1EQ*+P*;EUQ*@Q*Pkuu PuǃUQ*PP[ZQ*;EM*1SpYu' M*M*tjtrjQ*t P٬GZPPjǃ t9]u M*u M*uuFQ*EQ*uE uh=XE tu RR x1e[^_]UWVSQ*EQ*E=h)t =d)uhSY_=tO*t P*jM*tO*E=|O*ZJ~xk 0tMuZP@@FDHtuvs@p][sHJPZZ@Bk 4끋E@E܋]Sk 9]}6:}z}ru׉}8MHupK Ń=P*tʹh)Q*Eh)d)Q*Ed) M*uM*tjpt jY1e[^_]UWVStO*Hk |O*Ãt1H 9utO*A0Y9tSK;SpXZtO*Q*h)Q*d)e[^_]US|O*xO*9tO*|dxO*k PSlYXtR|O*ktO* ËEuCktO* |O*u ֩CtO*CtO*k |O*XZM0tPh\!hpD* .h!5|O*o|O*xO*؋]U+PhȎhpD*-j$ D*Q D*y ;0D*|< tD*J D*UhD*PH0ZYUWVS։˅t-9u(RPh* t{tyC<1VPh* uU{t3Hs!t ,E_< ~6G? ~ʼn>e[^_]e[^_]UPEEjEP5Q* UhPhhpD*,j#fH8uutmUWVS։hS7ǃ 8#WSVd ~ )u1e[^_]1ÃUWVS} 5Q*fDž<X2uJhPj% u88thk#-ÍjjP @u8th1j{Af8utSVWk y8#Ohj#)?jWj!fDž=Q*t fDž9DžjRj[ fDž9fDž9Q*jSV! @u8tfu ftR(@ufDž=Q*uK"Q*@uՃfDžfti@u KfDžMe[^_]UWVSQ}] SW迧^ZƅuzjjfXZu hj?>^ jEPWà ?tE8thhjp?8"u wڍC=wfۉ^e[^_]U@]Ut@@ ]Ut@@]Ut@h]Ut@t]Ut]Ut]Ut8]USEE JX9Zwr;Hw[]UWVS}}} M1;]} 9Qu9u,9yu u9qCۋu]u6u1;u}9Qu9u 9y u]9YtRF,߉։E]Ck,QMueZYt+MTԋM rurz }E1҉Ѝe[^_]UjzL$qUWSQR*-R*]EwR*ڞw ]]5R*5R*hܒj.n5R*5R*hjn 5R*5R*h jm5R*5R*h"jm 5R*5R*h:jm5R*5R*hPjmE$hfjmEPP$hjm =`R*t@uR*1 uj$eY[_]aUWVSMU BEBZry}y9yu};yu9;]ty9u ;]tnY$r$ [Pz9yu9t)tuPh˔jf1ɋEX tQRuuj4vQRuuIkQRuu4k ËEe[^_]UWVSX}Iu 0E EEЉ1 t1҉EU]] UUE܋Ee Ëu֊$Et\EU 1 t1҉E܉UE9EwrE9EsE܋UEUEԉU1}t щ;]u;UuM]Mԉ]@ uuu,J$ E =HR*Iu 1 t1҉ËM ʋUщe t \RP,$h$5HR*Ãt"SjPVHt hbYSdZR*R*1R*R*<EtEU\EEEԋU+EUẺUЉO‰NJu É1҈ t1҉E܉URPuu`;E 1҈ t1ҋMԋ]+M]uuRP9E EEEEuu,y#Ẽ tE8LgEۃ0E̋PathaRuuPh2FPẼP'4E̋XX9t$QRuuPhCjTbuủu]̉]EԋU؃E܉UEEEu$tVV;UTūtNN;M!t u^] 19]9Muu,%"EujP3EȃE$tWd9Us#<EEE‰ u uu>9UMQRPWEPEtXpXju7XZ9u9]EE@]k,PuW^XEk,tԋUVEk,tFF E܋UFV$EċEtP4@0P,@(FVE}t@P@ltȉF Ek,Dԋup(}҃ P$]EpX 1 t1MuuDE;UEu>t\]ԋu)։]u‰Ju ct1 t1VQuu+Puuhj_EtP @@1ҍMQRPWEPE0ju51ۋE;pE9veH9uEtpp ^uu,ujP 0Eȉ1 t1EUC뉀҃ɃDE!E]k,Pu UEZYu E}ĉ8y1EEĊE;u k,E]Kt[ 1ۉXɃ]L t \  HX M܋]HX]̄tK0[4K([,HX]KH EH9utCE@ ]k,]D$uu,ujP.EȋEk,UZ(*ËB$ʈ t1EUFuƋE0<҃<uDEEEūtNN9Mu1ۄt^9]u 9Mvt\]ԋu)։Iu 2CVlj1 t1RPVSPuuWhj[Euĉ0FE̋P9Ut+uRuuPh•j[E}8NEuĉ0E EuR*R*EE܋UEԉUyEe[^_]UWVSuEPN ^EU_9wr9w )ډEUEEFƒu >uFFFuEE9v*Wu hjZNFF1ۋE1)ډӋF@UtR URUE1)ӋE2;Ev1)Ӄ[ PȉE؉U܋MM܋UUыEeʋM1SQRP褼FVe[^_]UWVS]E 8!wEE ʋM9K~HPH EU,|;Uwhj,RWj}EEPhEȒƒyERPhj^Yhj,3W}t E‹CEEEM9M~ ) 9 3=`R*tRP h/j1Zƃ{u a1t t1҉Nj4k, kD,49s`tCC8RjPjjr8P 2h P_ w0jh Ȓ 1 }< DHk,49RPN@بt `dM])SQhn(R*6بt `dM])SQhѢ0 E tPt@pE @H9u 9Eu} 1e[^_]UWVS u }j8jeE@EMAGAqGA GA A$Y[}th$jeËE쉃TXZ u =)ƉEE} thrXEE)EPjh WVu h$j&eËEp E쉃TEP P jP^_ts s5)}thURjh ψ t1WVuXh$jtdEEp }E}쉸TEP P jP ZYu!tCHSLC4|w} tMh>HqX@Et} t#hs)qXu uuS9u unX SeX]t SPXzt ǃ ǃLntX\c1tǃ`dǃt}uWjbƉ_tCtPpb^tCtPJbFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSthgSXZ1ۉ؍e[^_]UE Puj) UWVSuGH E@1RPuu d]tN|1Ӏ}tURju1RPWQtPu hN ]{ 1t#QPuu JcTDEUB vQRuu ckQRuu ck NjGEEjSXZ} }]t\M])ӉM]tsIu 1 t1RPuusc}tVt19s!uu苆0uu V1e[^_]UWVSE@E@4Et EEIu } tu}}t EEE.Ɖ׋E t1txx|+t x9EY| t9EwLEEƉ׋E t1;UQ;ECxtUEZY‹E91Ƀ}tMQxtE | E|NjEtxRPʋEEH _X}t EP4PR^}y} jtuuUEZY|#] ]Ett E!ӋEU t19wwr9wqE3ވ}t(SuuuE}@,@0E@hpH EdUE q9||J}uDž|URj|uuu|E}1҃}tURuuً|E5| }u끍EPEPEPuuuu|}E#}u}t1U9~| u@E6E@hpx }u}t<}5uuUEZYPuuu+E}}EME uxE}tvhp}΃t,utɁtLX} EMELlpEtDžhh9EEPtppuÉEtxuS K1E@,@0GCu=E6lp t1s,{0C CC4SP^txEƋX ڋE u$EtDtHڋElpF4VPt[h]Mul}tE@,@0EAtPE؃u<%-D(5utp|tE}}}΃t,u}Ɂ}LXXEURjPt5t5uktt5t5h£d LEP }tDP4PR@}UBE";EZ,J0tB BB4RPX||e[^_]UWVS u_hEU9EU t1҉E܉UURPuuWEUo1EURPK Mt1ҋM܋])Ӊȉڀ}tN|1)ډEUfMeEUMvfBH MQjPjjRt PhݣY[MA tP@F(V,@F jQTXZtF(V,EԉU؋EUF(V,F 1҉EԉU؋EF (vkBH -MQjPjjRt Phݣ[_EP tM]JZ}zP4PR>Y01EUE܉U‰GÉ1҈ t1҉щ‰UtPB }9}}-@@EUM]HX }9}rɋMԋ]؉HXR vbE9E} BEUEBE9Er֋EԉB80E9Es(BEUEB E9E|΋EԉBBH MQjPjjR^t Phݣ^XZUB M܋]tH X$HB4RP>EP4PR1e[^_]UWVS]vfBH MQjPjjRt Phݣ_XMA tP@C(S,@C jQY^$EtC(S,C 1҉EU苋AM؃H E܉1RPuuV}Mts|1׀}tURju1RPQtPuh Ex Z1t QPuuT4F Fu>XvQRuuTkQRuuTk ~t*uuh` tFVC(S,FC ;vkBH @MQjPjjRt PhݣXZEP t~vrzNJP4PR>Xju_XtC(S,C 1҉ S^Et UC(S,C o1BH lMQjPjjR)t Phݣ)ZYEP tu}rz}zP4PR>X17(R*t C0S4C(jjT0uu Sse[^_]UVSUE 9|9r9 |9w1[^]US@PPhThpD*dhpD*h)CtsPh` hpD*0j+UWVSQ}u t~^h,= S[YZu ELhZ S[YZu E2h SZYZu EhSZ[ZuEuh !vZZYvMEPhud5$g*茒 @u65 g*hyd je[^_]UPEPhtd@5$g*R @u5 g*hjSU g*uPh#t PhϤ膪YXEt5 g*hnXZEt8 P5 g*hK Et8 P5 g*h,' Et8 P5 g*hT Et8 P5 g*hxߩ Et8 P5 g*h軩 UWVSP]̹ 1uVh}d(@5$g* @u 5 g*hե_ 1}t}tiV5 g*h%N Xj E pSSh~d(5$g*蹐@u5 g*hjE pV5 g*he[^_]UWVS}50=*11hu Wt tet quܾ9=0=*tzEE1EPh|d5$g* @u5 g*h jE;EtRPIu *=w* *UMU 9|]UWVS EUM5**1RSuu!I؋E)1ӉWh?#לXZMt*H9u*H9 tCSVh觜 e[^_]UWVSQƉkjEPV= >u#ËE8u=8"u w܉1e[^_]UWS1ƒ1Ӊكh8 Qh8 Qh8 Qh8 QRhhpD*g,jdUWVSEM )E@u h!jF)uӍEƉj؉EEEM!ȋM!QPu,BuAt\))uhuP;N 4R5pk*P)N 9)uC!pk*ƹ}e[^_]UWVS9*u*5* 1Xƃ*e[^_]UWVS ˋDž7 u Dž@uhA8XZߍDžjhZSS t 1/9Cu苅9Cus Pj ;Cuă=d*t.{ t(s$s shc轙C e[^_]UWVS E֋EE*@ P5*& ZYu h> jǣ**E;]~EK9|l;Eveu +] S7P7P1*1*<0fLJU }u"DE{0 *E)+*M艊CKSCsVKSC CHS*Ee[^_]UWVS@}EUԉM؋EGWẺUЋG WE܉UEEEtEоEE}5*5*EE1=)M]ظ=)RPSQCPEċUEUWVRPCRPuuԋEċUEUWVRPCRPEċUEUWVRPCRPuhK,"uuuuuuuhز' hC*jdh`*c u hj}E`*h? h`*YE[^`*U`*< <$u z  Ћ ,I*DQu<-Vj EPh`* EUuh%Vǃ%EPhVK tWh V8 toEU EU=)EĉMˋUЍEEe]ӡ*1ڋ *1SQRPBEUWhV uq*MeEUME EuEt *1҉EUEt *1EUEt *1)EUEt *1)EU>E]h? SCZYÉ]; t1`*1ƃ^*uh`*h E9E| E9EwE9EB|E9Es8uuuuuuh!ʔEԋUE܋UEUEUe[^_]USE Pu}hE膔C*HC* yhC*tYC*PC*؃ t7@t( C*y hC*WtZC*PC*hj蓬1Y]UWVSEM )u hKj])u֋EEUu؉E䙉E܉UE#EƋE#EjPVQC{Bu @u))uhuPE lR5pk*P?F 9)uTjWV5)zBu@tpk*C#EйNju5)R5)D 9)ue[^_]UVSPE);)u*=<*u!URhmdPFz y hod!0^*11@uhc?=hk*u111Hlk*~ k*P@uh0[I*01C9*~0 ***@uSh90ZY1E);)u*=<*u!URhmdP]y y hod!/X؍e[^]UWVSd*Att( t#Pσaw<w r;w]qFfw"k 1i 19u55,I*y$1TtDVt!@ u 9t1 [^_]UWVSEUˋE E쾠tًEU@uVh.XZ6ff=Ut1=<*t fuuVhܳff=u+DžhfǃXR1f=U=Dg*u Vh5dY_Dg*ЉUJDžUtVhm4XZ1^j(RPC( x0HŃ~H Ҍ*tLfǃᵃe[^_]U塸)=`*tvPh_5*5*5*5*5*h7 5*5*5*5*5*hɴ 5*h Phh@**5)5*5*QRP5*h(誎,hS@**5*5*QRP5*hn 5*5*hU Ë*uƂUWVSQE {΍M * QPSp& * e[^_]UWVSÉׅE EEU EUEUE;*|E;*19tX*tJ*}|>9uv7*1;U |*;uv#z=\*}AuCEҌ*ƒ!΃<* *t#=\*6}\* }FhjB *^_u hUj>fǀU*EU **EU***t^}t :*Hu*=\*hgYE֌*1;*g;*[*EU EUEUKx^ 5*t} !|9Ew1;}|;Ev=\*}t럃}*E 9*u ;]*H*1+]9~ Fu%ud PPRW# * H*1RPEU *+E*XZ79[2+Ӷ$EU **EU**1e[^_]UWVSE*1)UME;*E;*؉EU EUEUE;*|E;*=\*Eu t1*Kx;]t 5*tu+*Ѓ}|9Ms}|9Evt%}t}u Ɔ노7\[^_]Ãx UWVSË@S t+5*=*9u9t hAY]sǹ󥉍1󫍍@u'C Ct7Rh&XZߋ1Íe[^_]UWVS|Éס*tPp Yj/SI^ZuS5)hB#h*9 S*Y*u hUj豠jP0;XZy5*h9e""&^XxPS\ZY@tϋuЃ}| v 5*hʷ5*hY^Xh hk*Sk: 9t5*h9e"%f=~m*Ut 5*hSt;ZS];Xtj蔀e[^_]UWVSÃ=lk*u1ҸP!lk*f=|*u1f=u ShzXZ9*} h\,X; *RP1҉u Sh|zY^jjڸ*BXZe[^]UWVSlEUMu} ] E~*E̋EEE 8 EEE*=\*u(}t"uPhUyuuUEtuS&}t.Efu ukE ]PEPc EX*}u*}}}̋w1u}]̋[ ]Er}u ][] u"}̋w1u} u5*1u}U Uu.]̋[ ]E] ]u **)M]u} EE*1҉EU}5*=**E*EE]9]~EEĀ8t1EvM]9|'9r!}ċO1ڋw1EE볡**)|;Ew hvu}| ;us111ɉ tQ@tD*t6*1҉EĉUȃ|#;ur*1EU9|9v11뱉u}|1p**t2*1ҋI1;U|;Ew;]|;Mv M]FuE9*#| E9*wl*Eu h\*E6}uEUjhjjjEu>=d*u5E}EEEEEE }t#**EU****EU11ҹuuRPQUM6#EĉU+EU;U|;Es]u)։]uEE}td*E*19}9}t89t3M9UȋM| 9E9U| 9EvEUG19MtV*tH*1ރ}|9]s}|)9uv"u}*1҉;U*|;Ew#Au'Y1Y1;UEċUȉEUEU+EUȉÉ։ u hE Et 9U| 9]v]u=**1RPuuu 9t}u ;}uVSjjRUM!2EUEPuhȽhѽrthC*jdh`*Au hjˌ`*1IvXIƁ`*t*_* t;M|EHPh`*h t |uh`*EP6 EUEĉUȃ}t5}E$tC}t=juuUċMȋEC juuuuċUEuP*=l*uB=\*}t Ph9e"jP %YEEEE=l*}t`}uE}E$t`}tZjuuUċMȋEw uB}EwjuuuuċUEM*Ph9e"j}d^U UE E u }EfukE } 1E}t }=Z*1**щ;Mu1;UtuuEċU1_Z *UׁǾ}EU}̊EGuĉ+EG}Ẻx HPPE̍HPD>}̍_S[^E}t fǀuEPkE }Rft2=\*t h~YuEfuuEPkE uP3 =d*|=\*hV)Z\E̊@EċE̊XEčE@‰*p1WVjjjzE1ɡ*p1WVjjjÃ(Uă?1ɋ5*1WVjjj}̊MO_U? ЈGGEĊ_EčG‰*p1WVjjjpE(1ɡ*p1WVjjjIËUă?1ɋ5*1WVjjjɾ%ůMN^U? ЈF(}u E=\**tKx *u}E9*~: *EE̋EEUE$E2!E$E2!EEEEEE$E2!EEEE\;E'}+}Ee[^_]U]UPh>hpD*zpjzgUWVSxEU|(*wShdhpD*@pj@gS虩 EZuh|%EƉjRPuSU9u9th迵 jfSuuk  9t}thh莵 XjfE‹E Ef=U}EEEEEPЃ<]1E ƉEE]É]R{EEE_}t S PVE4hl*fEE19U~YtQ*9u.;*u&}$BaP*4hhuu *uB뢃u~1t9vM@9E~St*9r⋹*9s֍PaR*4h/k *9sf}fE@f*}}tGaPE4hmk } t}t}u$EEfEEEfEEǔ*uEE;EE@ƒt<u+E|0хtuEEZE]9]uu׮ XE4h`jY[끋Ee[^_] D*yUhD*j oZYáD*PD* UUE 19s f3B]UERPZYUSZKJy;J| Y RP=oZY]UWVSQ]u uhCSGlF fw4hPhJS l FPjhTS lFPjh`Sk Shh$dXZFXt ShmdY_FXt ShxdXZFXt Sh}xdY_Sj ev(hSkv,hSk v0hS}kv8hSokv4hSak$v 16H 1t Ch1҉t`X`Cl=t{{ tQh_hpD*MD8PhhpD*M$t,@t2ǃǃu"L@"΋H"C$t  X1񀽠tP CdPCT~v1񀽠tLtt,CPLltu"dttt tp1Pj"Yt1P>"ZttP "_tǃǃtt t1ҀCtS  t1҉dhdk11 t1҉Ɗ$ts`X\ X\ t1ҀCtS X\ t1҉Ɖ׋ t1;wr;s )׀ts{s1yxIu 1 t1RPWVtCtHt411҃XXXX  t1t$p|pCXS\pIpH0w:tǃxA/ǃHxuF6xu@t2t!xw+ǃxxxw ǃx‰9rw~uZ98}Llu2WhhpD*G 9_XDž߭ڍWP (VV$he@DHuƉƉ1 t16‰)NjωʊCt SC8S<C$ƀt51 t1t)s8{<)s$‰zD1t 0 ƉD耽tC|PEYBu@u60 PhЮ#i tu`d 1s Dž t1 t19u9t hX tG | -=?w& tj jhW$tu4 t1t\mm 1X 1񉃘@@TCPL\)CDžDž+x| ƒu 1 t1҉ƋʋщʀtΉ׃v<t\9|9v +x|$ t1҉9r9swt+)CS)C Ytu hGXS‰RJu 1 t1ʊt\tCXS\C<‰Ju .?1 t1HtChSlCDA‰@Ju 1 t1ntCpStC`Sd CHC@hx _u jjhU@1󫋃@ƒ<ftf<%GXf<%GdtDtSP1iY^tT^1RPƒXZDžDžtP@P @Ɖ׀t RPGY^Ɖ׉ t1;vY4RRhD ^jv Ɖ_ur;wۉPv _Pxv FYBH QjPjjR t Phݣ ?XZw F~=tFFF.Ht F F$Ft C8SG4WP_DžDžDž199AH Ɖ‰1RjV1RPQ(tPh=M‹p Ju @! 1kօu|t \@1 t1҉щ9wlr9sbF $u> 5F t)C8S< d)C$F FFFF F @@4PG^jjTjjSP(Nj@tK KS1P1fZYƒ<f%Tf-fGHhAf@ntK K11Ҋ t1ҋAQ jh2GHnG@hp p]1ɉƍ19vG@htA uى=v/ts sG@h1ƋD tC CRjPjjW@ DžDž1x1҉эB<| ;vh5P*hyd  Fu)P$t@4PX=*u jS n_Xh^b^DžDžt  hth F)Yψ t1WVhhV'M~Vh9#(XZ Vh9e"(^_hD*`Yu@tǃǃǃ`ǃdSZ=*uS}j [)CSw& 1HClC X,hww#1eY[^_]aUE PuhpD*胁 USMU Et 1؃[]Uju u UhuZYU1;Us@]US] 5D*h hpD*)SuhpD*hpD*j " j UWVS$}EӋWE܉UGW EԉU؋wj EPSM5EUU tEzt Suhnu} t1M8"t M t;Uu;Et Suh;}|;usuuWVSuh;}|;uvuuWVSuhj1>e[^_]UhpD*hL hpD*h| hpD*h hpD*h  hpD*h hpD*hw hpD*hh hpD*hDY  hpD*hiG hpD*h8 hpD*h) hhpD*V' hpD*h hpD*hj5W|$wUWVSDÉP^11+WVhPSyx+RPWV:PV Y1=PZ1g CYPFX+߭ڍ ,ٽf f٭߽٭ RPhPSEYhj; qRPWVÅuSPh"ؙRSWV%à u1ɅtAShGG"؍e[^_]g_UMt*ȡ)1Ҹ9~tȡ)Hġ)h*l*h*p*t*p*x*|*x*ȡ)P * ȡ)Z19~ BUWVSE9ȡ)9}Cġ)Pv Z19} @ȡ)E血*Eġ)EEM9M~FE}t4 tBABB$B4#EB88:tWBEud 5*ȡ)Xe[^_]ÍL$qUQ **5*5ȡ)8EM MuQQ$RPhp MɍaUS]CtS P S tSPSCr s Fd ZS?d *X]USEPsH) ** *H1҅u8l*R;t&t*R;t=|*R9t7h,j.8h*X4CXtYZ@]úp*ںx*UWVSu EEE#ġ)** *M11ɅtJA9}ʳ9M}#t*h@hHhhOP}9x4u }9x(u9p$t버t*e[^_]UWVS]uuu SO trNj@thqh@h1GGWX9w&~6Gthh@hhOwVw : G [^WY*); *V=x*tGWu|*P=p*t+GWut*WGtG4WPZWX *j@jK VjA G _4E UG$W(G,W0wE #ġ)G8*tz8GC GtWP { _ Ge[^_]USEM Puhh8h4hOxP ʉPHPPP s ]XPs4H ***@ l*Hl*0@t |*H|* t*Ht*P4JH8*9t!tXYX tAP]UWVS Uu }uWVRUaËECUt*R*EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=С)Y,A0Éa,ڋyY I4 s RPWSQ RPWSQe[^_]US]C%CSjSY1]UE UMQ1]Uj貾 UU P*PYtHJ *@ *UWVS] *C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCph] C] %{s] ]e[^_]] UWVS uE EEEE%*Etp9sS0ud{M9O0uDM9O,uبt `dM])SQh*6بt `dM])SQhѢ E tPt@pE @H9u 9Eu} 1e[^_]UWVS u }j8j虣 E@EMAh A A A A$Y[}th$jP ËE쉃TXZ u =С)ƉEE} thMXEEС)EPjh WVu h$jӢ ËEp E쉃TEP P jP^_ts s5С)}thURjh ψ t1WVuXh$j! EEp }E}쉸TEP P jP ZYu!tCHSLC4|w} tMh>X@Et} t#hs֮Xu uuS9u uA X SA X]t S@ Xzt ǃ ǃLntX\c1tǃ`dǃt}uWjC Ɖ_tCtP ^tCtP FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSthc)SXZ1ۉ؍e[^_]UE Puj̡) UWVSuGH E@1RPuu 蟢]tN|1Ӏ}tURju1RPWQtPu hN ]{ 1t#QPuu TDEUB vQRuu ȠkQRuu 賠k NjGEEjSXZ} }]t\M])ӉM]tsIu 1 t1RPuu }tVt19s!uu苆0uu V1e[^_]UWVSE@E@4Et EEIu } tu}}t EEE.Ɖ׋E t1txx|+t x9EY| t9EwLEEƉ׋E t1;UQ;ECxtUEZY‹E91Ƀ}tMQxtE | E|NjEtxRPʋEEH _X}t EP4PR^}y} jtuuUEZY|#] ]Ett E!ӋEU t19wwr9wqE3ވ}t(SuuuE}@,@0E@hpH EdUE 9||J}uDž|URj|uuu|E}1҃}tURuuً|E5| }u끍EPEPEPuuuu|}E#}u}t1U9~| u@E6E@hpx }u}t<}5uuUEZYPuuu+E}}EME uxE}tvd}΃t,utɁtLX} EMELlpEtDžhh9EEPtppuÉEtxuS K1E@,@0GCu=E6lp t1s,{0C CC4SP^txEƋX ڋE u$EtDtHڋElpF4VPt[h]Mul}tE@,@0EAtPE؃u<%-D(5utp|tE}}}΃t,u}Ɂ}LXXEURjPt5t5uktt5t5h£d LEP }tDP4PR@}UBE";EZ,J0tB BB4RPX||e[^_]UWVS u_hEU9EU t1҉E܉UURPuuWEUo1EURPK Mt1ҋM܋])Ӊȉڀ}tN|1)ډEUfMeEUMvfBH MQjPjjRt PhݣY[MA tP@F(V,@F jQTXZtF(V,EԉU؋EUF(V,F 1҉EԉU؋EF (vkBH -MQjPjjRt Phݣ[_EP tM]JZ}zP4PR>Y01EUE܉U‰GÉ1҈ t1҉щ‰UtPB }9}}-@@EUM]HX }9}rɋMԋ]؉HXR vbE9E} BEUEBE9Er֋EԉB80E9Es(BEUEB E9E|΋EԉBBH MQjPjjR^t Phݣ^XZUB M܋]tH X$HB4RP>EP4PR1e[^_]UWVS]vfBH MQjPjjRt Phݣ_XMA tP@C(S,@C jQY^$EtC(S,C 1҉EU苋AM؃H E܉1RPuu5}Mts|1׀}tURju1RPQtPuh Ex Z1t QPuu蒒4F Fu>XvQRuufkQRuuQk ~t*uuh` tFVC(S,FC ;vkBH @MQjPjjRt PhݣXZEP t~vrzNJP4PR>Xju_XtC(S,C 1҉ S^Et UC(S,C o1BH lMQjPjjR)t Phݣ)ZYEP tu}rz}zP4PR>X17*t C0S4C(jjT0uu Sse[^_]U@]Ut@@ ]Ut@@]UtPpHtPH]Ut@d]Ut@h]Ut@l]Ut@|]Ut]Ut]Utt]UtL]UtX]UWt\_]UE @(]UVSuE H$X(1y9)tNp1SQRP e[^]UWVSÉ׋EU ރtt RPhY^CSÉtȉÉ_he[^_]U ]UWtBRBR t RPhY_}ÊtBRtUWRP{hY_}ËBht1UVSuE H$X(1y6)tNp1SQRP e[^]UVSuE H$X(1y9)tNp1SQRP袑 e[^]UWVSE8X@ɃLȋu+F4tƅ- 1ۅ# 9}:E@ uVShR [BD1H)C‰AlE@ EDžtԡ)tt@EtkEpkEhM9~ω+EEp}x3ڋ]x[$9Z$vxӋU)UhApEE;uMt@hDžxDž|DžpxEŠ\p9h~Otx|H$X(E@4\t Љ\ lpx|EE?D@Ht!@]KtAFlyA E@ $Etm_pwtF t1ۉىJ,r0Bx}tB!! uC uC C @uA4QPX}w} wEPhEx4Xv\)Ɖx$e[^_]UWVS(}FH ;EtO`_dO@7)ӉM]Iu ?É1 t1RPuu@1'URju1RPVEtO`_d w@މ)։;:Iu u1 t1RPVS蜃1SPhuuv u܊]Hu}t_`wd G@ÉEԉU؉‰CVẺE+]u1ҊM t1RPVS]K!s}tO`_dO@hEԉU؉&‰ẺEЉމ+]u؉1ҊM t1RPVS聂1ukE@p u܉p @EԀ}tO`_dO@)ӉM]x‰wJu %1 t1VQuu؁uԋU܉E@4uPBH )MQjPjjR蚽t Phݣ[^EX HډCHSt4G8WP4PRY$EtGhWlGXW\O`_dOh_lGDG1RPuujnƉ׉S1}Mt}Wju1WVQ'tPuh$ EȋEE̋p 1ɀ}t!QPuulrzuA!vQRuulkQRuulk BEЉ}ԉMq,y0 t1}rzE̋@4uPZEE EuЋ})׉uЉ}ԉv‰uJu #1 t1WVuulEЉNjAH 9Ɖ‰U1ủẺURjVE1RPQ舨tPE1RPh‹EEЋp 2Ju J! 1k<2)Ɖ2E؃EM uEЋ@ r>EB uB R @EЋ@4uPXr]E̍e[^_]UWVSE8E p D1E芇<E]9C,r ;s(uE@puW3E@PE@@H,p0EP J$tr }O tQQBtfQfQ<})G,E @] CE@P]S] EE]9]EP2N] EUC$S(EUEH<҃T;1rhhLhhJҥtM] \EEUp<҃UE)P,E @])C(1e[^_]UWVSS] EC1Ex$tPGEGuhh@hhy7GuWuUZYtWSZYuF}SCe[^_]UWVS}u EX9F(r <҃<D 9F,s VWXZ<҃)V,N MtQMQBMtfQfQMAt#MtQQEtfPfPFE1ɉ‰C,S0]]CtS E@H E܋EH1ۀ}tX 1RPSQ3hӉ1Ӏ}tURju1RPut]KPQh E@ E1tSPEp pf8EE@1҃}vSQRPdfkSQRPSfk EUjuOh;uVWjh%=uVW[(hy=uVWIh <uVW:V  t'<<ۃˍ9Ӊ^;V4.<҃V,utVVJEtfPfPe[^_]UWVS] t@ U f P8jǃ jDb Ɖ<Wb FZYuWh 1=Ȓ*P3E fF8FF<SuX1e[^_]UWVS5*1ۅtb~ [uTF%}uu@u<~G !u~$t*O, O0tVu uR Wu u5C v(뚉؍e[^_]UWVSuE UEU**HutVPt `dVZ}!|}wh)hhhy茠(h EU t1RPT8¸z ȋz Ue[^_]vUWVSu {;{tp‰z1 t1t)FpVt)FH?WmG"GG$Gw4W螠GGjW h3JYs] SW dždž8XZtRPV tRPV dž u hOj:H e[^_]UWVS]E PSjVS$jVSN tAAtfAfA>yy$u!tCHSLC4|w QVS` WVSGVSNJ>҃uS1e[^_]Ut@P@0]UWVS}w4G EE P]芎]ttMRP`;Y[M]C S$ tȋUBE @}ttȋ]CDtȋUB~CE@H }tFFEO,_0}tFh1RPSQa}tN|1Ӏ}tURju1RPu8tPw,h5 EE@ EG,W0]t1SQRP_Nh1SQRP_~vkk EU ] K}tPH P U R}tPPE@4uP>XEuO G E 3 EP]芎]ttMRPn9Y[M]C(S, tȋUBE@UttȋUB@ tȋUBGDWHE tmEP]t}tMRP8Y^MA0Q4 }tȉA E@t }tȉAH }tȉA$EtEuG4O G  suG4O g e[^_]UWVS}]tWYuWh`j`DžPhd@u  u\t|VhedAu 蛞ǃ uܪ8tuhw$UXZ"F<CF(CF,C F0CF4CV8SCF@C FBC$FDC(h #, ߋShCPh2 C PhCPhCPh$tP! _}+uhzd@u n @VhedAu V @uuhjZ41}󫍅PuZY@ % Љ<9Lw 9t8Mǁǁ+EǀǀSMEƀ* D>P\ j PEP 1e[^_]UWVS,}jhPjWeq tGjPjVWVhu$U ʋMQ؍e[^_]UE ǀoǀo1]U u@ t ut]UWVSSEӉVhS} tW1҉jh'N!P讛 uΊt< tG1҉ƒ1}IQuRx ue[^_]UWVSÉ׉WhS tH1҉4< u<#t̓֍D39t-PH u ttVh9e"EXZ1ۉ؍e[^_]UWVS$EUIúhZ PjYXuRhPVhW uRh!V(PPPPPPhaW u Džths7VŐXZtdUNt V蘐X1҉Iv%jhƅM oP _uVZ E o1<t@)<@tjhh(V趏GGG GGPh V/ Hu GGV@)XE ;ot$PWh/| ؍e[^_]UWVS ] 1hZ u˲_Zuuhp*[^ Yt uhRWPhH#Vt%RWhH#Vt h C1Ƅa2=uK%Zucao1ɋVu:1ҍjh'N!P蚖 tj2WVߘ2 9uZ]hhMP誘ƃa QtuhRz 1ɋuэPWh#Vt-Vhh'aPhD1сv]t < uBaH bXt\uhAWhR=H uRVjhZ^j2Pk2 P?F 93~(1ɋitVjh  XtKCkWhPG ujVh j2Pk2ZP螖F 9s~$1ɋtVh(U _t uh91ɋtthns]PPPPhVC\\\\\]t h[e]`tF8tp SPà YyRhKXZÉ؍e[^_]UWVSu~jWj ZY1ۅuh@h H[^4C9~KNjQ0 ZYu Sh@h" :19~DBhZ u '_Xuu h@hB sH b ډc҉уt uƄ vh hP舨vh hPo ڍ41IQRPx DžuċFF;ShRu uWh  ;ЋF BIS蕇[6S茇X19^~4 CY ZDže[^_]USRÍEPjhjjj jSzU tSh% Rj]US<Ph5 hpD*肪Shm hpD*rSh hpD*b$Sh hpD*OSh hpD*?Sh hpD*/$Sh  hpD*Sh- hpD* ShD hpD*$She hpD*Sh hpD*٩Sh hpD*ɩ$Sh hpD*趩Sh hpD*覩Sh hpD*薩$Sh hpD*胩Sh6 hpD*sShW hpD*c$Shn hpD*PSh hpD*@Sh hpD*0$j-Uuu u9 @uuh j=UWVS$`։h Rh*rPEܟ119ܟ~@ԟhk`؟PV ؟ԟuA븅uy؟19~SПԟhk`PV觍 ԟПuܟ؉E؟C멅u Vh je[^_]UWVSƉӍhPdb1l󫋅dhx|h  lPhrVQSh' |xh@ ߤ0tplhw  t RPh 蘤h |DRPh X0Ph& CXZ 4u Ph9 #84hL   EPhrSuh^ 蚟 tK}chz 9Q r,}ch "Q!r}ch  Q"r[Xe[^]US4Ph hpD*葡Sh8 hpD*聡Sh hpD*q$Sh hpD*^ShA hpD*NjNUWVSӊ u@ ttg tbp\uPuhpD*hw əXZ0ZYu C@C1҉Ѝe[^]UWVSƉ׉ˋABP 3CZt=*u ^v?@+CC =*t H (+rC^V1^t @tC*C G<w$ Ph hpD*莟 0C@.C=(C#"C%1RPJ/ZYuC/C e[^_]UE @E E@E]VLUVSui'Zth=*ut=*uQ5(+s *$*Hf **BRPh-*4 *e[^]Ë xD*QxD*y ;D*| tpD*J pD*UhpD*PBZYUWVSQ]u hww#SvK_Ztjh!Sà uh8 ;/uhww#h!V_XSVZXZtC /u/uC@x/u@:tlZߊt hn h h h h h h h2 hN hg hpD*5P41։I~Qhq!P| P!X=*uH (+=*u ?Sy"^uo81ʉщ׍ ;Y+$$)Y1NIZtF"k4$M _uhpD*h kP!^t[Sh hpD*蠕 hSWIUh WtQ1׍G|Ch [[RPS1d FdKX=*uH (+sǃ=*u*?t_hww#SAZYth` SAZYt|ƄGW| .hPPh hpD*`Fq XvhjVECDžkx1ɸDžh9xvI:Z9hwr9shz 9sz t Džz t Dž믃tAtA*t ~CLAtQ1tuDpk9pkNjlރ=*t!t747Sh hpD*諒CD7 tD7D7 ThpD*t7:YXtD7D7 9xwhpD*j 衋XZCT7 9tvX xXBll979w s&XhpD*j ^_f 1։I~Qh>g"Pw uhpD*h !]Ph\!1҉I~Qh $1։I~Qh\"Puv 1҉I~Qh P5v N=*t hpD*h RY[*hpD*h 2XZ*h1։I ~ Qh Pu j^X 1҉I~Qh Pmu 11։I~Qh P(u uE=*t hpD*h" I^_*{hpD*h6 )Y[*_PhI hpD*B Ah PXZe[^_]U=*iu=*t jh`*-Iho TZujUSh h*`*XZth h*JYXth h*JXZth h*wJYXth h*aJXZ*]UWVSu }1ۃ= )ÍF (+s==*tx0 }t hD*PφXZuWVh hD*؍e[^_]UWVSl]u }1= )EF (+r=*Sh hD*萍K u=*iu =*=)u(WVh jd]S虉}u WVS} VWV(YXt%RUPSC: Mu UfJ"uWVS Ã}uPaVXfKEe[^_]US1ۃ= )ËE H (+s(uZtfPfPxtP!X؋]UWVS=*thD*h )XZjjK_Xt^=*thD*h Y^sC@H + s (+sSWSK!XZu19=D+WVYXt{F +ra=*tSHPh hD*虋{uSVS XZ"SsTs s*C$* [u_r 95@+]e[^_]UWVSuE H(+]V_Et8Mp p_Zuh 9QYE9Eeuu XZtMGt 9t@ߋEuI9tE}uSvUS[X)=*tSPh3 hD*QSASYe1Et"Et G;EuEt C;EtM}E$ fO=*WNø}uSTSXZSR_uuu VIǃ}uPS[fO7}ufGufGGu/WVPLVWfO=*WWu!WPVhd hpD*51/EPuu VfH=*PMNjEW\}ubSSS-EPuu V_Ã}uP-RYfK=*SVMøSVPh }ufKfK=*jSMøxSfGth WOXZ8uHt h WO[XWSWcZYuuuu VPEfQE6 uWPXw w"*G$=*uuu VLfH=*PRLNjEWVPhW hD*聇{1ۃ=*tuVPh hD*VUuu Vh hpD*;5EMVPh hpD*E/VPh6 fM ؍e[^_]UWVS=*thD*hQ ^_19=D+vxWVY[uxtV(+ s؋X tf{u0=*tSPhk hD*aSTQSXZ[r 95@+z5*t[^ tO{uDf{t h SMY_=*tSPhk hD*SPS3XZ[뭋v$롍e[^_]UWVS=*thD*h v~^_*1*t#{ t{$C$SOSFY[مuȋ*th SL[$XZe[^_]UWVSP*=*Rut6hD*h }#thD*h }^_5*uY[jjIƉס*EXZh+ D+9 l+WVHƉXZh+l+9vIWVYXuWVh K S6Ph$ hpD*臄fcWVHƉ׃r9w9u9tRPWVh; hpD*QI<RWV1XZu h^ JYCu ht SKXZCt S OfcXSPA<fcY[*;EPu;w ;@+e[^_]UWVS=*thD*h a|XZf`+jr&; jjGEU@+D+RPGEU5l+5h+cGƉ[XuuRGEUuuGEUE9Eqr E9EcE9l+rzw E9h+vmf`+j%: YE9l+wfE9h+wVs79*u :9=l+v: *EC;Eu*95h+s9] h+l+9vEWV6XZu h HYSPh$ hpD*fcWV3FƉ׃r9w11 ;}r;uWVXZu h *HYS`P:fcXZE;*t 9NWVSe[^_]UWVSjjlY[t<Ã=*thD*h zXZCtSPDfc_X[u=*thD*h y[^19=D+WVZYuًXtCtNrPPZ xu SPjSFjPPDGfc[r 95@+qe[^_]UWVS=*thD*h yXZ19=D+vJWV0YXt3fCƒfS{ufCf{t h SGXZ[Ƀr95@+we[^_]UVS]S^uSh hpD* 1Ouu Y[19Åt 9t@uu h E ~u}t h VFXZ؍e[^]UWVƉjhRPd#*t9xu9pte^_]UVS@fC*=~8*)f+5*hjh+?*5*CPS+P5*C* e[^]USjjj0c+CC]UWVS1ۃ=*9] }ߋ+tȉGffG=+t?tuGGG%)WШu9|G9=*thD*h2 vXZGt=*thD*hF xvYXGW9s=*tPRh` hD*}=*thD*j vXZӃ?"]] 9]szEftiB1=+tf҉jEPW<1IɃf E끍e[^_]UWVSƉӉ9tR)ySh hpD*| j%RP6a^thF P6,F e[^_]UVSjh@)-Y[1ۃt%h 菵 Zu V-X 0@؍e[^]UWVSX=*thD*h t^_5 +58+h hh@)x*߃tcȉu1RP ѡ*1ҍZ5*Yt@9uSVGPY uԋee[^_]UVSur9Y1ۉ tƅtËV '؍e[^]US]3%X]]r UWVSH=*thD*h dlY[* uWt'Y_fc@t h4 88ZVCNXe[^_]UWVS}E UDÅuWuu hS 7hhWF"ƃ y@Wh hpD*iqhpD*9b0׷ Ph+ hpD*Cq 1S ѡ*l*0"&Nj[Yځ~RQWk! @u55+5l+5h+h~ hpD*p#b0, Ph J=*uURQV @uG5+5l+5h+h~ hpD*hpa0 Phu$ hpD*Lp$jIgW!V!XZe[^_]UEU ]U=@)#t h@)Z=@)#t h@)XËHQ 9u BA ÉʅtJ9u@BUh P7XZUWVSƉ׉ˉ t9D+wr95@+wWVh 5 *RPWVl*s{ S$=*t [$t;{ u;suh S6XZe[^_]UWVu} 1 tB9=D+r8w95@+v.*RPWV*t9x u9pt@$1e^_]UWVu} t9=D+wr95@+wWVh 4 *RPWV*t&H$9x u9pu@@ P$WVh 4 e^_]UWVSujj[_Åt>NJ/t tF@PW3ZYt [u1 Ft[ 밉؍e[^_]UVSSj/P蒾^Zu1,SeY/txtESh8 3XZEe[^]UVSu*F*9v%)P6S?jj#9tC/vKShO x3XZ؍e[^]UWVS}u hf W3Y1}ҍZ<*uE5H+/ Zu hp 3X)H+ *9w <***uS ؍e[^_]UWVSPu=*uF5H+败 Xu h 2XH+Lء*19w C$؃(t**C$* 1EC! S1Y^49u!WVKXZt-"ЅtP9uSP hO! S1XZ&3*C$*e[^_]UWVS]} ƅu h^! S71XZ9stsF C^ j/W艺ZYx3WxƉ1҉IKS2VPufK fcߍe[^_]UWVS`=*thD*ho! aXZ=*=h uqi^_u,pZ0y Ph hpD*huh! :/fc 19=D+vIMWVZY‹Mt,AEJSBPj2UN)UR̓r95@+s1EEE9D+uu0ZYDžttj$GPEP,uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP(눃EU]rE9@+[1 *9~/*u E@ESjjEP8(GNjE E̡@+D+EUMԉuС0+4+E؉Uܡ +$+EU<+ESjj(EP'C @t,{X0脭 Ph! hpD*fuh! E-SNCXe[^_]UWVS}=*thD*h! n_XZuXjj5D+5@+ *jP詣 *[^u h " ,Yjjjhww#fHjjWƃ y*W0豬 Ph hpD*fWh&" t,xPVf8[Zy*kW0t PhH" hpD*eWhR" 7,EЍXjS LZYu ht" ,YSLV$ y,W0 Ph hpD*}eWh" +j(PPV xV*Z\hpD*h& T$_hpD*hB& Th<8#S褢+sWSh#hpD*[h SvG uhpD*j %UXZhpD*hX& ThpD*#5,+hS%,+@  t9*u +#Sh& hpD*P[hpD*h& Th+h& hpD*-[ hpD*L#5,+hW=%,+@ ShR"WZYu o? t$Wh+\+1Ƃ+_X=h+tjjh++jjh+L L) =L)u&h+h' hpD*cZ* *<+@+uA=*t5+h' hD*Z hpD*h1' R*Y[=*9t#QPhH' hpD*Y* tx;$+u$; +u|=4+9u;0+tTP.HPh' hpD*YYh +HPh' hpD*?Y*  ++=*t5+h' hD*Xtf=`+lt䋅u+~ō K|v5+^9|9v)Ã=*t#8 ~!E!PSh' hpD*MXK^=*h' Zt. + =l+t^l+jh+ltɋ~2KS!X6hpD*hp& hP_X e[^_]UWVSQE++ +9| 5<+1P+h P9~ DBu5+ 1ۡ+؃=h+t VP(XZVP5L)ǃ =+u5<+9+}(~$=*thD*h ( OYX<+++tu~]<+ 9t)R=t=*tPWh'( hD*\V+މhpD*hL( NXZ`+ftCftfHthpD*hc(  hpD*hz( N[_85+h( hpD*U 5l+5h+h( hpD*U=*uh pYujL<+ 1=+=h+tjS'_ZjؙRS5L):!Ѓ@t#F0ƛ Ph( hpD*2Uj2L=*thD*h( MZY=+u&*@*+PXOt<+ PVh'(   Dhh+5+V +h5+u++ e[^_]UWVSÃ=*6C=ltP=TtIʁlt=Tt1 =+u$=*thD*h( LXZ+}t=+#ȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC s,s(_YC(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC>=*t5+5+h* hD*zH뻋 PPUXZ= +t +.l+!+t19+~ҍxCe[^]Uf`+hKhKXZá +ttU +tt]UWVSt]+f`+++EU +M5+=+u}5+u=+}=+} }tEUMEEEE+Eġp+Et+E=d+x+E%=`w= =@tm=u"==t)=?WSh* hpD*F=*tSh+ hD*F =)t SS^t@tSh+  Y[̓=*tSh/+ hD*DF 5l+5h+Siƃ .`+\+hh/#XZ=\+u%=*Sh@+ hD*E =+tSuXjSh`+d ƃ E Et EPSYXEPStuuSDWS]=*tuWuuh$SdYuSKXZI=*tShi+ hD*'E 5*=+tSuX%`E|+RPE PSymyM60V PSh+ E Et EPS_^XEPSSuuSWS=* }`uy#uWuuP=*tSh+ hD*DD 5*=+tS8tYhS|YZy50芊 PSh+ E Et EPSXZEPSuuSWS(=*tuWuuhMSuS_X=*tSh/+ hD*rC =+tSts^5*uFhhS d+ y*40豉 PSh+ hpD*C=*th++PYhhXZ=*u=*tNEPh++P Sƃ tVIURP+0h+ hD*BvӋE EtEP5d+^XEP5d+uu5d+W5d+=*tuWuuhS-u5d+ZY5d+X1e[^_]UVS EH+EEEf`+= +t=8+Tt h*  [h* Y=l+uh+}Z4l+EPz ËEXE8t185+h+ Y^Uv"E-EF+9ӋU9uu +HtW5+h, TXZ݃= +u:+ EEUPE0~ M]ËUEЉEY^B@+D+ uE@+D+$M u9t5+h*, XZMl+e[^]US|=*thD*h@, 8[X=h+tjjh+%#=+t L)jjh+L) =L)y&F10O Ph+h%hpD*?*<+P+=+=* +19~ DB+ =h+t PQZYPQ5L) 00衅 Pha, Yt!hhv, Ph, hpD*>j5 <++=*tPh, hD*> +NuF + + +* +(uhpD*h, vhpD*h, 37[X=+tB=*%Sk++11+=uI)У+=*u =*tu3++0+4+++ +$+EPhww#腡ZYy#:/0C Ph- hpD*=j4E荐wP)P)PtPh%- hpD*v=jv4=,+t hpD*h8- R +u,=*t5+h' hD*.= hZ- X= +thpD*hx- 5j4+(+=+u(+]UE PuhpD* UVS]u =*u0VSZYy#.0 PVSh- hpD*z<=*tVSh- hD*[<e[^]UVSu*u8jjhVdy"-0衂 PVh- hpD* <!=*tVh. hD*; ؍e[^]UWVQM1y9=D+v!WVZYt xt@ur95@+wՉeY^_]UWVQM1yv!WVgZYt xt@u ڃwډeY^_]US]h h+Ɂ+XZCth. h+ YXC th". h+XZCth+. h+YXCth4. h+XZCth9. h+YXC@th?. h+XZ+]UWVSQMSZt$1tH (+s11ShH. hpD*I: eY[^_]USuh_. hpD*#:hpD*E,+HQPy PY,J!,+HyPZ t,+@ u( u둋J: yu np1]UE PuhpD*ݐ =*u(h,};YHuhi. -ZHugj]0UWVS}u }u-*uvVWYZyi*0 PWVh|. 1}u:*uCVWYZy6g*0p PWVh. hpD*8Kuh. *XZ18=*t*s. }t WVPh. hD*8؍e[^_]US]u h / hpD*g8SPh1/ hpD*Q8s Ph/ hpD*68C tPPh)/ hpD*8C tPPh;/ hpD*7CtPPhP/ hpD*7C$tPePhd/ hpD*7!{t Ph}/ hpD*7sh/ hpD*7S0E E/ ]UVS]s sCY^1t 9tF@h/ SXZs sVh/ h/ hh+X3+e[^]UWVS]C t h/ SgXZfK SyPVa}3S[Plj1҉IKS>PV$e[^_]UVS]{t h/ SXZS X=*u8hVIZYy'fK@'0| PVh0 hpD*-6=*tVh0 hD*6 e[^]UVSQuj/V([ZÅtFt@.u F)Hhe1 OVh1 DhE1 jHUWVS$׍hPwRBtShyd  #VYFuM+Ah<;  hD*Y[1ۍ>1ʍuEfEEE'E0VhQ`5,. @u hH; j59E<u 5,hU; <u5,hp; hpD*" ~<tP5,h; hpD*"_Pu󥀽_y-`9@2 CSh; hD* j 2RZ<h; Xe[^_]UWVSE] hp[ Zu h; j81 1;}L jQh5 ujQh;  uFu ;}OjShy# ƅtIjSh<  u'jSh<  uWƅ7fDžjh0uhj P5, ƅxÃ9t h< V+gYX$t hVrXZt#t hQ< VTYXh; VGXZhW< V:YXu h`< V(XZV5,5,5,5,hq< @t6t`f@fÆh< V^fY_\f@fÆh< V/fXZ~ -f@fÆh< VfY_u h*= ZESh Vh9e"pރV׃X9uEe[^_]` e[^_]UVS ] }tJ3h ;!VZYthG2#VZYu E'j EPV载E U:uy 3h1= Tsh ;!VZYthG2#VZYu E-j EPVhE U:uyshD= jT4EPhU5,R t hT= jX4e[^]UVS ] }tW3h ;!VZYthG2#VZYu E'j EPVʼE U:uy 3h1= Tsh ;!VZYthG2#VZYu E-j EPVuE U:uyshD= ja3EPhU5,_ t hb= je3e[^]UP}kE 0EEPhQ5,t hn= j3U}t'jhQ 5, t hy= j2U}tjhU 5, t h= j2UWVSEEE E܃}E4FEPU Xu h= j;21ߍNEfEVsSu1j EP6 U:t6h= j1TTdDG9}ujh0uuSjEP5,]e[^_]?] USUBUBPJ R Ph8  uE8 ]Sh9 XZ]UWVSE}EEU2 stE8uE8Ct;ڀ}@tSEPh> WQ !tSh> WQ  WVQ e[^_]UWVS@EU u}Jvu#XuW48 VJ 1ۃuP @ W$Xu.P @ j@MEP48 h>l#WV`exPKf@$2 у@t%> tL RPSh? WVG> tL PRh%? WV&Ph);U }Q~MuRlhm@ 2ZY1ɋlhlPh[A" hAlBXXhtY Xe[^_]UWVS] }uht@ ^X1C9~D3Ph@ FZYj X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u @u hH; j,EtU,<uRhOW  <uRhkW hpD*X #<u jSRPRhW hpD*3j0 e[^_]UWSU]1}EE E EUjh'RujSue[_]UUMEEE EUjh'RujQuUWSU]1} EUjh'Ru jSuae[_]UWVSRUEM0yu@tytuuot]y_v4m tQ\0J0N0J0N0J\um tf\\M t B@;EuX[^_]UPhX hpD*sjs UhX ?dUWVS É֡ 5E1,P,uhh,萦XZ,hY h'Y hW@h W5Y_u:hY Ph-Y j[ ?@,8  uY h,RPhFY XvHhx,: $hvY _ T,Pjh@,h|;;v4ڃvFE19t-Uss ssss3h/a d  UB ϋE荞 kT؋U9th,hEa ZYmEM9MtGSjh(/!  :19{v#TM4PhXa G, ؃TEj Xue[^_]L e[^_]Ã=l,t,URh,4)h]a qUWVS= ,uha Mjj=PY[Xd 1Dž\ Dž`hj`Ph,\PSV谱@u!\==$,jNDž`1Dž\qdX@DŽdj`R`PPQSz@u!?0HP Ph,ha 1Guh,ha XZ+=l,u"=,uPh,h% e[^_]UWVSS}] =l,?ΉE,u=, =,tthD*jWVu,u5Ы)Rh :#x u Rh cXZd,~tj lXe[^_]Vu E rM19}V=d,tUPh@ YXUt.=d,uUPha XZUBVWh)/! KuEa e[^_]E e[^_]Ke[^_]UWVS]} }=l,Ήǡ,u=, }=,t}thD*jSVe]u/}u5Ы)Rh :# }u Rh XZd,EH~}tj Yډe[^_]Ѓttt;Elj}tu2E r9s;Ph5$XZElj}Et PSha Y sPh!Ph ÍElj}tuuSha ,$M] s SQhMK"SQh! }uEa e[^_]E e[^_]}e[^_]UWVSu]}=$,t Eha SZYuEEYHjEPStEUE 9u#SVhb # =$,j8u8uθ]11PSEPMQMuu@Mu1t =l,1=,u=d,u}u}tPjPj a YXtG=,u=d,u}u}tjjMjj a =XZe[^_]UWVS]=$,t EEjjEPEPuu۫@uuh%b uj*SW|* u%Suh7b p =$,jjI*uVJ|W2*-8u|11PSEPxVuu,@u1Ot =l,|t1p=,u =d,tpjUE!Y^GxU1RVտEPVhTb jduV1pPUEx$tr=,u =d,tjj|UEXZGU1Rt`EPthTb jd]SjPًUE$e[^_]UWVSVU}5l,4˃=d,u5=,u,=,u =, h,h^b Y[ ,u=, =,tthD*jSuu,u5Ы)Ph :#0 u Ph XZ=d,~tj &XڋEe[^_]1v{9}E0Ph@ FYXt Whb XZE e[^_]O h+#jv 1PSPVuu腧@u1t =l,1҅ƒ=,u =d,tR E9Z=ƃ1҉IRQUEVA t^=,u =d,tj EX4Ã1HjPًUES@ e[^_]ÍL$qUVSQ,A QEjjMQuVRPU@uz}t Shb j=d,u =,tjYd=,u Sh XZEE1҉EȉUm\$E1҉EȉUm\$E1҉EȉUm$hb eY[^]aUWVS]EhEpEl}󥃽puBDžtjjtP|Phb { |tDž|DžttW6 XuQxjjxPVph迤@u x;tt Shb jl%EpujjڍE_X=,tF19|Whԫ)Shb jURp jjpEpG 뼃=d,u =,t jL=,u4Sh Y[%t h Zt4Whb G9|j Xue[^_]= e[^_]UWVS(EE̋}uu@=,t7EjjEPEPhb E@Ek(EEE(URU4 XۋUu6}U1}H(jjURPVWڢ@uU1H(M);Mtuhb j uދ}E 1C(9~؋0x3{px s{ pxs{pxs{p x$s {$A(뼃}t EHPhԫ)uhb j}W=d,t7j(Y(}tEЋE;E@t]e[^_]; =,u=,u Wh XZv$v vvvvv vv6hc u,돍e[^_]UVS ]EjjEPuVuuN@us}t Shb j=d,u =,tj C=,u5Ы)Sh :# =, h uu} t PfXuuhFc  e[^]UVS]E jjEPuVuuy@u} t Shb jEUEU=d,u =,tj (XP ,u EP.P5Ы)Sh$&IuRPh0e" uRPhNc e[^]UWVSu}EEE M$M=,u =,=h,H=d,t}jjEPjuWe@tqUtjRU1 XtZUUjjEPSuW0@tM;Mt S)9 [+jڸ,Y]e[^_]9 =,v}tuh,h[c  =t! u/Vhc  t uVhd Vhc Vhc oXZe[^_]UVS]EjjEPuVuuc@u j}t Shb j =d,u =,tj!Y2=,u Sh XZuuuuuh$d e[^]UWVS(ԫ)8,t f@,/@,,SV:Y_uVh@,XZ>)@E̍EӉljDPh@,ıh h@,赱}tu릍e[^_]UWVS\E@,1эAE1`] `] }92w2UjPWH= Utj@uVWPV3h`d WFUjEPjh@,WUuE Eu1}u+E9Eu#)tj@uVWPV3hpd j FO1ۉ؍e[^_]UWVStx|,1щp,,щl,d,) ,)щ=,u,u|uF1;xt苅t8 tww#RPh#PP{C} t~|P8 xvԫ)RPh :#PP9|P8 xvww#RPh#PP Dž|)|)Ã=h,=,th,h XZh,h,hd  EP!w$] Phd _X}u=|@0|sPhd fY^P|p4hd N |p@hd 8|0,XZpt 8 6hh8 h,hhd h,ݠ+#ppu/hWh,赠hhd h,衠揃+#ƀt2hWh,~hhd h,j+#s2hWh,Fhhd h,2+# s2hWh,hhd h,+# s2hWh,֟hhd h,Ÿ+# s2hWh,螟hhd h,芟+# s2hWh,fhhd h,R+# s2hWh,.hhj! h,+#s2hWh,hhe h,+#s2hWh,辞hh e h,語+#s2hWh,膞hh #h,r+#t7Vh j V hWh,<hVh,,(h,|h%Phe |@H t Ph"e _X|p(h,e j  }K= ,=,u }}|xXDž1DžtxThj`SPPWt:@hu`t|@9uߋ|@(9uΉdQh' Í@^dwߋh󤋅|@XPwP/ Y|XX=,uE t|@XhHw9=,uh,h UXZ|@XPvh5e PX}|s E e[^_]UE u@ t]US1]  t=U}tuZv!Zw t Yw 9u@뻃[]US]y,,,/-ja9X=,t=/-t 觷jSUu u' ZYujhԟ 膺jvUWS1}jRuPP؍e[_]U,E]UWVSh 5V^tw5H,8tltSv藀ZYuFr6j jPSqF1jP-FShAF#PsH,5H,F h uVSVVUe[^_]US>tPҜ=,uS Z]UVSÉ u=,u VSD ZYe[^]UWVSS׉M]uMu E E(u#;u8 X[^_]USt10!1=,uS Z]U=T/-th j5, h j5,u UWVSƉӊ>uu],OuG,hYS58/-V* =,,hYS58/-S 9=,؍e[^_]UWVS,E9,Z@/-]S5`0-蜣Y^=,u`, ,S6Z=XTw}n(w(2K mfF5_=w=GfF59==,#fF5=%wJ=w=fF5 =` =fF5 =w=KfF5==fF5wfF5lfF5afF5VfF5KfF5@fF55fF5 *fF5 fF5 fF5 fF5EۣP/-Eݣ*uRFWZPÃ$m %VF%  V?F % V׃? VwF% V׃? ~  VAF%?@ V? V V  V Ѝe[^_]UWVSEU qu= ,tw q0׃?π]wy8J ?΀]wq0J?π]wy8JP?΀YwQ?ʀJJ]J]JEXZ[^_]UWVSE ]U:= ,u~ 9sQGK9vGGO@~P^49w'WpY 9vG%OtWRZ1M9e[^_]UE;)r)]1]UE;)r)]1]UE= ,t],]US]uhy h@,]Y[w@,t7؃@,u@Sh} S5,j h@,ʪSQZt S5,؅x>v>v1v$v ƀ@,u@,5J)@,Htڃ?ʀ@,@,@,]UE;`)r`)]T1]UU 1}DuЃ=%" ]UWVSE׋u] IuRE1}҉I^3RWEWZYuDWYt1}҉ItO Kh,jEP)WPGtt#WZtEe[^_]UWVSSƉ׉ˋEh,jV‹M)SW e[^_]U,9,~/MU,EPU~E),ġ,,,UtuRh,%4 Rh,3ZY UWVSh .Yt8À8t1hmA!PX_Zu1ahW$#SXY^tSZEhdD.Xtπ>tʃ1ҍZ jSph VhB#SP謧e[^_]UVSÉh -Yud P.uZt19}z uRAC tPh V e[^]UWVSQƉU1ҍDPjV)jUR‰Ee[^_]US5,8thEUEU,;l/-}?U,PE,Z뼉EUE]}U,PώX,8u9,v]á,=,UVSE},vMUE>}~E,;,~a,,E1ۋMl/-+,9},v1ɍUE]́, ,,E,E),EPU~1[^]1UVS ,,E1ۋEl/-+,9~.t2UE ]ЉEUE}EEE8uދE-,,,K [^]á,8USEUEËM ,l/-9|4J9u ,xuE,E,SX,8t!UEC}P辌E,1]1US,,uM,)Êt@),!,t1=,,u =,t[]á,8tU1]1À=,t8U,,),,]øUWVSÿ,1։I=v {C,=,9wI, 9s CCG)+$1[^_]UWVSƒ1֍t2U];t,VjEPU)ډH tىEE1e[^_]U,,,,,,,)]U,,,)]UWVS]1ҍDE1;tw]ujEPƃ 9]vCCP芉Y= ,u,,3VLZu(VWY_uVZ,,넍e[^_]UWVSPE,,1ҍ,1E8tSjEPTF e[^_]UE,U ,t@]UWVSu} ?tB^9tWs QZYt'jjWC 3FCF^ Fe[^_]á,tUh,P,@XZUWVSu= ,u,,uR,,ƀu,%=ug%=tYV,X&%uP ,A,󈙨,9~ Eh,0_u/,E,>,,,Et,5',t1)PV(EY^ 5NH,!}},}A}} `,,,U}} !}}z}}e,GD,,t),8 ,,=,x ux r,=,w,,8,G,,E,,=,Ax u0,=,+x !߀x ,=,w,E},,8 u,8 ,,I,5,=)y,-,)V )B} u9{ QMWh,y څMu͉^hkWh,e,,XZ,8=,t },tP? ,X0E1}эAE,u ,,,u7,tF9v > t)E)E11һ,Cnu_}t;E9v2U؉MuuSl M܋UuE\C9w)t 18E18Et < uލs1׺Ѕ5,,tP3 Xj,)@Pf,,)RVP^,)8uFVD0XuV5,XW5,W _X,,}t6,Ph,$1ҋE,[^,E,,9,v,u-,,,lu5,7Y,=,v )8Hu%h% Zu ,ڸ,e[^_]Ee[^_]UWVSQM9E,11ۋEUp0 w%k Eܸ ]E0Ӊuu8.u M]EPjEPw{ M]ȉڍeY[^_]U,]U,1t B@@ ]UWVS|IÍxPS^_%=hZ SeS VhS f jh3 SD u}1VhSe th؊t t u@hG SHZYt/hO SHZYt%"utPWZZY듿)댿)VwXe[^_]1=) )UVS|ƅh P[V fSft|RP'm^Zx,E%=ufSfthP7OZYh3 h\!S聚hG h\!Sqڸ) hO h\!SU$ڸ)SvXe[^]U8- s <-7t <- <-9-t hV X9-t ha X9-t hm X8-t hy X9-t h X8- sh th h mXj5m OZYUWVS-ƃ@࿉ÿmA!uL#<-/W X=-tW_t h ^t uh;#hYjjXZe[^_]UVS։ˣ<-VuS e[^]UWVSQE á8-Ɓt#t&&ur%8-Wu58-0ǡ8-ƒ8- t;x- st jm&j&Ztjh ~XZtS&Sg Ye[^_]U-]a{USUá<-+/  tx0-؋]%?'#$Q50-jPC/td7.8-8-PS胕<+u C< u,tP X;u,S,X5-S5 -5$-cs$-50-jCPP)= /-S%X]e;!t@-tP+ XS*@-Y= /-uJ@-uh h8 d_XZ.h P= /-uS-P\bjh |]UVS+t//-/-u ujjj5/-RP? I/-t@5/-/-/-/-u %AA5/-/-e[^]UWVSRt e~AƉׅu‰/-/-/-=\0-u2t;=/-|;5/-sjjjj4 /- \0-g_8e[^_]U<-1!]UEp)EPh ){ZYUVS=-t7-t-t$<-tHtu <-u e[^]X05-P X1-ge[^]UjjUP---XZUWVS]1ҍt9r PNXe[^_]UWVS8-8/-@/-e<-0-4-$-=\0-t蓘=,/-tj]5=-j|--r_u).t u5,3Yuj_=/-t"/tu5,3Zt΃=/-uaa/-=D-t"jhç vD-@gt h7!vXt?u j:vXjqWv_X=\0-eu"rj1ɺ^!Ye=\0-[e<-t!A/ti7i%CЃ #.jSZYdh(-O0-4-<-_=$-ueu\-ƒu_uK- !t! @t#++t-1@ 1D- =-$-  t);P/-;@/- ;=0-u'=4-| =0-v5-5-4_Xjj50-=4-| =0-w0-4-jj50-=4-| =0-wc0-4-=0-ui10-=4-| v/-V=0-u5-5-3Y^jj5/-*0-=4-| v/-jj5/-+tM謄6:=4-| =0-w0-4-54-50-=4-y0-4-(-=4-|) =0-dv0-d4-(-05(-50-70-4-|w 6bRP$5=4-y0-4-5/-54-50-I6fe x}EEPh9e"x=,uE܅pPi t -/-jZ8- 8-=4-+| =0-w 0-4- 8- [ 8-=4-| =0-w0-4-T0-158-Ѓt'Ѓ 58-ЃtЃ8-=4-| =0-w0-4-0-1P58-j<`eS/- -/-h! M= /-j m %  = /-fCe5,)hmA!Pm4 u jh/ =X-tjhJ m^_j m ;#6j5/-BujPPe]t jhu =4-| =0-w0-4-50-Ye(fto"t K=4-| =0-v 8 EEPh 7跕t jh "=4-| =0-w0-4-50-hZen=4-| =0-v 8 EEPh =4-| =0-w0-4-50-]_uPjh l=4-| =0-w0-4-50-k^u jh (PYe譒u 5/-RP6. t=4-| =0-w0-4-50-\Ze8jhѨ >k_X%ne=,W%Yu ͽP!Zt W9?W%4- --j1ɺ = /-j m ;#}edj1ɺ 9_9P/-=9@/-19WpZpPh9e"}[p舶 dt lSd3d_ u`I SC 9uujVXXj`)%hY_y0SVppPh9e"Zp U=0-tOuZuhV _t܉ppPh| [ZYYth%Xt\5,V(_\\E,dX-l`-u/h/-5,(/-\Pdh蒺dui,t=/-tP^xP`ZYu(EU/-/-x|/-/-,tPX`~ 5,LV,X=/-tC#]5lS5m _Xu"=@0-~ppPh9e"YZYS X1e[^_]UEt5,PZYEU5\-3DZtjh Xj襝hmA!UWVSSljӉM}uWWYKxuWZu\0-tȸe[^_]UU,]U,jUU,]pU,jUVSu1SQYtPZ9u]e[^]e[^]UWVS]SSS$St5uu$1҉u1҉tjVe[^_]UWVSuEPY[11VEPh^Zƅt]VEPEP 1REP>ZY…t(RUZۋUu݅u5,XUu߱ Y둅uWY/5,S^Z;,u Wq[1WSZYe[^_]US*Ã=,t0SX]Ã=d-u*UhҪ LZtd- d- d-ád-US1j%P.ZY…t@zsuC؋]UWVSjjd7[_ǻdNyMVLEZMuYPE tG)C9|4jSWPE{W蒰 1UэL ׊EAe[^_]Uh MZu2UWVS]1jQrZY)8u"Ct_)8u:SuPCAACƒ1эy;t*tMWRUSS UMuAACe[^_]UWVS]5E1}֍FE1EtJF8)t8)uMUURP,ZYMt}tuEG밃}t1߈֍vjV@YX}t\)PS)Ph VWgiCUMUMQP;,^ZUtuRU膳UUXYCCB ue[^_]UWVSRhE!bYtxƀ8tqWXtd1҃ЍTjRUrSh Vha#URPh S hZ W9EW E hZ W}9ZYe[^_]UWVShdYu1yÀ8t1҉}Ѝ4jV XZtuh Sh$VWhW'jP}$y W] Y1PeZSK Xe[^_]UWVSPu1ۊtM<#t<%uA;uv8Ft78Ft3<%t <#u*,,tP ǃ1ҍ\_CFjCSXYӋut`<#t<%uR;uv8FtH8FtF<%t ,<#u5 ,t)UQ? PSk1ҍ\ UCFЍe[^_]UWVS]S蘱^u1jjjSOBu@thVS 19sTSjWq =0-u+€u!SjWR 9sP9YuPZtF1e[^_]UWVS uIE[= /-IP%EY8umA!PEZh 7Xt>u 1҃}э\ ǃ1Ik| jW;u)P)PVh$ WSie$uʪ WX1эD tRh; P F uh/M!P S} u un _<]V8^;uSP uH Y[u< u4 XZ]Ee[^_]UWVS1ۃ= /-u^1}ىjQAuhC SPdVLPǃ VPEZYu SƩ Y1W轩 V跩 XZ؍e[^_]UWVS=/-tf= /-u]jhl s[^ÅtD)‰U|uC-uChmA!uZYtH~jhG N_X11҉}Ѝ4jVKuSVPcrW t}fCftjEPV Ht:S-7^v}lEE hd [=EPjEE 0hmA!͒ZYLS6X>e[^_]UWVS uE EE= /-tP6Zha X~Ek e[^_]L1щMы}щMщЋM+MTjRUVuSURP bW} t]e[^_]5e[^_]UVS|uƍ|PVC 1ۅxE%1=@V ؍e[^]UWVS|u_=0-u3P[t(1jPVP谫h)^xPVZYy V`GXI1ۃ=0-u>E%=t/1j)P躐VPPh)S VY ؍e[^_]USQ|M|PS6ZYxEԋUjjjSIeY[]U ]UWSU1ӍD9v Hx/t[_]U=/-u]m]C=/-uFUVS}Bu@u1+jMƉXu tS111 e[^]1USt%jeMӺXwv1҉Ћ]U=/-t/-]f]UWVSEEu }EE]EEtE98/-/-;E}x8/-H;E=/-t78/-H;E,m9u9tXMWVLC[XEjzLY9u9t-)MWVL/-XZt"贚1E(MÅuE=)u h FYEEEHExM}~ Mu{11uWV1ƉXZucu^}tjjMZYuI$jKYBu@t}9}jjLYZu8/-HPjLYZuWVKXZuR=)u =,t1u,u'=/-u=!-u=!-u /-E/-EtW )Ee[^_])U1=h-u/-y'=/-t8/-]UWVSEEu }EE]f;E|tE198/-MHExMWVƉ!YZ@u}Mu ;Mu(o:WVJXZu裘踘DM뭅tf =/-u賘Ee[^_](UWVSEE] EE?t)t ujXZj莋jIƉXuouju=/-tQJ11@8/-HPjJZYu:jlIjjRPjjXIƉ׃uuҍe[^_]VjuSWVue[^_]UWVSEE] EEjHƉXBu!uu e[^_]jHY tuSWVue[^_]UEu)=)u1]UEu)@=)u1]UuZuUS]tSS-Y9,u SZ,SPS=)tH l-s X]] ]Ul-]UWVS}u ))tsWF ZYtsj(jW%CCC CCC t-sXF@C=)t@l-)̉؍e[^_]UU1tB]UE@]UWVu Ex^_]UWVEp} ^_]UE@]UE@]UEU P]UE@]UE@ ]UEU P ]UWVS}WEU}u}uEE=/-u-=/-Pk-EURPuu_[:[uʃ=/-uuuݟZYuEUEU\0-v蘡t uڞ EUn uu uu胟u}9}~B\0- 蓞WVPà ~ؙ)Kt|9uwaMà t 1 \0- tuIxΝEU=0-5/-Cؙ)]U t1腝RPSà ~Z50-u =/-~1\0-膝 t@uXEUEЉURPœ[^l=/-tLڛ՛}x t u, u\0-/U u@蓛\0- 0 u :@u*ƉRP,ZYWVZ [Xu}uuZYEUE؉U \0-EU u,\=0-=/-P@E芚RPMQƒ ~V=0-u =/-~ /-TU UKt U#UЙM؋])ӉM]E9E&|E9EjSWVQM]M]=/-t jjuuWVTtj*XEUeY[^_]UWVSu} ut1WV苚ZYuW谙tM uΉ t5P)=T)耙@wHs5H)=L)e[^_]UWVSu} uBWVEA x])؉Ã~jH@jjjRPStj,@jjRPSS=0-Ee[^_]MWV蛙EZYtE E e[^_]<j?EUj?EUE#EZY@t;};uE#EE9]}Q;}|.;uw)}t#jjjuuE8/-)HP67WVƉYXutE#/-/-+]SjjWV8/-HPWV7ƉXZtC9}~8/-H9&u|9uwjjuuS)#=/-uY/-WV?jjWV8/-HPe[^_]UWVu uƉXYBut1WVZYu$=0-t WV1YX5/-WV W} 5|}w-Øu$5/-薖VRPujh :EU EUEPh٫ :XZe^_]U EP)?i>uuuUWV識tjh ]:^_g!.>ƉRPYY 8/-uuIQjj +IQRP8/-HP*=9u9t e^_]Te^_]UWVSu} ]WV螖YZur t3@uyƉ׃=0-t WVXZ]u} e[^_]5膕UWVSQEE] ]Bu@ujh (:蟗XZ?Ɖ׃uuE E- e[^_]09SuWV59|9w 5/-RP e[^_]UP肌Zƒt\/-t0/-tp/-tL/-UPIZƒth/-tD/-tH/-td/-UWVS -UEjP Eju Ã}tTUtT-}ƉEߋ5-5-3 EP* E--E죀-ZY1t Su Xe[^_]UWVSÉϡ ,u tQXZօtw,Pm_uS#[ۃ-~K1|S臡YuSW_ZV-DPZYu--D7V躊_t,-u SV-DP蝋ZYt݉؍e[^_]UhG -Yt8u -hX -Zt8u -i jh{-jh{--U1}]U---------=/-t -]UWVS=/-uu uY[11҃=/-td5- -1 P) T)=-;M |';]w"!At] 9L)| ]9H)v@N --=/-uo]SRP31ҍr sSVhV"--P?F-1ҋ -B9-5-5--E؋5--1ɋ-)‹=-׍9E~ @t --e[^_]UU1wR5- ZYUVS]1w#SZuS5- ZYƉe[^]UWVS$-U -)ы-+U9~ʉU9~E}EE-E؋]9]O9B-E8=0-P Yt-+--P@VP蛗à u- 00-~=--+-,) |-~9|5())ș);-}Ju4-)1ɉڸ f|7lj>;=l/-~0N%u uH$ڸ _Zt΃= ,twLP蹐Yt<0-tu$uu u1UM = ,=0-tzVZtoVÃ1ѡ-t1ɋ@) tơ@)MX;5l/- t;u u1ɺ 1^_Cu uډZY1ۅ1ۉ؍e[^_]UWVSEEu }-t*5-5-1ZYt -} uW=00-uN=-- 5-=---\P--뻃= ,Mt -up-E-xWV1҉B^_%=u(%=tQA-5-=-Y7%uv-C-M-9~1h-bZ5-=-th-WV-à Iã--2M졈--#Í@--ۋM -; /-}0l/-;-}--/-)-= ,-Ѝe[^_]Ã=-~U塈---]1UWVS-t}t< t5-5-1~[^-/-9})5--=0-u?jm5-ZYt,-1ɺ )NJt @t-l/-9--|!=x/-t}t =t/-u =0-u @-*=t/-t!} t DP-D-e[^_]UU--@]UEU =-t+=/-tu ~'H  -  -]U--]UWVSQSMQyq uu RPhZYu荁ƒt1ۃt t \0-t/8-H9UUt -7C뮋 -tteY[^_]UWVSQMQyq |w RP訁ZYu㡀-X-Diƒ t)\0-u teVE졀-EUt HA-EEMD-\9Ew HK-+]K-11҅t -ىt -eY[^_]= -t& -tUSJZ P+JZ HX[]U=/-u /-/-jh #XZá-xH@d-US--XE9}jh D$-XZ]U- @=-u-----$- - - -0-4-(-,-8-<-]UWVSEEE E}M - -t$9K }E9Cu E9C9{rs-t ---pxH MH}xC81*-uX -Xp1ɋ8} -t"x}x9|9]w ‹]Eфt--HJ@XZ[^_]UWVSQMQEU=/-!E#E@} } - -tE;C ~|E;CwE;C uE;Cu s{- -St>s{ u}u}+rz u؉}܋u}+u}9}| 9ur rU}[^uX-UrzBR t?EUEU9U~*jjRP\0-t1u|9EwRPEUWVEU9U| 9Euu }ZYu-s{CS 9U}BjjRP\0-hu _EU-EU9ErRPWV1eY[^_]UWVSQMQEU}^ }R - -tE9C}E9CrCSEUE9EuE9Eu CS S -t*u}+rzu؉}܋u}+u}9}h|9usar rU{[^Ut rzBR ;}}&jjRP\0-uΉ!Atǃ^;urWs se{ZYus{CS ;}~.jjRP`\0-y!An|;uwRPEUWVXEU11ҍeY[^_]UWVSQMS6!ƉtEUXu$ux98/-~ CS !Ɖ܋u}WVY[;}u ;uueY[^_]USZKJy ;J|< t Y RP9ZY]UWVS]E E;-uC"qh;#OSIhtY ? EjU]nj;ej;jEj8jh$ ,y u]XhE!E_u;ht|E8t;u PAbZSE^t˃1}҉}Ѝ|jWauPuha#WV2 uvw YuuSaZVIVWw jcuuSj:j0d}t&uh j 0 m/-uXEe[^_]9UWVS}EEEEuu hxZYt jhǬ h W0YXujh oXZoh;#KWEhtY ;kl+jIcj9jj I}uV}uPwǃu8Vjj jS9jbl/-j8]@uGE UM9M}E U)M9M v tvǃt@uuk؍e[^_]UWVS] uEUX}u }t_jYƉXu u11j?Y}.uRP(;}|;ur RPuuBu @ujjuuWVS e[^_]ÍPw `-ÍPw -Ujh XZ1Ã'U$t,.t^^uuD-H-L--wt jh _uD-H-8/-HL-,@-hD-,@-Y@--/t$xuxujh XZ1!-U1ǀd-ǀh-=Pu]UE ]UWVS EtÍuV{,Xe[^_]UWV zu.uVX}u}t!-,!-e^_]UWVSEutl,=!-u8=!-u/=!-u&!-!-!- /- !-pxX 9u SWVW PƺZte[^_]UQM…t$,9tjh nXZAQUU19`-uǀd-ǀh-=Pu]USE] = /-t jh2 ~tVt uw,o/yt jhT V=@)x jhh DS][PD,Pȸl *=@)y jh ,EEPh XZ]U,]DU)x8/-@B/-]UWSEt~tE 8.MU u4@E Qh$Rd) }t jh Qh$R0 }t jh s/-)i)y/-EEPhǭ FPh ]S1҉I ~A| 0uD ]EPh ZXZe[_]U)xl/-@B,0-]UWSEt~tE 8.MU u4@E Qh7!RD ) }t jh Qh7!R }t jh- s,0-)i)y,0-EEPhC FPh ]S1҉I ~A| 0uD ]EPh_ :XZe[_]US] }u!jSnYZt]EPh XZ]USUE t t !-{= /-tE E ]PBXP]:^<ZYt ]]ϻ:utEUSM5/-EURP]UEU t$t u3l)+RWPl)l)EEPh XZUE }u'!-P~X="-u E gUVSE] tWEEPh  [^us.EEPh< Չƒtuu U:ttj}Y1StuPXZ}@t(Ctd$t!C v/-g_CtC~u9CEEPs!C8yjh Y_jCtXZu CuQt#9S t1Ifua1]S Kt1Ju1~Bt@tmEPjEP }SHu S CtC8C{ jh  hF\jhW e[^_]UWVS] uE0&LE0Y< v1t ztsE]URhc `XZEX]1+MU׃0 wk MDCܿ ~ ItAtk }te[^_]U/-="-tu]USh± ҢYt8t "-@);t CtS C t jjSXZ$ۋ]UM@)t9t@t 9t$1]UWVSEEEEEE1@);sEu6uJƒ ~bE ȃ߃A<vP-tK;Uu}t,;U~5>1I19EUuEEECt}t Evv_$K}t1}t.E#EEu} t1}tE] e[^_]Uh@"-#Zt=<0-EEEEjEPj |<0-uu u =/-u&u "-  "-= "-~jI<0-yO8IA8#;Ujh@"-tUEP藹EUWVS0d Ã1ы}Ήщ)jPYISuhyd VPe[^_]ÍL$qUQ$AQ )]E 8E܉Um4}fE fEm}mE$Y]aÍL$qUWVSQ 1yA iI'dt:uԉ}mԉMM5 4}fE fEm}mE܋U11҃ Y[^_]aUS,)"-t5=,ЃSh"-P 9t /-,)"-]U=D0-tD0-V=,)&-r,)P,)MH0-E]UVSP\0-t /-HL0-EPSXZt'uVEL0-XuVVVYC Ue[^]US]t CP1X]UWVS E E؋}]1ދ]1)EMYMjj WVc0MԈAjj WVƉ׉ Mtă}yC-YSueaXZe[^_]U]kUWVSu1)E] K0StyA-KQu aXZe[^_]UWVS 1%t@ER~ZPU؊@P0-X@ ="-t P>T0-h >X0-h` =8)h =4)hܝ =0)UWVS$u&-&-8 >D<:#~<%$<.!.-E}uur.-1ۃ=4/-u!NSƉ׍KXuuˡ8/-H9#QMWV֪S@M@E.-e[^_]UWVSP)ET)E@u }H)EL)EH)L)P)T)=4/-u e[^_]?=/-t1E1ۡ8/-H9~bSƉ׍CEXutBuY9}|49uv-9U| 9Er!@uWVҩS? E]딃}t e[^_]?e[^_]U.-ujh #ZY1=.-.-jXUVS]t 0PH X.-.-.-.-e[^]UhP)XUh<)XUVS]u N<)ut;ru;Zt1[^]UWVS4Ɖ׋EEȋE EEERVMẺUXZ]\0-;}|;ur E#E@uu}to~MEUEt*RPWVE܉Uuԉ}؋E Et2EU(RPWVE܉UEԉU؋E EtEU}u}u} E 0x =/-t%E)1)=~uuuu_uuY^t u܋}.-00-ut $u t t=0-uRUuPj0WNjUREPWuV(EEti.-t[5.-jEPEPuV5.-5.- t/jj/UԋM؉PHU܋MP H¸<)/XZ.-ujEPEPuV5.-5.-\ tw}tuuWuEԋUUKP=/-u uuWuEԋUQVD WD Y[1ۃ}t(]EԋU؉S1VD WD XZ8؍e[^_]UWVSEEu UMEt=/-u>=P)T)]Cut'95L)| ]9H)v!Ct[9M|V9rP=P)t<;w |];_ sut;O |;Ww?Ӆt=/-u1}t =.-tZY[^_]Ã=.-u /-.-U.-tPzC Z.-h.-XUS]t;u'.-tP>C Z.-h.-EXM ڸ.-/-]U&Ju .-]\1]UWVS,u}.-.-EԉUء.-EС.-E̸.-t$EE}x?EU E܉U1~J;]tjjuuE܉UC .-.-ut49| 9v!@u#.-.-EUE;E E|E;Es;CNu k-׋EU EԉU؉EUu d9}$|9usk-Eș;] |`;MvY ;] OΉk -ș;U |;MwM] )ӉM]Mԉ]EEEEutE tPE Z+u}f=)t WVhB WVhɾ  jh8:-5$8-h9-jjD!e[^_]hY X UWVSEhVh  'jht#58-褏jjjj h`8-jj (jh8:-59-诐nà yh ^X11ft#j{ƉXPjY~G9uAj5,9- j%jj艨jj耨V Vhm Bjf=)tj{)RPh tjh8:-5$8-贎h9-jjjj jj XZe[^_]UWVSE[hVh D 4jht#58-?jj豧jj訧h`8-jj_(jh8:-59-Jlà yh X11st#jzƉXPY~T9uNj5,9-j5,9-jjjjj$VVhm j;f=)tjz)RPh jh8:-5$8-Bh9-jjtjj覦 jj蚦XZe[^_]US,]S5,9-?huҊ9-u M e9-Sj5,9-h9-jj]US,]S5,9-ѯhudu MeSj5,9- ]UShSh  S)[t)jh!58- )t))t())t)f=)tgE)t$E)f=L)thh wY)t))H8-)t)jZ)t$)f=)thh X]Ujh{t 5,9-j褣jhzt 5,9-US]1umjP萌XZ]US]CStu RuZYt1]UVSEh P[^tPYyhj#vZPh hP*ƅun )uc"职$uX詏X]$Q$Ph SSYj蝤u*hZ (vXXX1$h0-蜊à ̋XPsY9u tthpD*h XZ댅yhk#uxuPh uPh¿ hpD* Cƃ0-0-8 u =0-vH@0-e[^]USErjPh9-h ` uxh9-hhP׉L8-yh9-h ZY?hSh   t h9-X5)5L8-S ]UVSjPh9-h  h 5-h9-P[^v h 豇YpHu 5-$5-5$5-hhPƃy5$5-h XZ+5 5-h+ hSGh7 VSe[^]UE jPh8-h  uXh8-jhZ P uh8-h9 2XZ)j5 )P f=,)u,9-E8UVSjPh9-hK ~ h 5-h9-P[^v hR oYz 5-Hu$5-RhZ Pgƃ uSh9 XZ@$5-f=,)tPhj Phr hSSh V> e[^]UWVS }l(9-,8-8-%E~1Ejh)h u u=X5-uhpD*h je"KF 059EaRcXPn"hlCf1;pskt9-9-9-51Ivh Z:55jh V蜺 fjh V脺 Xh,= VY^ƅh j5h#SYZ,h%P!SЁYZ h,= S軁[ZÅ4h 뫡5(9-59-E=,8-t h s5j/RUoZYUt ,8-RhK#h,8-+ 558-YH8-t[h tCkU DЉE8-j=T5-]PF>4,0=*E)t8HuR}t h: E hm #RUsYZUt9-"9-9-9-nhp\jϛhp\jÛhp\j跛hp\j諛 58-h_ j hH5-hH5-5u hd @u hs jhD*aXZtKth# h%P!h,= j [tNu+L)))=T5-u L) L))=,))=H8-t )=9-t58-\ Yu.Zt h j=9-u"58-. Zt58-h} je[^_]U`5-jh5-NjU8h`Uj@EXZu<EZE̅t`5-=9-u%uj YX=`5-}h5-Zu(j c=9-$uŁZY,9-j;Y,9-yuh9e"lXZ`5-O=`5-BjPZZY,9-tRhY,9-EPRXZ=9-uM@EPj5,9- jh t 5,9-v jjYX}UWVS]55- uh ԤYu h jh 跤Zt8/t P _)) Sh)EPg ƒ 1=,8-t9,8-(9-9-9-9-=8-u-8-%!;/u+E,8-jSY^Ut9- t t u!h Sh XZ h Xj`)9u QRP^ )Euڃ=8-u h8-hQ!P @u 8-%h9-h"u @u 9-=9-y 9-j:hM u 9-,8-uShP &=9-t$=(9-u(9-=9-u Shh j9j:h"u H8-=9-u7(9-t#=9-tP5,8-{^_59-9-j:h$u6 t )j:h2%u t ,)j:hh u t )j:hP!u t )j:h u t )j:h uv t )j:h'|#uV t )j:h#u6 t L)j:h,%#u t L)j:hu t )j:h"u t )j:h u t9-j:hJg!u t )=P8-u P8-)=8-u 8-)9-t Ph Y[p9-t PhOXZ9-t Ph%_X9-t Ph7#[^h8-hb$ux @u 8-h 9-he uV @u  9-h8-hkU u4 @u 8- ,8-5-5-5-t/j,S3ZYu,8-5-,8-@5-؍e[^_]US#]Ph hpD*Sh hpD*jU=$9-th$9-htj裯 j詔U C*yhC*ZujC*PC*=8-҃ !Ujjߒl9-h<[ Wyjh`7-4Uh9-jjs  Uh@9-jj]  U E El9-h\jqEYXjjcEXZuh9e""YXh`7-uZtlE quj&YXujXZ=l9-uVE ;EHhC*ZtU < tU EE9sE @E C*xˡC*PC*UE Mtt @8u1]UWVSu5-6-FVtI)~@  8u\Qu ^@P u f^?봈@5-[^_]UEP^v5-^?<tP@5-5- 5-5-5-]UVSEPh XZ);t[Ct =<8-uG,)PPh msC <Ƀ*PZVQPh A 렍e[^]UVS,u]S5,9-VS腂VS茂EԀ€Uԃ=9-t̃Ef=)tMẺeewfE%f=L)tЀESj5,9-e[^]UVSuU ]=8-tSRV!v y@19t 6- @+8u h Ej#e[^]dbe[^]UVSP,)EÈ<8-)t68u-Fu#EPPh9e"SV1%tك 8]tjEP5,9- Íe[^]UVS)t8u#5-tP [uV5-)Y)h,= Sr^Zu8-8-h%P!SrZY…t]h/!SrY^tXhE#Sr^ZtPh#SrZY1҅tBSh hpD*PhpD*r1Ҿ11Ҿ 1Ɋ`)1 !6-Aue[^]Uf=)t(8-tPMXjػUjh8:-59-tjh8:-5 8-.uUWVSjW5 8- u ފ< uf=)u"0U)څ~CCjW5 8-t ǡ(8-tP覠_9u)ƅy0hb` Vw(8-ZYu ƅnƅy)jP59-s e[^_]U1f=))]UWVSjj^jjUhbjIhbj=8-fDž,9-fDž 1jjPs ~Ft=jh8:-58-s ~$8:-!S 9tC Ke[^_]Ë D*Q D*y;0D*|D*J D*UhD*P,ZYUWVSơ7-H!vJى1ѡ7-D7-NtAw te7-P7-" Gf~ u@7-!.6h9e"JXZRh.!87-F ^_tyP‰ى1эY7-N7-v Rh ARh.!7-F ZYt*P‰ى1I 7-Rh9e"購 =7-"~7-h<[ InXe[^_]UWVS ME EEEȍx}:UA\t!^Pt E@A^|x}PrЉw0p~ЉwT& n8u@A=0u,Tp^ЀvEETЈQE<8Ut1 [^_]UWVSP]hG2#SkZYuu);CPtoj=S|_ZtrEDžUB@t-R肇‰4Yj SxY_tF뤉Uh#Sxj[ZUu RYNj?Sj|_Zt+eDžt:@t(놉؀;!uC5t gSh pZYU=7-~h<[  l7-Xe[^_]UVS)t'CtPPZtC C tC C 5)h hS蚸hZ S貼ƃtJVhSi t0=88-t Sh% 诹YXj S YZtSZVlX%5)e[^]UWVS}u øt=CtV踅‰j[#h#WhZYu VHXD1e[^_]USSKjh 5,9-jj=EPhf@5,9-lEu)jhxt 5,9-Pjhyt 5,9->뙃'~(Ph7-5,9-~kEj0h7-zu5jOh7- zZYtjKh7-yZYth$ IX1]UWVSEEh0mjEEXZ8-h7-at_tuj[^1t5)$EP5,9-j juYUU11}H9vE:uuCߋE{jj訂XZEe[^_]UhG d8-jh7-sUQjhxt 5,9-Ǟj}jhyt 5,9-讞j5,9-s$jGj5,9-sjhd 5,9-hj <3t<0thm 轶h 賶XZjEPhf@5,9-%jh 5,9-3hjɀ j5,9-,sjhxt 5,9-5,9-jUWVS,]pf=)t h _hD*誀uV5,9-M@Vj5,9-j5,9-r jh 5,9-|g<[ <[ jh 5,9-Vgڊt <=u,BHPS5,9-(gjh<[ 5,9-g<[ # ؀1uj5,9-q[^=8-tjchD YC<w3$ h%s#hhi h  h h ߴZSSh д hD ôX1e[^_]Ujh<[ 5,9-Kf EUVShT  X)$1tlRPh :#hpD*˶CttHu)hpD*hg hpD*ho  hpD*hu UYXP t FhpD*j 輯XZe[^]UWVSf~D*fuURhht@PT EPu EftEh} E Y )$EtE0t91эD ;E~ P VRh :#hpD*輵à EhpD*j XZe[^_]UGPPPh hpD*|tD;-t@th@;-XjWUWVSSt ÿ "h hh hh u 7u!USP,bZYUu5D;-e[^_]RSh jUEuh| h\ hh 芕@0h 1UEuh| hL hh T@0h Q1UEuh| h@ hh @0h 1UMuhA h jThN 11f3QBuUVSEu ]uh| h j`uhA h jahN 螔t0ffPhr AfPh -fe[^]UWVSSljUQ ^tcu uSuWhÃt,Wdu uSVW%i9uSuV u V ZV 聤X؍e[^_]À8uUJRPRP 1UWVSÉ,0hv Dž0hU1׋,03s @Esus 4Es 8E01R(4 R_ZYtdG (uhI h4#h8e"hpD*4 h@l#hpD*C uhpD*j #_XR EsV<8t94VfX<1IQRVzXVEPYMU1esj@DEP susuh 诮uh 袮uh 蕮uh 舮uh {U$19 t@ uRhp  4 h| KXZ}tEPh 5[^h+0ut#0uh SY,01e[^_]UWVS11WVhPqfuq h K=tq h [^-=߶xt$ uh X1ȉÅutXWVhPqeuq h (KZY=thPq h ؍e[^_]UEuh| h hxuh> h hh ɏx uhQ h hUWVS@]uh| h h8suh> h h9h g{ uhQ h h:߃uhl h h;ŋuh h h<몋|= v PRh !ǁ t,| %=wPRh  Džjjh PVc= tS h fUt#ts h3 .^_1jjPXc;u;t/uRh HY[$PRh  @u hh u h o󥍵ѶxԶx9t PRh Q4Ph@ ֥DYZ9~j:ZGh}B!败Xe[^_]UVSfxjRhSgShiV @u hp j1e[^]UWVSƉӍd$1jVR`Zgtjjj9`u hi$j讽Rh:iP臌 1@uCPh} CXZVYe[^_]UWSÍ1Dž:h 苤h {h kh [ h Hh: 8hX (hx  h j[TYGt Wh"XZuh}B!fvCfH fw l PPPRh: áj ۠X@)fP~F1fDžfvh9e"T[_FH$X fuffth+ h2 YrC=,I*؉)9~\@DWuhW 覠X1C9};Ph@ 茠GXZh}B!}_69uj 芟[Shi QZYэe[^_]UWVSƉ`d$1jVS@b`tjjj3uhi$Sh9iPr @u h\ jyVSXe[^_]UWVSÉι1ffDžf:[^_]UWVSÉι1Iv hi j跷ffDžIfI󤍕e[^_]UWVSDu hy jKjjj2H @uhi$0jDS`ShiH@u h j!uɋDH<1DžDž?ڋD1DžL$jDV`\h hD*mh Vh:iHL @u+Kt(j.ϜhD*:hjgv f8t.e[^_]U*PPh hpD*XjXU`Q.]W|$wUWV`Q.UMm 8h}fuf fum]muVp pQRp0h hpD*ܗ$e^_]g_UWVS]E }܍p(}p4EPSRY^tSh X3XZe[^_]UWVSP]} CM% CSCt5RPWKƃ tF謈18t/h)h+ 2^XRPh)Jƃ tŁct sWK sh)JZYth)h5 2^X}tg=tQ.u^SlUUtRWQKZY@uT8-tRh)KZY@t {lth)h? #2^XuSh)qZYte[^_]UWVS=xQ.t.h)h)EpIà vh)!jjEpF\ @Euph9e"1[^8xP=hQ.t=Q.u=Q.t 1ۃ=Q.Ã}  =|Q.h)hK hpD*[C*HC* yhC*rYC*PC*0 t+@t( C*y hC*rZC*PC*Ѓ߃Yt\F_jۍxt6Ph)Y^@u8h)hw"0\qF E *Ph)J^Z@uȋE%=t1jh] GPhh)Eƃ uT lQ.u"h)h9e"0\E h)/GPhh)DƃtOGXW\`du+`dE@hDžl)`dpt` d°d| `v1(`Tjj\jjPjXjwXP$ `Dž`DždځvRPT)XPV B P9th)h9e"z.Y[9)ӉЙ`d=`Q.t`dh,wTX-YZEph9e" .XZDž`Dždu61Й`d=`Q.t`dhhh`Q-\TBƒ ~&RXh`Q-V@ X9th)tEph9e"\-YX=Q.t#V\ФYZth)hZ 0-XZ\CXu V CYQ.tVW[Z1ۅÃ=Q.uh} tbG tYpQ.9GuOxPV^cZYth)h9e",Y[$E9GuQ.%#GPVbEYZuVvBZth)h9e"l,[^=Q.tWh)ZYt؍e[^_]UVS]hVs@ u sh 'Ƅ} t'h)6Zth)h +[^.h)VBZYtVh ١Q.t jsP^ZYe[^]US]} th)ͿYt h)h sh)BYZth)h T+XZQ.tE ]]]US]} th)YYt h)h $s$s sh)起th)h *XZQ.tE ]]k]U7!PPh hpD*ȎjȅU!PPh? hpD*討j訅UWVS|Ӊ΃=Q.ua@=Q.uR|Y_u%=@u'|h9e")XZPt#h|Vu =vQZVS!Y_u%=@t=Q.u^VSy_ZuQ%=@u?V)^u?SPShB#hS轉=΃=Q.=Q.|8/uVPZYti|h UhSWtWt=|PhB#hW2VWt|h (_XVSpY^|=Q.oS|9_ZuS|h f Sj/|eY^|tpj/SN_Zxt@xxV_9ZY+|x)؉t=9|u fDž.Nj|ƄPRlr^_u~;xluf.׉ދt󤋅tƄxPR0ZYu<|9u(;xu 9 u ;p=Q.t=Q.hD*,SShE hpD*C*HC*yhC*hXC*PC*0 t+@t( C*y hC*Vh_C*PC*Ѓ߃YthpD*hR 9C=Q.t%=@uS胲S[^uDQ.tS|<ZY"=Q.uPSj|j=tSQ.t|Q.PSh` k1e[^_]UE TETE]6UE MQTU TE]6UWVSEEU ZPs4u{8HPq4q894|99Ew-99Er+A<9C<|!TU ETE[^[^_][6ZY[^_]UWVSUE EXPs4u{8JPq4q894|79Ew-99Er)A<9C<|TU ETE[^[^_]5ZY[^_]UWVSEEU ZPs(u{,HPq(q,94|99Ew-99Er+A09C0|!TU ETE[^[^_]w5ZY[^_]UWVSUE EXPs(u{,JPq(q,94|79Ew-99Er)A09C0|TU ETE[^[^_]5ZY[^_]UWVSEEU ZPs@u{DHPq@qD94|99Ew-99Er+AH9CH|!TU ETE[^[^_]4ZY[^_]UWVSUE EXPs@u{DJPq@qD94|79Ew-99Er)AH9CH|TU ETE[^[^_]!4ZY[^_]UWVSEU JPYXy\pPNXv\9#|(9w99rTU TE[^_]3[^_]UWVSUE HPYXy\rPNXv\9#|&9w99rTU TE[^_]w3[^_]USU EAHt>SHt3 t7 t-9t=Q.uyDut1Jt] M[]%Q.1 u ] M[][]UWVSUDžL=DR.u=LR.u1= R.LuDžPDž,Dž0Dž4Dž8Dž<DžDžHDž@DžDDžxDž|DžXDž\Dž`DždDžDž Dž$Dž(FHftf u7v  PFTPhyd jF FQ.eu fHu+=Q. ~T.u=R.uF F-F,90s0L VPJ`Zdptt9\(|p9XsptX\J B9|wr9xs x|B9HsHJXZ\hll9d(|h9`shl`dB%= uFB 9D}D  9@}@Lpt$(hl =LR.=4R.t*rph5$j ]S~hp"jrpSh_Zpt=4R.t*rph5$j ]S~Tp"jrpTY[pt1hӍCp9,},1TӍ[94}4 Ev델 Z[^_]UVS RPuVR u1CQ Zu?t 2'e[^_]UBPh hpD*hj_UdR.]UPPh hpD*hj_U EUEuK =lR.u juuhA#Ph~th h h9e"YXjv2jURPE @uh h XZEth hątPh u角u+juhA#h` h~thd Zhd ojURP @uhd 뀋Ethd h uoątPhd h7 Y RW|$wUWVS8Ӄ=tR.tS8__XxjRiZYuՃ=pR.t;j8i^_t8hl ShK hpD*f =hR.tjS{iZYvtPSd^__j8MiZYuMP|U#jujuG8 V tH$SVPRNPhv hpD*;f C*yhC*CX0C*PC*0  C*yhC*C_uC*PC* uЃy~Yu=lR.S8h.c W8tS8h!D tVSZYu9|%=@uSrSJ_tSh [^V8EZYu.|%=jj8ƃ y 8|hS4 ySh9e"wVW=`R.tDž,Dž0Eܣ`R.Pܝ \R._uj3`R.V4,0=dR.tvdR.߭, 8mٽJfJ fH٭H۝<٭J)t5)IVh 0jɟ5)h j豞 ؍e[^]UVS] 5)Su5)ƃ 9u)$S.!)(S.t~Zjjj5)<)RP5),2 )1H8u)1 H8tH8EuV뻅yTH8 uh! j芝)Y[1XH8tNH8v@H8u!gxt )$S.=)u ChK _u5)h j My)GSh 0j,.Ht u h jh j躜XZe[^]Ã=S.<=)/UWV )w h $S.t  S.(S.~Mt $S.(fEEEPhm5): xv)j$S.5S.~tjjj5):x5jWVRP~ )WV5)]:$S.=)h: j聛Y^hj jnXZ1e^_]UWVSE@} })(S.jjj5)9Ɖ׃xtEU =(S.uR. R.9| 9v؉jRP5)z9y%Eh 0j諛) )}W1 =(S.ue[^_]ÍL$qUWVQ1y)(S.u\ Qh > 3jjj5)8y Dh C)y11҃=)~ h* jRP5)o8DhO 0j蜚) ). MQRPWV U UthZ j3)XZHfEEEPhm5)7 y)uCVhp 0j) )1eY^_]aUWVS]DžpD*= )u DžD*P+@.D.Y tDžDž=.= )h WV5<.58.; RPVh hVM5<.58.h hWM0VWh hVhMuV1HPVtf=d.t]5.5.h hWMWhd.h hVL1҉I(QVj = )ubhW".1WVRP, RPVh hWLW5.h hPyL0h (.,.8.<.WVRP RPVh hQL5,.5(.h htRK05<.58.h hWKQRW5.)HP.0h hPK8ۍuR5/hyd /O)1HPRjW  se[^_]Ã=)y.$S. S.UP=/u = /t@=(S.u7=T/t h/~5/h1 5h/N5h/=R.tJhR.5) ZYu4R.%=u#R. R.u5H.G~R.Y= )w=X/t)~ jP XZ5) )Y~jURP =/u = /t1=(S.u(5h/h; xFT/5h/ )=$S.u= S.u.$S. S.=.t)=/u = /t=T/th/T/=.tg5/ha *YZuQ8.<. tjhRP jh5,.5(. RPhf 5h/Lju5h/.XZUWVS Sh$/j y=hs 0j UjSj y=h 0j蹓 =S.=)8.=/u5/h XZ5H.h)VY_?h)V_Z*(S.)uPVh 蜑h PVh& 艑hG  )whq htY ^Y5/h Mh Ch 9h /h VHhww#V_ZtHu? ZYVh!j_ ; ptpt0$VtZYDžpu=/tVh!Rj_p<$8$V( pxDžp /t<$8$V] /ut($lYX!1$H%- !($uʃ$5/ha YZjVYZxPVi{YZy+lh!0j^WV@1$H%# PVXZ=/u ($j=/u=)u =)tj $P3VzA=)u =)t51$PjL$H$X$T$l1e[^_]U]UWVSu }KE8uEEUE;E~])])؋UE8tR9s?u;Gu6}jؙRSuu h,!E}t}uz //E/ //E/ɍCtPQS XZ PN Xuh<!j[XZKCPVȉMPEM /SVu 9tlu hJ!0jv\<+E e[^_]UVSu] }tKjjjVy Shb!jh.V yShJ!0j[e[^]UVS]u x@P X=4/t*jjL$H$X$T$ye[^]UWVS(]} yǃ$3$(v(DžlDžpDžtWVu , ~$pt1 lB9uŋt9|$up9x$t hy!OxPu ZYySh YT$9X$u;th!jY 2jjju /y"MSh!0jYZl$1e[^_]US.tP=..[.un1 C*yhC*Yu>C*PC*9P)ut(S . t믻 up.A.u. @.tӋ.zyPZN봣.j5.h.. %1]U=|/t . .=/t .=x/t .@=.u'h J .Yuh!jWXZx4/t9UWVS]t;uh!j VJ Yuh!jkWXZR1։~ ـ9/uE ؉BB=.u..P.1e[^_]á.t@=X/t .=/u4=D/t+UE$u.tjP5. US=4/t8.1t6{u+uh:!juVXZ3h\!hpD* [Ƌ]UWVS]=.u =.u&.yx5..ZtHHQf $d =4/tȋ@PURURpp p0i9xjjuuuu졔.piphg!jUph!h!p jgV Rph!p zǃ$ǃ$ǃ$ǃ$ǃ ƃ pP $P($%=`w,= =@tb="ǃ$===ǃ$x$|$$$ǃ$=4/L$H$X$T$0$,$$$ $R6$yǃ$mǃ$aǃ$h PRƽ y$.pVh!0jTƄ  ǃ$h .pCPh .rP5/ha à u.@1ۉ؍e[^_]UVS<ÉUĉMȍuVEPhEċUEUjk 9U|9EsVh!Vh!j@S:Nue[^]UWVS\]uCE=/uPh\!V V; }W($ T$X$E7j8$eEj<$ngUu8 u8 PjRj4$Wh!V $ w'@$  R%Ph!|$x$h!VH uEPh"V3 $Pw Sh%!u ShV  Vj HZYVXe[^_]UWVST]uT$X$}W($ SVWh-!Pe[^_]UWVS]u fVfuPvYt%t'SRjP}WPVWCVSXZe[^_]UWVSQU] Ӊ];Uss< uB1}uPBJyЉ w D$yw Dyw*DB;urBD9Uv qЉv1Z[^_]UVSMU utus1ҋML}uB9rSÃI w0WY uIÃ0Y t9s9rIA011҉1 [^]UWVSQ M1Yy9ZyUEE@TF?șMU9?} M]FF ȉE]ϊ< u F9utEEFEEu^KЀ wEU˃0HKwEU ˃A%KEU ˃aډEUF9}rXYЀwMEUF0ډEU9r'EEEEEU Y[^_]UVSEU uML}uB9rSÃI w0WY uIÃ0Y t9s9rIA011҉1 [^]US/u!/h6!jWMXZ 1ۉ؋]UWVSSu] E}MM5=.u)S.:-u. 0=*1Ҁ=.u" .Q.u ..=.t7tMM}E] ue[^_] E] ue[^_]E UWPZYtU:u W3hq!(x:u90=*9}5@0=*W3h!hpD*?e[^_]U1]UE E EE]鉲UWVSRjEPSGƉ׃ r M9h!jJ^_i8BP@tC=.ui..tf߀?t_j,WGY[Åtj=W4YZuh!j|JVE &Ej <= ZUuh!ҋ.B1e[^_]UhpD*h!dj )t 9tU )UhpD*h|!.hpD*h)!hpD*h!hpD*h! j:UWVSQÍEPS%^_uC .16ƋE| t@E]ST< Zu . KDe[^_]UWVSPuh S趮ZYh S7_ZÊUhVwYXt Ut/Vh !0jI1e[^_]UWVSlu j/61SZY/t@/h !5/诉[_m/ !./E1E1Ejh)h !Vu ezo$ 570.55h !x 0.뢸)댡58-uxuH.EfH.U|/ML. !><//x/ )= )u !Q/.=.u //)cX/55(Y}1/e`/V)=L.'S#..5`./ EP9~7UǃPu= EYZUuh!j5FjED 5 `.HUL.B"./ /r55DL.3 !SH.T)DH.H)5H.<)&H.0)H.$)H.))5L./)/55CZ1D/.z0=*4 )uXu}t h/pD* h/D*Hw6}u 9Uuj kL`).`.t Hu/E`h8 !j8Dh !P贪[_h !S蝪_ZF`..}tE8XEMthmA!WVZYEC*t&hZ WEZYuWh !jCMEEEE}tESq> [h !uѩZYu.uJ> XEjh !u uB.t EtS> YEPhu= XZEEFjSu E$EE]}t EtS= YhmA!W[Zt uGY=.oW1j5`.SR eEA~t`.E}`.E@EMh !SiZY=F=jP[_}uh !P$Y[u^hmA!SZYEC*ug1҉UEDžUukxhmA!SϧZYt u_=.tSh !ytjPh_Zy/hZ SEY_uSCtj.h !WdYZt2jh !W ujjW_Z9,jS)} H.t 8h H.Yt 8H./t11jh)h !Vu0 z$ P)Ã뾃50.55h !@/D/w5H.e`/ SL. !D</@2L/ˀ X/5 5Pwn$x )c//)))/)#// Ph !nAnTL55 Z704/ \/@ /π5Eh! jLjh`)EP.t 55h !j=hpD*h !5`)h 9#hpD* 5)h 9#hpD*hpD*hh"nL.'S#H/35W .$.|w 55h !thh !j=H/ 5RUh,= eZYUu)R)YhF !j555Za@W/B|/-Phi !jA<j8. |/55Y55Z / x/@8/x /f)W/H5L.9L.B"*/ xD*hpD*j j^_%u )h/D*%n;=u )% GVځu )% 02u  )=v )%.1 t\5/h !hpD* 1 AI! Ph|"špD*PpD*  )ru.)$ jj4 0=*0=*9Ei0=*9Eh !j9MEp/PG[y!j j4ZY\0=*0=*;E|)e[^_]U.t P.]Ã=.t[U.0h !j&9 tp0h9 !hpD*x5/h !臟ZYu1UWVS ֍X*tP t?t.[tot=D/ttjgZtF} tuHM!uX1C<]tIqEy-u)AE<]ttE9E|E9EY뼋M9Mu1}!9B8 te[^_]UWVSSU2]ǀ8/uxK)‰Ё ~WQh !jX7/U9r NHVP}t99r NHVP1e[^_]UWVS 5/h !6Y[Vh !n6h)!d6hK!Z6h Ss6h` SD_ZuhT!1H= v hv!6Y놊uh!5ZX<.uuh!5X1tL@/tL@LtFCC9r<9u(>t#LRDh!jg3tZL@tNu LDh4!hpD* RLDhJ!hpD*|L<th RD%, 1e[^_]UWVS}tExu hT!%<\u FFu%8uj[% Yu*hm!jp2^_uh!jZ2 CjWP3ǃ t4hVPZuVh!j 2 S&- [FNEΊt<\uFU8t.Fa7S, uh!j1Q-|Zu"&7S, hm!j1ƍNCtVu GMGt?jh !W豫 Åutjh%!W蛫 u*=/u!=$.u$.h-!jv XZjjP裻Ǻ, 9tPWh}!jA ؍e[^_]UWVSS]u hV)_Zy- 1{ǃ4$EYt"h YPWz/@E K<vI +UVh//E Rh//  jjFdP藺%($jj F|P袻x$|$BuAjj PTT$X$H$L$`$d$ƆH<$P)P#yjjFtP<$ Ɔ(8$P P!ZYyjjFlP˹8$ ǃ$ǃ$ǃ$ǃ$ǃ@$ǃD$5tk12($L+K06ǃ$($g~!xuǃ$($@ǃ4$H1|/D4uǃ$` ǃ$ ($jjIP蟸jjQV荸  @$ǃD$uǃ$̠($ǃ$̀($ǃ4$5/tNKt ǃ$ ǃ$ x$|$%$ǃ$$${!Kuz#Ph!jk \!Ph!jT ǃ$x$|$%$ǃ$$$($1e[^_]US]$tt"XwP=/uPhf!, c~/=/t / Sh!j ؋]]UWVS$Í@- 1U-u~t2hZ V_Xu$0 PVh.!jYC*1EPSGhZYt/G}vEVWhA!jEUt1C*t SqXe[^_]á0.t UU RuP'50.UVS]u F1,.tRPS΃ tD3j SxZY1҅tЍe[^]US]}t P/= /u =/t!=T/thpD*j 茲T/XZ5/h hpD*Su hpD*XhpD*j Q ]USjh$ i Y[xEh PO0.YZt&hZ S9,.YZt1350.ZS[j X=`/th$ hb!j ]UVS] u}t P/= /u =/t!=T/thD*j 臱T/YX5/h hpD*VuhpD*S~Sw Phj7"hpD*hpD*j ,XZe[^]U!JPh~!hpD*賷j賮U/]UIPh!hpD*艷j艮UE @E E@E]dUVSutYSC t } uC/@/R s S /H/ u/tJe[^]UVSu/@//؃8t VPjZY/u /u/t e[^]e[^]UVS/1؋tJ9tFjPZY/uԉe[^]UWVS/@/ǍPY11ҋ/tH9tCB'u9t h.! /u/t7ho jSVd9tVph.!p ,)HQP yP ,)H Z J VبXe[^_]UMtA'1/]UWVSu^Nj7t#vuBbY[Åu jWXZ ׻؍e[^_]UShb` MZtaujY1"1p /tP{ Ãp /X؋]UWVSPuU UVRV"ǡ/@/$辦VCC URߦC/H/u/t e[^_]ve[^_]UVSuV[t#sV&aZYu} tC t1ى؍e[^]Uju ZY1҅tPUWVSSu 1}uFRj=CPrZYjSjZYu$Sh.!5()x ubESh.!nEpn ,)HQP yP,)H Y뮋J @PSZXZ듉e[^_]UWVS5/,I*>Dxt]jEPV迟//E &!t%MAEI&!uV)PRh.!R/&!tQ//C&!u)BUP/NjU󤡜//XJ+|!3 1  (%w&/)*=^3/,,u-C]:Z<I^<>tL%?|$~:#./F,WWh./!يF<=<>޸N9= يF<~-<޸(&)&)"޸ N  /e[^_]UWVSR5///PÉ5/Y=)t ~/!uMt;ua$jEPSaƉՠ 8uE8t+8t/!m&! tBUUue[^_]UWVS}։ϋ [M]Pw$!/! ] ]u /!lU#UBu u/! uuuWVV uuWVYX &ENj]Ée EU+EUM? t1M? t1;}L;uA1;}/;uv(1;}q|;uwj1;}\|;usU1U1E1 1;U1E1 ]!؋]!]1؋]1 ] ؋] ڍe[^_]UWVS }Ӌ7V!_=/%us Љ U/t[5/>t'\ /H\ /FxFCXVԀ~/u#\ /Kh` VoP_Zu$)9r +ƅuh\ /K;/u>thww#V5PZYt \ /x/4腘X/ xXV>t\ /H\ /FxފFC9)u \ /x/C 8X/=\ /u$\ //@//tP! X//5)/j5/hV0!j5/hY0!/J/u/t[؍e[^_]UWVSSuE E}/@/V3Zy"/H/us/tjcj&Ë/J/Yu/t}t)=v)u =)tt5/Vh\!}XZ؃!؉؍e[^_]UWVS=N)ƅjh]0!苪kYt @tBEP譈/Zt,jjSPjh)=@t/PATH@=5/ /)X/]á/US ]t6;u1Ct*p]Zt/PjEPCpg&]UWVS }W1t@/B/PWnE_XZsnEX;t.Ey"xVG X迆0 PhR2!1Psu襂 uK /u/tU~ jV+YX}xuF ju js^XZxVF YuuF Z0uux/X / /u/te[^_]UWVSu)1ۅt"H} EPއXE EQ&/WvYX=)=/vEPćZ>t=/t$!jvFXZ=)=/=/jvYX=)f=/Y=/dGu V}u V]܃qu VqfjvXZ=)=/=/v /WVWVWVFY^vvv)/jv(XZ1=//jjv ^X1=/q/bV]܃Y.ju V- ]܃Rhg2!HhX)d 1EPBX/t=^)t/t tPE tje[^_]UWVSE ǃE܍uVF5/jux\1j,Y= )tKt>=)u5tURVUt E܃PuRXZ=/u VXv\VfXu /tj e[^_]UWVSSE] {))\ /\ /HK?t(\ /wx&APىˉʋ3\ /tx BMP M҅xJ H+ )QY/PWzXZ //e[^_]UVSu/1jvYX=)=/tV/u/H/z/Hu/H/\//wE/=/> ut-t)E Pv /XZ=/rK //e[^]UWVS 5/=)u1}WʂE؉E܋MYZt'hPES-L =/n[EՋE/]؅@=)5/@/P譝Pmh cEp X()pVPyP()H =X J=sF()pVP^yP()H Y J 5()fZjsEp E PEp5/=)uN/t>u/H/1/Hu"/H// /5/WXe[^_]UWVS]uVE؉E܋S /jPsqJ[tt=/uk{t_G/EpW-PZYt@1=/uA=)u81; u{C/u s |/ZYu 띋[1/VXe[^_]UWVS]} 31EsX=){5/@/P`P hw2!Stj RU5()UR h2!Xu h2!X()HyP()H Y J 5(),Z/@/ujS$euSPEEytUtNuduu /u/tjsWs Uu / R`o/X /u/t~tJ=)tA{t;5/@/PPh2!()Ee[^_]#e[^_]US@/EEEEpX=)tlExtc5/@/PwZYEP2$w2!&[EXtj S5() [h2!Y5()~[EPCZtiE//EąuKt&:EP$2!Y5(),XԋEt/j5/C/@/Eȣ/j EpXZE /t2u EpY[/@/E/G /t/t뾡/tEąt"EP$2!X5()]Z]UWVSu] CCC =)EPd|/@/EYy h2!wjVajVPvu<//tu5: ju^)jVu: E؉{ /H/Zu/tuEPQ|Xe[^_]UWVSE 8DžL/dd/0`/,Džl/EPL{Y/E@/txEXt7u!C/htPSD 1 sZtҋ[ŋxEp /X|EEXtC/s蹒_uEDž@tj|PSC [뵅t@B@닅@Pgy^t+()HyPX()H  JvX6 뾋Ep ()tRVP t vHyP`X()H J 5()_|sjhX!Vj u dԁ}8 ll<@41Huv4)@)@<DžDE y h2!=f)sf}hExt x U/T//*Ãt t7s /tS $h2!/tݍEP;Yt./u/j/u/P,L/LE/h!|nXZDH5/RuP\8L/T/=//ujjSx3 DHSRuP0nDHRuPn 88//JG@=/t*u2 $u_X88//t뼋Eftf8t pPEp yY[}t /fx /@Ht /<| / //@//T/u^ /u/t+EPx9Z=/u EP蠁Xht /蓁Xt /u󥋅puBukXT/0d/,`/L/jP9'뷡/LE/}t$Ef}t Pd/ d/`/h |^_/@/=~ h2!8u$PNXZ //@/uY T/0d/,`/ht /_[t /u󥋅L/pu /t  /t=/u//8U1} D8u-4)<)0)8)@DDDž\/PwIX/LDžhEP 7XE/d/9u DPEp d_X@uWEE= t= uϡ/T/DžhdjPY^뛋lufE|/f}t@SP[^</<p /h /50=*8/<@RPU_Z1/\\u /,\u //\t /L/,)X)()D)htKT//\t P/8t 5/\@u } uPS\Ht \uf}u \P[XP>GY//t8<)}G=0))lj}G<)=/ PEp XZ=/t"Zd<5/uQPR=|thB s^_/DuHP^Y/(DuEuu , ZH}G //t`uEPWnXe[^_]Ë`hPhL#Y U/]U/]UM//Q]UEP//]U//]US] }~s xZ Ph 3!E/9}~‹8c@//1]UU/x/]UWVSĀ]/tj/SD8ZYxtTWS^_tSh{#E%=@u Sh!=`uESh3!WVqZYt!VlXjStPƃ u럋E%=@tЉe[^_]UVS/}~P]SkE pjPB5/5//@/jh5/[CSKl/e[^]U/}~ E pvZ/u =/t3~/J /)х~ / //1U]U1]UWVS@h8 EP4]ĉڋEoEủE_E}ԉEOEM܉ʉME/ug`9\|Y@Ph3!lZYtuYƅt5/h3!kYZuz`9\hxPVYZy.^8B^84^X"E%DžX ==/tpE1ҍЉ`+)Ps_Vs^ju#ǃt fx`tVuh3!WRVbXZ/@/dTujuY^fudfG`G~tEt$jXPuh%5() f`z/@/dTujuGXZfudfGw /u/tG GfG CfG fCGCe[^_]UWVS EEE111Uh3!tXۋUt?bw$`!Ӿ̺EEE명tjYu>1ۅu8}u%}u%EE up /8EE؋ /tWPft# fuC}ft fu1}t#ك M܀ufuuPEXZEԋ륃E}|ujSZYtV@ftI!fuF}u5p /Pp /uqft fu}tԃ=)x .t/PjEPSK}tf}tjSY[t jPXZry1e[^_]UVSu /@/juË@ZYft&fHu sXfCFC fFC FC /u e[^]e[^]U /@/fEEE~)fEu EEPuW/H/ u/tUju ZYtfxupaX1UWVS E11h3!qZt&ptvt Vu۾EˋE ctM t Ph3!t h4!E p /9u^3!ct8 QPh24!uSd_`!!uFjS蒳XZ1ۅtHwh\!诺Y_utp /Pp /u58uSPZY h\4!j wx& thj4!ѹXhz4!迹Xyp /8t,)HyP脸,)H J N}u#jSAXZxGfEGEPjEPS?1Ef ftffj/S%ZYudEEء/}tEjSEPPEYM؋Eyu!3!u8 EQh4![_EPdjShZYuuQhU"XDuq@W0I Phi ָ %uh4!:tEPX['=)tE u \ /xB)ZP뒃=\ /uZ\ /)8u(hdYuNPGw Z1ۅt X Pv EPjXX} CStŠ")! <vB< w2 \ /x/H /UgYH /U \ /x/H /U8YH /U߈te[^_]UVS]=/9/~p/t;/B/0P 5//H/Yu̡/t|9/~//////1Ҹ/t];Y~t1/*/@/2Rq /0/H/Zt /u/tt//;X}Xe[^]UVSPu]  /u/tzhtP@ ǃ y {Q8t֡/@/OHtxuF9ut҉&!tFU9Us׈‹E@ʋuăEEU9Us+MMPP YMtMPuk EXZMU U}ԁt}\uEΊE<-NV]t\uNqEċEEEEԉEEURUMQM ZYxEEEEEĉEEURMQ ZYM8Mu ENE<]t EĈE}9}]C?}tt0Pxv"/u uuFtFub /EZxvtuGX?tG;Mu5/[xP5/讹ZYyi9tt5;ts-GJxwttxEMAˡ/;EtP9Uu8/t]C ww# PdXE9/t@/Džp>tFDžptJxw@tu@o/tW4YpF/zWlxZtۀx .u o.uÍX jSt tptSuК5/ 뉋UCBKHt/VP[Xce[^_]UWVS}P v Gu+EHAt3OZxv tpu tAƉ+E[^_]UWVS]{FFu/sm/^<$t&j EPSZ> 8>E<=t- /t9t /| /DE]} E")! <w \ //yAP/ \ /xUBE/AUJMH /뒅u. \ /xMUBE/H /EuJ< w \ //yYAP/FAUJM5/P /XZe[^_]UWVS,E] ]ԍpډ]Uډ]@&!Ej=V} ZYE@EM%ËHEEȋE Et(/u^E)EQ}t*EPV}_X1u6߀>@u//#V+Y1ۅtEt 8u11/+)EuG=)<*<@} }VE)HPh4!1}E%}}}tIO~,\ /H\ /Fx/?P/VϋEHU)@Eu uPV1} @/+)+E)‰/\ /} u1< @}Š")! <w2 \ /x/H /U>H /U \ /x/H /U>H /UЈGƒ v! \ /xM/H /GuJ \ /x/H /ĈU<>H /U뫈U#>H /U1}}t>@u=t /uM @1 1E @π} M$!5/P/XZۅ؃ E Pu\Y^E؀x1 \ //yX=P/5/+5)uuuuVusu#/+))ʉ/@\ /uZAu9uuuVuA\euX<tuС/+)Puy }t^MEu EMEtp|wt硜//كuAEAtBuJuEe[^_]UWVSUE %EEE tEl)/u /E졸/+)E:~uE t u R XYE 1Er`'E#E PVYu S/p//~>:=*z~rvzuzyz@uz=u/E} t \ //y:P/1뾋E  \ //yt:P/ \ //yQ:P/ k=/t*/+);U~xuH/E vuE E # \ //y9P/}u B< w2 \ /x/H /U9H /U܍rZ \ //y{9P/ /VXy \ /x/H /U,9H /UE ?z~5=u}&Eu V+[X u/ \ //y8P/EE SuMZY/+)jPHPa ։e[^_]UWVSEu ]=)t/P /)/)\ ///P/SpXZu&/=\ /u7/\ / \ //y7P//+)P4//XtCh/W///_XÀtS5/B+5/?YWjq4x//XZ//tNFe[^_]US]  )jju5)_P5)S;]UWVS$EPEߋ5/+5)hR}EС\ /H\ /ZYx/6P/=)VVWy]Sk4/+)Pw35/WEԉUS4)/)Љ/\ /\ / c6/uuhj5/藓/Ѝxt}"tj)PV /)O/)=\ /EЍe[^_]UWVS]= )5/ )1}DPS@XZ/=\ /uW5/\ /= )5/u5)}t }tD;tVh\!hD)臒jG4!Eud /Pu +] KSh5!$jVu +/5/)\ /e[^_]UWVSu= )/ )EvE%HPu,)xWPYyP ,)H XC;]| J1e[^_]Uh5!Uh5! UUM )t 9PuH]U /1.)B t xt 1z1]U / /]UWVS}u ]/@/)z tj,)J B ZB$B /P /P /P XtK =/5 / /u/t e[^_]鉟e[^_]UWVSR)S /@/rt1FE1}ItED< t< u )Hf B/B /B  /C $9tRg{ X /u/t e[^_]e[^_]UVSP)B /tAu x2 /xzhX)xhD)n[^= /)X/hS)p yu / /DC*8t)xu.*8#ujjj xtPjj xh<5!4Yl /)@)B//BÊ@5)Vt u+ / /1BVtPCË5 /V /+/H /u=)tE5/m5()XZE/P/~e[^] /x/P/U=~u! /x/P/]]U塰) /P  /P/P)Pj8U))@@ @$@)XUVSu] /@/h VsjjV tj)@~PsZ)s{uh(CX / /) /u/t e[^]鋛e[^]UWVSĀu/@/jV Y[y VhY5!қÍxPS[_ZuE%=upjjjS u]jtWSD u"jhg5!W_E uSb Vhl5!jjjS tSA Vh5!>SHq^9uS% h5!#u Pp/H/ZYu/t}e[^_]UWS}]/@/} t=/1҉I /  /) /u/t[_][_]US)/@/CxPqXCtPDv Y{ tT)S)v )P  /P /P/@)/H/Zu/t ]|]U塰)]U塰);Et!= /tC} /t h5!轙Á=) /uU=) /u]U}u$)@~P(p)@XUE9)uE )]UWVS/)i5rO9 )t=/}15)%u9NtG9}}ttVǀ\)t?iڀu.tiހu) )XZ[^_]UVSu95d /= //)tPnYjh$ $ )[Z@u$1SVYuCuAS? )Z@t5)n)ho Pin5) ` /yh5!詄)X2 ;` /t jjU[Xjjxjjxjjx  /9t RjYZY@u#0x hc5 /5)8 Y[@"0w hPh$6!m ` /9t&RjX[Z@u"0w hPh6!5` /5) ZY@ur"0{w h5)am)jjwjjwjjw5d /e[^]UWVS]/@/11;}ji0TZY@t 9|4u!8t!0G뺅uVv PhL6!Ht+J΃utBƃ /u/t e[^_]%e[^_]US]/@/9t P^q Xǃƃ1҉ /u/t ]]UWVSXÉUMt0h/ SI LEE8EtM}~EtEtFErMB9tMtEttt t tM IuɋE0Eu%E@uYEEHEwEu9u[5/)i5rO )+9t# ti1;J-R@Phe6!jEPOh? jEP: U1эqEt+E<2E0ho6!jWE׍t>E@|5uht6!W9tXZƒu)ątPh|6!jW踀`h#jW覀Nu =tRs j WP+E@t'1эt@)PD5Ph6!k+ U<21эtSRE_XKyS{~P Y P F~SEPXZEtP}KyS4~P _ P KyS~P|^FP|:uM}tFPh!SX iEu0EKyS}P Y P EEE|SB}EZ8e[^_]UVSMt&t"119}1ivuC⋉1tJiD} u&ƒuu=tă[^]UWVS utB>%~WA*ZtW)H[6!-Ft~uE<+t<-t<%u9)6!)i/6!//E1MxdtS~JH~?u(UFPQM*ZYMUt UQW(ZYUu뗅6!VG)YtV(/ /ZIxՀt~i90tH΅x-9/~%i/Àt6!6!1ۃ} uVR芏؍e[^_]UVSh8  3X=/tYh6!r,)HP{,)H Y`Sp /Z8Pp /xjp /0Y^u h6!P+/i5rO@Ph7!| 9DiPh!{FXZՋJ ;1e[^]UWVSSE11h 7!1Yt&jtptguEҾˍ7EH~h7! p /tyt h87!jPXZ}t+/i5rOCShV7!t$Ph/ {[^1tHi019i0h z,)BHBGYYy2RyX9H ,) MI,) M9EMeE AEpe[^_]USE/t Ph6!όjPZYt ۉ؋]U/u / /Jxu 1]UWVS=/t15//NxtS_///J/B/uh/\iPsË//i߉^19~i9uFPg /Z/i/11=tDDt/ /u$/tҊt /@/fǃ=)Ѓǃǃd /} ~iE PSX /u/t1؍e[^_]UWVSu]= /u // /SSDqXZu d /}=)tpt u ڵ8WjK^X}u-W5) ZY@u0j hPh$6!SjjSjj\}uVSj(qSj qt u2'[u)j jhW$# thW$#hY5!|t$=v)tSjqjSjijSjaju/ }uke[^_]US]U M=)u1tЃuEM E[]*UWVS}t EEPu EPE @uV8/t}/@//1i//9i<}}}E9Ety;MuOH%σu9t1}@ƃރ}tuދHtσut E1mt+}t9t}t 1҉t]u tK= /t =v)Ƀ;u u EttPEu() /u(/tk}upEe[^_]UWVSjjjà jjj =)tQCtN5) &^9t7P5)a ZY@u0 g hIPh$6!B1/95/|itSu=/uASqX8E t u1&tt M ڋEF듅ٍe[^_]US1h5 D)Yt1ۃlÍ\[=v)u =)u@p /8t4jp /0<ى¡,)%p /Pp /YZxuS5,)vXZ1]UWVS,1Ehz7!(Yt)ntput h]7!l /Eȅt2jjS/v uSh~7!jS虀_Zt Sh7!豄/EЅt$}p /8E/5/p /Nx0}t :uǀ12UjVY^Utvu}tFu=UjW<^ZE؅tjU2Sz =v)W)Yu EЃ}܃bp /8}EE/ /M1EMx2t"t uE$uE̱ɄtẺE܃}JE܀tU܊uHEEPjj @uLk耉E E܅Du6jRUYZU9t}tEt8u41҅tHiM4h juVM؋E܀uPZ}u}MtWtSjVSx E}sRPXgEE؉E؃eMt뫋E؍e[^_]UVS] ơ/@/ujSj 耻t-V5)j ZY@u 0b hPh$6!Pu%+/i5rO;)t jSfY^ƃ=…uutt tj ZuS)X /u/t/e[^]UWVSQ5/th6!jPTXZu h6!mPh9e"mY_9~iPh!mGXZ١,)HyPk,)H Y J #p9~i05) _Z@t$9n 0w` hPh$6!F볡/@/SS/J/Y[u/t E~Ee[^_]Uh8 "Xp /US] h8 "X]/uV=/uP/ /9|9t(uUh7!k/XB1UWVS]fE =X /\ /E1E}sF<?<$!t h7!>Y6jshjs ^{Ih2!9hk"sh$ [h8!sh8!s{ th8!s XZh8!h\( h8!Xsh#8!sswh&#ah Os Gh۾ =jslh#8!)s-h&# @h)8!Cph۾ s t9vhL v ; uh/8!h38!_vh78!sh<8!Y[s7!17!%1+A!17!17! Y"S9tRh j}WagW'VZw*C yhmA!0Ph j]S(gS[ hG8!h!Xe[^_]UVS]u t0u hH$YSZt{t hH$X[̍e[^]UVSEp5X /=v)u=)ۀj\ /u NX=\ / D...X /e[^]UWVS}u ]= /t5}t;=)t&؅ttPSF:YX}u)t7JiЉ@@t VP XZ؍e[^_]UWVS]u }Ytu(jWVS1#0X PhM8!xPWVSe[^_]UWVS}t  / = /dPX/u / /`Dž\\9 /~jhd /`Pà u\ /dP_QP^؀;48t@x/tc@xPStZYyEEEЋ\4 /9u; /} /1u ^8!a:t@uu=\ /hl8!S ^_19)XX)5/߉S;c()pVPYyPa()H X J EЋUԋ\ / /\he[^_]UWVS}uVY1ۡ/t]=v)u3t/j5()jhD)a)1PTEZ= )u?1{=)ur7u=v)t`=n)tWh{8!+bXC+t'=)u1҃=/‰/jPzY[1VHZ(uoVXXe[^_]UVSU:/@/jR輿 Y^x jP XZ /u/ttx=)t01=)t )1ۀ=)t)11j?j\j1 =)tt)t)e[^]e[^]US]/@/jS ZYxjP@/H/ZYt ShY5!s/t@sjX]Uxu}~E p[ P]P\1UuG Zu h8!gsUu uK ZYu h8!GsUWS1}RuPS؍e[_]UVSEX9)}]ށ}/@/FP^)P)5))/H/Zu/t'r/@/5)))) /u/tqe[^]UEuj h8!jǻ ))))UE))P)P\ /P ` /P` /]US]/@/)9t)PM XC)C)C \ / /u/t ] q]UU/@/B` /R~/H/Zu/tpUWVSW )\ k/@/=)5)G9uh` /t`)CPW))H )+)\ /)` /^^t5;:u1J+rr ZRMSNjM))X /u/t e[^_]pe[^_]UE/B/))) /u/t]o]US) )x&~S5)P7[K\ /) )\ /)؋]US)+\ /y))أ\ /)[]UU)))))M ))ȣ\ /]UWVS(u} 111tIwLBˋ>}tEv h8!?oCPEuU [E1ۅt/w|C1эyRuO}̋XY͋EЍe[^_]UWVS 1Eh8!aEYt}pul /E׋5p />u h8!ntjZt Sf[^Xjh|NhE[_uE%))\ /EEjMQMj HUt߀\Mu+}u*jQj蹸 H} t}tNEI tzʈUQMu7ZYUMQh%ZYU \ /xEC HXU+)E14E=\ /u:\ /+RUuZYt/URh%ZY}=)KE9sujW6c jhd /PtV\ /}u'1Dž\ /~u.EH\ /xCeZXUSDžu=\ /j5)6Nc))\ / EOnJEe[^_]UWVSEh!Yt E/@/j,P,/H/_Zu/tAkp /8}1rErEÀuDw@@uDx@D1 uErEuDw@uDx@DuEruuD5wFuD5xFD5EPEPEPh79!fXShG9!SXY[,I*DHt(HЀvE phM9!jtG?uVm/@/W ZtӁSPR V{F /u/tiu0%K PWh`9!ajӁS*X1e[^_]UWVS$f1EUhz9! _Ut,StatHuEӺ̉E뿻`!;LC9tp /8}ԅuxthzqha uY^7EԉEEEEЋEp/~.9-kM Eؿ E؉UM܍FЙEU܉E؉UÅt hC!E:u!EEEjEPh;!5Uǃ WEPh);!y9ujQh;! Uǃ 1Mjh8 h;!Tǃ M+E@111ɉUU Ph j MQMJhMQh@;!T Lj]EjMQu T( NjUt EMj[Ѝe[^_]UME  hG;!\P u| /=y /u / /y /h /h /RppUVSU h /t9u6p /u18-uHxtp /x-uxt֍q8tuPhj;!9Zz:u܀z:u.yu p /J p /2u Ph};![5l /15h /e[^]Ë )z8U \ /x@ M@ )J8 )z8]ÃxuUSt P=7 XK]HÃ8uU@8u]UVSƋXCF~h@0ZPfB  fYfZfYfZfYfZYZfIfJe[^]Uj@ )JHR P UPUSUJtXxv-u~u C $t hQEt8jvC8XYt&Z1HRPSt <t )@e[^_]UVS )p$ t jjQ )ulX(x,u{ upVZuhuXEt EP* XEm )@E/jP蒢 á/@/EE}~uE_E5)NjME/ /t }u/tM塴)E=))\ / )x tjE^ )@ 衰ƃ`u; \ /O+)~PYujP̲ u \t = )}x0h%=!,ƃ u) )HH \t\`tW$tR\ /HUJMD t"t/\ /x\G%x\) )HH " \ /x GxHtjZ )MHt X@)EjX)E}tWt jj )XjYYx}t轱 )@);E)\ /}tMߋuME)\ //@/u' E/H/Zu/tSK )}xE/E@EE\ /Jfxu@tA\ /xS DP]+]Kx8 \ /xB"P\ /xS PЍe[^_]UWVS]U DžlDžpt ) )H0fDžzB*!t fDž~ fDž~DžhfDž|fDžx@8EfE=))\ /lDž`F|(!u ǃ=\ /|NjFP<K  $ !b+!J fxi : b+!u fxQ \ /Gd) )xtjj"Xdf@fna^')>=1 "U\XЃ\n'cetSfm u rt[tJ ]vtMx2Džd6) )    OPЃw\>PЃw \ҧ@;w`u hf=!g\u'd\du h}=!ϻ?uwDžd Džd11ۉ\襪PЃ \w \)Pw \Pw \ A;dud(=w h=!%=\ / ǁw? \ /?ˀC< vG \ /GG \ /xBwj \ / ?ȀP vW \ /WG \ /?ˀCJ< w \ /JB \ /y \ /W ?ȀH w \ /WG \ /J?Ȁdx< w \ /JB \ /d?ˀCQ< FNw> \ /O?ȀP w \ /OG \ /Q|( \ /W?ȀH w \ /WG \ /J?Ȁdx< w \ /JB \ /Qd ?Ȁdx< w \ /QA \ /Jd?Ȁdx< w \ /JB \ /Qd?ˀC< w \ /QA \ /zh=!\ ?ۃ u \ /tM t)+' \u=uhC=!) )xtjj}X븊")! w \ /G \ /,fxt @ \ /G螦=u \ /_\0 u%) )@8xt j[jVHtb+!tfxu>h=!fxt& ))P0h=! \ /xW P)d)‰׋Ff|؃<`d8u!jYd8u"Džd(dZ@d~dXdG>uNy Džd>u |u &u dy Dždtm&upsj@ )jC( )@(x)P;ZY- )@(u @ @  dG )x$M )@ YН )`H,hP W )dH )@ [ (\u1m \ /VDx \ /@"<:jhډ\ /H\z{t &!\ /\+=)X \ /X@Džd{Džd#Tǃ}Ttq&!us,I*DzuftCy}TueKTX,/-/jjh,/M T,TDžd Džd &!t5 \ /x C\UX\&!uuQЃ w= \ /x C\X\dt:@Ѓ v0t \ /\XHqh>! \ /x{=\x=\dug%t7:t#u2DždQh(!!ZYt-'!!X\\9uC4Ú-d u}t h>!褚dDždFfxufxt dCwd@d ؋)X Ƌ@f@f@@b+!@'uAV|b+!u1\ /\bƋ@@")!f@f\ /\$赙p \ /@ Ƌ@@(!@f@!\ )d)h莝Xp/`/tu ltt}UWVS )@E}K )u@$x@*.$ !jjCCjj2Cu;jF EjUBjjUB뻡 )xu jF Y F @jYj 1á )x $CjjCj )@; u )x,u pZu hK>!j )@C )^x uVx,uPhy#p|ZYu=u )up0pXUS@HvDjjbj,@)@ @ )J0HCBHYvB )@)ttjjjjDCV )@^Xj  )B0+B8C j )p0Cq5 ) ~ uhy#v{ZYt hy#CEFq )xjƋE0FEX )xu7 )x  jj p02‰EEU )@Yu UBE밡 )xt jj@0Fj F )@Zt-Pv jj u )@FEM@}j jCCZYtNjjuX=)tt3j )@X&}t )@uWhY^Xjj )u@$x@}t"t;tj hXZËEC؍e[^_]UWVSS} uE EE1ۍu )x` )u*p0eÉpYtա )pZu1뿋H uX$ECE뢋}urO9uk} uej ) )H4swj/st ha>! ))+A8C7C )@4S@u} u jjEj$@ECE C )@0CX؍e[^_]UWVSP )@1u=)tt hs>!Cܡ )@uYj 蚽@Ej能NjUBp^XUjl;F7YUt֡ )@tj5ZۃpƉe[^_]UU )@@PtjjEX )@ #t/Ht3 )@jL )Ytrrh>!/ )1U11ҋE]SUU Et 9Pt]US]j SCU PUPX]UWVS]EP Zy h2!D/;u/C P1։I΁wQRu4 {1jjj踶 uguz jjޑjjՑjj̑jjÑ$jj 跑Y_;uVC pu us QXZjuz Ee[^_]U1=4/]UUE M~t E@]g} E U] UWVSĀuU ^/@/ $@"!FtutVtx YXljjW`y !PjWQy Kvhh=)trvjVx XZu hh nxPWZY@uWOy $E%=W-y ظYvhh vhh Vw ǃ F xI   <t:1ERSPQ y"^0g PSv hb?!,Sx Z //+VX褆E=)tO/޷j0G-PVh?!!,/躷j0#-Pth.!9t6PSWy y膷0Ww V PSh?!W"jjWOw 19u e[^_]UWVSu] 9t:S~w SV 9t8Vcw W PSh?!Y+VKw X؍e[^_]UWVS]{t97Gu 4/} tWy Pw X PRpZYW XCe[^_]US //@/jS /S /H/ u/t ]$*]UVS /t/}u jS8ZYstFxP`v X6͍e[^]US$) @$) $) ~!CPjju x Pv Xڹؙ } 0/]UVS]=0/ 50/j Sdu ƃ x 9t PSh@!z(%pt @e[^_]UWVSSljVÃ}tWhM{5,)j E8 tE"!,)tb_tQuh :#R0W҃!t#)t7QhT R u1ۃ u u1h+#5,)YX 뒅ttSh0@!R htY 5,)XZe[^_]UVSu0/9F|50/j vr à uq0/Pj vr à uOFPRj Pr à u6j j vr à u jj vzr à u h6@!&F9tSPVvr ^ e[^]UWVSu HtDE E1E Etmj@ /= /YM^9/}/S+$Zv,}uTu4/u EPV vu 9^ ujjSq y萱0 PSh?!Sw$ZYu/@/=0/ U50/jS7q ƒ uRE5tt UtM50/jSp ƒ y0 PSh?!C%xjjRUp URSW/H/ /~$}t ,)0)}t ()0)e[^_]UWVS ]EE50=*EEh@!u S t5EС0=*E)É]}h+#u{ [^u}h^@!%$E뉍X+t-uUuPh@!Uu1эAEؿ"!O9Mr,UuPSv UuG !h+#j[ 뼃}HE M܍E#}u}iƒuEEE܋p%VZ>0t1IvVh@!##~tFփs%@Hsru,1UPjSxn @Uuz0 PSh@!8ց !9t'WjS;n @u@0I PSh@!"}j 1}PMXShA! E9/|jM1ҋEEY1e[^_]UVSS]u M1P1<"!t&KyMS PMY P<"!<u~tvh S S4<"! XZt}QuLSh` HSh$A!@F y$KyS P-Y(P-Ph SY Sv XZe[^]UVS]蟬0u&=/u h/u/t]=\/uTY=/uZ`/tO`/8tCt>`//@/=v)tu/u / 0[^]US]`A!t%Sy ZuSh j hD/訶D/]UVS]} t"KyS P ^ P VPh9e"S ?t uShtY 9 ZY"KySm P X P F@ue[^]US/@/`/t8tPLX`/r/ /u/t ]]U/u`/ t 9u`/r 1]UWVS}u =/u`/t 8Ӄ= /…ttuotC tt7WtAtv  DjEPj g e[^_]UWVS ] }{hJ;"W[dZYƅuh`A! j5,) hmA!W)d^_ƅut1ۋ`/tH/@/`/P`/Yt jSXZ /u/tC@u/*}h!sc^_DžtCEuECEEpt6EhA#E0_cZYDž+NE}t`1ۍGtA`/u6u heA!XWaPh 9# C ~ htY qX1G@ut htY ZX11`/tB`/8u6u hoA!0XVPh 9#C ~ htY  X1F@ut htY X1ۋ`/t7`/8t+hzA!`/PL SPhV 0C@u1}uJ=/t,E0Zu-E8?-uu1tEhA!m_K11E:QM虳[Mt Q#Y)hs#QM[ZÅMtQr YuE?vEphA!5()D }tIhzA!`/Zu hmA! `/P) XSkPhV   8Cuui/@/t WNX`/t`/P]X<`/t jSnY[ //e[^_]UVSuu /d/tJ8tC/@/1P-`/P/H/ZYu/tB`/ru e[^]e[^]UVS]u /u VSYX /<vjS_{XZuƃ /e[^]U塰/=/u t8u1]UWVS\//`/u@@u \/e[^_]`/=/u4`/tX/]S8=/VjP V7t }sS7=/XaU@Ht `/t]US]9@/t$jj_jjVjjM@/]USXE=T/u'=\/tX/t EE/P/P///tEPj [u Eȣ/EPj Yt/@/EPj ZuR;Eȣ/=/uԋ`/tʀ;t{`/jS[X몍Eȣ/j}Y]؃EEEEEPju YXjSxXZEEEEK>v 耡 DjEPj_ SASP` XZ5P/yUT/EP/HUVSh`#!P[ZYj'SnZYu 1<3)؉‰|9w1e[^]U/@/d)tPd)\)X /u/teUWVS} ]1~SWu=^ ~)ÅE u F ~ӋE) B8tƒe[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu`/CfKS u>/@/s脠C CC/H/^uV/tM^Ffu9s/@/6CPRTC S)S/H/ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9()u]e[^]e[^]U5,)uXZU5()u~XZUPuu EP[E u h B!uPJu UEPu u UE Pu5,) UWVSu] Eu]EPu}WfEHE yWEPUX EPUEtDe[^_]UWVS u] j'Vyk_Ztt~tnh6B!V’ZY<u[KySP"X P"SV?CHC^_ySoP"[P">t%h`#!VWZY<tBEt9KySP'X P'E E1FVKI't/KyUES AU y;뼅t$KySP'X P'KySvP\_ P\KySTP'Y P'1}D>;,KyES J 'ZE J 't"KySP'X P'9()u]e[^_]ie[^_]U5()uXZUhX)?hD)5XZU8ruPh;B!Ph[B!UWVSSExE X85))\ /j=WhZYEj=ShZYU))9~u]\ /J \ /<=ttxF ؞p Cͅx]] }e[^_] UU /1Bu(+d/Prr hB!jhh/-h/UVSu]t t;E u1t:2&!V t;M t&!u1Bt)[^]UWVSS11ۋ`/Ctqt؋ uPY1`/t;Nȃu*Ft sUVЉZUt F6uЍe[^_]UWVS];uEwA!e[^_]hB!SAZYƒ1H9tGtN<'uhB!s_)j'SfY^ƅuShmA#S)PhB!s Sh9e"aXZe[^_]UWVS]u{St$CtS҉XuE{E} tu h*! YXt3Vh*!XZ$,)Jy RM ,)r1 ^G?=u q2Cu}th GPZY,)HyP,)H X J e[^_]UWVS=/u|/ hs/Y11ۋ`/tJG} tE t8tEt.|/9P5/K/%|/XZ/XEHEQx CCBf=t VRYY[EPWXZe[^_]U</EEEP2\ Zt EẸ/uu u$ Eģ/EUSE/`u 5/ZB!uB!P83/%/X7!tC`$jPh\:!R ]UVS]u /@/ts[VP /u/t e[^]e[^]UVSR#!ۍEt@S RPv7 u'Ev|2CFσCF CXh/PhB! u*E////e[^]UWVS`/t?Cu  u sYCuSZӨ@tsHCcX뻃/ue[^_]USjjuC u1+ËPu@t s SZuۋCS D]UWVSu/t!{VWZYt j=W\_Y[@MjjVà u12@u} utSt s SZuԋCS De[^_]UWVSE 81?rtE1hN!Yt+ntptu/t*Eу}uƃ}tp /8gu p /8u)1jSVWÃuZ pp /Pp /8EPjWMMу 1Ҁ9=uBt7}t!H"@tUWuhB!t Uu&뉅u }tWZpWhC!PVRW6 U&H؍e[^_]UVSQujEPV ËPM t /@/tSQSC |tjhd /V E ucCƒSu u sxZESjX /u/t1e[^]UWVS//su"@)s )s 躜XTSЃHujv^_;CtuV K TRYF u vZCFC FCFSXbe[^_]UWVS11EhC!3Xt4ft euvtxuҿ E¾뻃}u p /t0}tMP3 YMtW1M XZMʉ؍e[^_]UUE Bt h!C!jpp 1UWVS}u /@/j6X?-u2u,5 )@) )C CY1jEPWZƒ uTj=WZYZtWVPVjW$ EC CC@C BCJK t0BBt u tBB <=uUWuVP tUjWoXZU r$/u"0/<=u `/Hd/ d/S// /u/te[^_]US]tu sEXZ]US= 1ۅuhAC!NtxtIuhSC!uYu p /Pp /t SPXZ]UEU )]USME )u AR)[]UWVSR j EPS若Ɖ 8t)8"ur vShC!2,I*9]uE8u9u EDJ@t@EShC!e[^_]UWVSSƉu c9FuY~9uHjjZYPPEW UHx N9 uR0XF!؍e[^_]UŠH8-u>1tfzuh0 jjh %!1zuHhE jj h%!BRQ.uh0 jjh0&!hC!P+EZY1u(&!À8!uxu 1:UWVS|Ӊ_zfxopftft!f u&Pi_=;(; f xuWS[^1WS ZYuNf$`$!"E%=E%=@E%= E%=`sE%=dE%=UE%=FE E E 8Mȉ+EUԉ!]e]k9>(u;)uF C<He[^_]UWVSƉ׉ˉpfxe@fK$$!SVCY[OSVB_Z#SVB[^SVBZY׉lj։11 뺉lj։11 띉Ɖ׉9q|m9skgƉ׉9N|J9wHDyƉ׉n9|+'9v%!VƉ׉K9|9r1ɉ8PV~^_xPSgZY04U]9u9uE989|9uPV ^_ubxPSZYuO04U]9u9uE98J9|l9rfPV^_t1MxPSZYu鋅|9u;xu͋3U 3E S>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h#3`@_Zu#N*uFEEh/ V/Y_EEEE܀8.u)px*uEEh/ V/_ZE܋E܊Eu ShF!E܊@EE@EEЀ}cE}G)}E}A}Btu}%J7}ax}X5}i}d}gG}s}o}u}xEء/tPWY1}֍PEУ/ZE؋E؊P tT) tYtBuQb t9 u@v" t!u$ev'tq\tlaffbn^rZtVy,I*Dpt k\y yAMOu f^?H^@-W0\Q"Es}t}tuMuO}tuYu^qEС/tPX//tPX//1ɺ E5/FP`£/_]x׉2Es}t#}tRuuSh///Ru }tRuSh//RSh// @//H EF5/h9e"W/ 1t /}t"}t PuuSXPuS8 E}t PuPSY[$oƉ׋UЉ}t'}uWVuPWVuuP}tWVuWVP뀡/t_؊ "t'u/fBfEE;pEP/0[~]С/P/UXZEЃ}t&}tPP$uuS4DPP$}t WW$uVV$}Bu1}NtaShF!ZYME܍xƊEEF/r /;Et 8/hF!XeY[^_]aUE E EE]|+UWVS]8}h j jh@G!MQMQvƅMu!h j jhG!Q1vƃH Xu WhL!ECfCdC0X]USP]{(Ut EERh`tP)^ C,]UWVS]jjh!) y3jP[C8C<C@CDXZ1j,C8PV) VS* y!D3HFuC\C`C,e[^_]US]s4BBPC8PV3 C, ]US]s4BPC8P 3 C, ]UEPfR@dPh0#u UE8P!3 Ph du US]{(t ]C8P2 C@C@C,X]UPEEPhtj\ y hN!j衍 Uhnt jw\ZYy h#N!j~ Uhot jT\ZYy h-N!j[ UWVS }u ;-u F(CF(]hX j jh@H!EPntHPu~(tSh6N!t!JRV4uShL!{ VPX1e[^_]UWVSSƉ׋]t&MPV#ZYMuA# A9 Ԋ-uFt.MPVM#ZYMuG-u !Љ e[^_]UVS] E0C@PK!`L!YYtC,NC8PK!@K!1Zu؍CDPI!@J!YuCt(t8t,I*fDB@fO1e[^_]USÃ=8/t =$/t?</9t6t2d!th d!=th QRh [!Ϲ </8/$/]UWVS1Dž=P/~ Vhj[!pXZ1ۉ RPhST =t=P/Vh[! f}Ut=P/Vh[![^1ۋ<tw<u9 <ZuD/.j URP_à uX8"u h]!j} 1ҍe[_]UWSPh1]!;ZuH/.j URP^à utX8"u hA]!j,} 1ҍe[_]UVSƻ U!t[PVZYuICƒ@/D/CH/C /C 1f‰8/te[^]9 Vh`]!j|| e[^]UWVSӋ`6/ hy]!jW| 1 WVRh@/P `6/9t"uRSh]!jI| PRSh]!j| e[^_]UWVS É֋t8u Vh<[!jURM/_ZubE8/uPU/U@j}WM/ZYu3/EEE@jWM1Y_uEEEEVh]!,(/XZ1e[^_]UWVSRÃPjh^!hD*eCfw4X!hu!Ph^!hD*d s(hF^!hD*ds,hM^!hD*ds0hT^!hD*d$s8h[^!hD*ds4hb^!hD*dKhD*h^!+\Ea6Wh^!hD*LcvWh^!hD*9cF (t*< w4 X!Wh5A#RWh^!hD*cN w=ੀBBt/F fRPWh^!hD*bvWhDA#hD*b$E&hD*j \hD** e[^_]UWVSu~(u jh^!~,u jh^! ~0ujh^!8^_1~4ujh_!Y[f~Hujh_!XZ~8u F,F0F8~<u F8F4F<ujh5_!ƱG[X1v(t hH_!讱Yujhu_!藱GXZ1v(t h_!X /9v!PRh_!b EX9|݃8u xt#CPRCaPh_!CfKȊEaE{tQF<9CvURh_`!GYXSS;V\,I*DPt2hP11҉ZYtVhT[!Y_ Dž! v#SVhc!hc!Dž / ǀ/G< cw<t)< <<t<t//À/(/":(/17CfC_ G (/\(/13GfGb_ G (/tSk(/t,13G@G (/h/Ze[^_]UWVS1ۃ< X!tCtaPP_1uhc!跠Y1< X!@9uh1 jSV14GZ9uVMXe[^_]Ã=)t5UA]USÃ=d/=@/u1҉t%Ph/XZ [u=@/t =h/t 2ux=X/u=L/u7jFh/hedASB tHh/hrdAS+ u/h)d!je h/hedAP y hGd!je ]UVSQ/WEV/WEVf/h/Yf/d/X=h/u5h/hfdV y@8t}@8t Xd!E=h/u2EPhmdVM y hid!菔Z5)h JIXe=h/t1?h/hgdV yh/hgdV yzd!؍e[^]UWVEu /t /e^_]Uh /hmd5) UUE 19s f3B]UERPZYUS]EPu 4 hC*hSt$< ttj S葞ZYt1҉Ћ]US)tsPhi!J `E Ei!]JU=/tPhi!P: ~?I9}˃9Uuh juul ]HuED1E1;utY E70pRtPhhsQhhV:C < w4 Z!hPhV: C < tow$<t,< t(ukKh8 C RPQh"<t)<t<uGKCPC RPQhVI:9KC RPQhV-:sh h8 hV: O8C1Ph V9C ;Gu#8t/j_} tu Sh(s! Sh[$_X뿃} tu ?Ph(s! 벍?Ph[$[^띋4t 4PjsY$P]sZ}tEaj,PS yh LX;,ƒu)t"=tRw$u hyd " 1e[^_]UWVSSƉUjËUR9W1CCC  e[^_]UE;/E ;/]U;/]U;/]UE PuhpD*hpD*j )j'UWVS]"8ށu=;/t5;/h -YX=ZHtD/x뮍e[^_]UWSáB/p8XSY t& B/q0RP˰¡B/H01z 1҉Ѝe[_]U=C/tf]U=C/t]Ã=C/tUWRP"|Y_}UWVS }]EU E FD/D/;U 2 ;E'}w+EU 9|9B/@8}}]9)P#U#} M]߉9|*9v$=0C/tuH#EPu uh|!_B/uԉEuuu u^ E܉UƉׁ\Tts!s׋CE䙉UEUEUEUEU EUE9E | E9EC;}| ;u=0C/Muuu uh}!yB/\TEMuƉs!΋S։։E׋CRPuuh}!UE܋UEU;UK|;EsD=0C/t4uuu uh8}!B/uuhQ}!$1e[^_]ÍL$qUWVSQ0QEU}w}vE9C/wr E9C/suuhv}!zHY^;}S ʉ@X B/9ptB/9ptC=D/t  T<ujw wh;~!hRRWt*C=D/tDC  D/FbS5`C/RXZ"@)EU 9qS=D/t ‹T tGWtGGuWЉ^u uXZWcE E BD/GW RPRPhV8Vh\~!Bo h~!^w wZY=D/t@V+EU FV"@V +EU FV h~!ԜD/cX cȍe[^_]UWVS$uE 8tE @0@4=D/tFVFV Z} G$W('ff%f= B/furE P$x((;9=C/t ;u=D/tF F~h=D/t@󥋅 󥋅us0NډWVRP= 1D/ t 5B/#8tq@DNL##NT tu F B/@8M A t`d E x@D/P @RPRPhSΟSh\~!k h~!蚖ZHE p pt^X=D/B/tH0șCSH0șCS h~!蔙D/[B|] CS\u FFE x@tPPu Y$G B/C8} G =D/t {0k )ډƉ׋=D/t$ݸݼ tHM AQDt-U BBWVڋE YZME x@)D/E P @RPRPhPߝPh\~!i h~!襔ZHumE p pZY=D/t@S)CS@S )CS h~!蚗D/XgB/Htș‹Љቅ+CSe[^_]UWVUr8zu;Buz4|z0wB0R4B<NA^_]UWVSu^8;uOCvB/MQRWuuw MEȉEE$C/E̋09Uw96 } 9~jS YXuSh! dXZVEpWxE̋Ѓ 9s@t EpA$XE$C/xuu E_X B/EƉׁ\TtA#EASA WVhC/脔5C/B/}=A/t =C/t =C/t5B/u5C/% EԁxU tU tuh=!b[^=A/thC/ޕC/YEԍxU uEԋX\áB/RPuuw ƉމEH B/ELHh R5C/w5B/5C/S=C/tC/PP|XZD/E%=t =t)=@EE@EB/p8 EhC/ŔC/uu[à =D/V蟝CpSt_ EefCXEP |EUiC S$C0S4C(S, B/IT t12CS CSVC(Zu EEfCdEP{ECC C B/IT t1CS  {ChXC/C/~=UX,(=dC/u hW!%UXX0=dC/u hx! UX_7=dC/u h!TX9=DC/t=dC/u h!TXQB/ 48,0@8,ˋ0,48RP5TC/5PC/5C/5C/hׁ!BTB/@Di8$4$Ӊ1WVRPm| jj RPz RPk8dd4WVRP=| RP0,84h!@=0C/C/C/+C/C/ B/C/C/ tRPh/! =0C/f B/A A+ $(Y,(Ӌ$֋$PC/TC/ ׋Q4Dy4׋A8,ˋ0,48+D/D/PC/TC/ tRPhC! =,C/t4hX!,C/Xtssh!f j z_=$A/t4h!D$A/^tssh!) j =Y$A/,C/HD/S=D/taB/jBl04h 5B/5C/.f5B/5C/q=C/tC/PP蚬XZD/=D/t D/jX1ۡ$C/B/;Z,}DtPnXCPd$C/X=A/t =D/th!P E/_=D/u1=dC/u h!P^=D/t h!P[pOtȍ@Ph .V ZYu9@t/Dž<j1;=C/rw;C/v hk!=VSuPh!hpD* B/B/uEEE$C/MU9w WV蔠WV8Pu}=D/tCCp=C/t E=D/tCCt=C/tE=D/tCXCd=C/t EP$pv!YftbWVYZt=0C/WVh!!WV[YZt!=0C/WVh׊!R SEPXZ$A/Ѕ9xu39pu.JZHX$A/R"jhy|!EPVjhy|!.=D/tC CC C t jh!jh !EP謴VWVPh!<E"Ee[^_]UWVSB/ C/jjVN1󪋃hXZ=B/{Xj$=dC/t h7!X=dC/tWǃ$C/h 5B/5C/8/5B/5C/{R=C/t!C/PPuY^hQ!D_uD/KX$~9Džp;{! Džp1!~$lllK`l,;s0vphh!m$XZ3=dC/t=dC/t(ph!>Y^h!C_uP,pFȉ$1~K`F@p#CLP5 C/_Zu h! C/C/h 5B/5C/%-5B/5C/hP=C/tC/PPsY^D/D/pt DžP@DžHLPP1󪋃@P Tl0X$~RA\=C/t\\\t`K`lXDžU X)LpuwxnLtuS+HlZ0LDžU DžDž@DžlDžXTPhË!DžlDžXL1\C/Ƅput DŽ(L=0u֍1󫋳8<K8șptىDH#pxxPDžTPTx|xJ ;<HDž4Dž8Džx{,;xr= B/t6kxdVWxPh!hpD*x B/4p8d𙋽pdPpƋPׁ\TtC#xCQC RPhC/AE5C/=A/t =C/t #=C/t5B/5C/q =C/u-xU tU txh!XZ=A/thC/FC/_=B/t =D/u =A/ B/AhPpdЉDpƋDׁ\TtA#xAPA׋Id t1RP5C/5`C/A B/pdЉPpƋPׁ\TtA#xAqhAWVhA/sC=A/txh.!!6B/ph5A/5C/& =C/t5C/5A/ZmY^5B/5B/JXZ=A/thX!P7D^_u!5C/5B/ZYu B/AhPpdЉDpƋDׁ\TtA#xAPA׋Id t1RP5C/5`C/@j5B/F^_ΉpNjdЉdpቅptdtpt8D<,9|9Dv D,5D/u y|@xD+puodC,H;xu3xdf!șdDdffDžh$~ {8dDž DžDžQ(x 9~ DžQ,9~ x Dž W0x 9~$ Dž$u DžlWx9vll(1󫍕HU u H1׋l󪍕U u P1׋LuxLu DžU xdPT1d489TP\AZYPwP$v! U u Pv VPh|! GPTXxuPU u PU u PDžd,9t|D9pD/ptPTDž<1s8;< T$Dž($(PT4P\T%`y>\\Dž  \`\r@U u T<dѺG=A/tA/PP|P_XB/ph5A/5C/  =C/t5C/5A/DP[^5C/5B/ZYtc=0C/u-!ERKhj!"=C/B/shX9s΋9tRP+B/Ph!phB/5B/)Y[=A/tOh 5B/5C/ 5B/5C/E,=C/tC/PPnOXZD/B/A/E؍e[^_]UWVS]u A/`C/D/xPSZYyc0ܸPShʏ!d=D/t(jS# A/Y_yUc0諸PShݏ!3%= tSh)h! u>{o1=C/t `C/=dC/t"h!YjSq" `C/_ZySh!*oA/=dC/u=A/u Sh!oXZD/D/D/D/C/C/C/B/A/A/A/h ^C/ h IǣB/h 8A/h #C/  ʅ ʅʈt h!VSY_t-D/ujV! _ZyVhY5! A/=D/u/R RjPV6@t(4C/D/4C/D/?ts=XC/=dC/ D/PLPj5A/S5@u Sh>!Y^TuSh>!XZh,7#tVnY_t%hk!V]_ZtVSht!O T uSh!렋duSh!눋5C/V4u Sh!pu Sh!Uu Sh_XhB!ZHuD/B/B/(=D/tx<Ph ! [^=D/ăxB/(=dC/t hM!Y=dC/tCh 5B/5C/5B/5C/=C/t C/PP=^_hB!> ZHuD/B/ B/8<qH։9u9RPh5!=B/BHЉ8< =dC/t hM![=dC/tCh 5B/5C/5B/5C/=C/t C/PP=XZhB!o YHuD/B/ B/@DqL։9u9RPhZ!nB/BLЉ@D =dC/t hM!KX=dC/tCh 5B/5C/5B/5C/'=C/t C/PPP<[^hB! _HuD/B/=B/1B/L=dC/t h!X[h! YW C/B/ǃLǃPǃT\ǃX`B,Fȉ$1҅~K`F@#CLh S5C/K5B/5C/=C/tC/PP9XZD/B/=B/tv=XC/umh 5B/5C/5B/5C/-=C/tC/PPV9_XB/ph5C/5A/hA/5`C/ 5B/Sj襙LY^u Sh !DžDžDž 5B/;+^09~ËLSF8HLNd t1RPW5A/ t@ t Dž +h1!h!^ZuD/jR=A/tHSWW7 B/SA8HLId t1RPW5`C/ =C/t SWWJ7 B/@0 D/D/1Ӄ1ӉȉjSD/ZYu ShI!^,jS͗$C/Y_uShm!=~D/ D/C/C/=D/Ӄ9r w9v@D/D/LC/A/C A/jP0ǣA/jS!A/…ˆt Sh!S* C/Zu$Sh!_XD/jX B/ B/=D/u*t!hk!P[^u C/D/>hSP5|D/5A/ƃ hD/lD/pD/|D/=LBALt]1=C/h!hB!ZYjjjjjS:=|D/fGW9fGD/CJtejPh! =dC/t h!_=dC/t'C=|D/fGW9fGD/Yht!ZufCff=v]h5!X=dC/t hS!_=dC/t&fC=|D/fGW#9fGD/Yh`!ZufCffuihi!_=dC/t hM!Y=dC/t2jjjjjS9=|D/fGW8fGD/hB!Zuf{f9}zD3<:uPjj PEP1e[^_]UWVS,}jhPjWtGjPjVWV= u$U ʋMQ؍e[^_]UWVS u] Dž PVOY_\Dž$%= j/V݆ _ZxrPRV)Ph!h@R1j P.  1;}YRPZYu$ƴ$PVY^yGƴ=@u$$u&\uÉ(Dž,PS芘XZuk%=@u4(h!h@W0WdÉ(F= j(4 ^_1!hh ( à 1PSZYstS Yyh_9u9tԍ@P( ^Z'Hd`RPS~ yu Dž0 Dž0Džhϛ!j4V/jjV) Ã$PhFSj y$8S Y뚃}tV(MZtHPhF|@S yhF S _X12 tPt^}tJMQ41 tPQtYt (bZxSI X؍e[^_]U=C/tf]U=C/t]ÍL$qUWVSQ EԋqAEB/ǡB/@0]SRPq qZ M]M؉]܉E Uup1M؋])jj`SQ щEءA/]؋};r hۛ!ݲ[d!ʈEy1FX @C/!9tEFXRPh!荲A/]؋U؉ =dC/t hM!p YhB!Zu D/!FPVT}ԉWFPFTeY[^_]aÃ=C/tUWRPFY_}UWVSE܉UˋQƉ׋EE B/H0ș9|9vEE5EPWVu>TB/;B0u Exth!聱XB/@0RPWV| UBEuWVPSU tUB SE؋MM9M9u;ut8ME@ SƉ׋U9U Mb }9}t tE`EXPPT@PƉ׋E1]9]tE`1e[^_]UWVS(] CXƹ1}jVEpp }܅tPEpYXCS$EԉU؋WẺUЋC8S<M9MuM9Mu9W u 19Gw wuuRPuuVE0h+!ܯ,=dC/t hM! ZhB!rXu D/&WCSGW sC8S<ȍe[^_]UWVSPhjj/JƉRP2ÃfCTu6G뭉EuYXEe[^_]UWVS}]O,uh!!hy!h: ؙt,hD!hy!h; h!" U Mu )u1e[^_]UWVS}uO,uh!!hy!hK t7hD!hy!hM h! UMu] )ރEUu#P@EUEPًU Zt1e[^_]UWVS] u}A/t5`C/WVShZ!SWVu5`C/1e[^_]UWVS] u}A/t5A/WVSh!SWVu5A/1e[^_]US=C/u@j5(G/[Zt!h!h!ZYuj 5(G/X1ۡ(G/9XL~$A/t@Pp0h۠! Cҋ]á(G/t(Ux,tPAZ5(G/(G/XË(G/1t z,tUu uuuRUWVu} WVZY=D/tPXPd=C/t1s)B/f`u1񋂄1 e^_]UWVS0C/tH A/ A/B/!`Rh!{h!@ ujB h#!oB/ ǀdh P5C/ 5B/5C/N=C/tC/PPwXZD/ atuhlpx1Rh>!踓h!} 9h#!诓B/ ǀdƀah P5C/D5B/5C/=C/tC/PP^_D/1111 B/!t4PRWVjh(G/}thZ!h!辽Y[z1ۡB/dat <wPh>!袒h!g #h|!虒B/ǀdƀah P5C/85B/5C/{=C/tC/PPXZD/ Rh!q؍e[^_]UWVS]DžLDžPDžTDžXDž\Dž`DžDDžHG/d󥍵dh!uu 8 @tt8lt!8tt'8bu)TPSHPS~%VS5%_Z$8\PDPLPS$@uqE 90=*bjhG/Vw ujjVj/[E 90=*G`\jPLS Ɖ׃u H,D4TX$(LP<@SwY@P49vPQh!StNA 4PS0jhG/Pu Qh!Sl QDž4Dž04;BPs: 4Sr0jhG/P  t4뻋4;BPuhʯ!SXZ@|S <vH$1RP@<趷 RPWV($S/<u6h!jjWV($S]/<u h#!hd0󥋅f9]t1 EEE;Es @} fDGXZ[^_]UWVS}E EMM䋇$EuV|8ZtUMMEeEUMjuu*;Uu;Et S@X1VSE 9u؍e[^_]UWVS]u $~N&EUMjuu;Uu;EtWv 蔭 9u僋1e[^_]UEjPu u"US]0DPSu u]UEtu#Ph nXZEPu j { UWVS}juu W_jhZP<  msCs SZY9t&Guu h9!WO.sPsT1$ЉlPsLsHWpu/}tsLsHh]!WVpY^;CXt!sLsHh!W~J~*U 5! Uu1!uu Ph!Wyu  ujSPjjuu W ajpPl1RPsLsHWx /t Džll9CPvዕlSTp4F(V,+F V$dh~DVh9e"htQ`Dhdv$v `Qh!Wg,jVjhdv$v W WlQPl)p<ZS<X1e[^_]UWVS,ÉUMjQRPEuh!SY[EfUt(tuuh!SuF<Zp11҉}tu @BuuN_t[} }u@Hjjh !S jujjjjjS 1uuh+!S~uuhR!SjujjjuuS6Eԃ EE E EȋE}슄8E<F>E81E܉UE81u}1E܉UEMEE܋UEUЉE܉UE U uuuhH!S~*uuWVEPEMPhd!S EM슄ƒt2<t.jujuuu}WVS tT}P,u }u }}u։WVu_ @tE}@#u9X!jjh!S$e[^_]UWVS}u hj5ZYuWh!襓Y^EEU(,E$E U$04%jhSPW߱uhWS7h!S48RP_Z@uh!B$@%=u?$Phd@ @uh!SY^$uhش!M, ((Phd@ @uh!뭋, (h!SH딋ȃu ǃ$, (uFM苳$1RPWV肞  ‹Mt(,(,EU싋$1҉MRQuu藟 Ɖ׃M|wWVh!S}wtWVQuuh7!SWVS @tIEjjEP11ɉi @t)jjjStPWVS@utP ZS6X1ۉ؍e[^_]USS]t_ƒBBuCu'EPhd@ @u%h`!SZYuSh!S n X]US]jSYZuhŵ!LjS YZuh!1jSjS{tuh!SXZ1 @ ]UWVSW]} w FPFTPEp IZYFXFv V4ZYFWS(^_u Eh1!uSY^uEhG!SXZE1e[^_]UEPdUE PJUWVSEu }}҃ @@@ ~ @ fp fH[^_]UEP EBTU B ]UEH E ATB ]UE H E ATB ]UWVSu FEF E}t }ƒ1эAEhL#RU茟ZYUt 8 _! _!8 SE06WRhi!hpD*0;UsOSE4U6Wh8 uh~!hpD*UB 9t76uh-!hpD*ރe[^_]USQM$1SQ,(c eY[]UVS]u V 5|vQRPh!SBHEPQ ZYy 55h% "EUV |w55h!S 1e[^]UWVS|}u >Ã~9|~w1~$u+~,u%~ |~wF8t`WZtWXB{0C%V$9tVN|v;K;VN |v;K ;SH|PWZYE~,uVЉxxuF2jmEPxj$EP8RFxPv,thjuR\ uVjuuUW@|WZYjuPUW@v0sh!WW[1e[^_]UWVS]u}SZuBjWPSv@tjW p Sv@tϋE p0hж!S 1e[^_]ÍL$qUWVSQ EAQE؉U܋qyy uhڶ!uZXZJE䋀$EM1SQMЉ]uu軖  ‹MЋ]t!uuuh!u!$C8Ph hxV\-VhQ!sPhc! 1e[^]UU E$E8E U]JUWVSPEPV @'Et M 9 0=*uPh#C EPV>h8)j|u# e[^_]UWVƉj(j5ZYt:0xUM PH @@UP@@ @$e^_]Åt!USÃx$t p ]#ZSV#X]UWVSuEE}t:EXP @E؉UډEUE;E}E@)E;E vEh%!uuE UEUEUE9EE@U 1ʋM1 u9VuuE UE )Ehż!uXZ=!w !!w !QRh!u<EE9EVEEuuuu uuSQh4!P(U3UM3M t0ut&Euuuuu h!PEpE ]C E$C$]VE@E ]C E$C$EP]K[ ;UuT;E uOE@}Guwtx Eu艰EUPEU}W+M]O_ Ή׉u؉}܋}9}u?}9}u7E@uF}~tpEupȉ+EU}GW puvM ])SQ ]K[ HX }_)O_ WP}G{}~pPtB ]Ee[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy WVuuN  t/E؋UWVRP袇 ։щE؉UMWVuu  t/EUWVRP_ ։щEUMEE E؉EE EE}{kSEЉUԃ}V }J}t"E9E@| E9E2E؋UN|QvJWVuuF EUċE Et8EЋUWVRP萆 ։+EUE؋U܉EUċCS +EUĉEȉŨ}tE9E E9E9}9ur~E EuC|JvCEPWVuuo ËM Mt%։щEȉUM EUEȉUjjjuuȋEЋUEURPuS [{1eY[^_]aUWVSQM]܋yYq ]uQAEUw}x}yhּ!E Eu"h!u>XZEE|~th!֋GW EԉU؉N^ M]E Eu O_ uuuuӄ UMˍ eEUME9E+|E9Ew!uuuuh6!uKEUGW +EUVN^ )ӉN^ FGFtxuuuu贂  t;M]M]uuSQ UMˍ eEUMGW EUE9EE9EvxEUGW EUt~tLWjM]+M]SQ uhż!u:GxpF)VFV E9E| E9Eu hP!~t ht!FV M]+M]9|9s h!)ډFV M]+O_ ^ uFGFtx-EUGW EUeY[^_]UU Et 9Pt@]UE]UEt Pt]UWVQ MqyQ IUM苈t`QE܉UAQ EԉU؋E܋UEU؉EU9}}I9uv11҃yu9E Et!u}19}}119us+u}EԋU) Y^_]UWVS ]u }jWV11 uhż!SXZ.WVhaj EP~  ǃ 1e[^_]USihL#PwZYu hT!Sh! hT!Sh!hpD*+hpD*hľ! Y[14`!h)$MCXZujUUt;wt2ttRh-!ux UU1w)rtu (taw tKtA!vRhL!j@hG/pG/!Pu hQ!u UWVSjЉʃRPWuh!WZYEƁ8WEVu WEVth!WgVJ @(E1E܍EEE9Ev+ExtU|9v11ۋUBUE̓~SQM]h!W M]$1RPSQ~ E܉UE;E~HE!vPhL!j@hG/G/!Puh˿!WEEPuWU tqjH]S8RSPE苄F(1$EE1҃11ۃ}t +EUӋEH X$E苄1ڃ]C(S,mEVXEe[^_]UWVS4]u EEEEh!uV ǃ tBft4Au>EӃptsu+EEPSY_@uE950=*thT)jUuSnẺUjSSE t @M th!SE@ EjVuuSxBu@p EEEEP@ЉEEf@ fEċEf@fEƒ~NE1;`!u d!"@=uRhL!j@h@G/@G/Puh !SQE<w,<w<<< < r]< vz<uUt<w<sl<thrEPw=\ZYjh6[ Sue[^_]UWVG/}^_]UWVS<]u }EEEEEEEh+!WV Eԃ @t1}buEPSXZuԍEPEPEPS@u950=*th)jjE}|7}v1SNMu_t xuPt9pu 9uU@uuuuuSƉ׃u E܋UẺUЋE؉ESZEHEPSEjhG/P%uuh!S$ R$1RPuus EUSyXt E;AtIhu!SXZ~L;y uM;quHE Et(}|:}v2MuuWV&r  ‹Muh4!S[^uuWVQMSẺUЃ}Mu }ű}1yMEp(x,SY@t\u9p(x,S@t6uűMq1uhU!S%EOEԍe[^_]UWVSD]u }(,EUhu!WV E @t!}su#jsEPjjSn@u950=*th)jEuujjjSu AƉ׉ uuuh!$1RP,(q EU;}|";uvuuWVh!S/jSEZYtEȋEԋ@E Et h0!Eԋ@ EjSjSu hD!@ E̋P$@ E؉UjS jS tu4juuSx@u uuhf!SESjS3 ZYu h!4jSEZYu h!;}u;uuh!S_XEP E̋@PMATЉE;Us7jhG/RU7 UtJ(B,9E |9MsMȉEăċEP @ẺUЉ+EUЉEUM9M|M9MrWVh!SXEU+EUЉEUM9M|M9Mrh2!,;};ul uh!SXZE0x+u}ЋE0x @ r $󤋃p PF V$FPF0V4j\VFSv H PAQPA Q$PƉ׃q0y4AHQLS\@Et h!}~Eǀ$E}fEU}fuSEY^@h!}\u}WVjS$@)jp juu+u}WVS h_!SK-뙃|v;}|;usE9EuE9EdEe[^_]UWVS]EEEEE11h!uu £ btENtoat%itClh)$Y1EPS,&EPStEPSfZY@k}҉Љ։X}|C}v=S MM܋UUZt&xuPtM9Hu M9uU@օtE 90=*uEU t th)jZYWVRPuSe[^_]UWVS֋UU u$!h!q t h!腿XhS!Nh"!Dh1!:h@!0hN!&A t h!AXh\!6C SX1O11;u ;Fuh!hf!躾_tjmWj$8S胿1tttSh Shp!hW$ Wh0M!*hg!U^u]uTh!Pht!0ZY>'X68 tPPhX5# !e[^_]UVSjj h8 E MeRPjuV yEu uSh!藽}t Vhj7"能ZYj 蜼Xe[^]UWVStljP Zt 9St[Rh!Wh s Rh!$1s3!$1s s!Vh9e"hW(Vh htSvSWDluhhb$W SWh!菼FPh hS5Sh!p$jmSj$F8P?Sh!Nh!DF0V4 u h!m XRPhP`Pm 1e[^_]Ë D*Q D*y ;0D*| tD*J D*UhD*PZYUWVS|h6# h!蛻h! h!膻h!2m V*à Ws3 h!Ts s h!> / %CPh !K Cs31& { Wh9e"hP Wh htRxuxRP7juhhb$PϤ Ph!wtRxh:!`GPh hxR xRhg!2h!(jj h8 $K cRPjRx' (xy"$K cRPhaι Rh9e"边ZY jmPxj$W8R~xPh!臹h!}G0W4 u h!k XGRPhPPj )h? 9K Cs31N  [1e[^_]UWVS]u }EEEEh!WV苛 tWgt9at,buNEPS'lt)ut*iu3EPSm M뮃MYZ@uM뛃M950=*th)jXZcjS^_u h!i Y}t lM}|7}v1SuMZt xuPt9Hu 90uU@܋Utih6# h!迷h! h!誷h!Vi SNƃ v6 h!xv v h!b S IFtPhG!9XZ h? +Y  N Fv6U* vXZZe[^_]UWVSD] 1}G/}Ec!uhp!uu a tGTtlu&h)$@Y1tukVS_Z@ut6PEPSf @u#tjhG/Vc t E 90=*th)jZYVhn EPSwe[^_]UWVu }^_]UWVS]u EEEEEh!uVn tfbt< at%it;lh)$Y1t|EPStlEPS1t\EPS'_Z@uK}|7}v1SM}Zt xuPt9xu 9uU@܅t950=*th()jZYuujjuSe[^_]US HfJfHfJHJH J 1Ɋ\ \ Au[]USYSYSY SY SY SY SY SYSYSYS1h !RP$]UWVSEUfPfUfPfUPUP U1ҊL LBuExsu<1ۍ}jWk@!V uu vu uZCuɋExl]u91jSk@!W uu wuӝ uFuɉًU Ee[^_]UWVS}t?u1}WEPEPEPEPEPEPEPEPEPEPEPh:!W 4 u'EyƒtPh!VP$ '1RP- ZYPh"V#$ C1RP ZYPh!V# C1RP ZYPh!V# C1RP ZYPh!V# pC1RPu ZYYPhX$Vk# BC1RPG ZY+Ph!V=# C1RP ZYPh!V# C1RP ZYPh!V" C1RP ZYPh'!V" C 1RP ZYtwPh5!V" tdC 1RPi ZYtQPhD!Vc" t>C1RPC ZYt+PhQ!V=" u NG Džt VWJ ZYuV* [h_!u([^< Mt#Who!! W YhS!! p  ËF1RPb _ZuSPhy!SN! tߍF8Ph htWW tPh!S! tFP1RP ZYtPhݯ!S tSh! S/E  X Dž@U$A 9 ƅ{1RP Y_bPh!V5 Sh htWW .PhX$V CPh hWW Ph!V s$s  Ph6#V s,s( Php"V s4s0j _ZPhu V` vjmWj$C8Pu$VH Y^@W Z#Ph|"V u h!  h!  X@Nb$ Xn hmA!W D*t6h Y_uh0!uLSCVS XZD*tV轆_S^Dž$ Y Z Xe[^_]UWVS]mA!1h!uu / < @t! ^D _ h!VX ZYtP# h"V? uh_!SP L<9h!V tP h!V tP h!V tP hX$V hPq h!V FPO h!Vg $P- h!VE P  h'!V# P fh5!V P fXu=LH~ǀGDff(hD!V ZYTP] fhQ!Vt 1P: fX LfǀUjjj`Bu@uh!S$L0Q ;$u; YS Y 1thX$V _ZdP ǍtPW u.h!Vu ZY3P ǍEPWu tWh1!S h6#V3 Y_P EEhp"V P EEhu V P EEh|"V tP j$URPh!V _ZYPb ^9,s,Ph!S)L$t j $j61RPPBu @u h !_88VL$PO ƃ ;8uj$40RPBu @u h(!8L$PN 9uы$1LLEFI APARTAA \AAϋDHW O$ y(A,ϋ$(W0O48T󥋕LBHBLы,QPAT8PLGXj\WLBj$1RP较 Bu @u hF!$LM ;$uԋLDHAQA A$04AHQLAj\QNLBj$HDRPBu @u he!"$LL ;$uDž<L6@6 XZsVDZYu+C xu"t s s^YXj ZuV Xe[^_]UWVSuE @80ƅ77Ph!V t 7uo7V Y&V Zt h!_j0 Ph$g Ttg81ƅ9$@󥍅8Ph!jPS0Ph!jPuV VSh!jQ S O [t h=!je T˅S zuR$(WsCZY(u1$zu%B sV#=ZYu+C xu"t s sWYXj 膌Zu[O Xe[^_]UWVS@J9vr[^_]UWVS]u*YuPPEZ@u h,!h!u1Xuh,!h!j{ sV3 ws Vswhy#u) t&P EhM"u  uUEVEPhE!u貽 }Chs@Pus @{Pz E_h,!u ZY1t P[ Xh4!u{ ZY1Ʌt P= XMEPhE!u E Mu {hE EEEM؍CU\EPu u @Muh,!h>!fEftft5fu6t2C t VhM!jˣ }tC(Uhm!C0ut3h!j蚣 t C0sHtS4KL9vщ}t:s@shuqr us@s`u\r @u;4~81t/sl`}t$CUWs@s`u&r @uEsd6CptSuZY@u s\h!s8sXuq @u s\h9e"re[^_]UWVSPu Zu1hu _tPV Yt8W EWu Mu S [1PQS uV XtSe Z؍e[^_]UPEPhL"u3 1҄tUUWVS]\PhE!S t\MfnjLZu\SXtd$1jRS+ShiVp@tt}f1RPhE!u r 1e[^_]US]uu S? @t ]]1]UWVSu u$ [^u ~|P Y;Eva|?V }ƉM)1Ze[^_]UWVSu u [^u |P Y;Er{?VT }ƉM)1Ze[^_]UEPhz0 u Uu{UWVSt!FPh0!,1Y_j7RPh!hS.;t!CPhE!1XZڍe[^_]UWVS]h!S0 Y^tWP ZthU!h@!jVh!h V }ܹEPhiSL@u hw!j e[^_]U]U!Pt;w!Pt,!P!Pt!Pt ]U!tHw!t9!%!t!t!t ]UWVS ljӋE@E9w1;Et ^w+@VQWn 9]tD...1HR1vKMSh(<"WvnCE 1ۋMU)ƒv9sMCRh@ DP(' ύe[^_]UWVSxuhWhr!Vt@uh4!h!j. DžDžDžDžDžDžWh!ZYuADžDžDžDžDžDžjWh! uDž: ,I*DytRz:uL0B1j=R?Rh+#PFt2 uր8tSh!j jPSjRWFu*vDDžDžDž|Phi8VH 1@u h!j褚 Ѝe[^_]UhpD*h"!} XZUWVS] 1}EPh8i(SMH @t&E1r r%1ʹ|󫍕[!RhiSCH @[< v Ph!j蟙 h![P\PKF <fDžLVhiSxG @t%fNth!=@N/t h !賀_fDžLVhiS8G @t%fNth!=@N/t h!sYfDžL VhiSF @t0Nf=) Ph*!?XZ=@N/t h2!(XfDžLIVhiSF @t0Nf=) Ph8!_X=@N/t hA!^1|󫍅|Phi8SVF @t}u(j ~$PhiS1F@ThH!}EEEEĉEEEԉEEEEE|Phi8SE@uhݚ!'Yr}uU}uO}uIuuBEH~HE,I*DJtx:t~&jPh! uWhP!~XZ1Dy h!~Y PtCXZGj,}XhT!i~Y4t8h`!O~XZ h A~Xj [}_PhiSD @PhiSD @jh !P  u ftePhp!}[^Vf"fP Phz!} ft Ph!~}ZYj |Xe[^_]U8EEEEEEEEEEEPhi8uC @u h!j襕 1UWU1RhiuqC @u h!jl 1}UVS]EPhg!SͰ uh7#h!hNh!_ uVhiSC @u h!j 1e[^]UVS ]uVhiSB @u h!jՔ EPh!S_ uh7#hx!hh!=_ E߉EVhiSB uEh!XE1e[^]UWVS$u]ӹ!1j EPhw#VuhT!h!j EShiVsB @u h0!j 1e[^_]UVS ]EPh?!S` uh7#h@!hh!]^ uVhiSA @uh!E؉EVhiSA @u h!j膓 1e[^]UVS0uj]Sh`!Ve@u h(!hN!S% Zu Sha!j Uf@fEލEPhiVA @u h!j 1e[^]UWVSSlj։Ph9e"@z1yZY9}Ojye[^_]j- yXUWVS Éι1}fUfuEEPhiSI@ uEhu!XE1e[^_]USP]EPh!S質 uh7#h`!hh!\ M]]USP]EPh!Sg uh7#hl!hh!E\ M]UVSjjj"  y h!\1ɺxBhPS+ y h!ZuufiuS, Xe[^]USP]EPhC!S uh7#h!hAh!j[ MI6@u h!j贐 1]USP]EPhP#S蘫 uh7#h!h4h! [ M @u h!jW 1]UWVSÍt1fDžfDžRhiS= y h!jɏ h' Džl4)ӍH(@!P g_9l}l' Džl h!h1l#h!h!hr!h!h,!llh!v(ppx(@!P!pP Y@H/t @H/EAH/tI@tc@tC@tP@ tS@@tB@yA@p@dp@`p@\pXp19~ 9}BXpfH@u uwk pfx p@tp u= tt= w-g [=wOft'k 11?1X%1=$v-- 1X-1Ëp P h@H/d`\XSPPllh!tp@"\p@!ǃ0\wt|r:D0Tw*2tN=@N/xOGPlSPh+!h1!sE=@N/8!u!WrdPh9e"sXZ+A!;ds ΃8 y!VRPhb sC+#ʀ=@N/GPGPGPhG!hP!TsG1d_19d&j>Ir^r=@N/eGPh:!RKStRTRPhZ!rRPhd!r F뗀=@N/GPhk!rY[Gd<G=Puthv!h9e"rXZ=@N/GG Ph{!TrGPh!ArG W f`ڍWֹ!d=t-XPQh :#qK X`4F fXdd!‰T;TtGT!Pt !Pt!Pt PQh :#ZqC 뱍T`Xd<B =PuFu:h!h9e"p^X=@N/?GPGPh!p #t#=@N/d!h!h9e"pY[=@N/GPh!|pXZ1D D D ҃dD `8 t!VRd`Q!h!pu_h!h9e"o^X=@N/2GG Ph{!oGPh!ow w W Cdӹ!`t-XuPQh :#foN Xϋ`4^ Ëd XDžd!;dtRdT!t !t!t PQh :#nd 릍D`kXxP Ph!nZYW=@N/e!#w]5!w#'!0!!qK! tnw @![U!!tX]!"G!'tDww!%t8|!w1m!*!)t !r!t!t!OWG)\ j lpp)hXh'e[^_]US]lPhiS3 uhh!k Xh%|u h!j葅 ^1]UVSuVZtÍEPhP"V uh7#h!hh!O uS2^Xu h!j= CPSr ZYu h!h!Ph,!u | uh!h!j Se1e[^]UWVSuh!V [_u_P^ XY@vh!S§Zu h%!j膄 SPh!V}@u h>!j< xtdPhiV<2 thU!뮉`W裯X`e[^_]UWVS}h!W [^u5_tP XS ZYuhb!FSPh!W@u hw!j苃 E]uEPhiW1 @u h!j舃 VX1e[^_]UWS(ÍUй 1Rh8i(SF1 @tUЃt 11e[_]UVSփ λ!E!u8 SuQRPh!_je[^]UWVSu1j-Vhxi PQ@uh! UЉUPܥXۋUu h!j蝂 U]Vhxi WrQ @uh!ڋE9E~E19u~~j hYWh9e"iFXZj hS貭jcUVSP]SZt"ƍEPu S @u Vh!j PbUh! 1UWVS\PhH!u= uh7#h$!h:h!:L dShiu/ tW\`tyƉރ߉\`! ftShiu// @؍e[^_]US]dPh|#S胟 uh7#h!hh!K d|lPhiS. @u hO!LX1]US]dPhV#S uh7#h!hh! K d|lPhiSI. @u h]!X1]UEEpPhiu. t hU!j 1Uhh!u ZYuhr!h|!hh!dJ Ph,!u , UVSSu] EPSVa @uh!j hh!VN ZYuhr!h!j Eu hS!j~ h4!V ZYuhr!hl!hh!cI Ph4!S- ؍e[^]ÍPЃ wÍPwWÍPw=UY]UWU1ERhiuD, @u h!j?~ 1}UWVS$ƉUЉh!P [ZtP Y1F]Shvi V+j S& Ph!u@ ƃ SG Ze[^_]UWVS,uEPh|!V uh7#h0!hph!H ]ԉًU 3@uvE̋UЋM}}ȅy#Ɖރ߉ủ}Ѓ!Mu! Mu ։uj S[ XZtSh!u o Sy ؃e[^_]UVSuVB[thy#V ZYuhr!hL!hh!7G P< ^fx PS)ZYu h!jx| PX1e[^]W|$wUWStGjj h8 QRj]S8 SH z8 t!E!PSh!gc h<  Xe[_]g_US ]EPh!SP uW.juS * uEh!h9e"+XZE1]UWVS uh!h!je{ jLh)N$^Z!u8 jmh)2$ZY!u8 VRSh!hpD*d5h)t WV6Xjmh)#ZY!u8 SSSSSRShf!hpD*d$WG j[UEU P]UEU P]UEU P]UEU P]UET)T)1]UE\)\)1]UEd)d)1]UEl)l)1]UE@t)t)1]UWS]Sh)"ZYt UBCЃ v؃߃Av T )1҃>vT )1e[_]UE1҃t`N/]áp)uUP;Ut@u]UWVS4EEE䀖5M/M/EPj YZ@u h!EU׉uȉ}̋MMāɚ;~EU6eĉ}ċ5M/EEtNމ׉uЉ}ԉ΁ɚ;~3EUʚ;#EEEEEEP Z@t E EԉE{h=!j3x u8Guwt{C t@P_Džt@tCt΃}tċUM;Mu-;Uu(9u}SYtjEPv XZ=M/u,];M|;UsS_tu jbXEPjD ZY@EU;Uu;Eu E9E~ ;U|;Evhf; j'w UWVSX]S^t&Pu S @uh!u S Y tuh`!h!jv P] Zt h=!DžDž Vp Y_tm@$1jpRcp  w P󤋅pupVhL"S芖 o@=M/X=M/`=M/h=M/p=BN/qS_P(^Ql Z@zhX!h!jXu jVWfDž@Whi Duhm!c\_XjS#jVWDžDžDžWhiC @חYh!jt Vt _Zz@@@tj ZYhD*pV XZ}1DžrPSMƃ uhX!h!e1RPh!hWkWVh!Z jVWWhi[B@u Wh! t Ph!ZY_jVWXWh~iB@tt Ph!gZXZj Y_@uhX!h! u =`)j:RPh!hW:t+BPhN!Y1XYj:h!hW:tBPh`!Y1Y_̅SW?XZ艅DžWhi@ @u h!"h!YR SXZ=@N/u0=N/u'jSP jV`Vd =N/-zk?VP@ @u!=N/t!Pjh#!M/oX th]! X thԞ cX th! AX tRPh!W h#!M/X th]! _ thԞ ^ th! Yj (V5X)Z"SV65p)jSVv =BN/tj UXSݪ Ҫ  j PUWVS,ÉUP^uh!@h!S ZYucU̹ Rh8i(S @u"J8t h!jn jh!u躇 uhL!h!jn EܣN/N/u Vh!jjn e[^_]UWVS ]U 6hA!S> [^uhK!h`!h.hX!8 ‹N/ށ؃E u %EERU NjUR WPJtKPEVRZYUu % ERGU Ӌ} ߋE N/X1e[^_]UVSP]U Rh!SZ ZYu HWP S VPÃt7EPS5N/ƣM/S謘1FuM!UN/(e[^]UVSP]U h!S ZYuhK!h@!hhX!n7 P~ Si VPÃt7EPS5N/eƣM/S1FuM!UN/e[^]UWVSS]U !h"S) ^_uhK!h4!hhX!6 NjN/ށ]P W SPTǃt/PVZYu!] أN/1e[^_]UhpD*h!?N XZUWVS]U ]EPh!S uh7#h$!hhX!6 N/%˃ uˁEU أN/1e[^_]UWVS]h"S ^_tPN/ M/M/!‰N/d$1󫉕tVh7iS @uCh!jj h!S ZYuh!Sp ^_uhA!S_ ZYye[^_]US] u5Ph9e"QE tPYt Ph !QXZEPYtPSh :#zQ+# ܋Et Ph!]QXZ]UWVS0]SE^uh!~SB[u1PYuh!h!ji ]̹ 1juSSh8i(Vr8@E1jPYXZu hjXi }Sh8i(V08 @uh!uPh"!PhH$uE9Et!hk"_PhH$uj)mOj cOXEEh.!'Pl!^1ҋEȅtYE%!pt>9u;utHMɋL u8 QPh :#O Uă랅u hb$O[j NYjmZ ta119]~M%9u>uVPh8!kO hN!^OhW!4~j lNC뮃 띉}e[^_]Ae[^_]UWSËtP1 X1e[_]UWVSÉMEEEE;E t_ExtMUj8蒊ZtaNjux4Uuup4x u}x xuPK(C(EE81 S$uS$S(PxXC$ue[^_]UWVSӉϋuu n  0s Xt4u t(V8 YVWP u3 Z1V A Xe[^_]UWVSu]Et,DžpVRpRtWjPu cApW[ Y_uDA %NPڋE ZtEC sF C1e[^_]UWVSW]Et=s$URPq<Ɖ׃ rw E8t @8"uJ@=9{|9sw 9{ |9ss @"WV芫 Y^uz@ 'K(PUE 8Z@tE}G _C G1e[^_]UWVSDž@}u@{E@u E@ u+PE 0 [^uOPE 0x ZY:LPhz0 E 0 1tLt1  t u XHh+#HP~O H,Y_u Dž,a$Dž0Extj/S薞 _Z0t @0`1DžTXDž\@PTP,S耽 ǃu8@xuPDž,0~>Tt8u0xPS, ZYHufDžtt0-Ttt%>dT7(j DP0 ,D (t8t1ҁ,v ="1҉(S[(Dž,Dž0 @tC S8X1ۉ؍e[^]UVSu j,j蔁ZYt@!pECC$C$C(uuuM @u SօX1ۉ؍e[^]UWVSPu]E1+Ei̋M ;}};t79rR5GM 4WSuVuEsG]1 t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVS]11;}tAKqust*u 3zu PE։EMQД EtG뺍e[^_]UExu@@t]1]UEP 1tRZ@US]C$u C$[Ps S: @uCuu P{Z@u1]US]C u C [$(KSs Ps @uڃC4uu P Z@u1]UVS]u jb{Zt$pSuCCC]e[^]e[^]UWVSh!u迴 h!u谴 tÅu'j`h!h!c 2 VF S> Y[@8Fth!^F1󫍝Nv󤍅tJvr󤀽uOU9 t h fLOt0@t@9|u"tt SPh)!SPh)/!K: %h(<"<:Y19};Ph@ &:GXZe[^_]UWVS ] uع1}t}u+EU EUܸMMمx9s-1LuÍKكt :M؍AMPPuZt fP׋Me[^_]UWVSQUU} uj[Uuh!RyZu h!jQ jPV u} ]e[^_] UWl$1E|Ru ul}UWVS0E u_u hp!h!j.^@uhp!h!jQ P [@u hp!h9!ݍF1jR"  sZYS z yljDžBPhiH @uhp!hH!':uh=AN/u DžC jjhVRPӓ u+t"0!u$VPh` +7  Xe[^_]UWVSu FPZu*8+u1hi$jyO \`%1juStt \vSh iR @uW*81tM*8/thR! Xpe[^_]UEU =BN/uRP*ZYE Eb!$6UVS] t4sVuZYtC P;UuPVZYft1e[^]UhpD*hq!0 XZUWVSSƉӉM1V_t@jh!P u*W,I*DPtSh:iVl @}u h!jM e[^_]UVS ]u1ɉf@uh!h!jM EPh!Sn t,juV8 E؀8t-EPh!Sk u('EfEVh9iS 1@u h!jDM Ѝe[^]UUE@t0EMfu Uu!tURPh!M4 UVS]u1ɉl@uh!h!jL EPh!S.k u''EfEVh9iS 1@u h!jvL Ѝe[^]U)]U]USE UUXt=EEEE1҃UjURPZ 뺋]UE Puj|n| US]S:|Ph!jh SN/PN/~ UuUE Puj#|| Ã=N/tRUEE EjjEPEPjEPuEh%!3XEEUWVSd]~SE=N/tCw;Et7EE jEPjjjS;@uuVh! EEEEEEuV}WjrY SWjiY 'ǃjh!6[^u!!EEEEjEPj EtEjh!h0!ev EPhc"H hc"h.!j{ ju9hR!Yjjj jVjX jSjX  )jEPjM u$8t=h!Z9u)Eƒu%=th!jW =)t=)tjVjW jSjW )zEǃ„3=( u(EEEEEP XPh!jVjW jSjxW $ e[^_]UVS]E pt(I>v #![^]USRPh!hpD*1hpD*h!* Sh!hpD*1 j(USQjj]Sjjh)Btha ujN/Zu hjG jjSPjh)u‹EN/]UE E ]\UVSQMAY9uTH%  9t!$  9t!t!11Y[^]UWVSQMAq9ul8@E % E ME1҉9t!. ] 9Mt! t!11Y[Y[^_]UWVSQMAq9uI8@EU0 ЉEE1҉9t!M09Mt! t!11Y[Y[^_]UWVSQMAq9uD8@EU ЉEE1҉9t!M9Mt! t!11Y[Y[^_]UWVSQMAq9uG8@E% ‰UE1҉9t!M9Mt! t!11Y[Y[^_]UWVSQMAq9uG8@E% ‰UE1҉9t!M9Mt! t!11Y[Y[^_]UWVSQMAq9uG8@E% ‰UE1҉9t!M9Mt! t!11Y[Y[^_]UWVSQ MAquK8@E% ‰UE1҉9t!M9M!up8}x@EUE ‰% ‰UE1҉9Mt!9t!M9Mt! t!11҃ Y[^_]Uh jjh )u%1҅tPUWVS jEP% E]^XEU9U}3WPZYt WPZYôtE1e[^_]UVSQƋtRShh"EPSnERiZe[^]UWVSW1:nuzouP;E^1h+#P ZYt58nuxouSP+rZYuSPrZYu1urme[^_]U PPPhn"hpD*+j"UWVSj Ph"(311tc`"tNd"t =O/t2h"Pk"t QRh :#w( !փ 덍N!E!u8 xk"t VRQh"0(tKpk"t Rh"(Y= t 0h9e" h 'XZ=O/t){tKppk"t WQRh"'=O/k"t Rh9e"'sds`sTsPh&"i'slshs\sXhB"S'0=O/~chSjjh%jeu.t%j S^_tSha"& h$ Y_!utY Rh9e"&XZe[^_]UWVSlj u U] YXhVS t"ShK0h XZu Ete[^]h e[^]U航h"h*"hG"h~"h"Ph"hpD* jUWVSuEE@t"O/ 1VFe[^_]PϨ_u h1 j- VP ZYuj]e[^_]8YUWVS]EE1)h"u u 2F$` "=(P/t h"j - $P/밃=$P/u(P/cj EP55ڵ U:uy 55h"^C8K X ,P/LK@c4j EP55z U:u55h1"jf, C@K@Kj EP55- U:u 55hH"뱉C(KK@KEPuh`"55蒬ƃu huj+ Et ,P/tctKtK@ t=(P/b$P/ s=$P/E(P/c@tKt  )sc sKsC  sC shg"V肪 P/XZEth6 1Ƀ 1Ƀ 1ɅtuRhj uԋ} t1M8"t M t;Uu;Et Suh;}>|;us7=hQ/tuuWVSuhH uuWVSuhA;}|C;uv<=hQ/tuuWVSuhG uuWVSuhj e[^_]UVS =DQ/tPh\"hpD* h"Ph"hpD*z hpD*h|, XZ=DQ/"ttsh\!hpD*9 j1 =hQ/u UP UWV=,)uHH׉=dQ/t&ɉ HffJ=,)u f@ffB^_]UWVSSƃ=DQ/t/=PQ/t 1}~Q@Q/`Q/Pu腌 aס@Q/Ƌ@Q/׍%@Q/RPQMu5U/1 M9t 0<PWVh%" j"" e[^_]USt;uKJt u- :ɃPh&"hpD* ]ÅtUWRPtY_}Ã=PQ/UWVSˉƉס@Q/=DQ/tQu`Q/PT IRPSu5U/ͪ 9t 0;PWVh&" j$ e[^_]Ã=PQ/)UWVS Å =(Q/uU/BB4U/(Q/5@Q/ ; \Q/| ;XQ/ؙ=U/;|3;r)9(Q/_1Ɖؙ5U/rؙQ oZ"JtTz!9t !9t ҋDŽؙ=@Q/Q BXe[^_]W|$wUWVS4EU܉M U/A Id t15U/X=dQ/tU/5U/PP U/xU thE&"腢 XU/H xU t@\M܋]ȋM܃=dQ/tU/5U/PPQ U/A Id t15U/U/U/JH,șX;Uw$r;Mwuuh\&" * U/MQRPuu{ u}uĉ}ȉEЉŰMeЉEԉUM؁\Tt.CЉ#EЋM!SʉEU؋CxRPuu K` t1Ɖ׋CEU؋Kd t1EԉU؋K05U/U/_\TU/@xRPuuL Ã=dQ/tKSuaY^1}|(}܉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu-%ClRPuuĔ Ã=dQ/t]SuXZ1EtttpoY_DpTtF u1EnY_Fu @ߋu-%CPU/H05U/EԋUXe[^_]g_W|$wUWVSTEŰ U/A Id t15U/Y=dQ/tU/5U/PP U/xU t hE&" xEEU/B9]U/X`u؋}܈ tu}EzU uz`׃tGuk@tuLM<7  47!Ή8ɅtzU U/@`U/$~%U/Bl5U/FU/=,)~({8U/9tR`zKdVT~U uVT~U t PFXƋP1~@KdЙЙ™f3U/P8B#tp)Ë U/D4)‰U/9~6{U t[`щU/@$붡U/H` U/U/BY89zU tR`A`U/$~%U/Cl5U/FU/=,)KdVT~U uVT~U t PFXƋP1~@KdЙЙǙf{89|JU/5U/$NhFlx1Dž+D4U/;C}{U t[`щU/@$빅t3@҃uG;^p|tʋ$9~1뱅t$9~U/PU/;U/ud=dQ/tU/w4PP U/@U/U/Z4Jd15U/U/U/U/H41ZU/Z0 } U/؋5U/=dQ/t5U/U/P5U/E U/X05U/ދ~xx U/\t4TuX%FlF%CPO붡U/U/𙋝ڋÉƉ߁TtA#A׋A׋Id t1=U/X\Tt=LQ/Ss8U/+{0ƉK`Cx69~+9~U/ %Cl뀡U/U/9r U/A0y8p𙋝ڋÉƉ߁\TtA#A׋A׋׋Id t1pX~==PQ/j.Ҽ X܋ U/𙋅‹ËƉ߁\TtA#A׋A׋Id t18 tH$WVRh*" ;|]=LQ/B U/A,t)=PQ/t h` Ǽ X>xj ̻ XDžd~j 蘻 X=PQ/tjvdhl_u=DQ/th*"v5U/04=,)0FF4+=_w h*"j3 X=U/U/`1=dQ/tR5U/觽[^U/U/x\5@Q/WVZg SY=dQ/tU/U/r4PP豼 U/X4HdLH t15U/U/Z9U/vE=dQ/tU/r4PPU U/@U/U/Z4Jd15U/\X5U/5U/ U/@4P5U/ eY[^_]aÃUWVS}]tW YuWh`j `DžPhd@u  u\t|VhedAu Nǃ u菭8tuhwW XZ"F<CF(CF,C F0CF4CV8SCF@C FBC$FDC(h #. ߋSh5CPh C PhCPhCPh$tP _}+uhzd@u ! @VhedAu  @uuhj 41}󫍅PuiZY@ % Љ<9y9t8Mǁǁ+EǀǀSMEƀ* D>P{_j PEP辡1e[^_]UWVS,}jhPjWttGjPjVWVNk u$U ʋMQ؍e[^_]UVS]u VS ZYu Sh6U YXhVS訞 t"ShK XZu Ete[^] e[^]ÅtUWRPe7Y_}UWVSu}WVuu\ )jj`WV] 1] 9}0k`UJlRhTPLT1EUM MAhQlF̍e[^_]UWVSP]UpEM1}%JXF^ECS}tffsCCCC : 1҃}t1 :C(S,C8CP<j PEP~1e[^_]UWVS,}jhPjWQQtGjPjVWVH u$U ʋMQ؍e[^_]W|$wUWVSX t$@+BB"E}+ ZM]m[^_]g_Ud1;d1}ia0-@=B'a0$c0]Ua(Ph5"hpD* j UWVS0ÉU̍}pHEߊC Es { fSUĊCE݊CEfCfE҃MȉE؍CEhq6"D WVEPMQEPh6" Uĉ%Pf Rh6"ے (EPEPEPh6"迒 u; Ph6"謒 u( Ph)!薒 Y^sEE)~E9sFFPh@ k XZ֍e[^_]UWVSƊ@NJ^\d1tTu/\d1BJPRPh6"_u+\d1toBJPRPh7"/uI:uDfB\d1t#ffRfPRh17"蛑 fPhF7"脑 XZe[^_]UWVSSEӉ΍Q1f~WS< ZYt(}t{]d1ujjWA tu SNS Zu55݁ PShW7"jz xtuhp7"je PV}tu 0u{ e[^_]Ujhc1jB @u h7"jE UVS]d1t!3 Ph9e"hh`0 4jjPq ƃ t3 P6h7"hh`0 `0e[^]UQHPʉP@‰ȉE7"tERPh8e" XZUVS11c0C9uɁc0t‰Љ[^]Ë D*Q D*y ;0D*| tD*J D*UhD*P虔 ZYUWVS(a0~+a0<).a0Ha0$t")a0<)\a0xt'=a0t =a0<)hD*PYhpD*FYa0,b0xXZe[^_]W|$wUWSøthb1h7"[ XZ5xb0h7"I 5pb0h7"9 hd1t Ph8"" _Xxb0t?pb09} h8" [()8MMEuQQ$h48"ۍ j pb0Z;\d1)hd1EEHb0ۃv-@b0]PP$iB"RR$SPb0QQ$SEWW$S H)PP$ShG8" <\d1a0a0]a0b0EzuB"ٞzuB"=pb0\$=xb0$h8"苌 e[_]g_U1]UjjWXZ1=pb0P踅 U=@)u =pb0ujh/ uGWxb0ZY9b0~b0\d1a0 a0xnW|$wUWS‰a0a0b0 B"ٞw(B"r<)y1[_]g_,[_]g_W|$wUWVSc0xb0ff"c0 b0=0b09=$b0u ;,b0c0tb0f c0fc0+fc0Ej]Sjj5Hd1 yh8"[jhd1jjhc05Hd1< y\d1t h8"( ^EjSjj5Hd1 y h8"j h b0j Y[c0tb0f c0\d1 s$ ,b0ɡ4b0ȉ $c0(c0s,b0$c0d1}Xfc0fc0b0fXjh(d1jSP5Ld1; ƃ9t:Yy h9"' ZVShb1h9" hpD*TX@)xb0ؙ%ك d1Cxb0b0,b0b0 b0 b0ua0,b0,b0,b0b0v.}fE fEm]mEb0 b00B"5Xb0=\b0`b0 ]u}fE fEm]muދ5b0މ5b0b0 b01Ӄɚ;~ ʚ; b0 b05b0,b0b00B"؉b0 b0b0 b0 b0ى b0ɚ;~b0 b0ʚ; b0hb0rW Xb0\b0 b0 b0 b0 b0`b0b0b0=ɚ;~ b0 b0-ʚ;b0\d1t \d1tDe[^_]g_UWVSSljU΋\d1t ukGP9}[D ;tb0uN b0$b0u6}t0\d1u';EPVh/9"z ]؍e[^_]W|$wUWVSƉU܉MGEG]\d1MUQRVhB9" t h`9" Xuhf9" \d1Y^t,%E B"RR$Phn9" ]d1t"uGpD*e[^_]g_U e[^_]g_US8 =l1t%3SPhB"hpD*ć j~ UVSÉ֊@<t<t,<uPs PVhII" S  PVhWI" BhPSj% PVheI" S\PCPVhtI"̈́ hD*WOXe[^]Ãt¸I"7tI"uøI"UR|ZUWVSljPP áp1ZtEtPhI"E p1|;]~ WhI"j譜 tt+q 1>ft )كȉBHEf1}~P׋MكtuD21;]e[^_]UVS p11ۅw =w"=w'=w?=w W=w F=v=w=w "tft ؃ۀKȉBˉXfPrz9t)ˆ@[^] D*yUhD*j ZYáD*PD* USљRPQhS<hD*S} ]UWVSD5ÉhI"3 E"j_E1s1\Ѕtu }uCEtHHDB u1ۋtЅ}t1}uI1}ʍ}j.hl1EPj 91}ʍ}u VPh9e"j.hl1 hl1h 9#4 ZY5p1VPh 9# C :OhD*KXe[^_]Ã=p1UWVS @<tPhI"ɀ Y[CG"tRh PhJ"蠀 ^_Ph%J"萀 XZCH<$C"h8 C Ph.J"d CF" SbsshBJ"6 C!E"<t`E"<t|G"CS C "CPhaJ" CZYPfwi$D"hsJ"hpJ" XXh}J"hJ"hJ"h _3hJ" ^!hJ" Y PhP"t XZ1ɍQ9vhJ"1 EԍsfCfgfhvjfv5EPEPEPEPEPEPhJ" EPEPEPEPEPEPEPEPEPEPEPEPEPEPhJ"~ E@E< u_UĹ1jEPURϊ `t1a$h$S!(ZYt p1EPEuE耉E 1}E@11UZЀ wz&ZwzZwz uEw$ D"@ @11@ 9Ew+E}"u}j/uL9Y[ÅtT}uN=Hs1u1u% Zt1ȋ}wUCu ^u/EpVu" Y[t)}u =Hs1uEXS Zuz$uH XuuχYt!X t1}uJEHU48u3 EZBEċP}Wp @0V e[^_]US`)tuP &ZYtC]UPu*fxu#@PhP"hho1t o1 Htu DP5 P ZU}uE ҃' hP"h5N"RRhO#PPhP"u UEt$ P" t P"tP"P"Rh PhP"wu XZUVS$ H"E׉Íu 9stMtJ@ShP"6u XZe[^]UVS:!}tJE t1@jjEP à tj.06Y^ƅthn1@Pm$YZuUuRJ ZhPho1^o1e[^]UUE Pjjhho1PR thh#ho16 o1UVSE UZ1t@ȅt1 @!)ˉ t Eu7t3jSلZYt%t:!hPho1-^ VRhP"hho1qr mVPRhP"hho1Hr DσVQPRhP"hho1#r VSQPRhP"hho1r o1e[^]UWVS$uU )~Džy1B11119 @ttbFztHwtKwuPKt9uD5t w u3$t u$' C BFu iƄ\t @Ƅu7u.u%uuh:!ho1 [^uthP"A YEtPjjhVPP5 t h#V詺 XZSVh#hho1Bp o1e[^_]UWVSEpm1Q1Ҹm1 ɊH" H"HHA.)ׅ~Bxm1s@m1[^_]UWVSu=*tN*hhn1Y[u(j.hn1t2_Zth@Phn1[ n1uhh:!ho1Z F<tS<t<uTu vI:Uڹ1ˍ}fEu jEPI [^u EPZY1(VPFPhQ"hho1n o1e[^_]US]C<t<t <u]]؋]bSBPCPhQ"hho1Zn o1]UWVS$uU ]E~u)UЉEԍ}عjuVe _XEԅUtuu SV2Y^ SRV> }yPh9e"'o XZ,tPuh !o Puuh:n e[^_]UWVSXEEE EEEEEEE"EEEEEjjuVjj]SyhK"Et0utA@Xۃ1|tt\)19t A뚈@땀]\tUruZuztrur ,I*Dqt>0ut=B@XӃ1|t)\t)19t  B @UUBE8tYU@:tB8@UJLEM,2]t%E(51h["`P XZe[^_]USEU t~MH$ *1tRQh :#PVW 7!Ph!P 1XZ5t$h`1h\"51W 1 B]]UVSEu9(15<1U ,1u <1 *:tRZ9tRu= 1th 1RhZ"p RhZ"pZYu(15<1 Ph6\"jgl e[^]U}u1]øR\"]U}u軠1]ø#]U}u薠1]øY\"]U}tq1"h`1h_\"51U 1 U}t31"h1h\"51rU 1 U}t1"h1h\"514U 1 UWVS1}uEE PPEu萟WHt}6h\"E PEP th\"E PEP~ t}E p_u1E Ptڋ\"8at\"=1u\"1t1=11Ƀ=1PV1ɍM Z^9Yu19ARPSWօS蹕e[^_]UWVS0 Eu腞1Huh\"E PEP t1hV j褫Y[jht1 ^_u=1E E ;u$1jju 4à u=1tӃ=1tԉڋCt5151 1ڍ_Z9u 1Ƀ=1\"=1t\"QPSR蕄E =1b=1U111ҋt11'=1t=D1=1u$C9]jM[^1E OtˋE 51511ɍZYU 9u1҃=1‰ֺ\"=1t\"VPQR虃=1a=1T5111ҋE t151# 14RjhE 4z= u uE 40h\" ^_=1=1E 51511ɋ{ZY9u1҃=1‰׺\"=1t\"WPQRc=1u5=1t,=111ҋE t1=1'P= Xe[^_]UWVS1}uEE PPEu裚dHt}6h\"E PEP uh\"E PEP t}E HpptZu11dt&1҃=11=11Ƀ=1111RPt^X}5@1u51h]"G Y[xPSXZ}uOy2n@8tSht! [^0141O01416u2jE pYYutc9 |9rJU p9Ju19ZWPupShG]"荈01411tڏXe[^_]U41 01b` tL]"Pju uU41 01 tL]"Pju uUVSEuK1IHuhO]"E PEPO t10141Džxh\]"E 0mZYu*=@1u51h]"E ^XDžxhV j tXZjht1 Y[U t+;u(1j51u 谸à uN=1tσ=1th 1SwY^uShc]"51L 멉ڋE t5151 1ڍXZxt9|PVZYu0141 Vht! YX9u 1҃=1¸  41 01tL]"jRPSVhG]"0141=1=1111ҋE t11tj_XZ1e[^]UWVS] }tҕ1hZ s~K ZYu"sh]"51J 1 yj h_]"W2; L]"41 01u! tSWjSjljhRVuyV&Xe[^_]U帙 }t]U}u1'h]"h]"h]"51"J 1UWVSE]uu1҅‰uVruEE xhWZYutL0h WZYu u(? tθ PVh]"51I e[^_]Uh]"h1u uG1U}u1=<1t1E E]"]A ]Uh ^"h1u u1UVSEu u1=11td1^hSZYtRh S؎ZYu 1?S[%vh^"51fH 1 11=1u Ph=^"51!H =1t51hS^"51G 51hwe"@ 1ZYt T11e[^]Uhi^"h<1u u1Uhv^"h(1u u~1Uh^"hT1u u\1=T1t 1Uh^"h1u u'1UVSE] t~跑11=11yu=shVYZu 1Th V^Zu17s@1Yhshs1g.1s11 11t't8u51h^"? 1XZ4@18u  tSPRh^"51F 11e[^]Uh_"hD1u u1Uh _"h1u u1UVSEu t~?1uj^hS迋YZu ,1[h S袋YZu ,1>S踺Zy.vh)_"510E 1 b1=,1,1,11t1 1 RPhC_"51D 1=,11e[^]UEuD1Huh]_"E PEPH tЋE ph_"^YZu9=1uM=<1t51hn_"= XZE ph_"b^ZYu1@11USUE 1u 1Pt ]upXtgSn Y@u Sh_" B趵= 1t$h 1h_"51C 1 51h_"1< XZ]]]UEt~1=Huh\"E PEP tӋE ph_"E]ZYu 1USPEu芍1 HuhO]"E PEP莾 t1hV j詚EXZjht1 Y[U tE ;u!1jju Pà uu=1tڋktSh_"s\Y[u 1=1u=1t111ҋE t11tujޙXZ1]UEu^1}Ht}6h_"E PEP] uh`"E PEPB t}E ph `"[ZYu!E ph`"}[ZYu 1UWVS }u E|t+VBXu 1(\`"tjjh uVSzt&}e[^_]\&`"e[^_]UWVSEu H~}6hO]"E PEP th\"E PEP tUE DMMEhmA!P1^_t9E8|t1EP?[Eu13U\`"thr`"E 0[^E1hV j褖E_Xjht1 ZYuhE EH9=1b` u E 4M}`"t̝!jjRVQPkx=1t C=1u?=1t5111ҋE 1tB151ujʕZY1E;Et EP^Xe[^_]UWVS}u,1<jjt[XZSCYujjEhE!à uc"j/S ^ZڅtPhRV$ =,1t651S5 1HQPYYy Pj ? XZ J O~j581h VS8  jVS* Shv`"a 1j3 ~P _9uVjgZYCuh`"& 1X 1e[^_]UWVSPEEu†1)Hh`"E PEPƷ EwɋE ph`"V_X}h`"E4 ^u ]E XSh`"U1։IXYu^}h`"3 Xu ]E X Sh`"U1։I^_tF51h`"3 Y[Au}u'E X Sh`"FU1։IXZ1e[^_]U1}ti=1t =@1u߬1=@1uE E`"X3 h@1ha"P: 1 U1}t= 1uZ1= 1uE E_"2 h 1h1a"P : 1 UEu蝄1{HuhFa"E PEP褵 tӋE pha"SYZu9=1u<=<1t51hUa"]2 XZE pha"SZYu 1UEu1{HuhFa"E PEP tӋE pha"_SYZu9=1u<=<1t51ha"1 XZE pha"!SZYu 1UWVSu huS  9}1hE4SF 9~hhH$S GSh9e"RY[Hu jLZ1e[^_]UEu܂1/Huha"E PEP tu uh8 - UEu萂1/Huha"E PEP藳 tu uha" UEuD1[Ht}6h% E PEPC uh\"E PEP( t}E ppha"wQ USEuˁ18<1<1Hu ha"9QYE ph b"&QXZ<1]USEPvn18<1<1Hu hb"PYE ph"b"PXZ<1]USEu18<1<1Hu h/b"PYE ph4b"pPXZ<1]UE} tu跀1=1thhze"WDmZYt.h4~#W3mZYthe"W"mY[t밻v6Zt1u6he"R& t1tL15L151he"Ry& 1e[^_]UWVSSU} uRUwZUuUE e"1Ee[^_]%& Ë@tPgCYWvCZ=<1ttP3he"51% e[^_]USEU 1t tt<]Np*t8Cu8 PRj he"51% jrr 1]UVSu 1}t e[^]ovvZuvhe"51% 1@tPfCX3hf"51$ 1 e[^]US}uko1B=41u1E Ef"]b <1<1hDf"><1X]USEU Hvo1V=<1u1E EIf"] <1<1Hu hvf"N>Yrh{f">>XZ<1]USMU Avn1_=41u1E Ef"]z <1<1BuPhf"=XZrPhf"= <1]USZKJy ;J| t Y RP& ZY]UWVS Eu} tm1 Hhd"E PEPŞ tЋ5$1} 19~j k1PwX t*Cu%whg"51" 1 hh1Pf  DžDžk1X 9X0,I*DP@tC1<$t<\CFC=,I*KDOt\1KSDOtk DЋڋUJ9x1)PE 4V E <1NiuRCDž9E~?1)PE 4V> E <1҉эt F;Cp10m_u 51hJb"u!51h_b" 1Y^x t=1u 51hb"΃=<1t"51h1p 1 )XZj 6Wc18P5@1V =1t~t1hPh1o@1E1E 9XCt9Ee[^_]USËt PaYCtPuaCZCtP`aCX]USd1jMwX=1t>ٱ Phg"jd]S ~!1fJftPSR jh1 USdjvX=1t>w Phh"jd]SM ~!1fJftPSR' jh1( UWVSƉӋ:j:WYZuWh2h"Vv :WP)YZtj%WYZtWh;h"V@W#`C uf{P Huf{tCPhm"V hb!VXZe[^_]UWVSQƃ1ӍCE> <wsCuRSja u7] € t w <wsC1e[^_]UWVSË@tP@_CZSt1։ICtP_CXe[^_]USZKJy ;J| t Y RP ZY]Å8UWVS%uPtw=,I*UfTWfUt`PtYftwftJ0Euf]fۃW})0ufۃW)ڈ@AiXZ[^_]UWVSSÉ׉΋1u<RsEPhWSjs>x"~>D <w3s.CDދE8 u@EuhFh"k XZ1e[^_]UWVSUu u h_h"j1 ljjhh"P_ uWC fCPjhh"W^ uWC fCjhh"W^ u WC _t36蘛v莛Cv胛CF C FfC (Wuhh"j EA :j/RU^ZEUu R8)ЉUHQM褚ƋMQURPd{ uEuCXj@VZYta{ u X1Mq@P賚j:Epj t@P蓚MAYE@E@t>[urVj]RU%YZEtH:UttWuVhh")PERVMV>u WuVhh"fEPx:t1j:VYZtP>t3tJj EPRU U:tM9u HvWuRhh"i =fC,C tth1u 18 t R`CZ{u { u P@CX1e[^_]UWVSHDžDžDžDžfDžDžDžDžjhh"P[ jPFl"mY[@tt8tt;uWhi"g `8 j;Ph ^Zƅh i"P ^Y[tCh(i"V][Zt>h0i"V]ZYuh8i"yg [4WVhei"Dž DžzDžWŗj@P} t'X1@P萗Yj:B_ZDžt@Pb^uFDž;31ۅtK>tBj/Vg Y[9u"uFjh Sf tC11ۃu tE=D1Džt^1uNt;thi"S_ZDžt >thi"VZYX1=1tjjYXX1 hPRDž tDž 1 1RPǙ 11YZuu6 /HuE脕 tȋPhi"d 'tuRjWRjrXZujhDX"hi"j* 1҃u'j/SZY…tB.t ;hh$QDž1Pj#=1u/;(=1hpD*hi"e ^_Ӆ1ۃ)> t3hSS=hh ShVS$hh_]"SDž tN511=H1t hh\]" hhQg"S Wj51H,1uj/Vc Y[tPDž=H1t WjZWj~XZ1-1҃c‰_Ѝe[^_]UWVS,tDžxDž4Dž0Dž8Dž<DžhDžlDžpDž@DžXDž`Dž\DžTDžDDžLDžHDžDžDžDžfDžDžDžDžDžfDžEDžDžDžDžDždjh1 [^|u PFl",ZY@S[ߐ^͐_fu-t#8thk"PbVZYt ,hk"0t8u+Ku =,1u,h7k"_ P;_dd,1tXtj:VA] ZYDžu1҉I9s5j |PGP t|9u;tQV)P^O Dž^tSuM^DDuu,HYD?41 01ttPhk"t[tj%SxZYt Sh l"VDžDžDžDžfDžjP@l" [_@u/t%8t tD;t.h SͷZYtVhJl"xZ ^_KS1LDž[,؊YlDž 1ۃux4118Dž<PRV z t7 uA0JPPdv ZPV hcl"Y DtVO$ j TShWvvfc u =<1u'1hh W j h S Ћxu3v jv茚 à yUTPPhl"赤 m1T~uRRh|l" RRhl"P 땸=<1u 1~PvvSyS=_vtP&u ^@@yhl" hj*`ZY81u<P_@$L]"P[^llxP_Xj_X1u<P_Y=<1uDluv,hl"51 Ӌ<1t+Phk"hl"51_ hm"V bhm"V =<1t!Whm"51 CQhm"脌 t2=<1tWhm"51 CVhm"N u>lhb!P6^_lPZ@u8hm" $ ]=<1t51h_! Y[j\tl$TRLRHRRRR, dtX9,1XhmA!P谱_Zu DžpD*cX8|uXjj f\ZY4Xh @P [^ppuX@Phv`" ^_Džh8p 0141ut 9|<9v6uIuD51=1ut.9*|9w$=<1151hn"O Y[ tU!FtNut =1519u9tXP,hn"Xhb`  Xh P _ZppuXPh0!Džhhn~jZZYvM/-,}WVt# 1t*341 01hp"t 8uhp"E Xt1Pt1~hp"D X<11uGthp"51 u E 0EM_Xthq"51 U }ethq"HD [^ h2q"5D Yt 5Zt5Xue[^_]USEEjh`1 ZYt-=1uEE@Ejj膽Y[hjKY[hޑj KXZEE;EEj:M 4蟲[Zt{t1=X1u X1EU 1E,1t'hmA!SDZYt;|tS4,1YE~E@EE@EX=1uE]ËE@tjj螼XZUWVS$u j hcg"]S]EEEur‰E1ъL :/}~8}ىR3SNrESuPSh u負 ~j hdg"S]Uj/RUB Ãu?j:URB _ZDžUuRhi"A [^XS6rEG/ @P$rEYCEPjXZyV1ۃuFEEPjS1-ZY1ۃc)EEPjWC1-Y_cw u1u2EZtP2X؍e[^_]US1jH1@1`X]U1jHX=1t%1fPftjhtY P x111jh@1ϩ USd1j&HjdhPq"]S,1fJfuPSRvuZjh1r USZKJy ;J|< t Y RP ZY]USd1jG111Zr]tsuAjdhq"jdh|q"Sj jdhq"S 1fJ ft Phq"jk PSR蕞jh1虨 UWVSLEUMEEE̋EȋỦEԉU؋E1҉EUĉEU} t E EE} t jEPk XZTu}EEU9|9vPuu*à y 8t8# 1$1)׋EESuu螝EЃ y8t8#+]ЋMMÃ}REԋU؋ 19$1~ ʸ#EԋUEỦEԉU|9 1sQX| } jEP9 EU+EUM[^+My @B| @B)P^ Z8}tO 1$1|?v89U|9Ev1#1 51@X8Ct 1}e[^_]UWVSƉ1tfPft‰EfEtfSft‰DGfDiQPEPl ~1tfEt fT҃ Ѝe[^_]US1jDX=1t%1fPftjhtY P[ 1@1=u1t jh@1H c]USSjCX=1t%1fPftjhtY P |1@|1=u1t jh@1ۤ ]UWVS 1|1h:jOCh$;j=CDž@11DžDžDž1DžDž1u<PB1XSPYy Pm X J 1Hy P9 [ J=|=~ =~*x1Hy P Y JPh#1Hy P Z JPhhhS!5H1 5H1"5|11jAX}t91@ t.jAjA111jMT_=<1t51u Ѓ4tX"hq"51J 51k1j%AjA: ts <1#ƒ5tW~N=41uj=D1t/t uu51hu!51 1u,I*DXtk1 DУ1u1n=c~u,I*DXu Uu< t')t"?1s7@&du1(N枃d-u"ut 1uE9G=<1u.5u%=41u1 E51脯X uGuhPh1 =1u1t R[t'1;tu1t 1j>j>j>=1t ujVQY1:!ȅ!Ѓ„tt jZ|1$;!ȅ!Ѓ„tt jX0e[^_]UVSu=H1uhq"5 1[11h:j=ÍE PV5H1< 5H1hb!( 5H1腭1 h, Džh؟11󫍅hPR5P1> @ht"w ^,<t=1C=1=11<B\t؟1<u Džj j WhStPtP4 5<1=,1u <1WS\hmt"É5<1~&t =1uh1h\!51O =1u M1ٟ1<2<fڟ1RPj1P1P1P1P1P1P1P1P1P1P1P1P1P1P1P1Pjjht"ÃX1gt (1<DžXjXPjj5P1) *15P1͊P1Se[^_]UWVSD}P1=1tWPAjjPƃ APj5P1 @&P1EfEjEP M]ġ1ZZ<ډEUjEP͈ E+E̋MZ[+My @Biȹy1PjEPX q8tht" 1EEPEP5P1赉à ty5P1耉P1VjS@t?}uEjEPjjS>( W5P1 Y[Cuht"I' X5P1!P1Z18\hu"s ˍe[^_]UWVS]1h5j /EZYt#=11 y11!=1^11 y1111thPBUPm UBC1 1󥿼1 󥍺 1 11<<1H1@@H11DD1(1HH(11LL11PP11TT11XX11\\1jh1`UP5j`Ph1"jh 1U썂qP $jqPh 11U쉂1hh1PǼhPh1豼$hh1UˆR蕼hÈSh1uj,1 t1EEe[^_]e[^_]UWVSQ]j/SM% ^_Ƹww#t 9tjP XZt/y Sh9u"o khSh u1!u1ƀ u1. d1+C9t=BUjh u1 XZUx&0t(uNu51hKu"s Y[10 u1C<.u1C@Cōe[^_]UWVS]H1u*hru"A# X=x1t 1j>fDžƅfPftjjVPd t hu"n Xhhu"5H1 5H1  ڡ1ǃ(t hu"n X=x1t 1jm=Xt(t#fSfthVP jYu=1(ujZjXe[^_]US EEhG]"u?[Zt EG]"\"=1t\"E1u=1t=1ۃ9(1u%hwr"Yt!51hu"k cjSzXZjcX=1u)51hu"9 [Xj@X19(1uh@1hv"|ZYt}jS>z[Xjh@1( ZY'h(6j)Y[E0141 uuuh" Hu.RPh v" tԋEPj(XZjXuj茘 $sXE@E0141 u{Eu Ph" Hu|u1j$*$E$j=([XjXu1uu hv"51 RPh v"6 mjh1 ZYh6j'XZu1hG]"u|Y[1tt =1tSjtjb[Et1=1PFY=1ug&Eu Ph" Hu-jZ뼋Eu8Eu Ph"_ Ht!jX=1j=1u1=1PX=1t6 jPXع 1ҡ1~j8$,X=1u06u=x1t1 h,v"Hj XjB9Xj:Yj2[=x1t 1EPj?&XZ]UWVS1pt1 Dž` 1$111T1L=<1t}u=1tTuu up E 8-u}tuh v"51 u hIv"51l ʡ19(1u<DždDžhDžlDžT jh1* Y[u#jP vXZ븃=1jXhn~j$XZh$7j$Y[hhmA!u y^_uDž\C*T1 E 8|uijj $ZYlE XhZ S˙ ^_\\uShv`"4h _X1T1Džd8hZ u [^\\u u h0!Džd\fzt \@xRPFZYxE%=tu hTv"51 NEЋUԣ110jh1茄 ^_b501=41 h\"u}xZYth\"ujxZY(1t |Gv=\jWVP8B $\fzt \@jWVP4yu hk"f _XK541501h v" )DžTL]"}tEuuh" H1T^``uDuh9e"ZY뽡1hkv"hhX"h*h{v" ;T1v&P1tP X1T1P J_P1jF"^l@ujj !ZYl=1t=T1t =1y 11ۡ(17+51T1P P1`fxt `P\ft \@SVP uu h d _X舺8  1$1\P蚦 XY@X `X 1$1\J멋pt9$1~D1#Y51蘐^pt1ptu |9 1s`@ @tu@d`  1$19\H Xpt9$1|(~1 \@ @t+9 1sڋ1#u h \c XZ`@ @tbhv"?c _`j^dtd\R[Dž\`P解 Dž`$YthPj XZDžh=1P1xPxXP1`t`P7 XDž`j6X1=$1| = 1vjpXh@u l@u"hPjh_X㋅lPj V[^P1xP xYP1du `u)\tꋅd\RZ؋`Pp XLT10141 1$1e[^_]UWVSDž0Dž41PT1" 1$1DžL11T1,1(hG]"uSrY[DDu =1uVu=<1t}t}u&E 8-u}tuh v"51 뺋E PhIv"51 ɋDtE uPu` Dž8Dž<Dž@1=1uDHjh1P} _Zt=1tzj^hn~j'XZh$7jY[<}tWE jP Y[E j/P _ZV8tNL8 tDE Ph9u"_ [^1I E hmA!Pp^_E 8|utU 9t ww#tE jP Y^t/x=1u,8 u"E hPx_ZyE Phv"\=1t*茴8 u =1tE PYE 0D(1uJuTjjkXZ19u&ju1^_111u*jPkY[=ujh1u{ XZDu}u-k0141 tRPh v"m ͋E8t8Puh"I HhZ _44uuh9e"Y[ȃ}E hmA!Pn_Zu#Dž0D*T11E 8|u^jj _Z@E h @P趎 Y[00u E @Phv`"GT11Dž88=E uP Y[00uE Ph0!\ XZ.Dž80fzt 0@xRP0[_@t#E%=tT11L1h:n"h\X"h2h{v"V ;L1v&H1tPYL1L1Pc@ZH1j_=1t=T1t =1y 511(1Dt@0141 t/0f{t 0IjRPQ 0fxt 0P4fyt 4@V515L1 H1, u0ذ8 u 1$1 hv" [ ^ڃD41 010jjjP6 11ۅy_E Phk"Z Y[o|i9 01va0Jy? $0Pa Z $t t"941묋0x:ك܋0jjjP5 ^PT91# 51JXPT1ډPT 1$1u 1$14J4Pt X 0@ @uT0 zu@4J4P$ Xt uL@LJu{ G6N9A4H [HV0 1$1_4H mPT 19$1|(~1 4@ @tE9 1sډʸ#i8 u 1$1 hv")X X݋0@ @tE Ph  X _Xj^8t80R[Dž04Px Dž4$sYLu 1$1y3dLPhv"51踻 51hw"i XZ뾋D( u=1uj_ _苅8=ju*[^X\Bu@j`Sk ^_X\lpDžtE SP\ ZY@XP貨 $O,U $Rh-w"51Ժ djh1s Y[t 1=$17|== 1w,2h6jXZ=14PXjQ X<@u @@u"t: t w"t \t u 9Ev@\A];E s@XZ[^_]UWVS}M1ۊ4<%tU J9CMAEQЉUM%QYRҀv Lmnc1=1t=1u MME8 =1tE@1E}ct }.LEt @/uEEy0u QUEUJQψUߺ}w у0EM)щMJt;Ev/tHtH8/u;Et@}}U 9eM Q}.u29`K.49IK.498.k9.K/49K<4} ~!9K949+9M0 9C>)؋u N9CTmA!=1t1umA!)ڋE Htn<.u}mtd9voCDmA!=1t1)؋u Nt79vBCTE H9v3C%U JU9v"S% 9UvMA/[^_]UWS$]؍U1EEEEPSha$uk 1҅uu XЍe[_]UWVSu]Vuu .O u2N tt" t"fN 1} ҉эBU ʀ: uP}O9uF C*yhC*2b Zt C*H C*8 uЅt"ff te[^_]UWVSPu11эQ1vPhʂ"| juh"P ƃ1 EEP)P1ShC*yh"uh"51褃 j @1191 U e[^_]UWVSHuVIj j ShWuu K t hh Wjj h Sj@1U J9Ot uwwV à ucKtjjjhVww thh Vtj tVh"N ^_LjjV3ǃ u(PPh !h" PjV3à uPPhG"fDž=1~"jPm2 1Y[uu Vm3à *s8$}us8AlPPhl"O LjP1 +ZZ+y @Biȹy1fDžPjP1 u[ur8_=1~nWjVB2à u%PPh_C1ɅMEEUEEu+}uh"6Y^u$"U:t8}|}vuh"XZShȅ"1CBUHEjjjvE EU tth"[BUHEU:th"BUHEU MBUHEEh}TEEU]BUHE*U  MBUHE }uxEu U:u$ Eu U:u BU2EEtE }u MEHEj8h"jEP&u \h"jEPEZYwI$,"}tK}uEEh4"hF"Y'hX"hn"uh"XZ+ẺEt@PuusEMU| ;Et h"?뗉E}uEP"[EEEnv9U];t hφ"FEUu}ug5w}u Eh"U];t h"EU}x1h" v EP!YuuXZ}t]EUS}e[^_]UWVSXEUMhUhIE_Ztu hm"U1L" }Ej8h"jjjj5*Rh th,"^EEjjjqE EE11}u/ڋE=EU]E}uKhuu| y hk#NtyPEuu_qEMș׋EEM jEPwSZYdNE)؉EڋEt<9Eu7E1EU]E}t:jEP&SEZYvh@"1hj#bYEEEPfZthO"rPPPPEPEPEPEPha"hSe ,ڋE!thj#XEUu-S']EUSe[^_]UWVSÉUM=*t hr" Z*jjjSeNBu11@tEjEPS uu h" th"1X1u1WVuuh"Rf E1EU)ӉM܉]] ؋] 1 tM}xB~E܋UE܉U|w1ɉ tiE1Qh·"j]Smd LLD.ShՇ"hD* h uhV e $e[^_]UWVSxPj=:ZYyhfE%1=uUЃ=1t1hۇ"1EOlSWj  tt)u)؃u h"}t h"Xhۇ"pPj1 e[^_]UWVSÃ=1jP_XyShQ  Y[PV79_ZtVSh" %Dž=u ThSPSN1ҍz* 9},)ǍW5*hZYu5*WƬ Y_=1u=1u Sh""jPV t@Sh@"gjjjV#K=1uY=1uRhh Puǃ ujj[XZuPhQ r=1t1ɍP3Sjj1ɉ Vt hN":YtWZt hc"X1u,u#u P _Shy"'[^jjWtƃ u Wh"xPV6ZYtWh"V;=9u9t2RPhو"VP@ =S2 VDSh"`[_VjPZY@uShQ  =15*Sh :#hR_ =v *)A5*=1u@hh Rƃ uRh"[hC*? Ix _=1uVY@u hc" ZS Xe[^_]UWVSMHu1J<\u5252h"< uS5252h"jx [<[[y^t)AZ9]uA]Cu49]uAFtu냃ZB^5252hL"뗈]tŀ9[uHQU׍w҉w6s,}USq9t 1tAC]uACk\uuj RPW F 5252hʋ"ju ؍e[^]UWVS ÉU;]C"js ?<#7<;j~Nj8gG Ph0" tujGG‰^ ,I*t:DJ@CDB@CuDB@t0Cu&GGG1G*t?:tU <;HCdjy`@  P5252h" H9}"VQP5252hX"jqr x @$"Ctt DB@tCGу ȈGC, t DB@tCG;FOu5252h">C DJ@C<}P5252h" C tDB@[u\tP5252h܌"q I  e DJ@: CC) tDB@C C@ u5252h "DJ@U @Չ@ E DJ@F @C t DB@tC˶#G;u5252h&"_1څt @41tH;^u?Fp)ZYu5252h;") 6봉j 1Xx@ 1XsCt<\u5252hY"j$jG1ɍ^Xu5252h"[wu F1ҍFGDžCN@2FhY1DžDžƊV<\t u uCu K-ˆPh0 YZNtN\BЋvt;FvR5252hˍ"n΋9AA\t &\8u{S{u7t.Phh1 t1+DPaF XZ< u5252h"iF1C++=w1[^Phh11  5252h#"1ҋwFF FF1ҋ,I*um<;(<  HπpX@ *@ *Xe[^]USj@< *< *X]UWVSu]1rV ,2u2PtJtHhZ p4N 1_Z,2uph9e"jc @21jphy/!jh1I vh"h 1 ZY21,2@1151u Vh tI=2W2Ju>#u~nu 21R f,2,251A) 1X1=2u8#uxnu 21M M AI"t12tkt @uMf 1/t11=,29G ,22tBJk1e[^_]UWVS|=2uQ(28u==1t h"ja 2C*2"2D*212tOHyP1) ^t> J52P 52h1h1I3bK2=C*uE@1mP' [= 2tdh 2{ h 252 tU塴2HyP)% Yt J52P XZ1҉ÉUS]S蠀Zu Sh"je] ]USE] u ]]SP:ZYu Sh"j/] ]UVS]u VSZYuVSh!"j] e[^]UWVSR]u 02tPUXjEPVSbkPG02WPVSLk02e[^_]UWVS 19@2v}k 2tJtc52pjpKhZ pF ZYt6Vh jWD t52PjWV[" XC{2@ @t/D78t57R=P52hyd j[ @282e[^_]USu=42uh2"j[ 422CE CC 1}u2@QSPR542Vƒt 1t542RLPh"j[ ]UWVSE\2X2z !&\u.rE,I*Dpt zu0y_<\t<&uGh25\2V9r0Mh2P5d2Fd2X2\2XZM \2C1u2xutrPx utdh2)ʉ֋ \2L 9r,h2P5d2d2X2\2YXV2UM QS 5\2 h2=\2W9r*h2P5d2dd2X2\2XZe[^_]UVS]uCP9SsCPs C XZ}uCVu CP ss0 e[^]UWVS2Dž@jhl2ZYt22 <2SCu u K u2);Pfu@5p2j1ɋl2Y^!u=29xu&C uC8=29xC u1u*B5p2j1ɋl2K_ZtԋCu'u 29Bu؋=29xv uxu <22C =uB5p2j1ɋl2Y^u29BCtb C=<>T $"29@2r2k P522XZ5@2k 2Qt2p2{u52se9 _X =<2uu =t2 p2t5l2CPj V  ut2 @))Ӊp2SPV3 aj5252hl2;jjhtY hl2j5252hl2Fj5p25l2h2j jjhtY h2Oj5p25l2h27 52sM8 Y^ p2Dl2H=2D*t D *<=D *uYh Zt8tP, D *X7XPhht@j<$ uZftD * D *<=D *u D *t 11DtPDHTPPu DžPPr*HTt 1DžPT u?F;5D *r52h"A#6 ^_52j$}7 52j p7 1,WȀYtKW9ǍZ;D *r52h"A#6 ^X152PjH tdW:YtXPh܊" _ZDžtEF9D *w52h"A#>6 Y^1܊"y"PhL"52X=  nP<>;D *r52h"A#5 XZ1HPЉ<8PhP"52< 8B 9tE8t4$$$1҃8"u #C1@ډЍe[^]USPw?YtPUuU@u ShȒ"joH Ћ]UWVS Ek<` *AfEE19]~tV}CuGEs+EECE{ }^9~Mf{ufSf9|B)fS{+ESU9|9~fs+Ey1fC{f9|EM+uS;M}19~-USBuQUPuEY^MCu;M}ys(ujXZ1C9uf{th"uQs~Cujjs uCES)Pss8e[^_]U5@k2EZujj5@k2 US] @k2)thJjXZ9ƀxj3Pjj35@k2j35@k2:(]UWVSÉQ W VPh"3Ue[^_]USUE Z$@"i 1]Uhc21U`R2 1]US21]US21]U`R21]US21]U`R21]U`Q2k1]UhJc21US] @k2)thJjXZ*ƀxj3Pjj35@k2]US] @k2)thJjĦXZ0ƀxj3P_jj35@k2YS ]UWVS ]u t/{u)PvPQ t6vW1C EC;E~Y}C48IZt>vP ZYt/{u&MVU7MQURP͢GE랍e[^_]U]BUS]CtBPC YtsPys hC ssphCXZ]UWVS` *1AfEE1;]}@A@ [tfxu;]}xCkEt裬u555,5RV!ǃ1Et9u} < uEG5,5h."jj5,5jWjj5,5j$jj5,55,5X5,5B*Z=X(I*DBH;DICfQK S)y1fS)y1fCWCfEECfEЍP9UK ω)y1s9~fSM}9 EM|f{sXxu f}tfCLz `~x~Ha (S9SB pfCR Ku ktLt5 ?u I=tg>u'=Rt=Su#V(Yv1,I*DBu8hpD*j V =sC Zt sPP^XșYtABG t!u S^Zt CzwftbG uQs C YtsPs ]C sSs]C2XZOu V)^XG :zsC Yt sP|XZsXCt6PICX&uCD0tPICD0XEC9E|ыC4tu S_Xs-]CC ^P]C Yxu+uNu_u\5,5jdu?tH2t0,==}==R{=St=uhe[^_]UU2U fP]UU1x92~2]UWVSP)529B  MP52D_XҋMu1 126224ujWSj}tNE8tFEtuPV 1hf"52`u52`h~B!52_h<8#52_1эY52RxE52LxE52^x+EHEEEEԃE+ECE9u+EE}x;}ES9~Љ+U;U~+EE+UE9~PEPuu52_52w}thuu52\`E+EPu525252Y utK ttu11E"=== ,I*@}u)PPKPK O\9LDH@t JJt LDH@t)PPUP U))߃ A9K3 u.}uuV 1эy 9CEH9~6,I*DPt*U̍ )PQMCPt MЋÜG hpD*j XZ}t0j E+EPu52z$22}t1uEt >uV}t}9}tuWu ue[^_]@UWVS}52tc=2WMuW=uCY_; 2v-S7Zu2tP,@X=2 222e[^_]UVSu !*t52Pb XZ !*1ۅtjjVڮà tWjjjPD 2jjSjjPj>b !*,S蠯5 !*Xthi"V Y[Åt jfZV 2X؍e[^]US]gw> !*t-t)92r!DPb Zt92v  !*@!*؋]U52t22XU52lXU527lXUS]uQu P?ESPjK]US]u(u PESPj"]UE Puj UDuPh9e" UuPh9e" US]uuPDSuuu jPf$]Uh8 uuu uUWVS52r52sr_X}uw},u2u(P DWPjj ƒ}t(E8t E$9}1}эT E$DE9}K]u@9}t.}~(E8t 1}ҋE$D;E} u+E@E }y uhYj P& YZtC@]}})عEE9~)މuu uuS52Cƃu+u uuShq"52nE15VEEZtP55fZY52QPVK52UPVUjjV$V%E @PE@PEPS52藄P!V P52VpUP52UU,Uuu(PBURu$u uWP$tjh!j@k2PMbyjhXZ=[22SKE_ujhՄ[^SYu@k2ǀ$Hum@k2Ph9e"jVPj@k2)t]SPZ0}]jP//YXtE M19Et1҅t9t; tB CދUB4kl| 49t1҅t9t; tB Cl19t4EPYZu EG19tPZtGEP`_1;}s7klE@0 t(Pdt!ztHhr2p8p4eG19t4EPZYvGV2_}aS^T^uVS[Ehj[jWju.j]SZYuS!苋Sjj\ʂEPXe[^_]UWVShPV, hh"#V˞ hVW $hhC#W覞 VtOWZt/SSSSSSSSSSShu h4jj"Y[WVXZe[^_]UWVS}1ET^2jj|^_sjVPE i]@k2$*u u$)ujh`dY[0ES6^SZYS!Y_"#m"#[SX^55躱jj5,5\5,5з5,5蕱EPj  }t>hj]jXj襅u'jSTZYu"#"#)S賍XAtPZt@k2$PX@k2$S^_e[^_]UWVS}1ET^2j!j{ZYrjSPC xku@k2*u$tPV职_XEV|W[u/EPj ZY}thj^jjhuV蘌Xe[^_]UWVSDžHH;E E€8uEH܄t+E4ъB< u1}֍F(uDž<<9E1ӉI9(QuR ^}DžL<%wC@C0膣 C x## DO2xt SP; XZSjC ƒt=$ɑ(辑DO2[^tP Yc2" ƒuh*M $=t th} Z1e[^_]UShhjhI>jjjjj jjh+*h4y.hpD*h## DO2Y[t Ph## XZj! jPS; ]UWVS} EPuhV }u1эD 9h #V _ZPV h #V t,I*Dž +*tE1׍GPR蜹 uD8DGu+hiP諻 C iƄ[\PY^u jpjeXZ jS^_u5c2p Y ifB B 9uhsjjjjjjjjjSjsD4DžDžDžjrRPi u]XZ1L  2hiPh2U jh$#h2 t(jh$#h2׷ $#$#1DžPh$#j@\W\ jjPVW $@t ue4D"h2h :#h j_ÃKDžjVjj\V 1@"Vh%#Y^_Dž=2su'=2lu2,I*fDPf\Ph ?X Y[u7haT"PM~ _ZÅu?Dž1ۃjtN$󫍽!1󪍍ik^@ahh%#XRY[Hhh 2h 2j}= 2"hh 2h 2j~hb` h&# ÃPh/%#jXhW%#SWh[%#SWhX%#SW$hv%#SWh 2h%#SW= 2th 2h%#SW h%#SWXZh%#SWh%#SWS h%#jnWh2h%#h^(u.h2h%#h\S x S&XDž\hh 2h 2j|/h$#h 22| t~h:!h 2| ^_tih&#h 2| Y[tTh$&#h 2{ _Zt?h!h 2{ [^t*h,= h 2{ ZYthH$h 2{ ^_u 2= 2tYh 2h2h+&#jOt=DO2thU5DO2P h5 WtqQh-1#W5 Wc% CCRz"K C|QhA1#W4 C1#W0% C C$Rz"K(C4|8 JDž t"Qh0#W~4 W@tqQh-1#W_4 W$ CCRz"K C|QhA1#W-4 C1#Wp$ C C$Rz"K(C4|8 tDžE)iڷm۶;thU1#h`"h9h{1#s vt  O2@k21)tAPhK#hW U%pklUBPnuYuGE98wE98wjh`$XZ?klUBP4 jjjjhWp8RQx tUth.#|_u&@k2Ph9e"h jj?$hu!F|Ythu!Pj{ǃ y0@k2Ph9e"h踔jj#yUyVWz)19tkt@ZVX1e[^_]USM219tPklAx,tBP4 jjjjhh2p8RQx tjh2jz t2]US]2\w w ][]n[]À=2tUjh2j#2 UWVSjjj 1ۅiPZWPj Ӷƒ 1}эAEi<9EjhP譟 u[uuP蔟 uBE,I*DHt+Eu} uCjuj4 @uuV4X؍e[^_]UWVS}19t2klwFLt#UFh Pf< ZYUu FPyC19tKklGx,u@PCu2kl_1#{Tu1#PhhB#EP= E1e[^_]US]EPu O/ZYt$UtthhhRP= UЋ]UWVS\1}󫍕Ec21҅ƅjPMY[i8ރ} tE pS; _ZtbP,40SYt;JP,YtJ89xtfE@ ]BujR_Z c211҅t $;] t t B܉tEÄ"hjjh{khPnjjAjjjjh`+*4VPC{P ExtQ1x u.1^z}?;tB9ux(u PYF9vċ}O1ЋEx uZ1&1ۋ9vx(u PXC܈؍e[^_]UWVSu1ۀ~ tD~9v,ً1҃x(u9t;t BPXCˉMe[^_]Ue[^_]UWVSQ8ME111ۋE9Xv-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVSh1#h訬e[^_]UE8b]UE$2Ƃ@22fP2fP1]UEPE ]UE E EE]b7 US]$2)PCC0@2Rq C2C2C1]UWVSÉME1s(t[#2tM})t B '1Ƀs*t)uAqtB ɝEE똃}tB lBB|EEZY[^_]UWVS t1󫍵EPE jhjjhjh5#2jj jPSjÃ8VPhwS1e[^_]UWVS<Ɖ׉E19S vMQRUSPL UtEBjluZY1҅EEEE9C M9MMQuSPL k}lE̋UЉQE܅t8tjPQo HL >_4EG8EċUȉG2)ht% ZteP 9h|x .th PVh xPh@2 @t2p`-*9|qP52_Zut a Y21P52Ǿ_Ztã2 1ۉ`-*E%=up2@ 7=@p2@ Μ?2)Ph V. 22<$2@2P 2C2Ylƀ@22uF2fVhjRP. e[^_]UWVSEEt2ȗ"&Et2"2"1"Ɓ#2@"u21 #2@9u#2j~#2jr#2jf#2jZ#2jNE#2#21эq#2I9sډ΋#21I9sډ΋#21I9sډ΃1}H9sURh8 h1#jjz #2EEe[^_]mU|EPu ZY1҅uE%1;E ‰Uh@uÀ=(^2tuUh(^2h2#jƟ t1Td2hS2h4#hB#hhc2y h`R2h4#hB#hhZ2y (hc2sZ1Uhu/USQEEE jjEPEPjEP$ EUeY[]UShh"薀h茀jjhtVS 1Ѝ\XZ+];]thK4#h@"hhb4# P Ee[^_]UWVS EUϋMMjWLY[tK1ۋMU9t CRgqVSP ÃtPES蓰XZue[^_]邰e[^_]USj$u- ZYtDEXEPjhjjj EPS=M V…t9E wj$S1҈Ћ]UEPM U|* XUEPM U*XÃ=2uiU23tDl24#5l24#&l2"l2L#l2sl2]USE] tPqYSj:\XpXZ\2E]0UWVSDž8DžZ^1Dž@DžDDž<jj=d2t=c2tSh-5#j# E@#2tl2e[^_]UVS]u St tuh35#gNX35# +u=5#jjPVSe[^]UWVShh4# ^2^_t PhB5#Qa Y[l211۸.*P(t 8t#2u uA؄t l2Dž.*{5l2(q;`#2Sl2 j55k5,5跮5,5*3l2l2P5l2hV5#j_jd2Pj )Vtu#2l2uc l211W*t)u@(u !xt#2uƂ#2A뻉tS l2Ktju7XZ#2u(uSY_Hul25l2}l2l2u9uhjjm. 0VR5l25l25l2Ph]5#hii jjXZ1ۃ}t_#2tVhj5#h$^_Hu%hijiY[th5#jXZh5#jh6#j#2t}h ;KRPv urh"6#KxRPX uT|9u;xt8h'6#vhF6#O^_thP6#jGhF6#h6#LEҢD}tth6#jTY[juZXZ1e[^_]UWVS-*{t,t#W3NYZtWh9e"hg 11ujhXZe[^_]UWVSDžDžh2#IPh9e"P ytQP_Hh6#IPh9e"PJ xh6#IPh9e"P' y6륋tP諥^uh9e"h&fjj  [xPhL]"d ƃ tГ Yh P= [Z1ۅV? W,uh9e"h&Yfjjxh? P5 ZYƒ1}щύAPuRH t5Ph9e" VhP- u|:=uV$? ? ^_ZYu^_uWh#ejZYtI`_Xtjh%j[^1jh&XZY  X 衣薣苣 VC> ؍e[^_]UWVS]u S 13C[^_]UVS@]xu1EEEEu15URURSЃ t}D|}w<뭋URVSPL uF9s wEtEȋỦEUEЋUԉEU؋juuSe[^]UWVS]u 1V(ZtƍCڍe[^_]US]s Fs$>XZCE]-UWVS]193v8klCxdF@0 ttWZ X9vklS9zduBd@193v>klCx4uFtWZF 9vklS9z4uB4@s蚡XCEe[^_]釡UWVSjhPju1t7uu PD @uQ 8SKP 8Z S;Xe[^_]UWS] 1Sh|dup t#S;S t%iCP3[ZYt3ƠX1e[_]Uu hzd@u"UVSujhPjV9Ã1t(ju jSVF)Sty P 01e[^]Uu hedAuUU EHJ Ju BjjjjRPRPjQV0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhhGjj7jjjjD8ƃ4PV-Vw9}TP89 B4QVPA8PP8 txVRPQLP $Au99t+QP u@8 QPWRL j}e[^_]UWVS ]u F@klPvz_Zu1Fz }klN+MtklQ8RD8lP ~1C@PsyXYtM EC+EPuD UPj }1E@ USV$fCEfCFfC S'VSe[^_]UWVS(Ɖ1tFʸ uuuuxHHF 11;]wMkTShc!jR6 DŽfDŽGۃjjjjjjjjjj(WPQ3Ã4xVS(S34 1e[^_]UWVS] CC3),T@DDžXDž\S ^@u.DžXDž\48@DS<<j1RP<@1RPXPS@D DyjT<<X \[  t@ D@ ڋKWVRP.ٍ4@DD89DH|49@s48+@D689D|R49@vB@D+489 | 9 v48@D9D|@9@v0t'j7(Yp$(@DLh,gXZ@DeY[^_]UWVSu vv0N ^$ t*N^9|9v )ӉN ^$F F$FV1e[^_]UWVSQMLqyA Q,0AQ48LP@LCS$(WVSP|+,0׉PT P^2 uPT1ۋ,048SQDHRPƉ׋DHSQ0,)׋89TDHu<@49PtXSQTPC<@T98|(P94vPT48 @9 |(<9v<@ @} xEJEEjjWEPjV xE 19E‰Ѝe[^_]UWVS4Dž@k2;DI2*DI2@I2$1)tjR@I2[^tjPLSЃt19s voRVSPL tW8uL0Yt<jjjRhWVSPx tWM@I2XZF댡@I2e[^_]U O2t8 ]USEU  /uu =u/t2t/u RPh :#RPhB#hh@E2 @E2Ћ]UuPUpuPPh9#jO<UVSuPDZY1ۅy DO2tVh9#P" 5DO2C =^2tVh9#j5^2 taESb`Eh9URjPPh\!hpD* DO2 tSh\!P SC[j e[^]Uu Puh9#jJ;US]u SSXZ]UVSuhPS u }hPV VSh9#j:e[^]UVSu=hPS u #hPV~ jSN ZY}t1BtVSh9#ji:e[^]US] uZ] E] UWVSR1}֍FuPQY tLS׋uM uPu uh9#j9tESYXE E2 E2e[^_]á E2t98u4UPh:#j9 u5 E2OY E2XU]3UWVSS= E21t_uS ZYt ?;GSPh:#j.9u!9= E2u E2EWXXEe[^_]UWVS}u = E2ue[^_]Jj4jTá$E2jWCP jVCP $E2 e[^_]á(E2utUS(E2 E2t( E2|SRPh:#j`8SX΋$E2t$E2SCSWX(E2]UuPh9e"u u7UVSu uuPǗSh0:#jם1e[^]Uuh@UuhUuhUuZUuZUuZU1= E2]UP`UWVS ƈ@4jjjjhWv8PRx ~thFPS h^.#S`[ YXFLt%hhd:#S< S-Dž[SSWh8 ƒtPQ[ jQ t4tUDž Xu5VSh<#踉DO2 tYVSh<#P 5DO2 =#ht!tF@I1e[^]UWVS}u Eg"E+EP=#E:ÅujEPYX9uG@/5hEKZuG@/KtG@.1e[^_]US] h.jZYt/hn=#h ZYE@u @+@I1]UWVS,]<1u1AuT^2h(jPT +SMh_뻃t"tu-l20*+I2tP?^th=#hI2j Ph}=#hI2jI20*Wth=#Vjw f_WPh=#VjWDO21ItQVh>#R- 1֍vR>Yv  1*+: 1*0.k0*t!P#Zt dž0*, dž0*-ChT2hU2hm2u6 10*1ztJ K F55njj5,55,55,5Ih>jjh'h&j&jFjjjVPjCÃLWPS. e[^_]UWVSQƉh;>#Ih P: uA=DO2th;>#$PhK>#5DO2 h;>#PhK>#] /OuPhi>#Ph>#6 _XVh>#Sd S ]th;>#h>#Sj;*h;>#Ph>#Sjh;>#P!+ DO2ZYtuVh?#P 5DO2 ]jhHSY S{<X1e[^_]U1ҋE]UE]UE@d]UWVS$E]ԍE] u]u]܉u}}Ћu9uz u :}r1u}21M]M]x(Èك}Ät"]3] MuM9Mu]9]uM;M|];] r}.|M9Ms$M;M|b];] rXM9M|P]9]rF]9uM9uǀǀH vIH p x$B E؃$[^_]Un2!]UWVSPEԉUȉM]M UE} }}$}}ԋwu}9E |9Us։lj]ĉM|wEE}|c}v[uuWV tGEUuuRPDUMeʉƉ;U |;Esu}]ԋEUCSEUEEUEU]9]9;}%EEM])M]EEE]9]=}'E؀x ÅE؋@1҉1ӉM܉];}| ;u]1Éً]1Ӊ] ]99;}| ;uE9EZE9ENu܋}} } u}uuWVUMeʉƉ;U |;Esu}9}|a9uvV)9U| 9EvEUEЃEE9E|5E9Er+Eȉ0xUMPH EEEEEU׃} }u}uuWVUMeʉƉ;U| ;Eu} ;uE̍e[^_]UVSEU M]u]u ]u ]u]$u(]u],u0] u$[^]jUSQMYISQSQjjjjU> IuEU11ҍeY[]UQMY]US]sh?#j ]]6UWVS]u j/VE ZYtc)PCDPVk uJG<`~BH9v4H| t'19ty u9tBЍe[^_]Uju EDP3 UEvPEDPu * UVSI21ۃ<"t,jS=FFXZwh"C !uʍe[^]Ã=I2uUJ2]øJ2UWVSUu119y u 9;] t uz(t1ۅh|XwЋ19u9uǂǂ1J Z$ǀǀƀJ C@L1ۅt,?#؍e[^_]UWVSU@1B z(t ƂBBB ƂǂB fǂ[^_]UWVSUu}E E];E E1EM9E~,My u9tM;M tEM9M @Eσ}tMa}w}sWrV V}t RR}t PRhv?#PRh{?#&R}tPRh2#WV PRh2#WV 1ۈ؍e[^_]US]uh?#hК"hh?#6s 3X]]2USÃ=n2u 诏n2CS|=v ǃ-|=@8w {v ǃ@ ǃǃ[]US]{Tuh?#h"jg{Xuh?#h"jhh?#w{\uh?#h"ji{`uh @#h"jj΃{duh&@#h"jk뺉EE E=@8 CP1RP sjhs]UWVSLE EEEu}EPu Y[u1Ihj-XZtǃǃEȉEẺEEЉE EĉEEʅ~uujjMƉ׋MMċEeʅ~uujj$EE܉C`E؉C\UԉSXMKT‰Cd"uE CECECs {$s{ECE C(jh@@#CDP賮 } tƃEC ƃǃEC fǃ؍e[^_]UWVShj+_X1ǃǃjhPju踨@SC,PhedAQ yS/ٟ[^1,u81u }1;U|;E rE UEU9|9r}u~1E u~ CE UCS{ s${sECTC7Y19F u >C <t+<yNǃPPPF1RP蔺tG8tBkjPR F ;u R Z1҉C S$9|9vC C$+C S$GuhI@#jP-tXfv?1t39~/ t9 u ; tu@S-X؍e[^_]US]=n2u 6n29S$ |9C s1h n29K sjjjjRPRPUL t;n2r*19}tu{(u t@ڰ]UWVSÃ=I2uI219u/B !un2n219tr4z(9uA1[^_]US]EU u[]UWVS]}=I2u@119s3u3P;E <ދEE苃Etu{(u1+GW C S$MGGG(‰MtG$U1u숆ƆEG,PGtk 9t jPQn G tW"}uU9UuǃǃGt$9thY@#h"hdh?#O tU쉊@9C r 9E rA1e[^_]UWVSu =n2u Yn2EE19~\UEtEFPv,uutu Ex(u}tC;n2GEfˉ}FFN(tF$1ƇFt 8tjPkMP kUƄF MA E}thy UXEe[^_]UWVS@uE PEԉU؋E x@ EE @EE @EE X@ EjjuujjjjU u}hEUẺUЋFVEĉUȋE9Eo|E9Ewet`t[E܉UEUuuRPnU܋]eډEU+EUЋM])ӉM]M]M܉];]|9v }܋EEEUẺUЉEĉUȋE9E|E9Es EԋU؉EĉUȋE̋UڋMԋ]M]9|9s +EUȉE܉U=n2u kn2E19~VE̅tEԋEPv)uutu~(u}t:C;n2r"}thyuXEGfˉEĉE܉EE H(t@$1Ƈ}t E8tjPkP kƄEF F V$;U|;Er+EUF V$F F$Eԍe[^_]US]=I2u' w k I2!1;n2s k4n2C([]US]=I2uS1w^"E[]UWVSSÃ=I2u UU n2E=n21;Mt4;^u(Au1AQW!ZYtn2n2k4Bn2V 1Sh5$jRU F hq~ SPh@#jW F'F(UV,~0F((k I2e[^_]UWVSQu]=I2uE1;MUu;E  1<CCC xCkEt C‰CE C C(ljC$PC,ƒ}utK9Ku ;uK }u*~( tK @9F r9E r E1Z[^_]U1ҋE ]UVSRu j EPup U:t1ۅthrX pÉ؍e[^]UWVS0]C{Tuh?#h"h{Xuh?#h"hh?#{\uh?#h"h߃{`uh @#h"hȃ{duh&@#h"hjCDPV u h@@#VX' ^_s4{4t{4u PPShLA#h\A#jƃ(S Xe[^_]U1]UWVSPEEn2u111 t`}u"u 1B9t:9u;"uQuuu jjuЃu)뚉uh"uuu jju"e[^_]UWVS] ߋuE;Utj1MytaJ8{ sStWVPщC uEuV2P4CZ{u EPDC{uEjP4CXe[^_]UWVSn@K2"9@K2iK2Hj\Y11h"u3 Ј3tGFu߅tV=n2Pn2Zt9;t "{t "{t @K2S&Xe[^_]US1ۡn29n2vtCPX]UVSÉ11t u9};t1AC[^]UE p 1]UE @<1]UWVS]u N4t,@Xt!QRZYuCfH f{ufCCf` 1~4CEKEU9U~*Eȁx I_ufP ufP E΋VfAJt:tfAJ19x$v0Wv4RP` SF8u fL  fd GǍe[^_]UE @1]UE @1]UE @1]UE @1]UE @1]UEPE ]UWVS]=\L2XL2jǣ\L21։IX9 XL2} XL2jǣTL21҉IX9 XL2} XL2h}eǣPL21։IX9 XL2} XL2h~7ǣLL21҉IX9 XL2} XL2h ǣHL21։I_9 XL2} XL2hǣDL21҉I^9 XL2} XL2hǣ@L21։IZ9 XL2} XL219r$v/k B(0qǃ1҉IX9 XL2} XL2FȃXL2C8;E R} )NjhVKQWs4PRdk x(7VP5XL2h8#Ep|0} E $"SmA!tBP5PL25[2P^21RPssRP5LL2[5[2P^21RPss ՁRP5HL245[2C SCS P^21SQRP蟁RP5DL25XL2h!8#Ep識8C8u \L2C uTL2P5@L25XL2h8#Epse[^_]UWVSXE0E 9F wh8 j h!Ep8Ru VPL t tE8u:=`L2uhl`L2X`L2ƅƅ@Pt QRu VЃ P^21ۍPSQHRPSQ$RPhrA#Ep>ƅ11ۋ9PhQRu VPTtctZwR1I9v Ƅ A񉕜Ƅ )PPP菽 @ D\BXPh9e"Epq e[^_]UWVSE 0@ 8 t PXpNj0SWPvjhf 5[2P^21RPvv~RPh'8#j}W< 5[2P^21RPv$v ~RPh'8#j]S FPTX0hPRjPcP=S:hA#h M2 M21эY=[2 hWPh#j^W [2LhLRPh#j|RLO 0hePLRWhA#hhL2% 1ҋ9P M2@ ЉDHL0PLPh!jMQH hHQhL2 $؃NDw7ƃ M2 C)߉HӋH< ;LsNw ƀ M2-@BKhhA#hL2蚁 hh M2hL2膁 hh"e[^_]UWVS ÉUSP\Es [^u}tCjSZY1ɍ{}u#u9Mv)fGGD`Az9uupfB  M2fB }uBofBB] B UB0BBB sfB*B,L0)x9thA#h"hyhA#谲Me[^_]UVSQÉ5pM2kUpM2CEfC[e[^]UWVSu P,XjSYX19sD _@jjjh\jhjjj j SWjuÃ4t VPɿF=XZSUWe[^_]UWVS} SDVsBZYu19G @Pw ZYtW JO GЉ0100UĹ ]{ u6SPH<@Y}Dž4Dž8EWjRhsjjhOjjjAjjjRVhE4URPluVv}/1Dž4Dž89uv<`RVSPL t$hl`d48FjHy 0F ZY}1<@(,9H+D8`R$pWQL$R7}WS jj84@h0j#N^_u%DO2UPhFB#Z Y[UjS͹ZujhR_X1J5jS[^sjhs@k2@u ǀ@>U1]EEPV{XZ}y1N1҉XHùxt%| q1@ 4Ss4|GEE;xrB;Us E11ۃ}t E;]sPa3C_PYVz5pM2XZ}1Ѝe[^_]UWVS4}EDž}uEjn2jSY^jS^Zu]YjjS^Zu8-Y[9ƅDžDž9n2n24} tE 9u (u&tWRZuQ>EFV , HЉD9|9szjj h8  SQjShn蠿 6萿SRPhyB#S] SN ƅ6UPM Y[@ sL4;w؉1RuǾhl跾jj h8 ,HDRPjSݎG$hmeRjPKƃ1˃҃)ڍ\ SP9 1эD Pf R  1ыD f $VP V1I ;r$hB#h"hhA#uuZ1hjjjjjjjjjPƃ4tPVc_X1;s <1;t4=@YڅttS Z  t VpX1e[^_]UWVSljfDžv/ƅujhww#jZYyhhww#Sǡ l֞t0͞8t&ÞWPhB#hS Džp!yhWSx =vhQlWi Ƅ/lDlQPh :#hSz j/S Y_t3xv9tH9s x/uQOZy[ߍxPW ZYu^%=u0p.- >hQS{ h=@uW_uhWPE =hSgZY1Ҁ;/u 1Ҁ{€t{1򮉍pЉу+pD=w:uhh Spf =whPSTf =v 1 ?V_y  V_iY VZVFi X1e[^_]UVSƍ|PV  ZY1ۅxaEtXjVhYXy1Dj \PVg t VhZ$Vh\Xtljf= u؍e[^]UWVSEUMPW[ǃ}tE1WZt{fx vX jhFC#S uSuhB#EPe @u h<!2R 3Et}tFSuuhB#j&uYzWoXe[^_]UWVS hB#n11tY,ڸB#xuڸB#u$WSi XZWST Y^1yahB#hPS[ WS 1u hB#ԚPShB#jFShB#j-=hS. hB#S=hPP WPA u'hB#S PPhB#jhB#AhPS袜 Sh9#jtv PhB#hB#juhB#S藙hPWM hB#SzPWhB#jG,h,C#S^hPW h C#SGPWhB#j,hB#S+PhC#jMh.#SPhC#j*h+C#AhPW袛 h,C#SϘPWhB#j(hB#hPWh hB#S蕘thG8EE u9pwk]lE X{8tIC|9s8] []19Mtklu ^c0AO0u uu ]u]u9U| 9Ev uEUG0u_)Ӌu N^}t؃ډWE 8 1e[^_]UWVSlu} E 9FEklNA0t@FV|5v.Q P^21SQRPnTRPh0"jEPߦ FXxPuMyكSQh7F#j&EP謦 WM]j"转PM]SQh'8#j&EP聦 ,EPP^21RPSQSRPh0F#j&EPS Fx,u#he^PhAF#j(]S* ]kP0t-pTpPkPFPh7"j(]S ]6xt?@Lt1hPFPh>F#j(]S轥 ]1E th輫PFD8dphFF#EH4Rtt@8t PQ҉E[X}uFpTpPEZYFD8Lt$hWPuh>F#j(]S ]h3URjP7E~W0+u@u8H=uPEPhMF#Ephit uX} ue[^_]UWVS] j(诫{X1119tklSB0u z8t @މɍ]t$j+cj*ZVPh>l#jPS( j+?jPPS觏 htY j)"URjPc9hh"[2j,SPh7"jF^Sģ j- h"PSh\F#hhM2蟣 e[^_]Ätj*诩jPPEPhUWVS8Ë@H1{$S$C{9t&klD00 t fD2  D2 wA"fG G4G}G G,gG00G8G@Ep x$+s{ EU9P v%MQuPRL t Euu}EыK19tklSB0u+2z@s{S(xE+C$PR&XZE+C$e[^_]UWVSEU΋}EEEE;E k]l_C,EFU;uFt8tKQPR ZYuk{8ueEC8EC4FV SVCyu+c29uc29t򉚀뾃}c2} ۋEH(ʹ1󫋅uVB k8E X)t @4$1t2@4DžDž$u19x vRPVL t<~j$oujta_oB}W󫋅}WB k8E $PX@49p RVPL u Fuou都tQ_MMQ󫋅}WB k8E HX0@41fD @9v=l2t+"󥍅PU E["󥍅PU EY=l2t_DžDžDžz2Dž"󥍅PU E5Z=l2t+"󥍅PU EXEpX1 B T> B =N2x HufF؍e[^_]UWS]1CCCl@"=dRhH# S e[_]UWS]*1C(C,C0<dRh#H#S e[_]UWVS}] =`3*u-hsjjjjjj jjjjh@3*j_`3*4fG$ԡ"S5`3*UY[jSSjjjjhLm 1y(M,N0O։tF3h jWQb jWWjjjjRl0W/ Z1x W/ Xe[^_]UWVS$u] E= 3*u-hsjjjjjj jjjjh3*j^ 3*4f~ F$"N2 N2S5 3*S_XEPj SEY^C$h%jY˃'0(&)* +Bt=3h juVa jVVjjjjWfk0V. Zx V. X1e[^_]UWVS0É։5[2P^21RPEp0#RPh0F#jURU` jEPEȋURjjjjSjP^2EE8ju uWVUREP3| vMUeʋ}We[^_]UWVSME fy iQ$" jPPjjjjh^f@k2,1ɃP<1WV_ 1҃x,‰P,11҃x0‰P04jPPjjjjh`i ͍XTa{XXbqX\cg1҃x`‰P`롍XddOXheEPlҁ~ @ltPll1҃xp‰Pp[@@HtL3h jV^ jVVjjjjW*i0Vd, Z1҅xVQ, XЍe[^_]UWVSU] fz B$L"{ hWWjjjjh8h { /t jWVI Vh*#jW^ 1҉у| /D 1l_@k2,1Ɂ S<1WV9 .11҃‰  :$$;Vu}((<-tauX,,==Ph jS\ jSSjjjjVf0S4* Zx S)* X1e[^_]US]1{u({@uC{2"{x[]US]1{u<{ t| wCz2{x[]UWVSdDžDž1Dž{2PtZc2-Dž$9P QPRL 8PVV 1_X/t h VY^5{2 WVYZ9uOt-t!׍W񋽐H9vt1҅t$;y s1֋D0 {2PRhB#hPY 5{28 tZ PP XZt{2Pt]V |PhC#h{2 R RPVh*H#h~$tt;,($ PRPhlH#h~$!PRPhH#hs~u+{2@40|81e[^_]UWVS8u1~11E1ɋD>Pt=MMQt>TPRL Mt"E̋UЅt 9| ;EsEр|>XuC,@utVF$t#u0ˋEwCe EF(N,ʉF(V,F0{2!m~ye[^_]UWVS1ۡL{2PZAL{2thH#jWWW h Wo[ ƃu>WhH#hpD*Z DO2 WhH#PZ Wh@#jL{2ppp hH#V hH#Vr_XDžL{2k,<PXR0PRɠ GPZYtUOTtM8jjjjhRQPWxL{2؋QP :jjjjjPqTRWx Ph\!V 01hH#V_XDžL{2k,<PXQ0PR GPZYtUOTtM8jjjjhRQPWxL{2؋QP :jjjjjPqTRWx Ph\!V 01L{2p$p pphI#Vh"I#V h%#jyV4 j L{2tPh:I#hQz uqL{2t.VPhOI#h+zuKL{2thdI#h z u,L{2thwI#hy u L{2DpC1ۉ؍e[^_]UWVSN2c2xtl$u ƃxYPYt0$xt=jjjRt)PZuDO2ShI#xƅtDO2lVhI#X1ۡp{2P_p{2p+TPh9e"Ep@sk n2]ȋủn2n2!k ǀn2ǀn2ǀn2e[^]UVSMU19n2un2r9n2u;t = u1[^]UWVSCDž@c2Dž<?1$%$9p DWVPRL T} t} t!} ``tWVS jVS8 k<8|t$x4jjjjj4VRPx<tǹ8󫋅4tfDŽ~DŽ< Fhsjjjjjj <}@Pjj@ 9PCdž$X!uCjjjjjMQ3PRx } t !} t&K#URPh1#hMajjVLe[^]UWVS ]u Exb$jjjjj}WVPRx WhK#h` u-t4褀t|Z~H|e[^_]UVSu^jh"S8$ u*Sh K#h` P@?jhS# u3Sh0K#hK` 0|1jh!S# u&Sh@K#h` ugtX@Ojh$Sy# u$t9SRhNK#h_ShcK#h_ u Ɔy1e[^]UWVS=d3*T=l2u*!hpjzL{2_Zu l2=l2t!h8jiz{2[^u l2=l2u*jHj;zp{2ZYu l2=l2uO*!hj zz2^_u l2L{28{20{24{2p<{2@{2PD{2H{2{2z2z2z28{2{2P{2 {2p{2{2{2{2H {2${2P({2,{2z2z21z2z2z2z2Bz28h{2P{2T{2tX{2\{28`{2d{2N2d3*X1󫍝pVXPYhjhZhh,jRjKjjj@PShT4ÃjY[tjjXZǡN2 N2؍e[^_]U2=l2tuhzK#jP7\ UVS]u1t$uijjjS {ƃtjjHDjjCPt$@k2NV9H|9Dv DHe[^]UEx4thQ#h"hR hK#j@UWVSQ} E@E19u~eEX=Vu4uCG8-=Uu4u3Gx=Ou!WtZ$tfc fK F떍e[^_]UWVS0u=_Í}Ĺ 1S^tv}ċ$}$zut3PtYt&VZtVWjWSWjjSiƃxN2 e[^_]UWVSu uYP}Ĺ 1󫃽PuPZt苅P$S_xt2jjjSǃtSYt P$SPHHLd 1Zt0tt hQ#h"h hK#F jPjR8x tRPMj PEP 1e[^_]UWVS,}jhPjWtGjPjVWV u$U ʋMQ؍e[^_]U]UWVSTEЉUMEEE EM]E EE$E}EЋ@8Ɖ|Q}vIEUuuRPrUMeʉ;U|;Es M]x 9| 9vEЋP@9|9v tӋ}}}}|}wEE}GWEȉŰG<1ҋuȋ})׉u}EEUEUu9u$;]EЋ@,EE9E|E9EwEȋUEU)ډEU}#r,z0uԉ}r4z8u܉}}3}}3} ;]| ;M;] ;M;]| ;ME9EaE9EUM܋]}- }!M]uuSQUMeʉ;U |;EsM]9]|h9Mv]uԋ})9}| 9uvu}u9u5|}9}w+EXu}px EEEEEUӃ}1 }%M]uuSQUMeʉ;U| ;EM] ;MEče[^_]USQMYISQSQjjjjUp IuEU11ҍeY[]UVSEU M]u]u ]u ]u]$u(]u],u0] u$[^]UEP,1t;E t @1 B@z@uB]UWVSEMP,1ۅt;] t C1I819O$v@k O(9u2F<1ɨtF<B<9uBh EP$XZt("?ttWP0 YZuF C<e[^_]UPQRhL#EPjC~vhtY ugEjh4"P: t0uXdXGh? EP;$ZY8tjM‹E.XhtY jEZYuudX1UVSDžPTRPRPG mA!TuPj(PXS PcCuKhqO$SPh7"jxuV VSS$uh!h"hhK#ze[^]USEP]SGXZ1}u!]UVSu EP]Su tEPw u11}ue[^]UWVSǃ=O2u1t9?t4O2E5N21;]tuWv ZYtރuNtjXj jV|  uj jV;Tuj jV u7thhH$P hVP   yh@!V YZuDG8PW<G4hN!V YZu)+h1!Vy YZu)j hH"V uhjYXZu1][j`VC@P C,S0C4S8 u2t)CQ RPu ZYuƅu_, G W\X1*E u GGGO_O _$UWG@jhRjP Ƌ_,tnP4tKRPPs0s,Vt'8t"Pk PYX@8u ǃC4S8)G W$mDžDžSh|dV iR'SZuJ[YSh|dV u܋19v̋G,tpH,9H0u0;u"H49H8u;t밉jSP BuVZ1e[^_]UVSÉ֋BVC,S0FV C4S8Vt 9tPCZv蜩 XZFF F$F(F,e[^]UWVS]EUs,1Ʌt;M t A 9A$w1k A(t6󥍅uu@u uVu)tupu A}v;E1qF<ЃPuPuA e[^_]UWVSljhw*#S] "XZ}tJFEt=!Ethh+#P h6Po Wu uShL#j8e[^_]UWVSM8}1}]{,J09K0|;z,wu}ӅtHN,^0N4^8;Z0|%;J,v1ۃ}uhXo}u ǂ4J,Z0J4Z8M]}];{0|};{,w]t8ugǂ؍e[^_]UWVSuM~ t-^,11;E t9vt@ڋutM#1FuF,tF0u SVXN C4S8F V$e[^_]US]{ tjjSW u]UWVS EEM EEEEEP,1 9t @닃uF tu u9tuڋus09wu;S,tPhjQXYu}c2}t6׉󥃣E0Mmu NuVs89w u;S4t EP @+C4S8})G W$U؍e[^_]1e[^_]UWVS@E ]}Ĺ tjjp0jjjjUEa uhEx49x rhyUE9E| 9UvỦEhjJPZYu tRGM#JU1t7E,ى5tE@ P}W N4^8)O _$ VtTXe[^_]UWVSDžjhPjEpyÍPhd@S @[SEP,Y1Dž Džƅ ƅ t|ÃuYtSutЃ 5 u,DžuЃ  A뀋EX@uP@4tPhM#PK ƅEpPhM#jP3oE@@Ep0Et(pv0v,hM#j3VR@0X,H{09L;C,P{89T;C4 PCPVW ^_;s@\PVƽ ZY{u1}ZEPEPEPEPEPRUEPEPEPEPEPh:!VUS4 UuKEyt2t410t1w%1RXu kD{2[^]Ã= O2uU O2]á O2UWVSRkD{2Ph5$j RU hq{2SPh@#j(W {2U{2{2({2dž{2kO2D{2 O2O2ȍe[^_]Ã= O2u*UREKEkD {2zu9kD {2ztUWVS EUMU 1EH1M] Z@ BB UE@lUBE@y O2CFU,U9u O2@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU P茷 1]UWVSUE}u NtGrtPtGtvpSD GPh5$vS FD64t(vtvPS e[^_]U U1vEEUEP.U EZÅuUWVSS0uƀǀǀ6,u0΅t,ƀ})׉+u؅u^[^_]UVS]U M1k N( u2؄tdR M ¾19Mt"Au81u.R E@M,9du ǂdd[^]US]MEE k B(u"1tQЃ<1!ȃ;ukE U1uQЃ<![]UVSu>HX |whN#h"hxhO#|1v ǀ%|@8v ǀ@ ǀe[^]UWVS0]M=@k2Uщ@E =~u\LJ`M {| {@8w CP1RP~{ tnURjSPL t[EċUȉúuFǃ|=wƉ׃!! t19| 9vsjhse[^_]UWVS,E E thL#h"hhO#qhj0_X1"u臄 CEU^~1CCCSƉ׃s {$Cǃ?ǃjh>RPԜ@ǃEPuZYt!EԉE؉E܉EЉC1҉Y؍e[^_]UWVSSÉ։ʍNF(E19t t<w1(G ;Muߍ uZ[^_]US]= O2u19 O2v(1Ҹ9tkD{2B=v1kD{2[]UWVS}u] ,1S3,FZU;uK E4t:tSDtSTC F<wB<< w < sy<w <<g<te<t<[<tYw<tS<M<tK< 7}tPh[G#uu ]Ph-#uuu 1ۈ؍e[^_]Åt*UVS14(FZuS(Xe[^]UWVS]uh5L#h "hj hO#Es0hE?t SE%;}u拶0u͋EtP@^C,t PY`@1d(FZus'X]e[^_]'UWVS]C,t PXjhPjsaƃt7SjR #YXtRWV Wt'V~ZSXe[^_]UWVS]`t0`a󫍓0 Ste[^_]UWVSDÉ1jhPjSf9DžDž1DžDžDžuS1 RPhQ=fU_Ƌ!Džę9u&9uQ!󥉅0%^99ƒ<<„t <lYL0ǀ0Džff=Uuf=u(,DžDžFu1V<RP\@ECǃ1҉K0SP"Z@uS !R ރ{ uF19S$9|9C s2URjSPL tE؅t=u SX1e[^_]UWVS}u] EVЃ<‹шMt&`t[t hZEVM,SCv s Ct{UǂǂƂ}DtPDX}1`t0ǀ`1ɉUtt Au11U‹M9`u Ɓǁǁ019Et0…t1uCO#n00U) A0U9u1`t'0uuMMǁ` 7`EEe[^_]UWVS,DžBjhQRPyPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< E EDžh1󫋅,t20t"uhQ#h"hhO#ڻu3u/ƁƁƁƁƁƁ}} t~1É1uvB? ڈD>1É1uvB? ӈ49fDžU1 uEWVhP腏 0D1YWVKƋ!DžS59uC9u;H!؍S蝎SZ9u 9耊X؍e[^_]UWVS uuh(P#h̩"h'1Elj1ۅuh$h̩"hhO#-FVEUȉ ;U|;EvSQuuN0VFSuW' e[^_]UWVS|] }Ĺ }t ECuhw̋E0h jP]S jPSSj S貗ƍ@Z=wʡ@k2EHDEU}~EERWuu-wSVRPw։9]u9Ut@=~ƉЋM\ǁ`@EWVSuE E0E8e[^_]UWVSuE EEE܋EE؋@k20481ۉM]DHM]}~EEˆ=ˆu}|:}?v4jh>uuv=~E?E]E܉8E؋Mt]؉]M܉M]] ue[^_]e[^_]UWVS ]@k2480hc5#h}WuVEPS$xuuuhc5#hWVEPS2tuuuSЃSue[^_]Ujj j\ j P&|UWSq] ƒ1Hh8 PRhDR#hpD* j U=h3*u ~h3*2fPftP貄Z9h3*UWVEE왉UE}ujEPj' e^_]U0E EEEEEEEPEPuU xUÍL$qUWVSQP@u5jh2oz 22п2Կ222XZjV8z п2Կ2ȿ2̿2+22[_29y92G|92s72󥋅22DžDž=ܿ2t:uhAdjtj0ujjjR =ܿ2h<[ P! ؿ2ZYDžt!Ph9e"hP @2Ŀ2 ߭ 8߭ٽf f٭۝٭y1ۃd~dSh}"+PP 52~-=ؿ2t 1t~Hƹdh8 )Vh@Q#Ph}"+PP 1|vt @u4(R#SQh}"+PP +22+ 2y @B ڽ߭5ȿ2=̿2|_vXٞvO߭ٽf f٭߽٭11|vt  @4(R#%%y) ڃݝkdd%1ȉ P1 RPh}"+PP1 852=Ŀ2݅ ȿ2̿2)؉ ;;|- v"h}"Qf +5п2=Կ2߭߭ٽf f٭۝٭?~~ h}"jtPho@ Q輿 ÃhA#Q褿  <ЙRPh}")PPn Ã؃uhtY )PP@ C 2fPftSVPr eY[^_]aUS6 j( X]UWVS] 1}tN[;Ev 717]}u9s$;ut:GFFPhv#jW蠾 Ee[^_]UWVS uU 5E1E1t}J<-to<:tk< tgEz}JM=,I*DGtDOu[ 1;uzu B $tjjEP`  FCU냉|؋u35 5tQ e[^_]UWVSuhZ u ZY1ۅtzEEWEPEPB @tGujYXt9]rE SZtu6Y^9]s uZ1Wb X؍e[^_]U 5E1HPh GZYt H U3 5tP UWVStƉϡ 5E1EjEPEPRRrà @jjSq PjSq @jjSq tvPjS|q @tdj(qYtXpX x@PP@@ P P$PPhhS,hS#7ZtS\qXE3 5tO e[^_]UE]UE1]UVSƋ^t.StPVS{ t sXSYF^ t.StPV$S{ t sZSXˍe[^]USËSKtHKjs '+s _p@S?]UWVS] 5E1hVs nP w rƄ;1Fu舯 71э< tD 8 u 9v릋PVSss!@u#hS#5 Z8t 8#4KE3 5tM e[^_]UVS]sFEEFEFEjEPs Rl @u(hS# 5荮 Z8tY肮 8#tO-FVtPSVKC$F0s${ujs CA) e[^]UWVSÉ։Mjh0j<E @tMj1CUtjhhi#S? "mA!u8 VPhi#jhS臸 Ee[^_]UWVSx|M 5E1ɍEQ@u1щV GWEPS @uSmEP Y[euVq_Z@t܋| ujSZY@uWPVp @u먁}tj)EP|P4 ؋U3 5tK e[^_]UVS]u tSShgPX'u.1҉tShgP&'e[^]UWVSp 5E1u1ɋU@t&}1RVS-l @u SAlX؋U3 5tJ e[^_]UWVS EE 5E1} ~蝫 7S11;] }.41э =wɍCRPi ]3 5tJ e[^_]UWVSQUu1}=Z t.K Mu}t"tM9H s E9Es ؋΅tËKtHJ$K:Bdu謪 7@BUjjGXZۋUC u"tUsC _UE CPuC9Ev5UusY^UusbS\XZGCEC {u MECBCZRhir B$1e[^_]US]t&jP$iǃ]UWVS]1C4umSP ZY@؉Njt6jPF${iǃhi# @utCVtPVjv #v #iV볉e[^_]UVSá 5E1slCIPhhtV艛@u hT#.XV Shi#. E3 5t/G e[^]UWVSSƉ׋@ltH9t*{ t$fujQMPM Mt[Ƀ S Vhj#y. e[^_]UVSÉ1u;j#PS荣SdjS31N!uCj#PSXZe[^]UVSË0 PhJj#-ZYthaj#hjj#S[YXSjj%C CDF0uj)&XZe[^]UWVS։ρH4@l@@tF{ t;  tC[^_]UWVSSƉ tBωU6eXۋUu hT#,K  yY t6!Z@uhT#,Xe[^_]UVSQuEF@lt{{ tpEPUtzt zHtESQ0ZtEjS_ZYtSL_YtEtPtSǞZtE[jEPv *c uDjv FO F@l t"{ tSVIZY@u hXT#+X[ڍe[^]UVSÃxDt'SDCH~t$KDXPCHX{Lt'SLCP~tKL^PCPY{\t'S\C`~tK\ZPC`Xt1 tV.A, XǃXDt1HtV@,HXDKǃDXLt1PtV@,PXLǃLYt1tV}@,ZǃXe[^]UVSsjjjSjftRs@sft DB=<vD%8r 1эy}w{M}t+MBȉC`uY t~z txjZ\Zu hU#'XYǃ`f@S\P1.19`v$k\рyus1\D@u e[^_]Ãx tVtxDtAUSP%Y t=uSX^ZSϙX]UWVSu~ % Eu s&`u!V Y}t uU1ɉ%@Eu s$`uMV"Z}Mtuts `u1t%e[^_]UWVSEp0X4ف` u %@l8tf%ځ tW Yt ߉%ځ@ tW!Zt 翉%ځ` t1r rje[^_]UWVS]EC0snugCl0t0VUZ%t1҃wS#R Vhj#$PvS_%t"1҃wS#Rhj#$[^1C7thj#$j Sh{jC01vhj#*$EP8ZY@uh8U#hj#{$[_Hr: ƉEt }th8U#hj#J$ISFYtPh8U#hj#*$ Ku]jWuh[@uh8U#hj##XZu]Y_@uh8U#hj##j~jjhW$#\ǃ t!jPjWjWWd]K0SuP]jWu\@uh8U#hk#W#XZu&]uhk#"K4je[^_]UVS]hf; &#C0Zr7Cl0t~ u hjj#V菄YXvjXZe[^] C0]e[^]?UWVSLu] 5E1Fl}t)PFIPhj@W@uh U#t"EYEF ESWP6^ǃuSuh=k#! gtj@SFpP SuhOk#!Fp6\XZt"Mp@pxdu6Sg _hjRphpd`Phk#% u ^FThjPjTK PPQhk#FN1҉DžXX9`vkX\jWT t:hjPjWPGPPhk# WEXS_)Y@uC Phk#XZ tk{ uS%!XyS TXtES9_{ u81rPSZY@uC Ph l#hY_t{ uSyZtSXE3 5t4 e[^_]US]@2tt#jASZY@uC PhT#hyd  ]]UWVSUMu { ;u}E4WP ZYu{ ubFuE;E tx}tChl#S}MUOWVSKSyS"/S5&;ut"C MUSX[De[^_]UVSE] ] @Ih#h_l#h5l#K< Cl+STU S@Ue[^]h%l#hEl#h5l#' 1h%l#h.l#h5l#  1hMl#hWl#h5l# 11C2hfl#hol#h5l#Cl [hwl#hl#h5l#Ks8 @uPEDT#e[^]El#e[^]{E El#e[^]u Ee[^]e[^]US]SS Rs$P3O]US]U M{ u,C { t][][]UWVS ]]} SEpl*XZuO { t'C Phl#9^_CStP }OlQSS:[E jEPjEPu] EuhT#8YE 7SuyXZu螑 E ~ WEplKYXt5{ tC Phl#jXZF$C$N=K=~=tlC))`FVtPMQVFE@lPV2VP~ t'Whm#H@Pu?NGClHO9OH tWhʂjjjT VDslEPslSEsle[^_]US]SOZ@u:Ɏ 87u ]]F賎 8 t詎 8VtET#] ]UWVSHuEE} 5E1u Epl0[ZEPVZYt)}v%: 7 ShpT#hyd  X1C)E8C=uQMVu= Mt/jnt2Nt$kuȃÃpt xu뱁멻뢺뛉 0=*;Eu EjE [^jEE;E}_]4Epl4ZYt8x t2  tE뤉EE;E|*1rtC0=*;EuE@lt[u4EplY[tE뭉UE BBB BBZP{t/T> BBB BBZPЅujjjPVu?EVEe[^_]UVSEu ]MUuhu#hU#hhu#lnp4X8Hv ~  DCu EPj< @؍e[^]US]sCCC4C8XCt6HtJKHP=ڋHtJHP$YC uKHtJHPZCuK HtJHPXC$uK(]US]t sD=ZSX]]US EPjZY@tkjPjYXtZCCCCC C CCCC C$C$C(CLh@,CDZ@u SXX1ۉ؋]UVS<]uhu#hU#hhu# lCH{HIC,tC,s0+su;!1EPjEċUȉEUFV YY9Uu9Eu N9M~@ 9U|79Ev2VtPS VvVC(F0s(+EUEЉUԋN+M̉M؅yEЉUԁʚ;M؍EPjEPjjsDh;u{ 8{ GUus@uSC~uV ufF PhjWPVsu ju$QE0BEXe[^_]UEU tt ;Pt@s 1]UE@lt @$u@]UWVSuU \ 5E1`$jF PSi \‰p f%?-oSPf tpM3 5t e[^_]UWVS EE؋u } 5E11҃~ ^Ku.{uTvOjvPC PEP Uރ,)u'K.t/t  uSt uC L MԋNN9MwtE؋@lt 9St[&r ؋}3= 5t e[^_]USQuu u à @t4EjEPh@hS@uh`V#h?v#0XZ؋]US]SarZt jhj @؋]UWVSu] Ex 5E1FDžj'_uhhV#cSu8Y@t)@jhj @u&hhV#UXZDž}@ txutPp[_uSC WP+ ZYt-[}Px0+ [_YE@|Dhj萻XZhhV#;X0X}t1ۍWx4A+ ZYt C9]u19]F4% ۃ19~L~jPFP4萈 u 9~L~1G19~T~jPFX4b uFTt 9u1G19~D~jPFH4. uFDt 9u1G΍WVqZYHWhMv#o~DDž@uWV&pY_Džp Dž1]7G jPd @G$@ ajPOd P  yhPRtP# Dž@tRhi/a @t @u WXX@G@GG@WnYZ@tGHG@d_ t WnGDZGDG@G8OHM3 5t e[^_]US<t6r$B<Ƅ<ttu ux []UWVSljQW ZuhlX#!ÉEh EPzZYtfP$ XuhlX#S謺[_LUj@PVCN UuhlX#SURv q7S]Xe[^_]UWVSÉUΡ 5E1эDE>"ux"MF-VjǍ@ZYw;}VSZY1}u>t tCE9u|HMt 9MyN\C~VntB0bt""tt@xtKr     E,I*UNMۋUDJt!UۈU~MDyu~~U}EjjEP  ZE1ҊM܉΃0wGM܈LBu}t=t9jjEP S =~tCtCEE{}u0@t+9Esg 71}F4M3 5t e[^_]Ut t t t@1]Ut8t u@ t1]UWVSEUM܋0R E_uhtX#[nj=u4 ZYÅu"uhtX#hv#uXU1}ҍBE1uu+u YX끍EtuuRUZ U}t#Uu; XۋUtLRʶEXqCE1ى։ً}ID1MEPRY_MuhtX#urXZsED3 0uUDuIEXFGjGPVI uhtX#XSXZ18D8u؍e[^_]UWVSSƉϋ]jhv#RUY UuUDHMlM p}M U@} ð`jhv#R:Y uRLPMtu xU}Mu ðD Ud} hMCuC0UCP} pE$e[^_]Åt9utUWVSM։j/Q2 _ZxEPjj jjj jWF }tWhv#,t VPZYut?SuZYuuhw#gZY*tG/t 31X1u1ue[^_]1UVSQÉ֍EPjjjjjjRkAU uȉ3jIZ~C CHuC1҉Ѝe[^]UWVS]s ^{X19s v WF,Xs>C C{$Y19s(v WF,Zs$C(C$Xe[^_]UWVSHljUE EȋEEEE 5E1E1zw $V#1%!@!} =5w#tP胲XjM11"Xudž ]܃udžhX#wX S_tjMȉY@t 8thW$#Pp _Z dž[D  3 } U }u jMȺYuhX#hOw#XZt .uh\w#XƄ  u%r ]}t. jMȺ_uhyw#^)1}}k 8a Eu G8PY[}EPjjjjjju= } uhw#cXZz}WEPjhjjjjudB F } uhw#^_.} EPEPEPEPQEPEPEPM̋Uȉ /}EPEPEPEPQEPEPEPM̋Uȉ\ juuuuuuUNtuh}"mY[juuuuuuNujuuuuuuM룁*M1tdž}tdEȀ8t\j/P+ _ZÅtCj/S+ Y[ÅtM|t/uK1atpdždžVB}EPjhjjjju,@  }luhw#XZ;)=jM _uhw#^;<;D;}bj,u* Y[Åtxuuhw#5XZL9EuIMA=jn_uhtm ^<s%Ɔ<EPjhjjjju> E, }thx#[C<)ǍEPSZYHu-[ 7B<U?+<?jىy_<MȈ=<><D<}5MȊ (4t MȀy4u Ѐ EȀ86t x6@v}SEPjjjjjjuc=  }uh7x#[^$}}xWHGDMGH}j,u' ZYt }ҍz }WڡXuhX#NY|uhSx#WSd 1ɉ7SK7#}uƆ1 h,= u _ZuƆh$$u Y[uƆ hax#u _Zthfx#u Y[uƆuhnx#_XZveQƁ }t. jMȺ0l_uhx#[1  }EPEPEPEPQEPEPEPM̋Uȉ juuuuuu GjuuuuuuFjuu}EPEPEPEPQEPEPEPM̋Uȉ juuuuuuF(juuuuuu]Fjuuuuuu9Fjuu}Kj=ul$ ZYuhx#)XA@Ej hx#uJ uG1҃uMtj hx#u3J ujhx#uJ uM1nujhx#uI tFjhx#uI t0jhx#uI tjhx#uI EÅuhx#X@EMčUE@u sM1ҍE@t W~#XtSEPS1EPCP1EPC8P1WSPh%$t1ɋU`}ujhy#uH M1ҍE @CW"X2EEPESX1EPCPK1EPC8P>1WSP$$W1ɋUjhy#u(H tjh#y#uH uHEPjhjh\jju1 }uh(y#J[^aj h7y#uG j/uO! ZYDžtGEPujà uOt?EPjhjjjjW51 }t'uhDy#^_Ɔt GKuhey#1}Y[UXuMȍUE9[j/ug _ZuEjHPLj6 LHJHM HJHM MȍUEj/u Y[uEj@PD5 D@J@M @J@M c}@}WPGLMGP4 ߃  ߻E6ÅtCM1ҍEWyjP@PT4 TPJPM Eȃ}u} EPEPEPEPQEPEPEPM̋Uȉ juȍPuuuu?6P 8%uhzy#XZ}X#u| X^_hX#Q[i}F}uhy#.YFAUÃuuhy#XZ     @   uhy#=^_ EE}t}uhy#9[Q Et @}t[Zuh#u#ZYuh#uY[uhƂ#u[Zuh͂#uҜZYu nhՂ#u跜Y[u@Sh"u蜜[Zu 5h #u~ZYu h#u`Y[u h<"uB[Zu @h#u$ZYu @h#uY[u h#u[Zu h.z#uʛZYufh#u诛Y[uKh!#u蔛[Zu0hM!uyZY tuh{#Y[6}tuuh{#XZE s!t@uh2{#Xs}u hM{#XurWuhh{#Y[d?th#S賚^ZtSw Yu 1E}u3j,EE@PQ) uKhX# V˕XZ2EˋE܋U9vU9tL{tF@E܃,tt5UM YUk,CC C$C(SXE{ECs Cƃ}t&1}эQU܉uĉ) NjEEruE@E1}EÅtCEPjjjjjju<"Eă }*Džt^j11X8U܍B=vh{#XRUXjUȉX E1j@P' uhX#Sܓ^_CMĉ|JЋU܉X}h{#[" }ouQ^Yuuh{#MXZd@ Q@,} hٚ#u [_t&hӚ#u ZYthX"#u ZYuh W}t8>jMȺy[uh{#Y&=uh{#XZ؋U3 5t! e[^_]UWVSEu} EEEE1ۉEX#tM܉UVP YZUMtCcuVh{#BEX#u uVhL!*EEEE} X#EEe[^_]%XZe[^_]UShj1ZYuhX#Xǀǀǀǀǀ5w#@ h_#P- E@0ZY s s ؋]UWVS u ]}0=*t\%E싃%`E>URhX#Puu&t6jj55PىEǃum#UB7um#뭿t' M쉋 E艃Ve[^_]UWVSSEE] 1t 8t RYPZ1t 8t RʎXPXE@lu$jVu  =5w#t.P菎X%8tjjV. tŃxTuxTjPT\DQXFd htV,hXdlXptV,pltXxtVf,xt迍_tv觍葍YtV ,e\ZXZ]e[^_]Ie[^_]UWVSue^R D)Fh Pk+ZYu1DžhDžlEǀ} @7j,j)d^_u hX#Y ǃhj,jl_Zu hX#^ ǃpj,jчtZYu hX#|_ ǃxDžlPjPكh^uhX#ISu DžtDžpDž`@a#h`0h󤋅hdh? dPKƋdY_t ddtPpPdV1ҋE``81։9lXlV\h虇ZY\*hX#5hSu1 1эD 9dA t 1x\'H@Ӌd}h ǃdǃhlDpHtLxPǃlǃpǃtǃxǃǃhZ Ep,H T_Zu(Ep,hX#h|#˿h貉xPEp,蛫 Y^u EUSDžtDžp1} P1DžXDž`TlPhP/\ 1@h uB tO NO NO#N Nu;t\D8 u1t#\u@"u#u u@׉dMh? dPfH\d_Zt ddu `t2P1эD 9dtފ t uҀx\tH@߅tP1h<"\S ZYuxds} tu jE@\`@PEp`Mǃ tEx`p\d _uhX#讽YFEp\ hw#\ _Zu;}duP Y^`h8!\t _ZuA}duPM Y^`uuDžXlXu}th|#\ _ZtP`:tPpPd\ًU E Dž`DžXT h Y^Xu!}tSu5 XZPu؍e[^_]UM U9w]UU19U t]UVSjjV% à tSV`& Sk ۍe[^]UWVS ǍrXEEE8ErERWEQM Zu M};]s-M)ى"9sFACF"AC;]s M)1e[^_]UVSM UqTuh;~#ht_#hZTuh}~#ht_#hhO~##FD+CDtF@+C@u9we[^]UWVS _XFttCttCx9FxCT9FT,C8PF8PZYtF| C|CT9FTSVY_Ftt.Ctt(C8PF8P_ZCx19Fxu CPFPzZYSj1ZY@uP- 8t h|# XVj1ZY@tN1Sjr1ZY@uUl- 8Ut h#ѳ[1҉t5UVuq V U2- 8th#蚳X1늈Ѝe[^_]UWVSP}tCppjjV à t+jSV 9{TuESV S Eэe[^_]UVS$E 5M1Ʌuhq#h_#hPTuhT#h_#hhO~#uh#h_#h߃}u>pPS XZt,VSd uh#j ]S6 VjE3 5t e[^]UWVS8uh_#]Sz h_#EPl h_#}W^ u WV3džN0$} t} u2SVSVڕ_Zu1ҍE1ҍEe[^_]jjS  à `jSEP ES ;U 7S9;U tSEP ZY CTpESP YXC|twG|tڍEuEGT9CTuG8PC8PuYZuЀ{Yu Cx9GxuCXPGXPRYZuWu W >Et*SP( _ZtbHT9KTuZ8PC8P ZYtE1ɉ-t8SEPb SEP 9t * h_#臰S^[_]~pjjW à jSW} EC C9t ;E SW SEPW ukCTtF0V4% s=t8ڸ#SjH-ZY@uG) 8t=) 8t h^#襯XS{Y]:;E TSV8 SW 9t( h_#`S7XZjjuV~ à u=UEuh#hP`#j;h#Ptt ( /1UEuh#hD`#jQh#Ptt D( /1UUuh#h0`#j}h#zJttt8( /1)z 1zuz uzu 1zUEuh#h `#hh# Ptt1t-' /1xjh``#PE UUuh#h`#hh#Jtt!1t>-' /1/z#1zuz uzu 1zUWVSu] }uh#h_#hmuh#h_#hnh#Fu1Q<u3FuFPhP"WSW1 WSPFDPSrÃVWSPFP訨Ã؍e[^_]UWVS]u uh##h_#huh/#h_#hh#j{t~tCV8t )mSZtVX1tQ>8s<t<t(vv1WVSC e[^_]UWVS,u 5E1uh#h`#hFE<t<NFẺRF1 G!)JO9tw$ cu@)ω};Er181tAut@;Es8Eȍ$ /`1ۀ=2uU}Թ1EӈE2S}WLWVth;#h`#h'h#21ۉ؋u35 5t e[^_]UWVSSuF<t<u # /E UVY1ɋU9}Ay1Åt)ѸC+E 19}B1ۀ=2u32VZ;E thS#h_#h`h#2؍e[^_]UEU uh#h_#huhm#h_#hh#AfPUWVEu uh#h_#huhm#h_#hh#fe^_]US`#tPhz#. XZ]UVSuEPu V$ uVj*ZY@t؍e[^]Åt3UWVS׉ƉˋtPWh#Vu 1Íe[^_]UWVSƉl 5E1h\hu1PhPXZhS^wX`dh#l Y_u?dtdx\ jV_Zh#l ZY1lѿl|6h#PX Y_th|j#lB _ZDžt|h l* ZYDžtdhrj#l Y_DžtLh l _ZDžt4haj#l ZYDžthjj#l Y_h0!T Zu#Ph#S @CF PhȀ#S{ @*lhՀ#S` @@3@V蟿 Ph߀#S9 @VDb$t "Ju%#Ph#S @v@h#S @FHPh#S @v$h #S @ojVyPh#S@Qh!#Ss- ZY@=@ltQ@l9u*B XPh9e"SA- @XRɉXSj v&ZY@XuSj^&ZY@hjj#l ZYuWh2#SZY@Q#\t#Ph>#S @w`# h#l ZYtBh|j#l ZYt,h lx ZYth lb ZYuh2#u0`td`xtXhW#S&ZY@hI#Vu VYӃudtdx\빃ujV+YZh2#SYZ@~hb#SYZPho#S @VVr|Z%tPh{#S @46}Y%tRlu%u.\ tJ4Rl|Z%u lRPh#S$ @uh#SZY@~ptFpPh#S @~HtEvlFIPhhpRl@tlRh#S @Tub``@A`q PVhC#SR@\C#z@>dtyd@dtldqhPVhC#S@uPu`u)Vh#S耥 @~1\u_ptڃPtV<YtƋdp`p\Vh#S+Ph9e"Sb @\0uSN SsY^uh`#Zh419v$@u9v8uh#h`#hG؀xth#h`#hhԁ#} h;vvU UEE LB뻍EPVPV WEPVjuEPKǃ(VXt  8uuuh`#hyd  jEPV @u"F 8th`#h 詜EY^Eƒuąt@Puh`#h-#蒜(=t!tRkPuh`#hD#hEt>Ft4jVj@uh`#hO#XZE6뾋Eče[^_]UWVS85,I*u1ۿ1U u9t\}tVu01ۉο.t-uu AtC? 1A븀y.t"1_t܋}DWu  "  1t 1ZY[^_]USӋPr+u-u/u.1rO@مtF9v@ 9vF T s 1)Ӊى[]Ë D*Q D*y ;0D*| tD*J D*UhD*PF% ZYUWVS]} u uWS ZYt1rD;W PS t<.th S< Y_thk"S+ _Ztj h#Sx ttj.S ZYt؍e[^_]UVS]u ' F Ct h#' XCt h-z# XCt h! XCt h  XCt h#t h#t h#t hł# t ĥ#@thԂ#~thۂ#ssh#fsh"Ysh#L sh;"?sh#2sh#%sh #sh# s h=! XCt h#  ^Ct h # YCt hm" ZCt h)# X e[^]UVSM] 19t 9t&B,19t 9tB,1[^]UWVSu} 5E1SZ@u hm#hs#h4#WV  RPPShm#hs#h:#WV P 9v)WS"ZYtP9w)M3 5t舯 e[^_]UWVS UjR EE[h EP ZY;tjhv#S_ ujhI#SH uu1;}tDF uG,>tSP ZYtgEPjjjjjjS }u9uBu1;} t>Sv } ZYt)EPjjjjjjS }u9tG,Ëuu_ } u,Fu&u_j [@u_X13UM Iw ؈!Èe[^_]UWVSM 1}tw}?to1҅tQ1]\t.u#]<uu'7t)Kt/B t B@뼉)It t@[^_]UWVSEEEUE E܋]E;U5EEErE,@x% Vu<9utBE%?B ȃ}uz}E؁}E9Ew E;Uv "q}?v ^E}DEt,O;Mv 78ߋM_.MI+MM;U"}vV I}}t 9]tC }Ut;]tC } t}tME[^_]UWVS} UEEE]EE9E<EEHs2$ a# a#Csxu*y&5,I*DFuU] Ut\t(x$5,I*DFt t/uvUM M\Uutvmf\\E t0vP\0C0C0KEtt OCEt6u 7%sEu EE[^_]UWVS É׉E E 5E1Ul1PSYZ@Wh9e"Sl @}uSj=_Z@u$p hd S6 @u@ s>VhVhLPR sVS[; E sVSS:s1VPhV@Vh9e"Ssh!SxZYsF؋D<0tu NusSPmY_@u;Q;u@tPh5$Sj ^Z@u3tPh S @G뢨tffPh5$t&ffPh Sm @b t Ph5$@tPh S7 t%7@Ph9e"S @sZj.VWj跊tcVh9e"S @tQ?tG1ƅ@CtDžC8PZCPFƋƒ_u9Yu)CT@fCXPZu ttC|u Cxt Dž$usT1fDžFf3򈕼hVShW~< tNFtnt󥃅MS8,u CTPtHHt'CstHHt󥃅 t'SXsXtJJ)fSP蘶 @؋}3= 5t荗 eY[^_]aUWVSE8E 4 5E1DžHDžL"DžPETDžXDž\jjDVjjHSR @uD1R?@ZtjjVPjS u<@ HX<@D<@;<9rfE}C EC$E1XH%R`-~pQP\0 u35 5t4 e[^_]UWVS$]u 5E1HjC PPu ƅS'PhIi 0 tU3 5t薓 e[^_]UWVS$] 5E1HjC PP ƅs@CPPhji C0 C(Pjbj萞 t9| 9v)1ɉK$C$ t'9| 9v)1C )1){(S,C 1U3 5tl e[^_]ÍL$qUWVSQ 5E1hVM 9<t9w<<<s<t]i<oYfffftfH;Pj Pj_à fPpl}~[^tt PRWfw`ڋ@u 1ۃ8VoauQu u=1#u @u )1u PhP/ <SP fwG Ӄ Ppl>}ZY ,PA_@s@F<t#w <WFh<mB1T1jPV`P2 fPehP Pa  41t zuB$H1t zuB(`1󫋽 jWVQ fDžp tVhi@p @un 8t 81thb#h#vY^'(P$P PWjP-cuP󥍽`4pjPPƃ u( 81thb#h#XuXZuu1 thPuQ#ZyQ]UW#By: ]UWVE}辐b#EEjjEPEPjEP觢 tEy1e^_]U]UWVSpu 5E11^ jSPu PhliH @u Shp#_rXZx׃Ճ9t0PhWiHP @u Sh#rY_yrH1jSV VhPi  @uH 8Vt h#qZVhOi @u 8Vt h#XqXE3 5t݉ e[^_]UEx(H]UEUz(uE  V1]UEUz(u E  V1]UEx(ujhc#u  UWVSu} 5E1DžTh@hɍ#sZY@\Dž\PhqB@S @f\u f^uhҍ#ap^SVZY`$jF PRP PRhlBS= @tgTPhfB@S% @tOTVZXt<9~tWv6ZYt(F~DžXXPhpBS @u SjX؋M3 5t e[^_]UWVSEE { u'ssu P C CsKP@E<ǃ;{ w?UMVu ZY}UuE9UsE}uTSS;S rCC }Be[^_]UE EEEEPhgBu UVS$UEM 5]1ۀz(u2]EfEr)ufR-fUffE]EEEM܋EEjEPu 0M3 5tQ e[^]UE@@ E E]铧UWVPU 1tcEx(uLc#c#$DžXDž\jPR  e^_]UWVSSE1ۅt֋E<v<8<6EkJufÅtÉZ[^_]US]XSIXZ]]MUVSËt?C=<v7D%F\@ltL9t(tN\9J\uu 61 Ƌ@ˀ{=v P Sh #9l e[^]UWVSƉ׉h,j@1ZYt;PǀcSc;ufǀ,1e[^_]UWVSơ 5E1jhjsà @toEj}WjhS8D@u S<XCjWjjSD@tU1EfEDtEjRSIC @t؋M3 5tr e[^_]UWVSQMu }]E EtB}w a +C[UU+9v4 "101U 19t9u}A,Z[^_]UWVS EcSct V EE1EEEEtIeBlE܍E];]{GE؄t9}u)N +EeB,E܍Bl뮍CE{ECE;Ew}}4EMt}u [ˀ]E;Ec}toEM9,sC(1ۃ}t])ÉUuPi/ZYU艂(M,؉EU؃}u E苀(EM}}uԊEE} tE U}tM}E苰(u 1e[^_]USSӉʍMQM QMZYt }t1҉Ћ]UWVSÉU䋰~uu;=C*fu( 8uV Sh!#h EjFuPXZtE~uu h/#\gYuVC PhF#Gg EPWXZ}tWqYt'Mw QH1hc# Sh]#g1@3@u j5VUXZEUe[^_]USSӉʍMQM QMZYt}vȉ1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]UWVSS}uhu#hHd#h{Ӊ΋S IuN Ut`t#Cty KsjSPH uh#hHd#hh#P S@fPt()Ѓf2Bt)ЃftB;@=lhPƋ)Љ tjVEY[H;j Ph #__) )Ѓvf9ffB)9wBM;A;;T)9IB<AT)у9B=Aށ==TQK)Ѓf3ȉBQBt BB ZfBtaSVXZTt2t.1ЍH@; BJӋ<t>)9C+<A<<\)؃f||ȉCC1+9v 9,STv Ph#Wt lj󤋵 ƍ< ST S@m+f7Dž9 vXrfكuL>t2L7Pu uKƃv;B,mdDž9h9s 8ttAXrfكuL>t2L7Pu uKƃv;)B,V@)ljHGB+)=+wD@u]3 5tr e[^_]UWVSdush=1PƉGdY_uC 8u!5p3*h$#GZXZ1 Shd#hyd  Z ShuPYN1e[^_]UWVSS]Sj8h^_t*Ƌ]1t!>tCP/Ztlj1e[^_]UWVS(EE E 5E1h1#R脎 ZYCƅ1эyRxXۋuhTd#XV"[^WVhRSZV"9@t*PgPq ZYuhTd#XX1j6]j4@uƅ x, j@,Ph@hWmu#fWPh Vh6#fWPh SVhH#rV$v t"u)fPWVh]#$V(ZfPWSVhj#U E3 5u]e[^_] E3 5tOo e[^_]UWVS] d#tPhS hXZE1E9 v31;Et k, 9t@v 6hz#(PVüG,1;uts 3hz#PS蝼F,܍e[^_]UWVS uEU ‰U] w`sEtjQMWEP Mσu"eSPh#V@tOE_PePh 9#V@t/;]sO;] u{ v0  Vj _Z@uۃ2KD9E[ "VjZY@tθe[^_]UWVSu} 5E1}OEXt t4SQhS@u{Sh9e"V Qt e SM4cPh9e"V@tVj ZY@tuVjZY@u 1U3 5tl e[^_]USS]u<1t0ASu*JREPjZYu1 }vff]UWVS0] E@tHMԋ@E܋E@_tE@o$EPjyMԋU܋8XZtE8 %EPhMԋU܋^XEȂ#t6Ev#EE9}W<  E@Tt EEPj!MԋU܋XZtًEuEE9uEFEtSkXu EEM9t U;Bt;B uEEDɺy*%=t%1=utʉU}uGtEPW諨EPGP螨EPG8P葨WuZ EE@PEPjMԋU܋}ZYu0EEE9}zSBXUURVURVRURV8RVu詛 tE륉E̍HύD 9Es "USəYEUt)jWREP U +M̃ȉEEEz;Et M;At;A uEE}uFtEPVEPFP EPF8PVuŚ "EEu-@tu!uȍC Ph#OE؁ Ee[^_]UWVS4EE ]E 5E1ƅj4uIY^@uƅpup uxl>BV^Ph#試@ujuK_Z@t-0Ph#Y@u6V1P>^Ph͏#(@uzjuZY@t;@#P]Phߏ#ԥ@" ƉV]Ph#蘥@utx,uIPhlPhhV豺Vh #:$@ut 1Dj@,Ph@hVXVh#$@u39 v W~F,X鋃d19hv WUF,X19v W4F,X鋀Džd9 уLPuxh19t k,;>tbAQRMAXZt;s Wh3V3 8},'Dž9hvt׉⋍T9PuERPMY_t'Ph3VC P3R ,xXHSP艳ZY3RWh3PV3 ]3 5tc e[^_]UVSutgCdt'jP?sdV;CdKhClt"jP?slƄClCLCPe[^]W|$wUWVS,7E؋EԍC$ECH{ t/sOCCCC C CCCC CYKsS$Eԋ~ Zt:s(+Es$\YURPWh-#IC0CHL#s$s$'YPWhS#IC0CHp#7{@tCHw#C0u*C8C4s$XPWh#dIgwjWh#vIC0 S8C0u2EEm ܨ#}fE fEm}mE܉C8C9r?EEm ܨ#}fE fEm}mE܉C8PWh#H S4C0u2EEm 4}fE fEm}mE܉C4D;S8v?EEm 4}fE fEm}mE܉C4PWh#pH SpC0E̅t%C$;BuCtuPWuPWh:#Gs$wWuPWh:#GE@2t'CH#h#V迩jE@{HuJCt.Ctu(SJ9Hu{<t;t CHp#CHW#;u CH^#CHe#{0uC8C4nVh_C41RPjEO?Vht`C81RPjE2?0VhKzC01RPjE?s8s4Whk#F({@u|EumKMȋCEԋuPEWh#FhhEPMu ht`rZ  CuP X~Dx;{t5{<t/s$TPF Ph#XE1ɺVjj=s (C CsCCCC CCE CHV1sCC C$ e[^]W|$wUWVStEUMEE 5E1EEEEuWExDEP\Eʑ#ud#Ht ]:tRQE PhБ#C EPP@L u E@L%҃|@w }GLWPE@L@@PEPP@LEUEUh5w EM]^1҉Ή߃=ɚ;~ -ʚ;t Eu}u~Dm]EB"E}EP\Eʑ#ud#Ht ]:tSS$RQE Ph#BMUEE@0E@tt E8Exptj$Pu7% tًE@$Et̋E@ #FLFP]e[^]ve[^]U]|U^`E]UWVS]{ Wh#P>F0+F8PWh#=Sh_jn6F<FLFP$]e[^_]_U`E]UWVSQ] v F FXuEjjS C Ph(#A=_Z@2FHZ#hZ#S4EPWS uq@2t Shc#C=[^jWS^ t jP&ZYF MFuWS3 uh#hd#h h#軥FpH PF Ft'N V$vX]e[^_]e[^_]UWVS^ t9Kt 19N$׉ËEE2rKPC Ph#K9~pG PuC Phޖ# FphCj#S+S;Gueu}F tv@;GunPF/PC Ph#uS#X@4u8sISYtW4@19E싀s> U E샸v0FFO WF=FZ~C$E}tnUҊMM섄tLGEFȀ8t PD)ʃ@v j M@MH@E}uFHL#j3:lvHSGEt F<~pSXe[^_]UU1t@]UWUBv͗ 2E JI} ډу¸)Ј1_]UEt9ʸy,сt1H%]USU ME1t tt9Xu t 9X t[]UE1ttPf1ҁt]USE@ltju S{ u[1]USE@lt$ttH] 3 H uR1[]UE1tztu 1zp]UVSEE t u wm^Qt u ]uTItFtu t ?t61t0t,cScu=cSc =cSc[^]UWVShE E 5E1E@lE}REx :Eu1E@$ h_#EP jju ÃE8uǀxttxpuhv#hPe#h h#oh_#uV虂 E@pZYx tYucXu E@K|EPpB#B E}WSqE@p@ EWCPqC9SVSejjEEP) jjEP E }E8Pl_uqE0b^B$NjuuPbC| SEPdjuEP葄 EuEP?ZY@E@$txtiubXEuVSrpVCPhpE@pEPC8PRpE@pEPCXP

FxGptPFXPmY_ FYWu' WEPa9tjju舁 ǃ uVuaXZjj}Wg ƃ VWՁ VuVaъEU3 5ti/ e[^_]UWVSuF PF Ph#kVjvǃ@uAM 81t7C 8t-9 8t#/ 8th@e#F Phyd  FtPF9CuBN 9K u:KKtHJSS Xt9^puFtFp묉e[^_]ËRpt2US1rt tjRZY1Ë]USQ]uJj:ZuEh0e#XE%@@@ @@]UWVS]} SE^uh e#Pt Et09Pt jP+XZjWST ƅu&j4~Xt^FFF`EF EFE0YE7#N }WPh#jQME0# IC$Mu4!PWQ Sh#Vj@u* 8th e#h5#KZYFt(VXFtE@F0Ep1e[^_]UWVS]7~uU%t=t&~ttj3HaY_vHSSuj3/a~$jWS t'N(9H uN,9Hu PC PhG# 5v8v0F,PF(PWSu ˌ 8u| BtBpjWSf Džu Shh#$XZIFptN$9Ht~pFtj3q`Y_>uvHSwtXZEe[^_]Ge[^_]UEt tH]UWVS]E EEMu}U UU$UU(UuClu _QPEY[KP^Zu赋 0EjVuT Ã}Mt}uQMj4cXۋMuEe#e[^_]ECCC CACY t4;C t/C 76 WPh#jC Pĕ}t ECCECc%tOt;C uDStPQSHwuSu\à }u]e[^_]e[^_]UWVSut:t4;Ct(L* PjCPC PSF PrljR$ȍe[^_]USEtDt:tHtJKHP#ZsX]] ]UWVSơ 5E1h#0PÉ4_Z艉 8th#he#hyd  4?w+j@O0Yuhe#dž4@0 @uh h#XZtWhh#LY_@tEhP40Ph\!S[Ss @t ~4<1h#he#hyd  tSs Zh#' dž4XU3 5tJ' e[^_]UWp0_ Y_}USQRK YYS]UWVS ÉU苰x W,HFEFEZ EtUu/ș9U|T%9MrMXvXQ FFXWښSh+FVRPje[^_]UWVSHDXE0E,MEPslCIPC=P)SMU E uU ƒBue[^]UWS]U vX 11Ѓ19tBt e#1[_]UWVSá 5E1t΀yv u1y tAT rs@lt&B$uRSQXttGpCx h#XڍF PS_FPURUURCP_FTs Kth$u WC8Pg__XC9@VCXPR_ZY؋M3 5t e[^_]UWVSSEϋt?u[98ut1҉tH|PuvRXZ61e[^_]UWVSQMAE1ҍt jVSjjV3]e[^]UWVSuFXPF Ph#Vj@u3:~ 81t)0~ 8t&~ 8t~ 8t he#XF@tEPV%ZYt$C@u NtHUJNVI^‰؍e[^_]UWVS EEEE;} t!CtGUBC8} CTS%t =} uKtHuNKjC@P2Aƃ tC9FtSYCu+t'E Eu}u EPjXZEPVZYS-X} ue[^_]UWVS} 5E1E@l0tWuvtCPEP'ZY@t+C@3Eu!CD3GEuCH3GEu CL3G Et1ۉ؋U3 5t0 e[^_]UWVSe[^_]UU<t&t9PutƀU] ]UWVSE 5E1 Dž$ 1Dž@T(Dž, 0Dž48Dž<0j(P8 uhf#{$(Dž0@~j.SWj&w Sh#P(P uhf#x    0P<wSh*#=tSPhK#p~u F t:p hh#11ҀuB,Q{dmOYYh#MXZBZ<PSX0<CxP!j0spjjSjj C`y t[j@t/tJjEY[@u8h#TXZ$hǞ#_XthjOXZrhf#bTz4sT1BTuyBTɉJ ȉB$BTtƅ sB P ]_Rz@Bt z$ jRZYuԍB4PRr^_h#YIKu@%@ PDVQƒ{x 󥋅t ǂ@z4sTz(r4C|BS|UjB@P -jRZYƋDž E3 5tCe[^_]UWVS] ED1E9Hv31;Et k,9 t@v 6hz#9TPV4G,1;uts 3hz#TPS4F,܍e[^_]UU <t.t9PuƀRhjjjUWVS}<u1-0t9~t6^xtuu S u؍e[^_]UVSE<u1(0t^xtuu S u6ډ؍e[^]UWVSSu10EEPdž<ZYtU9pu 1ɺGECltu6@8t&jP|8ǃ8e[^_]US]<t9XuPxtJTXt 1[]UME <t t9Juut zdt1]USME <t3t-9Juu쀺uZ`ty @tѰ1[]UWVSLEEE E 5E1EPjٳE<Y^EE9CEuh#j uVOCPVh#u" @usXsTVh #u~"@tuuVh1#ud"@tċCD1C9Hv W?F,Z拀l1C9pv W?F,XCPECLE}EfE9Es0D SM@uklp1}9t 98t(A, DH1M9t39tF,}OQuNQh PB PEPu2< UU)U0{x1t=WTu+ t%pWXRPEPh=#u @O?뿋]3 5te[^_]UVSu F<t%tF9CuuVCxPuݍe[^]UVS]<Sjj[<1҅t#09Xuƀلt9j3p%Y^t=t h#SX*XZe[^]ÍL$qUWVSQ Sjju SYEEhʚ;臐 Eu}Z1҉uЉ}ԃ=ɚ;~ -ʚ;tUЋMԉUMEm]EB"E}PP$C PhK#{Sh EPj$eY[^_]aUWVSPu} M<MjWC PS_ Mtۀ8$t#MPCPC Ph#<AS<jVMuC<St%9t9Putuxdu׉Ue[^_]e[^_]U`i#Bt f9 t]UWVSu E} tP}w @ 'fɋ] ]+9s? "1Afҋu]LP19tu692uA,t[^_]UWVSÉ֡ 5E1|tH1Dž9t ‹T @1#hP-_Xt,Av# Vh#hXZ11Džf|uȉC|t=C1ҋ9v9 fft ӉBԅtffC 󤋅}3= 5te[^_]UWVSj EPjEPuVWPE PhK#l(`EEEEP1ҋEEYtE&EƀVf}uEąXgEEEPjuSUэ<}))Ufw#_8 E Pho#վXZ}عUʉUEȉE9v'8 uuE Ph#vtEۍEjPSw uCTuCTcT{4uEC$U9S tKTS C  E]}uuE Ph#Ž f}t4uVx9ru}GxEȅtMQ|t9suF|Ev}}EjhPu袿ǀ~fEfE{(uECE};};E}3= 5t1e[^_]UWVSÉUM} w Shܠ#6 u1ɋUY5 EdžF|Fxdžu }Wj=XZƆVWuMU{ZYu]>t}t Sh#[^=V\tN`uh#hh#h hB#$ƆVWuZYe[^_]UUE MvɉME BE]{ 5 1]W|$wUWVS@ 5E1@4}1}g#SL\SP`}̹}EpDžt\xDž|E#jj@ $ uuu t$;u8u=fDžxLƅfDžDž9Pv~Breىu3t.ufffƅ,ltffG1Bƅƅ-ƅ ƅƅ΋}3= 5t"e[^_]UVS]wShGj谕F FF$ F(F0XF4F,D@u Shh#hyd $ ]e[^]!e[^]USPh)j$@ @@$@(@0@4@, @8C@u Shh#hyd 苜 SX]UWVSuVhj葔~ ;u Wh#* Wh#XZC C,CC$ C(C0XC4@uWhh#hyd  e[^_]Éue[^_]UWVSu~ Wh'#gC CC$C(C]e]UM E]UWVS ƉUϋtH0X4M]tVjjP艂 u  }EU ƒ ~Dw C CC$C(C0C4C,C8@u Vhg#hyd 腉 VY h#VXZPmA XUsdRC\CdS`ShC\C`Yt0Et*E%M s=tu#WVXZsdRsLRsTRSRdžCltEtu6@@t&jP}@Oǃ@e[^_]U11ҋE]UVS]Sh'jitrSh1jGSh)j2 ShjSh:j wਆte[^]UWVS}] su\CPuV~ uP@2uHt9u0S@FrtShPC{tuSPW[e[^_]UWVS]+}w~ EEEE싰L1E9Pv VG,XEt1E9xv VrG,XE싰1E9v VOG,Xu h&#EPy @n{EpOv"GE܍FE؉fȉM;Mv ffكM1txE;Mt9ufft;Mt 1E,ԋGuPeZYMU9xu"M싱LP19t79t B,t)EuuhTVEP Ruu0 Et+]SRWRhTPE PuuE0s }}u+uuNXЍe[^_]UWVSVuhhjI_Zuhg#蟄[xǀVjhW$1҉Fu$~ t~ EWhg#hyd @ EǃP/#h/#VZYe[^_]W|$wUWVSX t$@+BB"E}+ ZM]m[^_]g_UhpD*h #jUWVS4ƉU)'h#6 Y>F h#ƺFfVRVRPWSPh# j.]SFPj~uj.h S Sh!#j.SFPj~uj.h S S6F^(ZU)ڃ<+tnw<<h&#7<2t`w <,h3#-^<:t*<<h+# C_yh9#CPPh@#Ih]#kCSPSPha# CSPSPh# %Ph#ZY9]h`  Xe[^_]UEtu2@2 2@2]á22t9W|$wUWVS$21B23*у 4f 4 s f2.s f2N s/f2f 02f 224 1s22 ut122 22 2f23*Of22ff2f2=`2tjV̸Eȣ2Eȣ2ZY3*X242U1E2]52 2jh254ƃ x9u h#董XVS52hA#E 4Hujh3*jض p2|2d2h2 d2u|2|2d2"53*=3*uЉ}mС3*Eri d2h2 d2h2El2l2=ɚ;~ d2h2-ʚ;l2|2d20B"we[^_]g_U 4҃Rjjhh2jP`t 2UWVSu9;t 9uCЃ?у/hhww#V莴 =wau+9~Ct:Wڍ>ZY3WA^t u襱[O jh@P臰E DžhRu ?tu*X W@ rSDž}Dž\Dž  1<‰롍C<#u WvZY53*O1j=hx$W ÅNJtG:tNjE@PSuTƒ t\};tu谯^?[tBuG:OMt <:u+Ѐx:t:BK)ȉ)É+9++++S-;ZYu?>Xt u蓮Xt>2 X lj)PWSk RQR ={t uЭX)P9s(PW:Y[uW=F Z_Nj8S1:Dž_SG=X+tEEe[^_]UPjujM UEUH4tPH4X@4L4D41UWVSDž=@4uE @4=H4u[hJ@40(H4ZYu?pbP5H4表^_tADuD4P4t=L4uL4H4u@ @uPH4@4P@4@[u 1MhJP<ڋ ,I*f\Yf:u#t =D4t|0\GD4B|0\u D4Kފt:uf:[\tCS@⍅P5H4dZYu*H4t B @RH4X D듁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u gu ][^]UWVSj=u u jd1^Eduy N{T/E@BMu5])CdPVE6ZYuV9[C MEdEHM:^uS:{{\S:JЀ+1GOT90vtCtgmNt@RtKFu^MZ_}ttuP螝 Y_Phj@ }WChj@ W)j URP U:C}„Ut 9Ehj@ }WYZj URP U:C h^!WjCYZh^!WREYZh^!W:EYZhhj@ W"CYZPhj@ W C YZ8hj@ WC$_Z j:uj ZY 1e[^_]U=4t =4t 1u&hh4h4111 4u1҉UWVS}u=4t 4t)-u(uu W111T u >؍e[^_]Ut E4]UjX44tUP4XUWVSu ]tI1=4uuuVM1Ҹǃ =4uu 31҉Ѝe[^_]UPEPhh4h4ut1҅uUUWVSu ]tI1=4uuuV1ɋU ǃ =4uu 31҉Ѝe[^_]UPEPhh4h4ut1҅uUUP Љ Љ ‰ ‰ @]UWVSBJ ωؙ/ 1Iu[^_]UWVS EURӅtSC{ }tBt 9u Pu}9{uعߋuuNt 91u Yu}YOtYtu;/9Pz uA B @ HtAHJtH;u QuPP ɋZty ut{ u B t{ uFtA B YtSZYtZ;u K}QJPH J @ RtB P HtAHJtH;u Quy uAA @ QtBPQtP;u J}AHtz u$Yt{ uA H‰[tz uGQtB A YtKYZtY; u Su QP Q @ tB JtAHJtH;u Q}BPEtB E [^_]UWVS011Ʌt#^9Zs>~ىJBB t CuGQBJy @Y;9{t) u#G A C ڋJu9Qu3:ytOyzty;uW Q׉ʉA C  y;t_{yt{;uOYt  W;u4z9tOyzty;uWJQ׉ʉA C K9{t_{yt{;uOK@ [^_]UWVS EUBRӅCtSC {}tB t9XuP Pu}9{ u؍{u}O t9yuY Y}uNY NtY t>I u3‹E@ u~}tB tu9puP P}}ot zZ};KH9PzuEJB@HtA H J tH ;AuQ Q}BP PJɋZtyut{u Bt{uItABYZtS Z Y tZ ;SuK KuQJ PHJ@RtBPJHtA H J tH ;AuQ Q}ByuEA@QPtB P Q tP ;BuJ JuAH HQtzu$Yt{uAH ‰ItzuLQtBAZYtK Y Z tY ;KuS S}JQ HPQ@QtBPJHtA H J tH ;AuQ QuBP EtBE [^_]UWVS11ۅt+y9zr9r 9yˉщZ BBBt FuSHSC[yQY s9st)~u#FACڋJ u9Qu7rqtN q r tq ;NuVVJQ ։ʉACKqst^ s q ts ;^uNNYt ~O;Qu7rqtN q r tq ;NuVVJQ ։ʉACKqst^ s q ts ;^uNNYK @1 yU[^_]UWVS EURӅtSC{ }tBt 9u Pu}9{uعߋuuNt 91u Yu}YOtYtu;/9Pz uA B @ HtAHJtH;u QuPP ɋZty ut{ u B t{ uFtA B YtSZYtZ;u K}QJPH J @ RtB P HtAHJtH;u Quy uAA @ QtBPQtP;u J}AHtz u$Yt{ uA H‰[tz uGQtB A YtKYZtY; u Su QP Q @ tB JtAHJtH;u Q}BPEtB E [^_]UWVS11ۅt!9s99yˉۉZBB t FuGSBJy @Y39st)~ u#F A C ڋJu9Qu32qtNqrtq;uV Q։ʉA C  q3t^sqts;uNYt ~ W;u4r1tNqrtq;uVJQ։ʉA C K1st^sqts;uNK@ 1҉[^_]UWVS(ÉыpB1x}Ɖ)M1E‹EЉE>9vסp4Eԡ04E=vEiEЋEȉE 1PUƋU)‰UM1EUU؋U‰U؋EЋU؍;UvENjE9Er1}v(U Uk=9Uv}E؉EEEMnK ECEC{ȃ([^_]À=4UVSh8 h8 h8 h#3*h8 htY hh1#3*3* `= =4um $=4u$X` =4ub` QRPh=#Ӌ53* #=4uN""#=4u!=4u[ ,$=4u #SQRP֋3*Ut4Oh8 htY PhV#Ӌ3* U4'h8 htY Ph]#Ӌ3*Uh8 htY Phj#Ӌ3* UL4h8 htY Phy#Ӌ3*UP4h8 htY Ph#Ӌ3* UD4h8 h8 Ph#Ӌ3*U㡨3*hh8 h_!Ph#Ӄ h8 h8 h8 h#3*e[^]UWVSPU Uu]}1IQujU1IQRj1IQVj͈1I$M] Ee[^_]饈UWVSUXD=4tMjuR3 M9544syuA)lj| D><Í>;84s Ãx$ux x @$D><Í C9A v$MExډ5MA Cډ9svs{uF =4uE@ t D4EX D4؍e[^_]e[^_]UWVS΋M<19t L \$C h4[^_]UWVSx4b 8DžDžDžjjPht4jPTy @u t4j-P p4Pl41 @Hh4X1t9tkhRh#賁 t'ƄKh# X҉uƅ% t5u 4B A<9G$#44444볡3* h4A9}H 3*@3* 44{4o4c3*UH3* h4I9>@3*33*%H3* h4I9@3*44444444ƅahÇ!Qh.#P3*eF 8=4t hKY=3*9=3*}=3*Š 3*P4 p4 d4w5`4\4h4+ 3*I X4L4H H4t @T4 T4 3*D4p5@4 <4Lj=844 =445l4tA 44544)04=4t4DžDžDžj PhL ,4jT(4$4 441X4t4Zv44 4~.9s4D4549v-4#t!9v4=4u 444i£ 4u.4 11y 48tx41ۈ؍e[^_]U=x4u]1]UWVS$E؋@4ӋE!؊ 4M9E@0uЋ h4})r$u9])sF€}t Z}؉E)+FIu*w ?#w)?#w#1;SsS |C@C;Fu ;u Ht FN PH9t9vztFsFgR }t Z}؉ыU؋EDE؉EEɸ,4}t KZ{SC44$[^_]UWVSS9D4t D49vzc41tHNj_6E4h4=49(4v1ɉÅuy}u9 4vb <41tÅuQ=$4@u1j0Qǡ@4!)Y9tPQ$4Z9uč3 4t=41tW9s?9t=4G9r139s*ME44=4}uȉ؍e[^_]UWVSÉUh4EЊMEC1tM9HtHPrʉƉurơ84EVE;Us7<֋G $u'9Ew M9EsE9s 9VvVč{EFg{ t C KD41t]@ 8444)ЉGW׉B B$ωBBC h4544U[^_]UWVSQlj9d49T4vE1 @U`49P4r H4 !ʉU 3*D'QE 3*1 @\4Dkt$t{utF1ۅtËt FSV ÅuOpV19t D@V׃t )|CSKu18l4 !ʉU|ݰ=4u =4t 1MZ[^_]UWVS @4!u1UKDžtƅu4=4.G_,4=4u =4t1[^_]904rUS[]jUVS uuu=4uÅu6=4t Xh8 h8 hd#P3*H 護 1ۀ=4t Eu]j EPhOx ؍e[^]UWVS(] Cuw-1=4Xh8 h8 h#Et!9U=p49v 9w;504w`l4!E!ȉE9E1‰U;]v)E؋E904DEԋ h4EE܋U؋E)ƅ=@4!ǍC h4!u1)]ЍߋU9UtU]܉\ E]]܋E+E])É]މ)]̍ߋU9UtU]܉\ ӉT$EEM)PE,E+EZ+Et]]܋ h4PىEX=4u=41M=D49wE@4u!Ɖu;]w))UDžEƅu4=4uS!‰UuU+U!+E܉E؉‰u]U)Ut EwEG,4/=4t M?1=4uu01 =4t'Uh8 h8 h#P3* E01ۀ=4t#EEEuj EPh'u ؍e[^_]UWVS }u ޅu=4utttj t19uU;04wƅu(2/ƅt%=4u9(4wJ9 4vB181ۀ=4t Th8 h8 h#P3* z 1=4t E]uj EPht e[^_]UWVS } u)=4t1ۃ}#EE }@4ЉEԋ}!9}t< h4E)4lju؋v$u 9Ut )D8@E؋@ EEE@Eء049E T49U s=9UE 1 AE1 @9MP49E w-9Ur@9Ew;H4Ӌ 3*U !E!99Evl4U !9EtU Åh=4t;E";Es_E ؋u؍31ЅEuM=4t9E s+M UU Z%=4E9E }M )U1h9}E9(4w 9 4u #uEEElj¸,4)<4PVjE#EPuqÃu,4;ZwG,4'=4tE9E s+u U ڰZ#=4E9E M )1zE Åt9@4EuE؉ߋu9E s M ߋuMETt)=4t0Qh8 h8 h,#P3*~ E Åu 1]=4t"EE܋E E]j EPhp ؍e[^_]US ]=4t$]EEj EPh_p t*]U]U]U3*]U3*]UU,I*fDP]UU,I*fDP]UU,I*fDPf%]UU,I*fDP]UU,I*fDP]UU,I*fDP]UU,I*fDP]UU,I*fDPf%]UU,I*fDP ]UU,I*fDP@]UU,I*fDPf%]UU,I*fDPf%]UMU 1tt1:]U]UEU ]UEU ]UE]UE]UE]UE]UU1;E t <t@]U]U1]UWVSuE 81ujPVPt C9]s؍e[^_]U]USUE 1 t @B9Es[]U]U塈F*]U]逨UEE]UVS]U ËrNJy;J| uU E[^]D q2[^]U]MUS4#ufh ZYuC u1]UE P w Ĺ#]1]UU1t <t@]UUM 1t#tB,I*t ft@]UU1tҡ,I*fDPf%f]UEtt ;U t1]USEM 19Ut B[]UU(I*DP]UU$I*DP]UVS]u8 8 ;t<8#芫 0PVSh#hpD*e[^]UU 1}w4*t:t1]U8 }3u ]US1ɋE]  Xw Zw 8ut A8H1[]UU#9L$vLF*]UU#9$v=*]U]U]U]US] uShpD*lhS@tv 0Phj7"hpD*hpD*j 4XZEpD*] UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-U]U]U]UEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]U]U]U1]U1]U]U]UE]U ]U]U ]U]US]=5t 51hh5ZYt ]USQ]=5t t5EPZt1]UWVSUt):t$1H@wj/R v ZY1ۅÉ؍e[^_]UEE]UEEEE]UE EE$E]U]U]U]U]UU5#tRh#jPh4I4UU t 1JH]UWVS< .ED$,ED$(1ɋU d1 Ɖ9M u։L$$t$|$ $D$ZL$$9U U֋EЉD$$eEUD$$ED$( T$,t,L$(L$,L$D$ EU$T$ ZEUL$(E L$(D$dD$ 4$|$Yt$4t$D$T$ EU$T$VD$,T$0t$4|$8t$|$ L$(L$D$D$,T$0D$ T$)D$E D$E$舰Ee[^_]9EL$$t$|$ D$,$D$(D$>YD$,T$(L$$EUD$ T$aD$E D$E$Ee[^_]ÉƉJ\(\d1XWVS\$,D$0tMtQt$@T$8xI|$D|$T$D$4$o_ )]D$+*D$4$E_ D$7D$4$+_ D$)D$+*D$4$_ D$)D$4$^ D$ D$D$4$^ T$bD$+*D$4$^ 빉T$D$D$t$ 4$q^ T$D$+*D$4$K^ D$ /D$PT$|$$$m@Ġ[^_]UWVS v 8(l$8tE|$D$T$  D0|$|$D$ D$$JŃt$@t$T$ T$$$+Ńto$$d Ńt(D$D$0D$$kJ1Ƀى* T$ D$t$$$ T$  0D$|$$Jڋ 0p[^_]ɋ ffffffUWVSL _ !D$)/devD$-/XtyfD$1XXD$3D$/$Jƍ$DD$D$FtH4$~ 4$K$D$H$L$` 8$d $h tT$l$$h $ T$$l t#$l D$D$$T$T$$p $p D$D$gt$=~ 1L [^_]JD$$D$D$ D$DD$D$4D$$D$$M@D$D$ /D$p$/T$l$)D$1t$0D$.pD$2D$D$,$5IǃtyD$.tTL$L$D$,$MuD$ D$,$Mts<$IuD$D$o} L [^_]` 8u+t$D$D$$볉,$JuD$D$,$aH`1L [^_]}D$D$ VS RD$4D$D$0D$ D$,D$D$D$D$$tN% ƃtu D$$HD$$<([^ËD$(T$D$$H[^þfffVS öƅt7T$B?D$ D$D$4$Ӓ=w1[^( ?VS N<';V tBǃV <$Gǃ<ƃR y 0 [^D$D$<$ptAR $ǃV <$qGǃ<ƃR 1 [^ 0ǃV <$7Gǃ<ƃR \KĆ GUWVS8c %$LD$/4$@T D$@4$EƃD$|$(|$$UE> D$$4$FD,(D$$D$D$D$D$ D$D$ D$ D$<$h T$$tVuAT$ : u88[^_]ÀR u|$8kt'R 菅 T$$WVS2 $ Q P/D$/4$S <t$R $@ %V D$D$<$FDF 1 [^_]ÿ'늹 노UWVS PD$8D$<D$@D$DD$PD$11|$r D$TD$XT$`T$d1D$D$΅.|$d BT$Q )ЋTljD$8T$tt$=jw 9`2e |$O L$c@ D$@$!Ɖt$tD$4jw9`2xD$X;D$\g 8PT$XXL$dy|$dD$@T$DAQ @D$tD$D$`?Y$X WGW[$CpChSl2$@ OWT$(WT$0@$D$ @pT$(ӋD$0ЉD$(T$()ӉȉL$ AhQl$@$@@(D$8$@ wO@$CpT$ L$$Љ+D$ T$$ChSl1$@ @$@p@h@l$@$T$(_\$ $yy Q\Y`$@ @$\hTl\lW$ALQPGWA4Q8iGW싌$ALQPGWA4Q8WA\Q`:GW$ALQPWA4Q8GW$A4Q8GWALQPW؃ډA\Q`GW$ALQPGD$ _WD$(T$,R $D$(T$,A4Q8ȋL$ H\X`D$8}GWl ] $A\Q`$@GWċ$ALQPGЋWԉA4Q8GWAnD$D$=4$' PT$ D$0tYl$0 EtID$4$胮u+D$0O T$ U tHL$81ET$9UtH!Ɖ11PV twG$蠩<$蘩1[^_]ËL$41ET$9Uu 1 ~o#D$D$ 0,$@<$81랉t$LD$${}ffffffUWVS< A$XX D$D$LD$4$藪uD$:4$;& DžD$D$4$_8FD$ D$ $W $#D$D$ D$D$$#D$D$|$8|$ D$D$/7$TD$t$$P$UL $P<[^_]Ë$TD$SD$$P$L $TD$8D$D$D$8D$ $PD$D$DM$ $TD$t$$P$X $PO3U D$$TD$mD$$P$nK 1D$($8D$$,T T$<[^_]Ét$D$|$<<$|!D$<$$T D$$TD$mD$$P$J D$(1KMT D$$TD$L/T D$$TD$LD$D$ MD$$TD$$P$^D$1S 8D$/4$:D$ fS D$$TD$MD$$P$I D$D$(ceS D$l$ D$$TD$$P$^4$1!MD$$P$2$PS(賭 uD$ D$$D$D$D$D$D$ D$D$D$D$ $ x D$([øS(D D$ D$$>D$D$D$D$D$ D$D$D$D$ $d x D$([øUS(Ҭ ÔD$ D$$?D$D$D$D$D$ D$D$D$D$ $ x D$([]øS\ D$D$D$ D$D$D$D$LM$lx D$[øfffffff »L$0u0WVSͫ Ï|$(|$D$$D$D$ $RG 9w*P ?|$ t$`MD$$0[^_WVSg )|$(|$D$$D$D$ $ 9w*|P ?|$ t$MD$$0[^_VS D$$ƅuND$$0[^VS ÃD$D$D$$ƅuND$$0[^VSx :t$4$蚗t[^ÅtD$ t$NT$$0D$ [^WVS$ t$$|$(|$4$t[^_ÅttD$|$ t$MT$$0D$[^_VS迩 Át$ t$D$$訛t[^ÅtD$ t$NT$$0D$ [^UWVSb $t$(|$,|$t$D$$$Sit(wN (|$ t$MD$$0[^_]WVS  |$D$ D$<$]ƅu|$OD$$0 [^_VS 賨 uD$ D$D$D$D$$ ƃuOD$$0 [^VS a #D$ D$D$D$D$$ ƃuOD$$0 [^UWVS$ D$ D$EUD$T$EUD$ T$E D$D$E$/ Ɖ׋D$ tLL L$ EUD$T$EUD$T$E D$ ED$ND$$0$[^_]UWVS$U D$ D$EUD$T$EUD$ T$E D$D$E$@*Ɖ׋D$ tLBL L$ EUD$T$EUD$T$E D$ ED$hND$$0$[^_]蠦 jT$ w (Oፀ8 ÍÍÍ*Í8ÍÍUÍofÍkfÍEÍgfÍl)ÍkÍÍ7ÍUÍ$Í_Í^fÍÍYfÍ )ÍÍÍÍkÍ3Í,ÍÍÍ~ÍQÍ+Í.fUWVSP芥 TD$|$dD$l0h t#\$J D$D$P[^_]ËD$OD$8|$xT$hD$pT$tD$ T$D$8D$D$hD$<$\$UD$x;D$hsAlj|$D$t D$puGWD$T$xvD$@D$P[^_]ËD$hDD$D$t D$ptM|$D$(D$$<D$0D$,1ۋT$xT$ t$UT$T$pL$x;D$xv +D$0)Njl$,D$(G;D$hs>;|$hs6sD$pT$tD$ T$D$8D$D$h)D$4$\$SD$4Í@|;|$hs<M1ۋT$(1l$%|$$;|$hsGL$$SL$p\$tL$ \$D$8D$D$h)D$$T$\$RT$L$$D$Ǎt$(MD$$<1ۅDt$|$$<_GD$;D$hD$>D$;|$hs0 uM D$(D$$,M }l$D$;|$hsJ 1L$$Mh@ ]D$D$8Ӊ11`D$OD$8dT$jJ /MD$pD$@D$tD$L|$|$(D$<D$4D$$<D$HD$DD$0D$,uUЉT$ *<bɋ\$OD$pT$tL$  t1҃,L$xD$(;D$xT$0A +D$H)Njl$DD$4G;D$hsD$0>D$0w;t$hsD$0w;t$hs9sET$$HD$pT$tD$ T$D$8D$)D$ $L$\$ML$T$$\$ߍ D$4L$\$(D$<D$$<D$09s|$$;|$hsEL$$ZD$pT$tD$ T$D$8D$D$h)D$\$ $\$bLT$ L$$\$ߍ|t$4M\$(D$D$$<D$0;|$hsM\$D$$UCD$|$,FD$4D$$,nND$<|$,=D$xH\$D$(L$L$0nt$x9D$+D$H)Njl$DD$4G;D$hs>;|$hs?T$ qD$pT$tD$ T$D$8D$D$h)D$4$\$ KT$ D$Ǎt$4\$Mt$D$0w;t$hsD$0o;l$hsD$0;|$hsry$W,|$:J|$0)lj|$LT$T||$ |$PL |$Lol$49l$0D$X|mD$ 49D$,D$FF p$nu$@,T$H49FF%9l$4 D$ F l$ 9l$(uD$P |$L$@,T$p|$ |$T$ED$joE,t$0PT$Ex$ RE,0pEH% D>l$LD$L ;D$ }D$$D$$;D$8$$D$\$pD$4yD$4$tD$d$lpD$LyD$L$LD$h$IpD$TyD$T$D$l$&pD$XyD$X$D$ $pD$yD$|$0+D$TD$,+|$|$`|$9~D$|$4D$9 D$T$P@D$$D$|$L$$@,h|$14*D$ D$FF p$ku$@,P4*FN  ȉF 9|$u|$|$D$T$$T$;D$M|$9|$,|x$@,p<$ED$mE,PT$Ex$E,pEH% D>D$D$ 9D$,}D$0+D$XD$$|$`|$9~D$|$LD$9 D$8D$D$T$p@D$PD$|$T$$D$ $@,|$8h|$14*D$ D$ FF% p$#ju$@,T$P4*FNX  ȉF 9|$u|$|$D$T$PT$;D$8T$D$$9D$8<$@,8p,R|$$ED$XkE,t$0PT$Ex$@E,0pEH% D>D$D$ ;D$$~45$9G} D$4D$4D$$@,H1|m49D$\D$8PD$,D$ $$$@$$@$$@ $$@$$@$$@$$@$$@ $$@$$$G$G$G $G$G$G$G$G $G$$V$F$F$F $F$F$F$ F$F $F$$$B$B$B $B$B$B$B$B $B$$$$$@$ $@$$$@ $($@$,$@$0$@$4$@$8$@ $<$@$$@ED$|E$E$E $E$E$E$E$E $E$$$$D$@$H$@$L$@ $P$@$T$@$X$@$\$@$`$@ $d$@$$hl$$l$@$p$@$t$@ $x$@$|$@$$@$$@$$@ $$@$$kD$,@|$PL$gL$  L$PN$al$p͉|$tljT$x$}XVPF9uӋl$p|$tT$x L$pN$D$`|$tωT$x$XTVPF9|$`uы|$tT$xNNjD$L9qD$@=D$<D$HD$D D$XF$D$\'T$`NHF;T$\L$dL$dT$`$NWuD$4D$%(5$9GkG8D$00X3 D$ F$p:%tVPFT$9׋L$L$T$$Vu D$F$ l%$VPFT$ 9׋L$@L$T$ $QVu D$F$H%LVPFL$9ϋT$T$L$$Uu/ D$F$%VPFL$9ϋT$ T$ L$$UuD$LD$UWVSx8h $$$$X5L$8L$<L$@L$DL$HL$LL$PL$TL$XD$\ T$8D$8D$(5T$`T$dT$hT$lT$pT$tT$xT$|$$ t$`D$`D$$5$$$$$$$$$$ $$5$$$$$$$$$$ $$$p5$$$$$$$$$$$% $$$5$$$$ $$$$$ $$$% $$$h5$( $,$0$4$8$< $@$$D($H,$L$ $($($5$P$T$X$\$`$d$h$l$p$t$ $P$PL$ T$D$l$|$t$ D$$D$D$(D$$$x[^_]ÍD$8D$(D$$?D$`D$$D$4$?~$t$<$?$|$,$?$$l$$$p?$$D$D$,$$D?D$,$D$0$(T$T$,$$?T$,D$0$T$4D$0$PL$L$,$$>L$,D$0T$4}$ea /T$DT$ T$@T$T$dž<dž^džvdž#dž:dž'dž#dž#dž#dž-dž-dž_dž|džodž-dž-dž<dž>dž*dž!džf|2D$hMuTAt_ҍvx uߋt)WT$¹ T$ D$D$D$$)10Tl=u[^_]SRT \$15Tl=u[UWVS%T 5|$$+kKGG(9uD$$MjK$3M0T$$MD$ǀ!5ǁ+ǀ!ǁ,ǀ!ǁ-ǀ8!ǁ.ǀ%ǁ0ǀ%ǁ`ǀ0%ǁaǀǁfǀ ǁgǀH%ǁhǀp&ǁiǀ%ǁjǀ%ǁkǀ %ǁlǀ%ǁmǀ8<%ǁnǀ%ǁqǀ`#ǁoǀ#ǁsǀ(%ǁtǀP$%ǁuǀx4%ǁvǀ,%ǁwǀ%ǁxǀǁ~ǀ#ǁpǀ#ǁrǀd"ǁyǀe"ǁzǀ@ǁ{ǀh`"ǁ|ǀǁ}D$0|2~t}tCJt$ Jxt$ƉHuӋt$t)L$0QT$¹ T$ D$D$4$,D$0lL$0l15|$0]]X]X] X ]X]X]X]X] X ]$X$ \l((9u[^_]$>bGt$$<LG$^:G$v(G8$#G$:G0$'F$#F $#FH$#Fp$-F$-F`$_F$|tF$obF$pPF$r>F$y,F$zF${F@$|Eh$}Ee8 D$$4HSFN {5\$l JHJHJ H JHJHJHJHJ H J$H$((9u[fffffffUWVS4M ÔzD$ T$$L$@572D$D$4D$ V 5L$,L$(fD$tD$$a3D$$Ń==2D$g 4T$  4%y  444fǃ V D$Dhfx~L$f8@D$ V f6f(4L$,%y 4; 4ufǃ V D$Dhfy4D$ D$D$$MC44 49)Ņ[4T$ l$D$D$D$ $Cƒ6z4y 449 4Dfǃ V 5f14[^_]ý_fyD$7D$$T$$K1D$$ŋD$@ @1teD$@ 4  L$ 44%y  4f V m1 449Pf V Ły 4fǃ V L$T$$xT$$C0tD$$ŋD$@ @0]D$@ 4 XL$ 44B%y  44D$ D$T$T$D$ $@ K4%y 449 4fǃ V 5f14[^_]Àx4Wy 44; 4fǃ V 5f@|$ AOD$$D$$ŋD$@ @* 4 L$fA 49|$|$ 4%y 44; 4dž4ͅ1l$$uoD$$ŋD$@ @~ 4 L$fA 94tNfǃ V |D$(Q)pD$, 5Q)D V T$04D$ L$D$D$D$ $s>A4T$04|$|$ 4%y 44D$f` ifC*D$ D$!D$P$`$4%y 4 V |$fG fǃ V 5fpu?4|$|$ 4Py 44l4B( F rD$fǂ V ǀ4ǀ4ǀ4ǀ 4ǀ4UWVSTE rt$h@5(V8у$Y33t533|$l@<*$AT[^_]@<*D$D$tL4D$))V8WN<aG*D$ 11D$|$FF$FT$ L$ tpPUWVS!@ lŹ taQtI,$v2QD$}t"|$t }u1[^_]ø[^_]UmttM0trωvE;tuutmtUqЉ v;t i똄ҍvtЄtU;t0 wӉфujҍt&uXʄɐeHUWVS,> ÙkT$@t$D:u+|2tT$$#T$F@fu|2|$(|$ D$T$,$|2D$PJN$JN 3 Q$`D$D$$FTQ$D$D$$賐FXF N$45 (5VT 5VX85|2P3J0eBpZ012džl2D$TD$t!T$T$džl2D$LɉL$D$D$ L$T$ D$D$$$T$ xD$T$ $2L$$ $2D$džp2džt2džx2D$tudžx2D$؃,[^_]ËL1$a1džp2džt2iedžt2K@@Dǀ@l@hǀǀǀ<HHpF$fBD$t"T$D$<$*T$u džl2t"T$l$<$T$u l2T$D$D$<$֛T$l2tl$D$$觛u džx2D$tD$D$$聛u x2E|$D$$[-x2D$tD$,$0u džt2D$tD$,$u t2|$,$t2|2@@fxxFXFT,F@ftP|$ D$D$,$|2tRD$!1` FXpH" 9 e@5D$D$ $(S8 eD$ 45H$ (5H 5HT 85HX 5Hh H42 5l2 5p2 5t2 5x2 |2$[V8  eL$@5tJX851øfffUWVSljՈL$D$(D$_ɉL$D$ 9tEfxft3fu9juԀ|$tD$BD$,9u[^_]ËBL$,L$L$ $L$aS7 Fd$$t*Pf9uǀ[ÍQ$0$UWVS7 cҍ PQfx ؃[^_]ÉŋftBfQEf3uD$,CC؃[^_]+CC؃[^_]fA¨uD$D$D$<$(ljT$T$$ #T$tRf@f@@ f@@f@@L$LX 9uE!`Q$/$C*D$ D$D$@Q$S$UWVS5 gbƉ׉L$$tolt5$>LVp9uUD$$ ULV[^_]ÉUWVS 5 a|$w9t)fxf8u@$9u׋~1$-*97$*<$*[^_]UWVSljՍX9t0fx ftfu9iuA9uЃ[^_]ËAL$L$Au$UWVS4 `$(5fV2ǃ V ǃ$V ǃ(V QtVD$ L$L$F|2R,t9,$w=w'D$l$l$,$ 29t$ u[^_]à 03 _T$D$@5t*2L$L$҉$T$D$ ø 2 _T$L$~,@5t 2t1Éʍt& 1øWVS 2 W_@53339}|$<31 [^_à T$$?$t3333볋33D$BD$${33\$\331vl 1 z^D$@5t(2T$T$$1ɋT$QD$ ø a1 +^L$@5tJT 51øWVS51 ]|$<$ƃt [^_G @tJ8u@53t(5D$45$gǀ3[^_UWVS$0 q]D$T$@52D$5 5D$ D$D$tD$$UwD$$ Ń=D$;(V @V ,%y  V $V fLnfr f9qfRf]fML$T$D$Q)ʉ$pD$$&ŋD$@ @YfD$@ u|tw V @V ,%y  V $V Lnf?(V \$V yt싓 V (V 9=fi$[^_]ÃT$fB (V $V 9f@V ,(V V 9f$[^_]Ë V @V ,%y  V ;$V 5f+D$uQD$$ŋD$@ @|$fG $[^_]ËT$ED$ )(V V 94f$[^_]fD$f` $[^_]Ë(V $V C*D$ D$ D$Q$Ρ$UWVS - Yl$,@5L$EU8׃$3>3@<*L$9t$336Ѓ[^_]ÅtL481E8U<I11$My9}BMy9}3@<*#R,$\%xOUU|$} }9u 9|$|$ T$D$D$ $xUUWU UW3(5D$45$aǀ3Ѓ[^_]ËE<LD$$ƒ=M! NT$T$ T$T$T$T$,5$vfffS! M@53t\3$[1[UWVS ËMt$ dž203@fu|$$t$@f|$$Ħ03\383d3<3h3@3l3D3p3H3t3L3x3P3|3T33X3343`3Fh43Fi22832@32D32H32L32P3222<3%2fdž22832@32D32H32L32222224432<3%g2\33@fuT$D$$؃ [^_]dž35051 [^_]ø|$$訤VSB K@5$WtHh5 Pi051[^VS  ýJ@53unL45ǀ2233t@@ft$T$D$$؃ [^ø1 [^VS Z J@53unL45ǀ23tL\33@ft$T$D$$=؃ [^ø 1 [^VS  {I@53uhL43t\2uA23@fuT$D$$؃ [^Í2p1 [^VS1 H\$ C=w!Et,5X33|$ D$D$F$l|2VT$ǹ |$ D$PT$$蓯|2VT$|$ D$PT$$eF@:t.|2VT$|$ D$P<T$$.dž3[^_458(58 w-3<$v3dž31dž3 S  ?[ ?@53S Ú?@5$;1[S r?@53t43@ftT$$͘؃[ø1[S U ?@53t<3@ft#T$D$$j؃ [ø1 [ >@53to31 >@53tq31 l>@53to3D$1øq ;>@53t q3D$1F >@5T$31fffVS$ =@5@@fuT$ T$D$ht@$ީt D$ fu4V PwtT$ $Ѓ[^Ëǀ3[^T$ft45(5S F=D$$V ǃV [S$J =D$ D$ D$D$D$D$V D$D$ D$$ǃV $[S$ Þ<D$ D$D$$V 9D$ tǃV $[D$V D$$zǃV $[UWVSf (<V V |@5@@fuT$T$D$ht@$,D$(5L$ 45)f59hu9PtT$T$ l$$AT$ ,59hu9PtT$l$$A03@fuT$$Ȕ3@fT$D$$\H$E$[^_]|$f*9tǀ39tO|$ ǂ3)(545(pz,bK) _:V tS A:V t V D$$ǃV [= :V t# 9V ~2UWVS 9@5R33@fT$$V V Z5_T$$_T$D$D$ xOL$HL$@$軔`5@|ɋT$hT$V l$D$ $茨@T$t B:<l$D$$Yl$D$@X$:@$趇D$ D$D$@$ǀ303@fuT$D$$؃[^_]d5`5@|V 1[^_]ø1V D$$xǃV V +V l$D$8$@BWVS, O7D$ D$$D$(D$ t$ t$|$|$$m0D$ D$$D$(D$D$|$$mD$$n@53tqD$t$$=m,[^_ 6@53t1S [6@53u23@fuT$$谏؃[øS ? 6@53@fuT$D$$X؃ [S ð5@503@fuT$$؃[S  b5`5@|$tH|t7V T$D$$դ@5ǀ3@$A1 [ËxtV T$D$$荤@5ǀ3@$1 [à 4@53D$$WVS  x4D$@52t^t [^_`5@@ttǂ2V T$D$$蹣@$5 [^_`5@tǂ2`5@lǂ2늃 3@52$ËT$D$9B| R,1SD$H~X,u1u 9u1[ø[UWVS \$ l$$T$(DƉD$C9~)ՉD$;l$ C,D$ $8>9|K9}S(x 79| K9} $;l$t=S(D$<$8p|$,u{|:9~@ ;8~ʼn8$;l$u1 [^_]ÃD$ D$D$D$D$D$$ӃD$D$ PT$D$$ԃD$D$ PT$D$$UWVS\$C~0S,4D$D$D$D$0D$ /D$0$D$;D$l$)D$>D$D$ |$t$D$ $NŅy4[^_]1D$D$$@tStyuԋD$$hL$D$ED$(4t414[^_]ËT$D$$@uL$)29v 뇋T$,4[^_]Ët$)֋D$$htT$t$D$ ,$肛)t$T$L$_L$ȉt$$6s>tftl$)T$D$9|$|$D$ ,$"uuE}D$fUWVS( À-D$T$D$ϋL$93|$<,I*DB@t DB@u<$Bŀ?D$4D$D$$D$|$ D$$$t8)>t/D$D$ l$t$D$$DžyŸ([^_]Ë|$ )t$<$ Dt݋T$ Rt$4D$3~#14$93ߋ4$[^_VS ÷$t$4${83ǃ8dž3D$0$4tf|2PtD@fx,~:Ɔ3$?&|2@P,3@31[^Ɔ31[^øD$T$t3u1øWVS ú#t$4$qFt{ʋ9t‹9u F0$7F,$,@59p9p 9pF|t$轆$4$1[^_ËF4$9t8$>9uNT2gB92tIXH90t‰J$;@h@ S@>2WVS Ç"Ƌ@T|2GTttN@ ttN@ ttN@@t tN@@ƀttN@ttN@ttN@t4tN@ ttN@ @ttN@@ttN@t@tN@t$(ttT$4$LT$t'G8ttT$4$7T$t#FT|2F@%F@Ifyt ‰V@1[^_WVS lj֋@T|2@Ttg@ tg@tg@@tg@tg@tg@tg@tg@ tg@@tg@tg@u:u>uFt`5@fxtg@1[^_Ãg@t‰<$t<$!S L$T$ ,5t C@%t C@f%f1[ yT$,5L$u PT$,5L$uLS` &D$,5JT|2J@J@[f{t%t ȉB@1[ ,5T$5 ,5T$S ,5T$1[S\$L$ T$t C@%t C@f%f1[ËD$T$L$ uËD$T$L$ u8VSt$ T$D$u1T$ ӺډH1[^ø[^à T$T$ T$T$T$T$,5$ST$D$ JT|2J@J@[f{t%t ȉB@1[ËD$@@ËT$D$T$D$PS\$?T$ 1[G `5PT%t t t@t̀t(t t8t ttLt 1 Q`5PT%t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffVS t 6t$4$TD$t$,5$ [^VS : t$4$D$t$D$$ [^VS  t$D$ x8t>t? J|t*9uD$t$D$$l [^É4$褒܉1ԃ bT$T$T$T$,5$m UWVS k -t$ |$,l$0D$(D$D$$D$4$΅tl$(|$$t$ [^_] [^_]à D$T$ T$ T$T$T$T$,5$cÃD$D$$D$ D$ D$D$D$D$$0à ]T$$T$T$ T$ T$T$T$T$,5$ffUWVSLR t$`D$lL$h V, @R`5@t 1F `5@t 1UWVS, l4D$t59(EH%D$ML$EL9E)ω|$$9~T$$D$(D$(|$$)D$9D$ T$L$D|$M IRփs~tftED$l$D$l$;D$||},D$4"L$ 8'Mu>EPD$(96D$()ȉD$$9;T$$2^L$D$$DD$9<1ҋE|F% F;U}a4RT$E,8HEDT$QL$$L$E,8pt$Ex$aST$u,[^_]ËMl$D$9et$(9|&ED$ D$t$,$D;u}ڋEt$g,$1,[^_]9EP9D$$)9T$$)‰T$9<|$D$ 7RE@I׉΃s`tftD$D$D$;D$t_M,|$49"D$ ȋ!}uËED$$)9ib?낋D$9D$$<1ҋEqT$;U}e4RT$E,8HEDT$QL$$L$E,8pF% Ft$Ex$|QuD$D$9D$$nuD$$9GNjED$ D$t$,$c9uD$ff  VT$u1,5RD$T$tA1UWVSl$}9tSED$_+\$w~8G( @E,W,u,4<${ω:_9u<$?9u[^_]ËD$tPt@+BøËD$tPt@ +B øËD$@ËD$@ËD$@ËD$@ ËD$@ËD$@UWVS Dl$4ED$},47UT$RpE<@ L$<59.UHT$9|$l$4|$4G% D$EGD$[El$Gx$ OtzE% E 9l$v3uGD$9ƋEuƁ;t$uUu=#v놉GD$ D$D$D$D$,$,$~1 [^_]ËM;L$~+D$D$EED71D$1 [^_]D$ ,5$_S ¥D$\$ V -t)t!V AV V 1[1[ø[WVSD$|$X(~.p,11 ~ȃ9t օy)ȃ9u[^_1[^_UWVS,D D$@x,45D$(V D$ 1(5D$$D$ D$D$D$D$ D$T$T$D$@$at#GV T$@B(ɋT$~ST$ L$$T$$+V tH9V ~1,V tyڅYD$()R)T$(ǃV 1,[^_]UWVS, |$(G$D$G(o,D$ 1Dt2W T$y؉D$D$uD$ Dx9w(D$ [^_]D$D$D$D$t DD$D$ D$ D$ [^_]UWVS` "|$G(~%o,1D$D$"9w([^_]WVS |$V 1~019t% 9V uDŽV 9u[^_UWVS ÆƉՉL$$K~ |$VF +B F(D$1FFn|$~FP4$ ND$D$ F,L$ D$xV=1G% G 9nGFD$TG|$Fx$Iu [^_]ÍD$F,$tىF,<)|$F0$tF0VN +J N(~,|$ IL$z)NR,T$1ɉt$|$T$ T$rprpP 9u΋t$ED$1nD$xD$D$D$<$JL$AD$ D$ 9FvF1 [^_]ËD$ō@D$F4$F4V0L$L$N,L$L$ IL$׉|$ L$|$t$l$l$Brrrr Bz9T$ uыt$l$.9LU MFD$ ^9~HMFD$ ؍ 9E~CM$E ^߉\$^ 9~ CE ^ <9*~(m9u11)…1ɋ\$\$ )مȹWVSp X<39}%t!X$P <9}u)щˉى[^_R)UWVS \$CSHx9~ WSHϋL$9L$|$S Hp 9~ VS p ΋D$9D$Ct$aD$C D$C$591[^_]1)υ1)DžS (509D$9x1)ƅzp4559tB<59t8,59t.S9L$9y|$t$xf|$9~Dž(50;t$ut$l<5tMT$P |$x$1[^_]ËD$2L$C D$1 CL$1R D$~L$~@59B$t 1ËD$9B UWVS Åt$l$ @5;p$5,<5D$$)‰,5trp$h 452(5*2u vt@:u$vu$؃[^_];h :1[^_]øUWVS sD$t$ @5ǂ3~Z~V;B$tLt$$D$5$u)t$$&$[^_];r u1[^_]WVSL$T$\$tfAt_q;pUq<;xJI8YtQpX ~0@,<1r9~R q92}29A1[^_øUWVS ]|$(L$,GƉD$ GT;P$T$0WT$T$0;P W)ՋG t$0)Ɖt$wtR9NsD$ ;FhD$09F _l$l$;nROG <$|$4$t<$1[^_]ÉVF VD$F 4$c69uȸ[^_]ËT$B8|$u ࿉B81Ã@B81fffffffUWVSr 4D$,P D$(+P D$,P(p0HD$D$,@,L$4|$,GȋL$(+AI, RP<~PVF D$,@~vD$ FD$D$<$BFD$D$G$AFotD$D$,$AFmuD$ D$ L$,9AD$D$T$,9B~R(&[^_]UWVSD$PT|2H8ˁX8p h;j t[^_]ÁuكH8HR$ht@9u؋W ztϋWu‹ut duH89uuX8UWVS w`X͉׉D$$迲ƅ:@|ǀǀ$苲D$F,)D$ $dF0L$4F4D$FTFF~n~ n$D$,FD$0F F8FUWVS$[ t$@l$DL$H|$PD$<rD$D$hfD$Bf|$@\$UD$tE(|$(wU9} W ;nfD$D$f9D$>|$0_\$D$4;CD$8@,\$4\$ D$f+D$ҍ4Rt$ T$JPQtt$0d2t Q0tL$IL$(I 1PQ0ED$\$^9YD$t$ pEDF% Ft$Ex$\$1tME:D$@D$(@EDB% BT$Ex$\$1H[^_]1H[^_]ÉD$8!u9F:ucFD$~X~,111҉|$ |$ t^+]}, tF+E],"щ;T$|69uD$ @D$|$(|$ t D$tD$D$HU(|$D$`)9~U(D$X D$ p D$`)9}E8t@U(D$(@|$`8)9~ D$U(D$(@ |$`8)9E8t D$ E(L$h|$9| E(L$h9}‹D$9 M(\$h9|UD$ D$@fD$ D$`fD$&D$BfD$|$D$dD$W9A롃K8@E8D$ySBCYVS ' `5Rt @u [^$ LV D$D$@$=Q [^UWVS躴 |‹5M#A@Ɓ`5~tA@Tt2T$ V L$D$$PM5!A@!ƋT$ tA@t2T$ V L$D$$PM5!A@!ƋT$ tA@t2T$ V L$D$$?PM 5!A@!ƋT$ ti@LtZT$ V L$D$$OMa@T$ l46t1T$ %D$ $gHT$ MMl46uϋq@!Ƌ@t=(t3t)V D$D$$gOEH@@t=8t3t)V D$D$$"OEH@@T}t.t$V T$D$$NEH@ t3@t$V T$D$$NEH@ t3@t$V T$D$$cNEH@@t3@ t$V T$D$$(NEH@@t3@t$V T$D$$MEH@t3@t$V T$D$$MEH@t0@4t!V T$D$$wMEH@t0@t!V T$D$$?MEH@ t0@t!V T$D$$MEH@ @t0@t!V T$D$$LEH@@t0@t!V T$D$$LEH@uMt=@t.Lt$V D$D$$MLEH@[^_]Ë@@tV T$D$$LEH@UWVS茯 NƉՅ@@5HɋFu?EEl$F$v)tF1[^_]wt$F~t$Fuu@@5Ruw$F~u둃wtt&뗋$yF~udD$PT$ PT$P T$P$11UWVSD$(L$,\$0t$4|$8T$<$l$@l$!щʉL$!ˉ\$!މ!|$ )4$L2T$)|$T:Xx)9~ϋp H)9~9,$x>T$ 9T$x4T$$T$ډL$4|$0t$ t$,\$( $[^_][^_]UWVS z <5@@T$ 1`5J yt/1l4tt $A [^_]~`5V l$D$@T$FIB@5#B@vV D$D$`5@L$H`@=V l$D$`5@$HB@5#B@~B`5V l$D$B$iHB@ 5#B@UWVS׫ ÙD$׉͋t$,$39D$u;l$0t1 "D$D$0D$ t$l$<$3[^_]uUWVSX @5D$<3 5L$TrJx pHT$8D$8@8@u B8@ B@ V t$D$`5D$`@@D$5GD$<@@@h |$8<$og8D$`@@htxD$hD$<D$4pD$8@D$\H40l$\D$8P,111ǃ9| D$<D$4pRD$8@D$ht $ AD$<D$4pD$8@D$\D$\ D$8P,D$4@D$XfD$HD$,1(5|$p<|$D,:l$@T$8L$,JP, L$LuMT$TR,:JT$@|$hu D$@D$TD$|$GD$~ W ǃ$W W t$Gx$#$W % $W D$<D$4l$,~D$T@,T$DDL$A,T$DD$@(;iD$@ D$ T$R9|BD$ D$4x|$PDmL$I<|$l|$P:|$T7v,|$D4>FD$D$`@pLR|G%D$Pl$$|$,G,L$DPE%9D$PE9ŋu$ 9tl$$D$@,T$DP96)ЉЉЍGD$0D$<D$4@D$`@@LD$$|$lD$,D$\;l$ TD$u"G%=tT$>dD$4HPl$t$,4$D$\D$<phF9|D$@D$(;D$,ta~pl$ D$ 9t$ |rD$tXD$$tl$(;l$0KwD$@v뇋D$<@D$@8tGd딋T$XtD$<L$49qt6qD$p9XT$`R zEA;l$ D$@PD$8H2x HD$@p 9} D$8@(9~D$@ D$43tD$XL$XoD$4@L$LIP)xPL$LI 9fD$HL$HL$,T$4rT$8;JR,7$ t9ƋwL$dD$@9L$PL$TR,L$D @RTl$4|$t|$PE%9u E 9D$su$ 9tՋ|$tl$4D$T@,L$DHD$p 9)ʉ‰ЉЍAv)ЉƋD$$$I+T$09rGD$@@9s6D$Pt D$`@ xa wD$@D$$wT$BD$4;D$,twBD$$P<5D$uD$@9RD$@8t$D$@8 q9|$l GD$D$`P zM@tP O@ Đ[^_]1st$D$PD$0D$$D$4PHD$,D$z<$D$<D$4@@t$t+ D$4@u ;l$ uՉt$vD$01 T$4RD$$D$\8D$<L$4D$@D$($$fDŽ$D$D$$$C[D$<D$4@D$XJD$<D$4pD$4HPD$8@9yD$TPH$D$<@$O؁Đ[^_]Él$$l$$x|$8pHOfD$1fD$D$T$8;BT$8R,4tFD$8@~11ɍV,L$D$,$FD$D$E$FmtD$D$,$FmuD$89xTN댋D$<@D$hC`5D$`@HhɋD$8M@D$\D$4HP|$8G,wt$w4$|D$TT$@D$|$D$xO@D$|$<T$4|$T9r~7|$4WL$$D$\D$<D$4T$BD$JT$4BJD$$脕D$<D$T`8@@$s$1L$\ȅx%9|(D$<D$4p|$\89}<5D$tD$lPT$ @,D$(ND$TD$$D$D"D$|$D$D;D$ D$DT$D|$( L$T$tL$$Q,T$H9Ju=T$lJL$xD$pt1 9l$wBuD$DD$4D$ D$,|$TL$$D$0D$|$l$0D$0tlL$0|$(T$:|$tċL$$Q,T$H9Ju5L$lIL$xrt1 9l$tuL$,9L$DD$,t$(@PL$4D$09}}hE%9tk|$lG<@D$ȋL$D)ȉҋ|$0׉|$4|$LiM9[T=D$9D$uыL$L$DD$0+D$DD$HD$ y$9D$HD$TD$dD$DD$P L$x|$(ω$D$|D$D9D$P8|$Hlj|$,$D$XD$,+D$HD$pD$|D$XD$@D$xD$4D$DD$ D$ T$H‰T$L90|$X|$do,l$$|$4t=~9y|$@t$L$ tv9quj9ut$L$D$l@D$D$pD$D$ D$~qD$1 9l$ttuL$L9L$D$ D$ l$@D$4;D$P!D$XD$,D$,+D$H9D$Pl$HD$HD$P;$D$D$D$T$;D$,t|$$4T$( <vD$pD$L$H9$D$L|$09~D$0@W D$d@D$ґ9@W G 9l$TE@D$蘑|$E@x$GuËD$8@D$\|$8G,wt$w4$ D$TWPWPcPD$T$E:D$DD$4D$ D$DD$OD$DL$l4t%D$TT$d3P@t|$d|$$\.V D$D$D$$$5D$<T$4|$G B9Bl$|$(D$dE$ \EE% E 9sЋD$<D$4T$RT$ L$(+D$ D$$D$D$ D$,D$l$$ T$L$(41ҋD$*D$D$`@ID$mD$tp;,W BD$11@W T$D$D$<$}9l$T$utD$vD$<$Q‰D$,D$t@,W 0W D$ ŋL$D9~͋|$p+|$ |$(T$0)D$XD$TH,D$9nBD$\l$4l$L@W D$׉|$ll$$|$$)D$(T$XЉ֙,:9|$H|$9;l$p| ;l$;l$$9l$0D$(D$$9D$pL$t L$dy|$DT$,9PdL$Dȁ<ID$dD$PD$@ ϋt$tftD$@D$@9D$PD$p멋|$tR, ;l$LuD$T@,D$Hl$LD$4D$4;D$\D$TH,D$HD$V L$L$D$$w1T$cD$L$L$D$D$`@$A1D$dT$DDL$I@ϋt$tftD$|$,xD$tBD$ D$l$$ǏL$L$Dl$$D$(-D$THL$@D$|$ +|$pD$`@p0xp+D$0D$l$4$QV t$D$$50D$D$ D$L$L$L$ $t$D$l$`E@@p$/D$D$ D$0D$D$$E@?|$$Qt$D$$/D$t@D$D$|$`@@0$Pt$D$$H/D$D$ D$D$D$0$t$D$@@p$/D$D$D$ D$D$D$$Id|$D$$.tdV |$D$$V.dD$D$D$ D$L$L$L$ $T$`@t L$t ;qt؉D$$HV T$D$$['D$D$ l$D$D$$'D$`@߉|$$xHV T$D$$&D$D$D$ D$D$D$,$V t$t{T$ L$L$D$D$`@$&T$ L$V ht$D$D$`@$9&Љt$LDD$tV t$0;p+t$tɉT$ L$L$D$D$`@L$%T$ L$ċD$`@1t$D$L$%WVS ۵\$ @5B19Jt0C:ur11ɋCD$ CD$C D$C$Su8\C9u,5 Q+S!SQ+S !ʉSB[^_ËKtSp늃h 2,5$7UWVSO l$0t$4\$8D$DL$HuX]\T$o`] X] 9|@D$ )ȉD$E@@9T$F9L$ <`] X] N5L$ C|$D$$jT] x`>u D$ u ǃd] `] X] 93`] E@@luP] T] yP] tL$d] L$`] ,[^_]Ë5D$ D$\] D$D$ |$%y ʅyQЉ05>5D$ )ȉD$E@@`] X] 9}F9|$P] >$ d] D$ \] N|$ 9}LT] d] E@@x)t$D$$d] \] 9|N7`] t$D$E@$eT] W`] ;X] \] d] D$ 8)(5D$ND$ L$ hzy );|$ E@t$ t$D$$\] D$ d] D$9~1됋P] t $d] \] zNT$D$$FE@x`] ǃd] X] |$ [ʋL$ )9E@9ND$D$$\] d] N9}>d] E@@x|$D$$d] \] 9|ND$ 5D$4P] T] T] d] .\] 9D$uE@t$ t$D$$d] T] ;D$PND$D$D$$$ǃ`] ǃd] D$D$ D$8G,`] vI A;W@E@I$ d] T] P] t%T] @lNT$D$$`] `] $ xD$9X] |$ D$ 8Vp$d] `] D$T$L$ I,@r@$3d] T] T] .P] t #)$ P] t L$ \] D$ 1P] t $ad] \] P] t $ 0\] 9L$ KUWVS z ôD$\] (5|$?9|X] \] d] `] 9pX] 45D$ `59EPBh9t^\] T$t$$?8ƅtRD$;d] t4$7T$,V D$D$4$uX] T$1X] `] \] d] [^_]Å_ˍPX] 95|$V |$%$ u ǃd] D$ UR9|1Bl3L$ϋ tL$L$D$$묋X] `] E`] d] `5EP :5V L$L$ L$ L$D$$JtME@t)@L$L$D$$E@@lu$ u`] ǃd] 45D$ X] 9P))ΉX] `] 5$ DE@녋\] 5u E@xht"T$D$T$\] D$ ǃ\] w T$\] T$ X] T$d] T$`] 11w XT$\] T$ X] T$d] T$`] D$b1fffffffUWVS>w %@52D$<5D$5D$ D$9\$txC9\$ ~gC,$1$4C~JFH1  9C~59uuV9~V 9}͉ 9C˃9{D$@D$i[^_]Å~t$ ~v,$D$~'XC\$с9u 9u94$uˋD$@D$u `5Bfx~$fx"~Bltht 1Ëu틈u㋐ttߋ{u E`5@ xUWVS$Wu !ljD$ZO`5PZf&f5t$$5t$ R"f!fvt$D4l$Udžh] f@5K\S`Pt!V D$D$ $ Pt8l$V D$D$ $5l2!P@Pl{hmǂh2ǂd2@fx*|2@@*t ǂd2t d2t d2t d2t d2 t d2 @t d2@t d2t d2D$ B\~ǂnfǂr ~ǂzfǂ~~ǂfǂ~ǂfǂ~ǂfǂ~ǂfǂti~ǂfǂtL~ǂfǂ~/ Inff@f@@ 9uǂl"ǂp"D$~&l"l"ff@@9ut$h] %Hfl"Jfn"Lp"džl] 2<5D$5D$}D$98txD$98tpD$h] _HGD$ ~LOI1D$l$ ͅ~"G,HQL$% ؉ 9u;t$ uыl$ <$\$kmr1$[^_]ËD$$5$[^_]ùD$D4ыtǂh2tǂh2itttǂh2DUWVSnp $T$\$t$ ft$f"D4;f$599@5h2tq‹p"˃u#p"fl"D$fn"1[^_]f9l"twp"fl"t$fn"L1[^_]1[^_]f~dffuftx~TftdfVfD$Jt$f9n"Kp"fn"끸MfuffD$fD$fD$lbVSn ‚D$ L$\$f@5;B`l"f1n"fh2t1[^fte~1ftSfufft6~%ftKfuf1fuffuf1f1fff1yoUWVS m ÖT$4l$8|$4붻#륻D$$ck -@5d2S Nk @5h2tu>`5@t)V T$D$$r5L$!A@ [UWVSj ã5A@T$(1T$(f@5t$ .h2uyTl"f,fn"LD$|2@$'(V T$D$$D$ (DfA@%T$( ЉA@[^_]Tl"ffn"LD$|2@l$'V T$D$$D$ (DfkD$|2@h$I'V T$D$$1 $D$ (LD f $D$ (LD fo/D$|2@tsWVSh ßD$@5rNQVxJ4$[^_;V|< uډt$$+WVSzh <D$t$NQVxJ4$E[^_;V|< uډt$$WVSh @5pt$D$$`lj4$[^_WVSg át$t$D$$_lj4$[^_ffg kL$T$,5xx;P};H} PH1øËD$L$T$ xx9P~9H~ PH1øSL$At1Q Q+P xYY+Hx;P} ;H}PHAu[UWVSf ýlj$L$,I*(DEr1ɉ7 FLHÍvDEu.t2*tb/t[^_]Ãt$t[^_]ÍJrD]tD0ЃщD]u*u$[^_]É1uUWVS,f גt$H|$LfT$ L$l$@L$T$D$1ɋT$DD$@D$l$@Ut3,I*D$D$(D$ $tw|$$֋D$@hl$@PuߋD$tIT$~AL$ȃf w2CpVЙÅ~l$|$,$փu1,[^_]À}E$T$$?l$@D$(L$ T$DD$@L$u T$( L$ Qf SpVŅD$D$$|$Ll$Ll$D$$$׃uUWVST$\$t$|$ l$$J9Y t-9t%B x$uKBfx8u1t R(l$ |$t$\$[^_]1҃c D$#D$ D$D$D$D$$EÃc IH5 F5D$ D$D$D$D$D$$&Ã3c H5 F5D$ #D$D$D$$fffUWVSb Ƥ$CC<\<^tEЍ\,I*z9%Z <,uP{44OC<$CЍ\z9%,I*Z<<'<\Z<:f{8 fP0{:kB&E<,I*DjP1ՉL$$߉KDЍ[DMuL$$؍\$:{f؍[)f )ډ׍ۉ)ډӃ0)lj[^_WVSE_ L$L$ D$T$$%t$-?L) RЍ)ƉWV<%uAD$ IL$yՉGVl$v/|5\u(D5<\tF=D$$PT$$\L$ta|$)ύD>=uD$$PT$$$D$$PT$$<|$L$D$$$^|$$GD$$/D$$PT$$>D$$([^_]ËL$L$ TVu<.t<*u QT$ AщL$r1BF =1|$$T$ Jt.T$$JL$$%T$$JL$$+T$$JL$$%T$$JL$$cƋD$ 1*L$L$>F=C\D$$PT$$%L$dtD$$PT$$D$$PT$$dD$ 1*L$L$F= 1T$$JL$$%T$$JL$$ctD$ 1*L$L$F=D$$%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+D$$L$HD$$HD$$D$ F=D$$%p0%@p0%?D$$L$HD$$HD$$l$ |$$~D$D$$%>%tD$$bL$t T$$%+%;D$$ƋD$ F=D$$%p0%@p0%{@2}%*f@ %-D$$L$HD$$HD$$D$ .D$$pt$$%D$$pt$$L$iD$ *L$L$l$,$O 1([^_]T$|$$T$|$$T$|$$VS!Y `5t"p] 9t $=p] D$ D$ D$D$D$ $uLp] tJ@t  H5 L5 PxP5[^É놋D$ [^Ép] @uUWVSNX T$$D$ BD$D$`5t`l$ ,$‰$vWQ t=q$1  9t,~fuT$l$$¸T$uF[^_]1[^_]1z<;@lD$,$胸uQ ;Dl[^_]UWVSiW +T$$D$ BD$D$`5t]l$ ,$‰B vWQ t:q$1  9t)~nuT$l$$ݷT$uFfy[^_]1z<; kD$,$螷u;$kAPfx[^_]UWVSV AT$$D$  BD$D$`5|$ <$/‰=,+^D$<$+^P,H t@p$I  9t*~suL$|$$豶L$uًn 9uօtBD$(tA$D$ $T$1 ÃD$$T$ D$ÃD$ $T$1A nT$PUWVSA ænl$,t$0|$8>u"E`[^_]Ã|$4D$$|2EtjD$t$$ D$ E$3&ET$ wt$sD$$ [^_]ÍH$|ƅ$/D$4"L$4$#E@ x u dkljD$ ͉D$$ztg<$fǀ}uU)9tYn~tFD$|,$Mƅuۉ,$/9u$|$D$ D$,$[^_]1[^_]É|$D$ D$,$yu[^_]VS= ÞjƋtL$ L$T$$1[^ÉT$D$ D$ $L$ .t5T$ҋL$ u1[^L$ L$D$$x1[^øUWVSO= j|$׍rY:ō@ $%1*E$!bE$1CE9]t!]\$$\$.E]EEEXPf8pf Kɍ\IL$ t$|$(u H u U :v9u݋L$ t$I^VHfXxfuҍDщ|$(Vf u fyfK9ufNC[fNuˋ|$( ft'X u^fufpx;} tE$$\$0E$} E$$ 1t^E E$D$ 11|$(@\$ 2ZnPs#f\$[^_]DžEXPf8HfmXfCfE E$t$\$/E$[^_]Éf`ǤXvp@Bu<vBfBB;E zBfBpu6u9BBpfru fyfBBp롉BB돉ʉP'f+WUWVS(8 ÌeD$ՉωT$ sD$D$] D$$=v(8([^_]D$D$$ƅtɉ<$5l$$l$T$ T$T$ D$|$4$肱tL$$u14$([^_]ËT$ :D$<$D$ŃuʋD$PŃuT5|$8D$l$D$$=D$$=D$D$$ƅl$ D$D$BD$4$2L$$T$ FUWVSD$ L$D$D$D$t/<:t<ӍkCtA<:u0)t#Hv=S}:tʋD$[^_]É봉kCu)t׍HwË|$փrtftD$($L$T$D$ tyD$lD$D$[^_]UWVS +6 bD$T$T5t$蓾8/[$z…tPD$D$$T$ ŋT$$7+t"MUD$>,$ $t$ t<$L$‹D$. [^_]Íd$۽t*D$ >tD$D$t$ 4$6<$L$%tD$ [^_]Ít$~^S/J$yʼnD$4$D$,$%*T$<$L$‹D$<$L$D$Cl$D$ $<$T$ D$D$T$ $),$VD$T$tt [^_]ÍtUWVS3 Ü`D$$D$t$(T$,щT$ }ǃtdKt1D$4$莔t#tDDm`D$4$kuݍDm`|$ |$$HPD$[^_][^_]ffS53 _lD$tD$D$D$$ 7[S2 _51[VS2 á_Ƌ$L(F$A(F$6(F<$+(F $ (F$(F,$ (4$([^WVSr2 4_|$wt$G9r [^_Ått$$B$tw[^_É4$[WVSD$|$\$H t2Bf;:u=st.ft$ƒtBf92t$nuu[^_BT[^_UWVS 1 u^D$ L$$L$8p u=LLfzz\$WC{D$ff^fpPxD$ PLfJyX+f xD$XfxZf~zC]UWVS/) U\$|$,I*($DU@‰$2Du@u )1҉t5qtL<:tc3QtN8t@\t^t ΄u$[^_]É ntqu΍N8u $[^_]À\uET$H\9uuD$(L$,L$(1QT$,jD$4|$ D$DD$BT$D$|$D$4<$\$$f/R|$ D$0D$D$$xD$D$|$1D$4|$ D$DD$D$$&T$D$|$UD$4/|$ D$0D$D$$D$D$|$<$\$$e|$0G1,$\$$dt$0F1|t$|t$ D$D$D$D$D$ f|$D$D$0$qt$|t$ D$T$D$D$D$ s빋D$T$\$$D$0tD$0D$0d[^_]À?D|$ D$0D$D$$D$D$|$}151f D$|D$ D$D$ۉ\$D$D$ n<$\$$iÉf|$0GW(tf;uf;fuwD$D$0$|$0WG$fG$D$(G$WfG$G(|$ D$0D$D$$D$D$|$jz XfP<$\$$GÉf|$0G,W8t%f;uf;0t&HDubD$D$0,$|$0W,G4fG4D$(G4W,fG4G8D$xD$D$$D$D$|$D$0~gJD$tWVS4 nIt$DfF(|$|$$ܢt4[^_É<$茋11t㋌9ufV(4[^_UWVSG It$(`5(0F5fFH54$EF(fD$FD$`5<$=v [^_]Í8x|)ʉL$ t2T$T$D$<$7T$9vz|L$ ))‹Ft$T$T$ D$<$T$ 9vx|pH5[^_]H5VS Gt$tjF$zF$oF$dF $YF$$NF,$C4$;`590t1[^1[^ø RG`5@v )΍)ȍD$<$yu [^_]þ FED$=w 1UWVSY Et$04$9T$T$ D$D$4$-|$-?L) RЍ)lj,Gd$L$) RЍL$)Oʼn*S)ǍD$4$xu [^_]ÿfffffffWVSc %DD$:$Ot$pS[^_1[^_WVS Cƍlj$|d${|DŽd[^_UWVS ÆClj$T$ 袻D$$ 'ʼnt$T$ T$d$yl$$ 9u1[^_]7萻UWVS`5 B 5D$T$\1ҍD$D$ǍD$\D$ ? tU;|$ tD$|$D$-ztՉ L$T$\3`[^_]D$tŋ|$< t< u u몍PvUL$(ΉL$ $xL$ D$xD$$D$|$ D$D$@t$34$6L$ FjL$ L$ RP$D$,Ƅ$$D$,~WL$$9xL$Ή$j{L$Ή$xL$D$ x$wL$D$/{L$D$wL$D$w$$x˪$觚ƅtzD$/4$$t`D$T$$T$JT$ T$,T$D$4$Et$ԪD$${D$T$ T$,T$D$4$D볉gWVS P >t$|$$tT$ 3t考 [^_É|$D$ D$4$u [^_VS ú=t$yt1[^ËD$D$4$M[^ ‚=D$wdt 1ÀUWVS` B=D$t|$x 5L$1t$\1hdu뀜D$|D$ D$D$@t$4$)=L$|L$9~D$D$ƅta)tSt$|$T$$tT$ۉD$T$|T$|$$sD$D$t$|$\3>u`[^_]D$SUWVSXF <D$ll$p 5L$T1ɍpduD$tD$ D$D$@T$$T$T$D$$ AD$D$tD$l$d$q9D$tT$T$$ u23L$tL$l$$pqL$T3u-X[^_]֊&ҸqRUWVS` :E 5L$\1ɍpwedu tQED$E UD$ T$D$D$@T$$T$追T$t7TML$ U MT$L$$臦t$\37u`[^_]øQVSJ :D$pw@du t,GÃt"É؃[^É$rÉ؃[^UWVSd Ü9D$xT$| 5L$9|$`1$hdu뀜m(m8@wDvD$b81-u|D$Ǎ)tp|$t$T$$6pT$ۉt$T$$襤|$L$`3d[^_]êfvf>~%D$~LVF9u1먋FD$D$ (D$D$@t$ 4$BVt6bf7=8.)OS Õ7D$ PwduӀu $ws[ݯ-S G7D$PwduӀuT$T$$聐[臯-VS. 6t$uD$D$4$![^@-VS é6t$hD$D$uD$4$Ln [^D$4$I [^S W6D$L$Pwdu#ӀuL$T$T$$n [菮-S7 5D$ Pwdt1[ÃӀu$؎[VS õ5t$tuD$D$4$ [^-ffffUWVST$|$lj<$11PӃ4x  ՋV S ׁ;$űD$(x[^_]UWVSI 5D$1=a tBу$1$T$tt ƒu@u[^_]UWVSd Lj4a D$$D$~ D$ $ T$D$xL$$T$(%b b b xb > Sȃ L$ $T$vL$$T$(%S9u1d[^_]1Ƅ8a @u1۹ %I$ ;a @t8;t)9u u1빍 31D$$D$~ D$ %I$1T$Ƅ8a @u :tT#@u1۹ ;t.))9D $;a @u D$ a `A0D$11t3wDD( N u̓9L$uz :!@t$:`u۸@u܍b 18`8a 0uፇj D$ a \$D$ދ\$1퍏L$Ѝ D$ D$ 1Ƅ:a  u1ɉ\$\$ u\$19a T2 ЃuD$L$Չʉ ȉL$ L$%T$  19a T2 ЃuÉ׉ Í%L$ T$@to‰ Љ Ѝ Љ Љ ЋT$ЋL$u1mD$D$D$ D$t8/LJa ?jUWVS\ Ë/T$pL$x|$|1ȉt$d$ %D$(R4檪UUUUUUUU T$L% L$Pt$Tt$HD$LD$D$z D$TD$D$XD$D$P$z YD$TD$$D$XD$ b T$D$ D$l$,$u#109u,$tD$L<*uD$Lx04[^_]Ät< t<:t|$LWtڀ tÀ:tl$LD$D$b l$l$|$5NŃ?|$t 9m|$ щ̓tcL$4`@~GN@<2qT$(\ !%tꩀuЃT$, D$HD$D$$\$$[^_]1[^_]ûn-D$2UWVS â$$轏D$A$€u$$$pƒt <$9u+$ЉD$HL$D$ |$8<$Dt$t$$D$<$DD$l$<$Dl$l$$D$|$<$D$<$|Dt$$D$<$Dl$$D$<$|Dt$$D$<$eD|$l$(,$EFV)ЉD$ |$$t$~T$l$4$D9|$ uۋ|$$EEEE t$|$ t$l$4$Ct'D$u$D$4$Cuً|$ fǃ $1ƃ $D$D$$D$ $UD$xCD$ D$$JD$D$,$D1D$D$$D$<$CR9%I$))9D$ D$l$<$B|$,$D<$uBD$ \D$l$<$BR9cD$D$$D$<$QBCD$D$$D$<$1BfD$D$$D$<$B&T$ T$ D$D$(L$. L$4 ȉD$$B  D$D$)L$/ L$5 ȉD$$  D$D$*L$0 L$6 ȉD$$  D$D$+L$1 L$7 ȉD$$  D$D$,L$2 L$- ȉD$$R  D$T$3T$$* P @D$D$,$CD$[^_]É+$LD$(D$,D$0D$4D$D$ D$UWVS[ $$ @D$$6666D$(6666D$,6666D$06666D$46666D$86666D$<6666D$@6666D$D6666D$H6666D$L6666D$P6666D$T6666D$X6666D$\6666D$`6666D$d\\\\D$h\\\\D$l\\\\D$p\\\\D$t\\\\D$x\\\\D$|\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\$$ 81ɍl$$t$d|$ $  0D 09r|$ <$,3D$@l$<$M3$D$$D$<$/3|$$$$|4<$2D$@t$<$3D$$$D$<$2|$$$$24[^_]ÉT$ $<$2$ D$T$ T$<$2|$t$4$3D$$6666D$(6666D$,6666D$06666D$46666D$86666D$<6666D$@6666D$D6666D$H6666D$L6666D$P6666D$T6666D$X6666D$\6666D$`6666D$d\\\\D$h\\\\D$l\\\\D$p\\\\D$t\\\\D$x\\\\D$|\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$\\\\DŽ$ l$$t$dVS D$ T$\$~Í`у? H9u[^US} ?E$!<*8t%\$E$MD$uEw؋]D$T$$UVS@ EEET$(T$0=}|D$ coqD$$Ơ<*0ك\$8D$ $ A Ņ!D$8e[^]D$ cqD$$Ơ<*ك\$8D$ $ u-C*D$ D$D$1$T/!D$8eD$ c D$$\$8<*D$ $OD$8 D$ cD$$Ơ<*ك\$8D$ $u-C*D$ D$D$$SC!D$8yD$ cD$$<*ك\$8D$ $ D$8#D$ c>D$$\$8Ơ<*>D$ $6u>C*t$D$$$Ċt$ D$D$"$RM"D$8D$ cjD$$\$8Ơ<*>D$ $u>C*t$D$$$$t$ D$D$"$R譂"D$8D$ cQD$$\$8Ơ<*>D$ $uu>C*t$D$$$脉t$ D$D$"$fQ "D$8CD$ ccD$$\$8Ơ<*>D$ $u>C*t$D$$$t$ D$D$"$Pm"D$8D$ cD$$\$8Ơ<*>D$ $5_u>C*t$D$$$Dt$ D$D$"$&P̀"D$8D$ c4\D$$\$8Ơ<*>D$ $8u>C*t$D$$$複t$ D$D$"$O-"D$8cD$ cOD$$t\$8<*8D$ $D$8D$ c OD$$ك\$8<*8D$ $D$8D$ cBD$$س \$8Ơ<*>D$ $1vu-C*D$ D$D$$3N~!D$8D$ csD$$Ơ<*2ك\$8D$ $u-C*D$ D$D$$MF~!D$8|D$ cD$$Ơ<*ك\$8D$ $ iu-C*D$ D$D$$ M}!D$8D$ cD$$<*sك\$8D$ $uD$8D$ cD$$Ơ<*Vك\$8D$ $u-C*D$ D$D$$!L|!D$8D$ c D$$Ơ<*\$8D$ $;u-C*D$ D$ D$X$K8|!D$8nD$ c D$$Ơ<*h\$8D$ $qu-C*D$ D$D$g$K{!D$8D$ cz D$$\$8<*8OD$ $pD$8D$ c+ D$$<*؋4 ك\$8ٞ؍D$ $]D$8$D$ ccD$$Ơ<*Tك\$8D$ $ou-C*D$ D$D$$IZz!D$8D$ cD$$\$8<*8D$ $"D$8?D$ cD$$<*ك\$8D$ $D$8D$ c= 6D$$<* ك\$8D$ $vD$8D$ c D$$\$8Ơ<*>D$ $#6u-C*D$ D$D$$%Hx!D$8D$ ~D$$Ơ<* \$8D$ $Qu-C*D$ D$D$$G3x!D$8iD$ cp D$$<* Gك\$8D$ $gD$8D$ c D$$Ơ<* ك\$8D$ $uu-C*D$ D$D$$FU D$ $N u-C*D$ D$D$$PBr!D$8-D$ c5D$$\$8Ơ<*> D$ $ 8 u-C*D$ D$D$$Afr!D$8D$ K D$$Ơ<*\$8D$ $(  u-C*D$ D$D$$*Aq!D$8D$ cD$$<*ك\$8D$ $ & D$8T$(T$0D$ cUD$$T$8Ơ<*>Q؍D$ $7  6u-C*D$ D$D$$9@p!D$8D$ cD$$T$8Ơ<*>m؍D$ $ Nu-C*D$ D$D$$?Op!D$8D$ cD$$T$8Ơ<*>؍D$ $ u-C*D$ D$D$|$?o!D$8D$8D$ $  D$8ك\$8\o"D$8\$85,o!D$8bFك\$8Un"D$8;HK\$8n!D$8ك\$8an"D$8<ك\$8h/n!D$8e+vPك\$8[m"D$8\$8m!D$8vك\$8zm!D$8\$8;Sm!D$8ك\$8ٞj؃$m"D$8Qك\$8l"D$8G2ك\$8l"D$8ك\$8rhl"D$85fUmك\$8 l!D$8@ك\$8`k!D$8ك\$8k!D$8\$8k!D$8*4ك\$8Dk!D$8zك\$8Vk"D$8H\$8cj!D$8*ك\$8j!D$8dyUUp_ك\$8Rj"D$8Hك\$8j!D$8KكdD$$L\$\$$1D$:݃ D$$e\$ك\$8$0t!D$؋4zt ك\$8>^Mi!D$8D$8zD$8qD$8hD$8_D$8VD$8MD$8DD$8;D$82D$8)D$8 D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8D$8~D$8u\$8%h!D$8[h"D$8Gg!D$83g!D$8g"D$8 g"D$8g"D$8g"D$8g"D$8qg"D$8D$8Tg"D$8@g"D$8v\$8&g!D$8\g!D$8Hf!D$84f"D$8 f"D$8 f"D$8f"D$8f"D$8f"D$8rf"D$8^f"D$8Jf"D$86f"D$8l"f"D$8Xf"D$8DD$$[D$$zك\$8zك\$8xكك}e!D$8C*D$ D$D$O$4HL$ f]B>fj=SL$Q A$QB AAAZ tY0B4?BBBB$B<B@4JpJTJPǂǂ[ø[ËL$t6Q t/A$t(!uA@,@0@4UWVS t$ \$$tF txV$҉T$tmŅu`~ۋT$xK/u91ۋG8t9_(tD$F($G8o _(t$ [^_]4ۍCv [^_]WVS \$D$$81|$(8CC tkS(s$tzD$D$$ЉƅttC@8@4?D$ D$$Džtt$C($S$C [^_45C C(1ҋs$uY5K$xɿ¿뻃D$D$ D$D$D$D$$WVS\$L$t^S tWC$tPuE[x,9{@49 w.#T$S?1D$$D$@fD$D$$\$0st$FT$ B0F??$i1D$ L$?t)T$$uYG [^_]=>?uL$t,Q t%A$tuAǀøËL$t4Q t-A$t&uIQ |$uQ ÃQ øËL$tGQ t@A$t9\u.QJC?tL?t+BDBDøËL$t+Q t$A$tuA4@p)øUWVSr <$$D$LD$4T$lf9ut$4ifD\L9u\$4tPfE@,U9v2)ډT$]\$D$<@0$\$|$L$L$$l$ D$L$M:C:C:C:C:Ck:CfN:49\$$*:Ctl$ L$+\$$]`9E`ÍCfQZff ;U`)UtUlE`E\Ul)…E8D$ T$D$,$\$@)ElE\EE@XE\Ul)D$ T$E8D$,$\$(ElE\EIEHEGD$@)@t$=14D$Y5F$D$45F F(u >[^_]øCD$@)@F4$N˸ă D$0D$D$,D$D$D$D$ D$D$(D$D$$$ UWVSl$,\$0s {$D$ {sST$ECECEC E CECECECEC E C$E$C(E(K,M,K0M0K4M4D$D$$։ÅENjT$ָT$+D$C,D$E($U C8D$C,D$E($U C@D$CLD$E($U CDD$D$E($U D$C{8K@SDT$C,r8iC,{@r@jACL{DrDC {ru{upKB+BCЃD$R $ | 0 D$ [^_]äsfit&ftC {rf<CBf&뽤CL{DrD%f뻤C,{@r@rfTuB"f@{rD$ fbfZff,$D$ D$ ffffUWVS ʼnT$ $DŽ$ 퍄$$ ҃9u1ۍ$|$ 1Ʌtt3 u  u1ۋ1Ʌtt3 u  u1ۋ1Ʌtt3 u  u$uN$D$t21ۋ1Ʌtt3 u  uD$u0<$uD$1 [^_]Åt1t3*u뙅t̉1t3*uE wrUWVSE _r4$\$l$ iD$Ѕt)t.t!K13uЃ[^_]ÃUt <$l$ 3ȉ 3 3K33 33C33ȉ 3 3K 33 33C33ȉ 3 3K33 33C33 ȉ 3 3K33 3339l$ vWUt<$l$ 3Cȉ 3 319uɋl$ <+4$K139u1[^_]cL$ T$D$L$ T$D$UWVSÉ׾q ))щlj$)Ӊ ))ٍ,$u.vv Ѓ[^_]ÍE=v͍Ÿ[^_]UWVS jøU> j+D$@S> jD$D$$+[S= ÞjD$$I3[fffUWVST$| |$ɋP4$9}fT$l$<\ \$49 $~i` f9rot(f9t$r9tK|$T L-; $WT$X88Xwljf9t$sNjl$T$T [^_]Ët$X80XwՉމ돍T$T [^_]UWVSPÉЉT$T$@(p ǃPǃT=1Ʌ=1!P\ ƄXǃ9tf<ufD9u<$J<$1|$11P\ fƄXtD)~D$<$xl$/uPl$>3XD$fpfq~` P` PP\ ` ` T X TT LTT$ffT;XX8EP@$$|$TAT` X D$0t$pt$@0t$pt$(pt$ p< D$,\ f9uD$fD<\ PL$D$$t$ Ɖ\$@)݋\$(, \$D$tD9|$/ AD\$ 9}D$$fA9l$|‹\$fC< \$ 9v1zt$1L$0t$,\VfQu$t:\$tSt#LT0AfDT01ȃ <uf9u΃P[^_]Ët$ \$D$$t~|$ h)lj D$D$ fKSz{SCx{ )T$f @8D؃0[^_]BUD$D$ D$D$ D$ f녋D$P‰‰D$ fKSz{{Sjk )T$ fO󉋼wT$( fT$ f.D$$ ffu-fu#fu 9f8t{WVS# IPD$T$\$fOytZ@fv-@f V;[^_@fffffffUWVS" ÔOƉ׉͉$+=yarat?=tcidu+4$Pƅt874$Gu1[^_]øV[^_]É4$ztƅuȸ [^_]UWVSQ" OT$ ͍L$t$XDžt [^_]Ét$l$D$ $tD$$[^_]48UWVS ! äNƋ@tdϋ.Dyarat$tcidtXFD$,$M9V [^_]É,$\tD$FD$,$%9T$t 1 [^_]ø [^_]É,$OVSN! NT$D$[ƅtp0[^S! MD$D$D$$t1[0[VS ßMT$D$ƅt0[^S iMD$D$D$$t1[[VSo 1ML$T$D$ ƅt0[^VS? ML$T$D$ ƅt_0[^VS LL$yaraD$ ƅt.0[^S ÛLD$D$D$$t1[[VS cLL$tcidD$ ƅt0[^Sk -LD$D$D$$t1[[VS0 Kt$ t$D$$D$D$ $t-L$(yara ƅu[^(0[^0[^VS ÅKt$ t$D$$D$D$ $蓷t-L$(tcidƅu[^0[^0[^WVSU KL$ |$D$(^uH|$D$0D$D$,$t=D$ $L$4tcidƅu4[^_É+0[^_0D$ $Ju붍&0fffVS fJD$D$D$$gDtƉ$&=tcidt1[^ËD$0[^VSR JD$D$D$$DƉ$7&=loobt1[^É4$\T$[^VS þID$$$\t1ƉD$D$ D$D$$CDD$4$I"D$[^1[^VS dID$D$D$$eCƉ$%=rbmnt1[^É4$7-t4$.w߃wډ4$%-͉4$-T$VS% HD$D$D$$BƉ$ %=rbmnt1[^É4$,t"4$,߉4$-T$̉4$C-yVS nHD$$$D$+t1ƉD$D$ D$D$$BD$4$ D$[^1[^VSK HD$$$D$+t1ƉD$D$ D$D$$BD$4$ D$[^1[^VS ëGD$D$D$$AƉ$#=rbmnt1[^É4$~+t4$V,w=w؉4$j+ˉ4$,T$fVSi +GD$D$D$$,AƉ$N#=rbmnt1[^É4$*t#4$*߉4$+T$fˉ4$+yVS ñFD$$$D$*t1ƉD$D$ D$D$$/AD$4$5D$[^1[^VS PFD$$$D$)t1ƉD$D$ D$D$$@D$4$D$[^1[^VS, ED$D$D$$?Ɖ$"=rbmnt1[^É4$)t4$*w=w؉4$) ˉ4$K*T$VS oED$D$D$$p?Ɖ$!=rbmnt1[^É4$B)t"4$B) ߉4$ *T$̉4$)yfVS2 DD$$$D$`(t1ƉD$D$ D$D$$s?D$4$yD$[^1[^VS ÔDD$$$D$$(t1ƉD$D$ D$D$$?D$4$D$[^1[^VSq 3DD$D$D$$4>Ɖ$V =rbmnt1[^É4$(u%4$(@߉4$(L$Qɉ4$(yύvVS ôCD$D$D$$=Ɖ$=rbmnt1[^É4$'t%4$'@߉4$R(L$Qɉ4$ (yVSv 8CD$$T$($T$&t1ƉD$D$ D$D$$=D$4$D$[^1[^VS BD$$T$($T$g&t1ƉD$D$ D$D$$U=D$4$[D$[^1[^VS vBD$D$D$$w<Ɖ$=gntst1[^É4$ T$[^VS^ BD$$$t1ƉD$D$ D$D$$<D$4$D$[^1[^VS AD$D$D$$;Ɖ$=gntst1[^É4$T$[^VS qAD$$$t1ƉD$D$ D$D$$;D$4$D$[^1[^VSV At$$t/t$D$ D$D$$;D$4$D$[^1[^fS  @$'t/T$$D$kD$@@ @ [VS s@D$0FuFt$ 4$ 1[^Sw 9@D$T$9t6J 9H t1[ËRt2@t#T$$.t[ø[Í8 Ս8 UWVS  ?t$|$ G t l$4$u$1[^_]ÍD$4$[^_]ËGD$4$O tɉl$4$UWVS  J?oŅtFD$ $]D$P$T$T$tCNjt$ s*uuED$E [^_]äftt,$1WVS ø>|$ƅtx<$ȶF N[^_UWVS |>t$t?9u5Džt*F G VWFt$FG[^_]É<$1[^_]Ã$ŅtۋFtD$,$ o[^_]Í8 UWVS =t$tT9uJDžt?F G $Ņt Ft-D$,$1 o[^_]É<$D1[^_]Í8  c=D$t 9t1Ë@ y ?=D$t 9t1Ë@ЃWVSN =t$t:9u0F $\DžtFt D$<$q [^_1[^_Í8  °<D$t9u@tÍ8 1UWVS z<t$,t 9t 1[^_]ËT$0tL$09uFuy ~ W$T$ŅtŋD$0HɋT$tVFtGL$D$ D$T$,$DFn~ t$tj8 뱍8 UWVS î;t$,t 9t 1[^_]ËD$0FuD$0$螳F ǍP$T$ŅtFT$tKL$0L$D$ D$T$,$xFn~ t$tj8 뭍D$ D$D$o$謢S :D$t 9t1[ËL$tL$9uL$$S }:D$t 9t1[Ë@tT$T$$wn[Í8 UWVSg ):t$8~$uFt%[^_]0L$4[^_]D$D$D$ D$D$4$7 tl$E$$DžtFD$D$D$ l$|$4$t D$;D$t <$4`D$D$4$Mt{tȉxT$P T$4 fD$T$@WVSP 9t$$L$(~tXV9rqtz~ [^_ÉL$T$$tFVL$1ɍD$ D$D$$[D$ D$D$$1'D$ D$D$$VSt$\$u tD$4$u[^ø[^WVSt$|$F t)19^ vD$ 4$u1[^_D$<4${ttD$4$dt̃uD$>t$[^_?VSt$\$D$<4$"u1[^D$/4$ttD$4$t̓uD$>4$tD$ t$[^WVSt$|$F t)19^ vD$ 4$u1[^_D$<4$itu tD$4$FuD$/4$0tD$>4$tD$ t$[^_UWVST 6\$t$ u/<><&tTD$$t:<tFt {G(uG$F~>1[^_]D$DPWA/D$0uˍjG(o UJ/>tH!/"G$>DP@HWHyqо =t!Kwt߉)Ӊ_x"PxW"h<>v;7oD$0HjzG(#GGGG G)Ӊ_ x>GhD$ D$D$$}<=UWVSl$|$D$@tI1ɀux;u<bxpux;uN\$ t|$ T$$t|$$[^_]øZqMxuCxo9xt/x;%"S x :/D$;D$ t1 [ÉD$D$D$D$$ [UWVSH0 .$\D$@D$$U D$$iD$ D$0D$D$8D$(D$txt놉$o1[^_]Àz t9:!DOCuzTYPE{z plinfz stb քt >u#rppS~@,D$ $[UWVSX,$$$,t6}t0,$D9u9/tfD$.T$Ћ0!ကtMȃ)׍O /.pl@istX@XXXXf@ X$T$ ǃ$,D$$(D$<$xa9$,T$ T$ 莣0<$cT$ $s01[^_]Ã9/u9u8/u 9Őu)=vT$׉rtftD?1[^_]1[^_]1[^_]]<${bT$ $Ɖ$ցt$<$eT$ <$bl$T$ $ct K;0T$ UWVSá)$//ǃD$$ƅ D$D$$$!aŃCD$ D$,$覂AL$xGȉ!ЉF9'L$D$D$l$D$ D$D$$3,$aD$VT$$eD$D$D$D$ D$|$F$tU~Ĝ[^_]ÉD$$,$at5D$VT$$qeĜ[^_]ËFD$$4$1Ĝ[^_]É,$`4$1oVS 't$D$FD$$dFD$$w4$L [^SÀ'D$$t[ÍD$ D$D$$UWVS,g)'D$$D$$ND$ D$7D$D$ D$$@D$D$$N9$@EPtҋEp}<$E$@L$L$ $PŅtօfa<$tK$@t$ D$?L$L$$PtHtvՉ<$D$ t$tlƋPtҋh~<$MttՋD$vL$ $P,[^_]ÍD$ `D$D$$DD$ `D$D$$D$ `D$D$ $D$ D$D$F$ƌD$ D$D$<$蜌D$ `D$D$!$rUWVS Æ$D$ $D$l$$Iu14$ [^_]À~$uFt~uف8versufxiouɀxnuD$D$$D$4$t4$DžtD$l$4$u<$t1wD$t1UWVSDÚ#l$<,$J$`t $`D$,D$0$X$\ ;|$8|$|$4|$|$0t$,t$($\t$$l$ t$(H|$t$ D$$D$$XD$D$ $ K$X$\l$l$l$l$|$ t$T$$Qul$ $\$X$\L$$RD$D$ t$$XD$,$Ju1D[^_]ÃD$0D$D$,D$ $\D$$XD$D$ $+ItBD$4$XT$8$\D$,D$0;  낸D[^_]Ël$ $`$`D$ @D$D$$` D$D$D$D$$ ËD$ D$`VSF!t$F$4$[^fSU!tD$$`x $^[S x $^[VSú D$0t$ $H4$Q1[^Sà D$x $+^D$ $g1[VSJ@t(t=0HR9r(w9r"9w%s31[^Äu0HR9}[^~9|9ސw9rٍ&D$ PD$sD$T$ cSD$T$ 9t4HZ1˃t!X@xJx3Z3B [1[ø[UWVSWǍtD$$^x 4$]|$ ,$Ot"$D$~4$\T$Ѓ[^_]ÉD$4$\$ KT$tԍD$ $L$L$AGAGA4$\|$,$ȄL$t2L$$D$4$b\L$ $!T$Ѓ[^_]ÉL$L$,$跅L$9uL$4$$\L$ʉЃ[^_]ÍD$ D$D$?$؅UWVS4*t$HL$LAQAD$ T$t>OD$D$ |$<$l$4$u14[^_]Í|$4$Qtމl$4$ 4[^_]WVSUƉƕD$D$ D$$9WrwgD$ [^_s8"u1[^_WVSljKD$D$ D$$[qV!ЃtND$ [^_8"u1 D$T$L$$L$ à D$T$L$$L$D$ VS`"t$t9u4$y[^1[^ËD$@SD$t 9t1[ËHX@tP@uUvT [Éȉw5ȉw=wЁwv[ø@[Á[ø[Um3Et 9t11]ËP@]U@Et 9t11]ËP@]SD$t 9t1[ËL$tL$9uL$$S•D$\$ L$t 9t1[ËP@txx3X3H [VSLD$ \$L$t 9t1[^ËpP@uxx11 [^UWVS9t$4D$ D$D$Ft [^_]À~$u|$ Vn<-tS<0uzxt:;t-D$D$4$vtT$0똉|u뉉uwffffD$9D$UWVS c%Džu$@ƅuU1 [^_]ÍD$$ŅD$t$@@ƅT$u$y [^_]1퍃`D$4$nD$F$Wn,~0F4F8F< [^_]S] $;V[Sy;D$$W $V[S?D$ $U D$ $}1[SýD$D$D$$K[SÒD$D$D$$K[SdD$ $UD$$U[UWVSm/|$,7F4N093V,lD$(D$D$ D$t$D$($=F4F4V,…$[/[^_]ÅtO`D$ hD$D$b0$6~$ F$T4$1[^_]Åt./[^_]ø[^_]Í= D$ hD$D$q0$}D$ hD$D$`0$}D$ hD$D$0$n}UWVSÂŋp,t$ T$D$$tPT$t5}0 rE,U0D$ $[^_]ÉE,U0[^_]1[^_]UWVS$,D$։͋:D$D$ $teD$ D$ED$E $[t }(:D$ HD$D$ED$E $%tE(t)D$8$<$Ѓ$[^_]U$uψT$ED$D$ D$ D$D$8D$,$stD$ =T$T$L$8D$D$D$,$T$[T$D$D$,$7D$D$8D$ vD$D$D$$:T$D$D$8$T$D$ D$D$<0$zWVSE|$Gp4$QGt&`9uG@ƍbF<$~`9uFGt$4t `9t 1 [^_]ËF09F4F8u~<$CL$T$8Ņt-pD$<$PD$ttqL$L$l$<$L$u3L$,$L$ $<$[^_]É $l$0L$D$[^_],$빍D$ D$D$ 0$hS§D$L$ t `9t1[Åt@9uL$ ["gD$T$t `9t@S?D$T$ t `9t[Åt@9 u[S?D$t `9t1[ËL$tL$9uL$$F¿D$t@9u1S×D$t @9t1[ËL$tL$9uL$$WVSO|$tZƉ$t/|$4$P t4$Ut>4$[^_Ë$4$1[^_1UWVS|$l$ t$$Ft [^_]1t…tF$tUމT$$T$tUD$[^_]g$!SND$D$$[UWVS _!D$ $tVƉ$1vD$t$D$$$DŽt4$ [^_]Pv(4$Av( [^_]1 [^_]WVSÞD$$t)ƍD$$lj4$[^_1fffffS G$觽t/T$$D$D$@@ @ [VS1D$0FuFt$4$1[^SùT$D$9t!J ;H t1[ËRuu[@u*[ÉL$@D$$)[Í0D$ D$D$$dD$ D$D$$cUWVS:t$,)V D$D$D$($nF D$q>D$D$($tT$D$D$($SD$D$D$($2twl$D$EU0L$L$<MʈT$U?T$D$D$($*1[^_]ÉD$D$($[^_]ËD$u|$E͍<<D$D$($Et0D$D$($]|$tc;D$D$($1D$=D$($D$D$D$($y11E=fUWVS(Ʋt$ljT$L$ 11퍆D$wFvHv9<FUUL$9T$ #+D$\$ +ՍwFH҃T$WBHkT$$D$D$$\$=T$$֍U|$t9T$ vy+D$ /~Gt\H9уL$uLFt4HIպwFD$D$([^_]ÉT$D$D$$\$!=T$Յt̉|$t 9l$ v+D$/~GtHщ˃\$FuH/[1҉Aֺ~G3HֺՉֺ1D$D$$\$/<D$D$$\$ </D$D$$\$;Uaщ˃\$uTFlHw!9,1պD$D$$\$Y;D$D$$\$5;ֺT$$D$D$$\$;T$$Յ<p(ӃZF<<H5ʉD$D$$\$j:w<Hv=]ЃD$F<<uD$~<A\$%D$ @D$D$ $][\$nUWVSh ŅtD$u [^_]ËD$$諳tYNjt$|$s:D$u(D$uED$E [^_]äED$E fD$tL$D$t,$1f|vtT$PT$P HUWVSãt$tj9u`6ŅtUF E VUFuOV t>T$$ͲT$t Njvru1u)E ,$1[^_]ËFE[^_]äf=D$t 9t1Ë@ UWVSD$$tE9u;h pt-ts,$t#ǃs-ut[^_]Åu1[^_]ftʍXD$ D$D$B$YD$ D$D$F$XSJ T$tK9uABR t t [ÅtD$ xD$D$\$X1[SãD$t 9t1[ËL$tL$9uL$$S ]D$t 9t1 [ËP ;T$uT$T$T$@$ކUWVSI t$8~$u7Ft=D$ T$VT$$t N [^_]ËFD$T$$11tԋD$h,$DžtFVT$T$$D$9D$D$)D$4$2T$xT$P T$4?~gD$D$D$F$mD$tPF F;D$8"#1D$ `D$D$B$qV<$Ft&f8"uD$<$"D$@@1VSHt$ܘ $ƃ t$И $ƃؘ 1[^S7D$xuQD$D$$[ÍD$t 9t1ËL$tL$9u9VSÃt$D$$)-uИ 4$[^Íܘ 4$[^VSc%t$t9u4$|[^1[^*D$t 9t1@SD$t 9t1[ËL$tL$9uL$$ VS辿Àt$$Ft [^À~$tD$ D$FD$F $u_D$ QD$FD$F $ϼtWD$$+И 4$_D$ 0[^ÍD$$+ܘ Ǎ D$ D$D$p $mSffffffUWVS 貾tDžu$@ΫƅuU1 [^_]ÍD$$iŅD$t$@菫ƅT$u$ȳ [^_]1퍃D$D$4$蹱D$D$F$])n,~0F4F8F< [^_]SâD$ $)D$$)[UWVS諽m|$(t$,9D$0(D$4;(G4;F4uG9EL$0L$4G,(D$8F,(D$<[^_]1<$s(4$h([^_]ý[^_]ÍNW9sL$$9(L$ $-(YT$ $(T$$(<농D$ D$D$ $(Q D$ D$D$ $PUWVSP|$,7F4N09 V,tctclD$(D$D$ D$t$D$($t~n4/[^_]ÅtO D$ D$D$f $@P$F$&4$1[^_]ÅtM/[^_]ø[^_]Í= D$ D$D$u $O D$ D$D$d $OUWVSöŋp,t$ T$D$$«tPT$t5}0 rE,U0D$ $[^_]ÉE,U0[^_]1[^_]VSb$Pt8ƍ9u,F 9BƍMF<$o~9uFG4$?[^_Ë$4$$1[^_1WVS|$t$\$Ct [^_1t{$uى[^__S1iD$D$$E[UWVS D$ $tVƉ$QD$t$D$$$iDŽt4$A [^_]Q(4$(Q( [^_]1 [^_]WVS聬CD$$聯t)ƍiD$$腴lj4$8[^_1D$ǀǀVSt$tML$ \$$ZL$(J\$,Z [^$t5L$ HL$$HL$(H L$,H[^1뱍 D$ D$D$A, $?X D$ D$D$B, $?ST$tqtnD$t AT$D$ t AT$ D$$t A T$$D$(t AT$( $[1[Ã\$t \$ L$ tL \$ \$$tL \$$ L$(tD \$([ø끍 D$ D$D$Z, $>UWVSED$] u}څu59D$Ë}t E@؋T$[^_]9v/u,E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W뇉u 11҉ËD$\$J ‹D$)‰$ D$ |$t$؉ƉD$ ËD$D$؉t$ ։d$ljT$9rStKEtdD$)T$ $|$ E0PD$D$19D$sY+D$T$ T$1D${UWVSE] u}D$څu9v:1҃[^_]9wGσL$ uG9r;t$wމڋD$)[^_]Éu 11D$멋D$[^_]ø ‹D$ )‰$ D$|$ t$؉ƉD$ ؋\$t$d$lj9r(t") $|$ [^_]9s+D$T$։UWVS ED$u }Uu-9wXu 11҉ËD$ڃ [^_]9wڃu39r ;|$11ڃ [^_]É1ۉڃ [^_]ø )؉T$L$ щL$<$T$ ։t$׉$$9rt1둋T$9sF1{1tUWVS$EUu +D$ׅ\$\$D$]u&9D$T$D$ 9vWED$t$ D$1T$\$t؃ڋL$t \$T$ \$ M\$t$ q$[^_]ǃD$9r 9\$>+D$þ\$T$ 녋D$u 1D$1҉|$ƉÉt$,|$׉|$؃ډ]U ] u D$ ‹D$)‰$D$ L$ |$L$|$׉L$؉ L$\$t$ ׉d$ÉT$9r=t5D$)T$ $|$ É\$T$ D${9D$sōq+D$T$ T$1UWVSM]u D$ \$y كۉ\$ˋ}D$u9vVщ1 9t$vEL$ t؃ڃ[^_]ËT$ƒD$uO9r9w)t$Åu 1t$É1]U ] u D$ K T$)ЉD$ыT$L$ щL$D$$T$ L$t$$$Ɖ9r't!)ˉL$L$ 9s+$T$щUWVSEUu D$ Ӆy T$ ؃ډӉNjED$u9v\D$9v'D$1ۉ؋T$L$ t؃ڃ[^_]ÃD$uT9r ;|$…u 11҉ƋD$Ét$]U ] u D$ A T$)Љ ډT$\$<$\$ ؉t$׉$$9rt D$'t$L$9s1 UWVSLD$`t$dL$ht T$hhxP T$4H P T$8P T$<P T$@PT$DPT$HPl$0|$,|$4|$(L$$L$8L$ L$t4$C$~-D$HD$0D$HD$,D$H D$(D$H D$$D$H D$ D$H D$D$H D$D$HD$D$HD$D$HD$ D$HD$D$4$ u(D$H@x#t|$D$H$$4[^_ɃtӃ @?tBrz<$tBwjzrZ@@L .@Bs ErwsJtortHw%tH==utf [^_]ds-%uxf [^_]--PxJiE- uB-u3-JAډ,$BSBxщډSJTf [^_]-f [^_]Á)t(Acl bpta-UWVS誌lD$D$0$D$ D$D$ D$D$0$Ń4Ǡ5|$0$Vl$7L$D$ D$T$0T$<$[%L$u D$ <=t9<D$<1ul$D91[^_]É<$ D$뽸0UWVS蒋HL$ $T$4 T$8D$@D$<D$tD$xD$|DŽ$DŽ$DŽ$|$D|$t$tt$$\$ cOl$\l$t$$\$ c:D$D$D$ D$D$$D$D$D$$\$ |$ Bhƃ{D$D$DD$$|$ 1cD$D$\D$$cD$D$$D$$r5D$D$4D$cK$0$D$|$$t$ bD$l$$bČ[^_]D$|$$\$ ibD$ˍcK$?Č[^_]Ë|$ D$D$DD$$bD$D$\D$$aD$D$$D$$VC\$ "|$\$ .8D$|$4$\$ tD$D$DD$$|$ xaD$D$\D$$\aD$D$$D$$D$D$UWVSD6t$(D$T$L$,tȃ"T$~GD$D[^_]r |$$9^D$03D$@\$$3\$< tQD$4T$8\$@T$<ӋD$D[^_]r |$$9^D$03D$@\$$3\$< tQD$4T$8\$@T$<ӋD$UWVSwf 5$1D$D$d|$|$EUD$T$ EU$T$U E|$u$3u%Ą[^_]É|$9D$$@`USEU M]M] M]M]M E ]$]M[]VS vÏD$tT$ uD$D$$h [^ËT$ T$D$D$$6ƅu D$ [^01av'i mNA90 %7vT$ UWVS vD$l$<|$8,$\$+cD$D$4)D$D$8D$l$tnt$<69|$8r\$9|$8v +L$L$ $T$@L$ yt$t$$T$@~ +VC9u떋D$8D$D$D$D$t$|$T$9uL$T t$4Ǥ9ul$8׉,?9l$8rHt$9l$8vT$T$ 4$T$@T$ y|$9u,?9l$8s݉D$ljƃtt$D$$T$@x /9uƍ/t$9u)l$|$8"D$$\$i1 [^_]1 [^_]ÉڃffffffUWVSljT$t$()D$ )Չl$tpӉә؅u)$~ID$É\$$~+<1+D$  ; 9$t 9D$~D$9l$uÃ[^_]Ë\$UWVS,ts65D$0=*MuEǀ5tǃ$ǃ(8 T$T$ D$ $D$H<-<+(M$t3T$D$D$‰MD$)Ɖ)(ǃ$Mu,M9L$@D$D,8-uPubD$,D$ $D$H8-EPU|$D|$(c,[^_]Ã(t$u$p,-LFD$,:uD$H<-<+|$D$H$…D@W<:~ZED$(D$$E8 ,D$8D$=t$4$D$ ")|$ D$ D$L8D$D$14D$L|$LH9LtTD$T$L<tMD$ D$|$L$ $ uщ<$m;D$ t:D$ut$봋H9Lu@ 9D u렋D$u}D$NƉD$LNj@D$  4=*\o5D$H<-<+<:uI:4=*t'D$H8:tD$D$D$ D$$Hs5?,[^_]Í8 ,$(D$D$0))uǃ$ǃ(,[^_]ÍPwT$ YD$G t81D$PD$P0,[^_]ËD$$D$ {}s<;KE~VE9D$@8 ,4=*tD$H8:tD$W$r5WD$H<-bD$Hx:[~uE4=*tD$H8:t|$8$q58?4=*ED$H8:8D$D$ $jqD$H8:D$D$D$ D$`$0qtED$D$MA~t7T$t$28 ,E7W 5)z:t͉E9D$@8 ,4=*tD$H8:t|$$p58D$H<-tD$(ET$DL$$L$4=*2t"T$H::tD$D$$pEOt[„5EOD$$E$(D$D$L$$T$DT$AO „5 뤋|$DD$UWVSkÖ5u\8UtN8DŽ57:}u04t D$,8:?[^_]0D$(;L$$P88-h8pDŽ57-txu8 8D$-D$,$tg--t$D$,$7x:tw5}u0[^_]Àxu08 8觰t$ D$"D$C*$$0J}t!5(8 80tx:t 09L$$~"D$( 5J5볍8 8D$,8:t&4Wt$ D$<E::S iaD$ D$D$$P [USii+D$E$$]ffffffS5iD$ $^1[UWVSiЕ}UtFt(GD$O _D$9w G 1҃[^_]ÉUM O GD$ȋGD$Exk);Ub|;E s[ T뒋E E jlD$ D$D$x$M ]xL$M O /P *cD$ D$D$x$tUWVS gÈl$ M 1D$(1EU29r})ȉ‹D$(9wD<t$$sFu(u M M ]U9w  [^_]ÉftЉ<t$$ruq띍GD$4$ YƅtIE)DT$D$$E0}M =| =|$(Sf{P`UWVS{f=t$0|$4D$$AW$gSŅ0x@@ jD$D$"jD$ lkD$D$,$:DžtOD$$[^_] 11 8$[ 81 T$,$Z$Z T$S LeD$D$D$D$C*X$Fp [SeّD$ D$ D$D$D$D$C*X$kp[SdÜT$L$ L$ D$T$D$$`[Sd`D$ D$D$D$$_[Sfd(T$D$ D$T$D$$_[S*dD$ D$ D$ D$D$D$$#[UWVScñt$|$ ~OD$4$UV0t>tD$4$X[^_]Åt≺؉1[^_]ffffT$L$D$ yD$ L$D$bUWVS l$ t$$|$(t9)t1؅yD$t$E$Uu9t)؃ [^_]É [^_]UEU@ ]WVSbÔD$8p$:Xt|$[^_1[^_UWVSbY|$t$tEbt,fh f@T$Px$p,T$ P(T$$PDT$(P [^_]ýut1UWVSbގl$8|$<$6OttƋD$0D$4Fn~ D$@FtPptoD$4t8oapD$D$|$ l$L$4$t[^_]11D$4$VD$UWVSha*l$$T$(E0ǃt5~+u,t r M$t D$ RD$T$,$[^_]S `æD$D$D$D$D$$ [S`vD$$D$ D$ D$D$D$D$$[VS{`=t$f~ tyD$4$F0tN@9t $UF0ǀǀ FFF t1FD$4$1[^ËF. UWVS_ÕT$l$B0ƃt5~+z,t } J$t $]EU!Ѓ[^_]WVSZ_t$D$4$nx#P8D$4$[^_É4$S _ċD$D$D$D$D$$Y [S^ÔD$$D$ D$ D$D$D$D$$!W[WVS,^ZD$F^0utttl$t$ D$lPL$ |$L$4$uى~uu|$ |$D$p^0u|$\$\Ct$,^,6D$p ^,D$T$`zD$pv|$%CD$L;D$|{D$D$lD$,$D$8D$pD$XD$tD$T|$|$T$@$BD$$$|$$$|$,;D$|-D$D$lD$D$D$Hl$TtD$T$\$(D$t$$\$(l$ |$0|$iL$`T$,Z0D$<@HD$x)Nj$:z)Ɖrr D$H:D$D$$\$($)L$tD$H D$BT$$\$(D$TD$tT$1D$H AL$$\$(_D$tL$ND$H l$D$$D$[l$D$$$L$tD$H9f rdt$t$LD$HUWVSPZ'T|$dD$ht$lt$ 5L$L1ɉts9thP ux<$PD$pt T$D$pD$|$D$$nT$Ћ|$L3>P[^_]ÍtD$2@D$|$<$+<$nP댋@D$\ /tUGL$L$$3ul$ D$D$2|$<$.<$P L$ h̺aT7jffffffUWVS%ǔR<$8X9sr,I*2DVt`1*Dnt ,JLi9u9t~Pt<$ Pȃ[^_]@ 1UWVS<%QʼnыD$ U9s"ƍ@9sx9t5Eƍ@9rEuދUuE EE1[^_]À8]u9sӉ+D$ D$l$ʼnl$D$ D$4$u 4$9t'7uӋl$|$tEuEzG[^_]ËD$ [^_]WVSL$Qp9rHtk P [^_ÍJ9v:[uz.uƃ.N9s z9v:.t$VuF V@대z]uփUWVSNjhp 4$pt1Z (J9u$D9uh [^_]S% [UWVS F#PH9sE׉Ƌ@nU=v0FuF F1 [^_]ø [^_]D$|$F $u~UWVSXuω։Ëh@9sC US 4[^_]Ã@3tkUWVS,p"2O\$ D$@p VP xQ9Ql$Y D$T$$\$ L$APT$|$L$L$$\$ gD$@H9L$ttX1҉ȉ9u)|$D$ $\$ 茻D$@PՉPT$U]EEE D$@J9vBt$ |$ g9r9D$@D$t$\$CD$ C,[^_] ^xD$(]-|$7\$ Z)|$ ,I*|$$|$9wN]9-[/‹O9s8-t=؃UM E9u7G듋D$ |$G,[^_]Íp9vx]t7x-yT$_T$8~GuG D$ G9|؉k1ɺt$,[^_]ËD$$\$ D$xu@ D$ t$F,[^_]ÍrL$192JD$(lV:=79rGuGD$ 7w<-<]=\UM E7G9bV9v >=GuGD$ G- ~]wuG ō^\$9r!_uGD$ 7wt$D$<-<]wL$9\$$DC~AHDSȉ9u+t$D$ t$ l$݉|$Ήl$D$D$<$\$ ĶuuՋl$|$WGl$|$FptEU]^uq>D$ D$|$KD$$\$ E tdt$D8$\$ &U ED4$\$ t>tQ}4$\$ DEU u$\$ E uD$Pu@ D$|$8x뚋|$7G9s V9v >:GGGOuGD$ 7w1ۉt$AGuGD$ G+D$|$EUP-E-7;wND$@D$>]\$D$@D$Px)?\$ ,I*t$ $I*t$(I*\$֋UM؄ t/|$ 3t À\$39t  :]uD$@D$xL$(t[y!ڈ(Mt EUu ڈMuD$@D$PD$xtt]u11T$ ȉ L$ 9uT$ uC u1҉ʉ 9uT$t$,[^_]CED$D$pt$(@ D$9l$ 9\$D$:CuD$ 9to+K8@D$ „M8u1\$$L$L$L\$ 8uM9uۋl$ \$$9\$v|$GG@D$(݉+L$(0D$,[^_]H\$$:1ɺ\$3l$ 믃D$L$Y]E]0@>D$t$^-E-0@ ~]7(~]GUE B m D$@D$x‰D$21--l$ D$(D$PUWVS D 5ED$1FH8 $@tlL?,I*tXuztP$I*9t@ $~D$D$FT$fD$] $~D$3Eu< [^_]É<$?uًVB4HJ4(I*~[UWVSh)щ $u [^_]É։ÉϋPtS K<4stft$C[^_]uufUWVSKCNjt$$hO D$ G$oH9rP(9wP(9uj?)GD$)D$щ $_G \$ ([^_]UWVSžBÉT$΋|$(D$,S T$HL$ =vC [^_]ËCuK11ҁƒЃ|T$4D$D$ vT$D$|$)<$HK)P؃[^_]LqD$)$x_K+L$SA1ɺCT$kD$-t$)4$xVD$ D$<$QK)s {t{1ɺnKuCP؃[^_]=D$C[^_]C C[^_]ÉI&KT$)щNpCPD$5KT$)ыD$UWVS@v4@ƉT$ 5D$,\$<1ہ~ AD$0D$$D$ D$,I*D$4EƉD$E]t$,I*t$(9K|;T$5puL$$XɋF D$,t$<30@[^_]ÃE\$ M ]]+*ME3+L$PqME5+L$`SE]ut$9 Jրv.?t){P9Ht$4DJMuE ]]9\$9\$uVuF FD$$F+L$+L$9rEuE EEEPDZXD wD$D$ٺhGE;Es8)tL$0)n wEDHٺpU]9sBE:)>EuE ]]ED$1ɺ EH(@0E]D$ 9s!Jր?Y{ut$CEuEiUT$ 9H,I*DHE EE1ɺ EH(@,E]D$ F-E]D$ ,E@D$ D$8ED$;ED$8^ ]u]D$ 9rEuE uFEE]D$ ED$ t$ XE]Et$ ^EGE W]uE ]]ED$+JME+L$PE]cpt$9H,I* DqD$ED$ tMX EE?E;Es 8,D$$T$E]9s8}u8} E9u]E ]]T$E]' EEME+L$] E1ɺEmE]\$9\$9ED$$tWED$D$L$+L$ED$ D$Et>1ɺD$$D$ D$1ɺ(E]$L$ T$)эE ED$ 맀?{=ED$]L$t$)4$xED$t$2EPD$)$HcMD$)$XCMD$)$H#M#MT$)щ;BD$)$xMD$  EE]PUPD$(DPu34L$T$ )эF FD$EL$ *L$ 9uuE UU?OUWVS8 Dž7|$ÉT$ L$|$L 5D$L$41Ɂ{ xCD$D$ 3k9T$GD$$1D$ L$,I*D$(Љ9F9.;l$ >\).f[(CPDrpD D$D$hS9CDHp3k9s F9CCD$uCt$3s1҃$‹|$19 ׉…9T$ u&CuCD$ CC D$L$438[^_]Á{hЍ4Fdkt$3sC@H9vV<*9v<\CD$>\PCuCD$CP8)-Cn;l$*u4Cɐu/SC D$C3k1}tCu3k K{4+L$PKsuD$)$XK+L$`3k1ҋCD$3kCC C@t~3kD$0D$3CD$0^ ]}3k\hS9@H9v 8\ux)tD$$$)\  1ɺ(3k~{3S9s 8,oD$$T$:3k9s+F9v >\9tx\Tƃ9u+SuC t$3s1ҋCD$>^u31ɺ CH(@,3kCD$HCD$C3k1B>\~)3D$)$HK8N`@^3kyD$C1ɺ l$|$$ t}D$ <(uL$A PAT$tAT$80uËyӍ:1)މۉl$  :)u39T$ul$|$ D$#/ul$|$$Yl$`D$@ET$8UD$D$E$\$(T$4Ep@1D$ D$zXt&nfuT$ B%`tMt^t֋E(D$ E(11҃F%=H=P9sу;]@vf]@D$ D$1ۋG9]@r1ۋ9pxZh;]@a1ۋ1Z=OD$ E(MLEEED$Go eD$4D$( D$,D$0$$\$(D$4Ĝ[^_]ÁHLXELEEED$Go eE(tD$( D$,D$0닸 Ĝ[^_]1ɺMLEEED$Go eD$ #D$41Ĝ[^_]É,$\$( $E(D$ D$tO}@G$\$(!EHH LZYZYR Q X SP ҍ1[ø[ËD$xuxw1T$øËD$xu@ u<.wøËL$T$yuA u<.w~ 9|D1ËD$T$xu@ u<.wx 9øËD$u D$D1WVS W(t$T$ |$(D$$u;D?9r0T$D$4$0?FFfF [^_1 [^_WVST$L$zu1BЍp9xAFAFA F Z1[^_øUWVS,f'\$T$@t$D 5D$8|$(1zBύD$T$4$DFȉt_VD)݉l$ :|$rt$Z\$ J L$$(*hjhjh j 8pXH ;D$ u1|$t$(37u,[^_]ø\$>T$zuBu :BrøSL$T$ yu#Au:Arx 9s D[1[fS U&JHT$D$$> [ËD$ ËD$T$ Jσw@)P T$1øUWVS\$L$ |$$4k ,$v [^_]øtw9+$1D!)׍D=1Յt +D$8t]@‰t$s[tft+$r)t ufE+,$EC 1[^_]ø‰t$ruDuM댉y+D$8t_^듍s U}PfUWVSt$L$ |$$w}~ 9)1D!ŋD$$)1ՅtuU +\$ˋD$)j)t u5)^ ȃ[^_]1ɉȃ[^_]Éh륉 $Z $뽍^YVST$ \$z)B1wyvrJ q 9r`L tI8t6P9rJP9r=9v18tP9r+P9[^úѺB[^WVST$t$\$z)B1w{vtJ y 9rbL th8t\P9rLP9r?9vP89u!MP9r'P9rv/89t.uݺ9s[^_ú뫍B1[^_ËT$D$ttuBøøUWVS!|$4t$8L$<<ɸ9D$0l01ɋT$,t;l$,wvD$(tsD$(D$0tyPT$ t9QPL$L$D$D$ $]L$D$ ȍX\$ XD$@|$ 8[^_]ý[^_])dPT$ WVSD$L$~WQtD);T$w~ȃt9t#KHsx1s8u'u[^_ÅtB1[^_ê[^_ftu.ut1밺vfڪsWVS\$D$‹|$ߋt$stft[^_uuPfWVS\$T$D$txusڅt89vt[u+H9r HD9s݋D$$[^_ÍCōp9rxD89rՋT$ T$ :|$$7)[^_Ã땸UWVSl$L$T$ |$$)$tX B9$r5r9$r%8t;9$vuԸ9$sۋD$,[^_]ÍUǃL$(1|$,)[^_]øWVS\$D$‹|$t$ރstft[^_uuPfSD$D$D$,D$ D$(D$D$$D$D$ $T[fUWVSPÁljL$ 5E$L1D$JD$D$D$D$ t$Jt$T$<$Dt'D$D$$L3MP[^_]ÍT$(11  rGD$,D$0D$$D$$D$ T$aTD$D$$D$u|$$tn$Kt$ Ƅ$KD$D$D$D$ t$GD$G$qut$D$ $sPtu|$$<$ D$$$D$3UWVSP8Ɖ 5D$ $L1ƃ D$JD$D$D$D$  D$D$T$4$OD$D$D$D$ |$J|$l$4$sD$(D$4D$8D$<D$@D$DVT$,D$0D$(D$$T$$T$ D$aTD$D$$(l$$td$KƄ$KD$D$D$D$ t$ED$E$ut$<$NtXmul$$EtXD$ |$0D$$D$$$1L$ $L3u#P[^_]ËD$$$ D$ԋD$1UWVS4D$4T$(L$ $D$,$D$0$$D$$ 5$1ɅD$l$PL$<D$FD$,$D$TZD$$D$PD$ D$D$$ʼnD$$輒 !%tꩀuD$)ƒT$D$<$vEŋT$ !%tꩀ\+T$9w|$XfD$\t$`fD$dND$D$D$X$\F D$fl$Tl$$T$T$$4$jGD$ 4$>GL$ ɋT$$4D$<$<0<(t$@4$dD$t$<$qDt$D4$ED$t$<$RDt$H4$&D$t$<$3DD$l$<$_Eo|$Tu@D$D$8D$$SDD$l$$C|$T tD$l$<$DtȋD$PtD$<$ F<$FD$8 D$<$yCD$Pl$TD$D$D$D$D$ D$D$TD$$u&t$4$]=4$]=v$=tS$Y/4$GE"x$>/4$,ED$LD$9$/$뫍$.D$P#UWVSl< $$D$$D$$D$$D$ 5D$h1$fD$ 5=D$D$ l$H,$׎D$(D$4D$8D$<D$@D$D$L$,D$0D$(L$$L$ D$l$$jD$$@t$D$D$ $T$ yT$ D$N$t $9PtFD$D$D$D$D$$L$D$$:ƋD$$$gL$h3unl[^_]Í˪$BfD$ D$D$D$D$D$$L$$@룉$D$D$y$ !D$D$4D$D$0D$D$,D$ D$(D$D$$D$D$ $UWVSl $$D$$D$$D$$D$ 5D$h1$fD$ 5=D$D$ l$H,$蟌D$(D$4D$8D$<D$@D$D$L$,D$0D$(L$$L$ D$l$$2uuD$$Pt(D$T$ $T$ wT$ D$$L$L$T$T$L$ $L$.ƋD$$$[t$h37u/l[^_]É$D$D$y$@D$D$4D$D$0D$D$,D$ D$(D$D$$D$D$ $7à D$D$D$$ UWVS$D$$D$ $D$$$D$ 5D$48$1D$D$8D$,$DD$(D$0$8,I*D$(I*D$D$D$ D$D$<$>D$ <$QMj$8< d< G< ?LL$ T$*< !< tЍTtD< uΉ9I>ut$$$8<+<-$9<@D$(D$0L$,L$ D$D$$:$諛؉D$(<+<-t$D$$:fqh1s< t< t< ut&Jw$9Q<@+T$(D$0L$,L$ D$D$$:$薚D$(<+F<@D$,D$ D$D$D$4$J$D$ t$ G4$f u5Ft2<@D$,D$ D$D$D$4$ؙ]|$4$3ļ[^_]Í$9$D$ rt1뗽$9$D$ ؉D$(1Ƅ$8?t$D$$7$D$ MD$0$D$ 4D$0UWVS^ $D$$$ D$($ D$ 5$15D$$ \D$0D$D$ $D$D$4D$D$$萛D$0D$@ D$$4$MqD$D$4$7ID$PŋD$0@ $OD$0P T$$ZD$0@$ J]D$4$mD$ t}D$dD$,D$4$T$ D$l%=L$$$eD$$蘰,$谰$3i[^_]þɍJ]D$$ɈŅtID$(D$D$D$ $D$D$$D$,$BƉ,$tCdT?T/^L$,Sd>$T$ L$,L$$"ZT$ x'D$|t5L$0;At,L$L$D$ltL$D$(D$D$D$ $D$D$$D$$T$?ƋT$jUWVS@;D$t$X|$\l$`T$ 11  rD$(D$D$ T$\$aTD$D$T$us\$u vM[tBl$|$ t$CD$C$Ju׉D$T$$\$6D$@[^_]Ë\$$\$@[^_]øVS(e' 5D$$1D$D$D$D$fD$"fD$T$4T$T$@T$T$tftBJ$1D$׃SЀ wYӃ0$waD$$D$;L$rBD$ )ljB)уv [^_]ÍSw'ӃW$vD$D$맍Sv uRmӃ7$_D$$D$mD$d+D$ GIu8ڃ߃Aw+ )u#uf媍YUWVSdT$0rjBD$ƃ_ BtrD$,yf9x딋D$$$Yn댸 UWVSH{=$\D$($`T$ 5T$0 $D1ɉ$4nD$,J]D$v$\}D$z1퍃/D$D$CD$$,$}D$D$ D$D$D$$Ņ Ƌ|$D$8$uD$u"$[^_]$!\$Džu1ҋ\$ UWVStÁ$$D$ 5D$ $p1ɍl$,$!D$D$@4$+x~Ǎt$pT$t$,$!D$t$<$*…։D$qk0<$+bk0T$u*D$D$,$L$ $p39ut[^_]10 UWVSlÙ$D$ $ 5D$h1t$4$< $T$D$ D$4$O l$4$L$h3ul[^_] S`"D$D$D$$蚺[S8D$D$D$$r[VSD$D$ 4$`D$ t$D$D$$\[^ËD$ȅx%ɁtfffffUWVS(zDD$t$<|$@ 5D$ T$$1҅t_t$l$,$t$*1ҍLW LWuG(t$ |$$3>u"([^_]$)\$ Džu1ҋ\$&UWVSÌ$$D$ $ D$$$$D$$($, 5D$$1ҍ$D$$D$@,$'D$A W|$0D$ D$$D$D$D$D$$#\L$D$D$D$D$D$$*'Ņl$D$D$D$$;|~z)׉ ug0D$$!(g0D$ D$D$$L$$39[^_]| SJm.xdg0D$$'Qg0t1|$$D$(D$D$$Ht$$}D$$C'16D$D$D$D$ D$ D$D$$UWVSp^ $D$ $ 5D$l1t$4$|$T$D$ D$4$l$4$wL$l3up[^_]=fUWVSh$ʉT$(QȉD$,AȉD$ i ͉l$Yˉ\$0AΉt$4qΉt$8yω|$fD$$pEfUWVS D$ \$4t$8 5D$8|$11|$1҃ƒуTuD$l$ D$4$'F%=t)D$l$4$F%=uD$|$4$t!1уuD$|$38u [^_]Ë\$ afffUWVS(D$t$<|$@ 5D$ T$$1҅t_t$l$,$t$1ҍLW LWuG(t$ |$$3>u"([^_]$)\$蠚Džu1ҋ\$UWVSJ $$D$ $ D$$$$D$$($, 5D$$1ҍ$D$$xD$@,$hD$A W|$0D$ D$$D$D$D$D$$EL$D$D$D$D$D$$Ņl$D$D$D$$|~z)׉ u_Q0D$$LQ0D$ D$D$$L$$39[^_]| SJ.xP0D$$&P0t1|$$D$(D$D$$1t$$}D$$16rD$D$D$D$ D$ D$D$$UWVSpުà$D$ $ 5D$l1t$4$>$T$D$ D$4$7l$4$wL$l3up[^_]fD$@@#Eg@@ܺ@ vT2@UWVSt$(Hx|$X \$pt$ PT$x|$X$p t$P$T$x(|$ p,t$$P0T$(X4\$,P8T$0@yZ|$<  1Ήt$n|$<  L$P1΋L$ n  T$< 1ӋL$8nT$P 1L$nD$< ЉT$P 1$T$<n D$P 1ډl$P=n  ʼnЉ 1D$0n Љ 1΋D$,n 1ӋD$$n  1NjD$n ׉ 1|$(:n ݉1!1‹\$8;ܼ  1!1ϋ\$ܼ  1!1֋\$$ܼ Չ1Ӊl$pm  1|$>pm ҉ 1ߋT$8>pm Љ 1D$(>pm  1ȋ,$>pm 1l$0.>pm 1֋l$ >pm 1l$/>pm 1ߋl$$*>pm  1l$(>pm  1ȋl$(+>pm 1l$5>pm 1֋l$ )>pm  1l$<=>pm  1ߋl$ >pm 1T$ T$,>pmT$  1!1ȉD$ D$vmzD$  1!1\$ \$3vmz\$  1!1։l$ vmz 1!1l$8=vmz  1!1ߋl$vmz 1!1l$$(vmz 1!1ȋl$4+vmz 1!1l$<5vmz 1!1֋l$ vmz 1!1l$(/vmz  1!1ߋl$vmz  1!1l$,(vmz  1!1ȋl$+vmz  1!1,$5vmz 1!1֋l$ )vmz 1!1l$0/vmz 1߉1T$( 11D$4 11\$   11t$   11L$8  11l$ 11T$ 11 $ 1ى1|$ 11t$  11\$, 11D$0 11T$< 11l$  11|$  l$X |$T$}|$@|$`}11L$$ |$D|$\É] L$` L$X|$p1D$ll$,(NSD$HD$\΋$p T$Lt[^_]UWVS l$ u}Ã?@)؉D$D$(1EU;L$(wDuv@;t$(|$$\$,$V@;T$(v1;t$(r [^_]1;t$(sD$()|L$$΃sNu tӤ [^_]ftUȍ<t$$sNu@u9T$,$;)ދ\$ZuYu@t릤fftuPu7tى17ffD$$pD$UWVSΔƀD$0D$ |$4 5ED$1GWL$L$шl$ʈL$L$L$d$D$?@)ƒw)ƒT$ D$<$D$D$D$<$L$ t(_AAa9uݺ\1u-u3tftD$3Eu[^_]ê[tfƉUEUU f%f=t1Áu EøffffL$$Yai qyD$A(tQS[ĿRjjc [1Í&t&L$y(tQS[ÍjRj, [T$D$ Zbj rzu@ $fffD$$X`h px1Ít&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[߾Rjj~ [1Í&L$QS[ójRjR [T$D$ Zbj rzu@ $S豑sD$ D$D$D$$[Sy;D$ D$D$D$D$$Qk[SAD$ D$D$D$D$$k[UWVS(ȽD$ D$$D$D$D$|$|$ D$w =*1UWVS$یÝt$8|$ |$D$4$ex@ND$wY 5!L$ D$|$4$ne$[^_]Ã>w) 5 d$ 1|1WVS&|$ CD$ totD$D$ 4$<y( J*t@ [^_ÍT$$T$ |$)‰T$$v;뵍9D$D$ 4$;SXt'wA-t =ur- P+uT$ #T$P[ÉL$ ot utguu0@\$ X|$+tJ|$-tL|$=uH뺃+t[É Ƀ шH@붉hH{HrUWVST$D$ ǁI@|$ Xt@~"ouvgt1[^_]À+t-uJ!ȃ XuL$t B$J΃t?t #j!t,#j!t#z!tt 4$#r t<$4#r ]$#Z P$cÃ$V<$kUWVSTy;|$h?D$4D$8D$j$VD;D$dT$$zD$,4pjŋD$pD$ t$D$4D$gfffD$$)‰щ))L$ED$Q+T$$D$8‰D$ D$D$dD$D$`$#ttD$<2D$@fffUWVSlj $0ʼnT$ D$;$r^fS f?tqf[f*t"f9tZD$9ttv9vY1[^_]Ãfz*thT$ ;$s fuf?tf[tf*t+D$f9uphuD$T$ UD$uD$T$ 8Z1f!L$t`JD$il$f]t,if-tCf9މL$uD$il$f]uԉՋT$\$9\$PJZf9rf9qrD$Y눸SqÿD$D$D$$'[WVSt,u1[^_1ۃtt_Dt[^_UWVSqQT$͋$(L$ 5>$1|$}u4D$E@D$<$tL$ $3u[^_]#`UWVSqɝ\$ D$։͋RЍD$F t =?F\$\$$\$ bDž%F:~L$fyu+L$UʉUT$ $L$\$ ]ÅT$L$‹D$lFJ‰F %[^_]ÉT$D$$\$ 0]DžT$tnLD;Du)FF t1T$w1؃[^_]ËUދ\$ b$\$ dLVjUWVS]ot$$D$ϋ$$D$$D$ 5D$$1ff/tf։1fFftRf/txfy9wڸ\$$3;VĨ[^_]ÃfB/f/u9w…t4D$ D$D$D$ \$L$$D$뛅uԉˉĉfl$M \$(E$$ڋD$u\E tl$ UJMtf~/tD$0%=@tm=t#D$@L$ ‹D$1$D$u‹D$@ @\$,$tMP(uD$0%=@u9/늋\$$/\$$衱\$$̈́UWVS:m\$DD$T$L$$D$$$$$$D$( 5D$8$1f9r w9vpf>*uf~*u1f~*D$<FD$,9t$$l;|$,bD$(f?D$l$G$L$T$D$`D$,D$<D$4M L$L\$f;D$\$DwD$$D$0$D$0E @$U D$ D$ ?E @D$DJD$0T$BD$HD$)D$PD$\D$TE$D$XD$ $D$0ЋU wtL$(Y\$@Y|$@l  x .\$L$9*H f fl\$H;\$L$4T$ [^_]D$ D$D$,$&L$tWu\8 D$@9D$L$T$D$$RD$L$~ ptZytrl$k$xRD$$bRl$N$PR8 8 붃G&wҋፋdD$D$@D$fffffffUWVS4Mñz 5D$$$0111 r D$?.D$D$ @ D$ D$D$D$$1D$(< T$T$$Ůl$(\D$\t$,$BF8t߉ 8#uD$\t$,$~Bt8t㉃$ D$\t$,$[Bt8t㉃( D$\t$,$8B8t߉, ǃ4 ǃ8 D$\t$,$At>8t$94 D$\t$,$At8t$8 D$, D$t$04$t$,+*D$D$,D$D$\D$D$D$$kAŅ8tՉ$uȋu 붃7tt$,$蠬u牳0 +j< D$D$ D$D$O`D$l$(D$\D$D$,$@I8tۉ 8#xD$\D$D$,$}@t8t߉$ D$\D$D$,$V@8tۉ0 +€ , -D)( D$\D$D$,$?8tۉ$4 D$\D$D$,$?8tۉ$8 L$$$03uZ4[^_]Ë0 iBǃ 41ǃ, B.5ǃ0 (VSI]vǃ< @ t$D[^ÍJ]D$4$@ t [^Ét$O$˘1S%Iu@ tt [Zu1[VSHïut$9ut$ $踩tu1[^Í [^VSH]ut$ut$$ $ftmu1[^Í [^SJH u@ t$tǃ@ [ffUWVS<Ht\$,T$0L$ |$P,I*D$ (I*D$σD$T$nD$D$t^D$D\$ \$1D$T$T$ T$D$D$ l$$LL$$D $D$D$D$D$ l$$LD$$H$T$9upt7;t$$D$<0D$ |$D0D$,$>&D<,D$D$ l$$LD$$D$;ƒ|$;}8-؉1D$|$111:UWVS8=àj$LD$$P|$( 5L$09$41D$ D$$T|$$ƅu@11D$<$2D$$2t$0$438[^_]É$g*D$t$ D$$TD$D$$jD$,q$#*Džs1D$,hD$$l$4|$;D$$~(D$D$ D$$.D$T$ T$$T$D$D$ l$$TL$L$ $/D$D$ D$D$ l$$TD$D$($;T$ 9umt7;t$,D$<0D$ |$D0D$,$#D<4D$D$ l$$TD$D$$ƒ|$G8-؉1D$&|$111UWVS8T;h$LD$$P|$( 5L$09$41D$ D$$T|$$Bƅu@11D$<$\0D$$P0t$0$438[^_]É$'D$t$ D$$TD$D$$D$,q$'Džs1D$,hD$$l$4|$;D$$~(D$D$ D$$!,D$T$ T$$T$D$D$ l$$TL$L$ $D$D$ D$D$ l$$TD$D$($T$ 9umt7;t$,D$<0D$ |$D0D$,$'!D<4D$D$ l$$TD$D$$ƒ|$Gi8-؉1D$&|$111&}UWVS 8Ïel$ |$$du luD$|$,$ u uӃ [^_]UWVS s85el$ |$$du uD$|$,$Mu uӃ [^_]UWVS 8dl$ |$$du uD$|$,$}u uӃ [^_]S 7Äd5D$D$D$D$$ [UWVS7KdEEU 5E1EtcMyu)čD$UPtMPy:uD$E$8j}3>ue[^_]øD{UWVS6ëcEE} 5E1EUtdyu)ԍT$:MJtJx9uD$T$E$e}3>ue[^_]úzSJ6 cD$$D$ D$ D$D$D$D$$RS 6bD$D$D$D$D$$:S 5îbD$D$D$D$D$$\:ffffffUWVS5tbNjt.Չ tD$<$ u)[^_],I*DPu 1[^_]É<$[^_]A5bD$t8t 1øUWVST5a 5D$$L$P1ɋD$hD$D$D$,$J\a` |$(e1󫍃h D$0T$, h tE|t@:t;i D$0w  D$0t|t:tD$09rx D$pD$D$,$_| D$xmD$D$,$x_D$0D$ D$DD$D$,$V_x0D$0 n8€ $L)D$:_D$D$,$#Qt |$4|$AD$D$,$6bD$4 |$,D$D$,$ bt D$4 |$pD$D$,$at D$4 |$D$D$,$at D$4 D$ D$:0t$D$,$/^D$0fd D$0$/(|$D$9t8u8"tZ|$D$ D$T$L$ ȉd$Ɖω$|$3T$3D$ uqD$40x1[^_]ËD$T$rvfbu)L[^_]ÿ@*"S*ÙWD$ D$$[fffffWVS*eWt$ tX>tS4$zD9u x9tn/t9swx/tqƒ9tx/u)‰փv wD$ t$D$ <$Ƅ [^_þ/uǍ뿾S<)ãVD$D$ D$D$DD$D$D$ D$$D$D$ D$$tD$0L$8t<[ø<[fffffffWVS S)Vkƃt&u+T$D$ t [^_$D$D$W$zǃtD$$D$<$D$<$~<$61녍$jhSz(D$8D$@D$4KD$1\$,L$0Q\$4DS\:P\$,L$)=Q9|$(zoD$8wkl$<{MmSL$t /DU@eˋD$h@ @$D$L$hA(TD$hpQ))Ɖ,)9)9|$hGW |$ "D|$hGL$ D$ !1\$XL$ D$@D@dD$@41뒹"eJJ JJBD$5ڋD$hP$@(D$D$< 1ɀ|$(zD$EuFt$HFt$9Ft$*F;t$@:9uЉD$T$(|$$|$ D$ D$,u |$$\7D$,t |$$%<D$,t |$$&7D$,t |$$=|$ D$$D$ |$$#D$ D$1|$$;\$$,I*DXGD$ DBD$$|$ 0|$ D$$|$$--|$$^D$ |$$?L$$ ȋ|$ |$ \D$ |$ }D$$0|$ _O|$  =|$  +|$  |$  |$  |$  |$ |$ ,I* |$$Dy|$ L$$D$cd@a(I*W7{D$ D$1 !(I*W8 |$ 7s1 dAmUWVS0 D$D$|$0D$D$l$D$8D$3)Ѝ)Ǎ,}~d9w$< t[4$w$ot$ ?D$D$ ,$ΡL$([^_]Ë< u$Ѓ< u$(ljE4$(tw$oD$ D$,$֌[^_]Ë< uuǃ< 댋T$(tuEo[^_]Ë$ u.D$$=4 ǃ$ 11< UWVSAt$$0 N))Љ)Ǎ,}~d9w$8 t[4$w$ot$ ?D$D$ ,$L$([^_]Ë8 u$Ѓ8 u$(ljE4$(tw$oD$ D$,$ [^_]Ë8 uuǃ8 댋T$(tuEo[^_]Ë u.D$$0 ǃ 118 UWVSut$$4$苓Ņ, H1B9u/>3)Ѝ)Ǎ,}҉T$ ~1GD$4$OuT$ 'W$L$([^_]Ë< D$ t$G$苉4$@G$L$(1[^_]Ë< u"$Ѓ< u$(ljEw4$tr@L$(1[^_]Ëuǃ< > u uL$ PωsItftt$$/tFD$D$=@t$ $!/뙋$D$ D$D$v$QD$$$|1Ĥ[^_]t$ ~$fD$ 9$t=D$ $Ĥ[^_]Ή?D$ 9$tD$ d$/D$ /D$ $v$D$$Uf9?)>f.11fffffUWVSDt$4$ZT $P ǃL ,I*>ʼntP><:uVFu<\u$JDK@tǃtDK@tB<:uE1[^_]ËP t$9ǃP ǃT 1[^_]ه ST$<:t u1[ËD$  8u?u|$:tN19L$uԍBz@t[Ë\$  8u u|$:uu@t|$:ut:u[T$WVSt$|$ 8u u|t/:t*t&9v :t|tu[^_1UWVSdI\$D$DT$HL$0$|T$8 5\$<;$`1$!;$u"P tT$<$-D$4$\$8D$D$0D$4\$`\$$ϋ$xD$ D$D$$x$\$yD$ L$$ȉʉt$1Չ9v^xȃ :dD$ \I1҃ t tD$ N;L$9wT$(D$D$$D$$x$\$CDT$(|$$,xȃ fL$ D$ X@|$t$<#t T$(D$8D$<$T$(t$:L$ t$ N;L$&T$(D$)L$,L$)t$$\$T$(80\$L$,D$t$ 1N1^(D$ t$9-D$D$l$$,$軎D$D$ D$D$@,$(rD$D$@D$0$\$B$xxRD$4Ƌ\$4t$x$\$CD$ >|$DŽ$xD$0D$0 $\$WD$ l$\$t$D$ sl$LD$ xDD$,D$PD$8D$XD$@D$=D$,D$,$Dž' S<:u싄$D$|$$x$L$0T$8D$@t1pftuC:kD$ lD$ l$X<:tu)l$P.x:t:))‰T$$D$+D$9/D$)؉D$\$$T$(\$R&l$t$<$t$<&\$$\$D$X$T$(jl$L\$4t$)P\$HT$9D$D(D$ \$<$`3d[^_]ËD$L$L)ȉD$D$)ȍ))ˉ\$(T$T$ $\$T$;\$T$‰T$Nj\$(ÉD$Ll$|$跀0,$言0D$ L\$T $sŅ|$$\$D5D$D$L$x$\$@D$,$\$ l$,$\$Gl$4u@\$ Ht$ tƋ|$4u{D$L$\$t$ u$x$\$?뫋D$L$\$t$4t$x$\$?D$X$t$k $x$\$?mD$ Ɖ<$|$hD$8D$P$~D$T\$X|$PD$ \$|$4$V tuD$ 4$VD$ D$XT$hul$PD$\D$T량,$|$P~D$P$T$ DžT$ u+4$V\$t~ D$ \$cT$l$$\$"4$Vx81|$D$ D$Ht$0D$D8,$D$ @l$}0<$*}0D$ T$ D$D$D$$L$D$S_!H t$hǃH ǃ@ ǃL ǃD 1[UWVS( $<D$$@D$ 5D$0$$1D$@ sH }l$,I*l$ P tL D$ D$H $K9T$DT$(>Do@:t~#tyD uo|\u ǃD 1$$t$:\tUut$H $8BT$DԀ|\tǃD ǃD H $赋ŅuRH $fǃH @ P@ @vJ]T$$vH xfE:|$,$$L$$ʄu<:tBt<|uT$ D$L$$L$D$)Ǎ@L$$$31([^_]ËH $裊>H $eǃH E/D$@ H J]D$@ $SH [&HǃL T$.m"fVS\$ t$Rt$\$ [^UWVSa\$ D$=D$0D$D$,$$dŹdP:t't#^tl~\t{t.P:u)rD$4([^_]É)GdD$,$\$ Z8Źd^:tt^\$:tt~|${Љv%t$B2|$ @-\$0\$~0~|$~\$|Љ|$~0~\$|Љ|$\$T$,$\$ tt t$ t$ t$ t$t$:t$yt$m\$t$]t$l,$\$ g]\$ w DUWVS CD$=D$$D$D$ $$d?ǽdH:ttt*H:u)qu5D$(8 [^_])͍AdD$<$t" (ǽd볉L$<$t뷉<$ [^_]þv WVS D$#D$ D$D$$0tT 109~&уrЉ vrwW9ڋD$$1 [^_Írw7Pу߀Xt P닸fffffffUWVS<}?Eu u 5U1Ҁ8<$$uD$/<$Ci8 DžDž֋D$D$$5u8w]P. )čD$cKxxr󥋽|$D$$4}3>ne[^_]É::$uJmtubt뵃$J>:#t sS1ҍB <獃$/WDžDžet<:w=wmD$ t$|$<$ϵƄ5/ȍ|7tftƄD$6.D$$0t$|$$0D$?.D$$001׉t<:u9)u6uD4Dž .vf' 5D$D$D$D$$ UWVS]EEU 5E1EtoMyu)čD$UPtMPy:u 5T$D$E$j1}3>ue[^_]øJfffffffSçD$.$lCd D$ ΐ$G` [UWVSDXt$X|$\|$D$dD$ 5ED$@1PD$ $7d t$6|$:L$`fL$>T$0T$T$,T$ D$ |$6|$$sDuL$0 vD$,D$9|$` d MЋt$@3u_D[^_]Á|$` #` %9u % Ɖt$.D$ D$D$hD$D$$az;D$h҃"q` O딋D$@9G/D$@f9G1҉T$ D$P T$,yL$$|$0|$D$T$($)HL$$ L$$T$(L$$99|$hL$ωփT$ tfD$D$$kRD$.D$ D$$VfxHuPP|$3z$J 1 uҋL$`3JʀuċxD$D$ D$<$LbD$$uD$hD$|$D$$~d9D$hT$$xT$D$$+UT$"uu"t$F y D$$f SID$` \$ D$$D$D$T$ $T$|u؃[1VS<T$HD$Lt$PD$,D$0D$4HL$(L$$@D$8t;D$ D$D$$D$$虠uD$FD$ D$ F1<[^D$D$$D$$^<[^ÅtD$ D$D$$*[t'L$̀rS[ @>*[ iS *D$D$D$D$$y [S üD$D$D$D$$Z [SÌD$ D$ D$D$D$D$$y[UWVSQl$(|$,ɈL$t[<$]iD$L$uFt8tuFu1[^_]ÈL$D$D$|$4$v]L$uȉ[^_]1UWVS$$D$$T$$L$ 5M$1ɍD$tD$LDŽ$DŽ$D$$$.D$T$L8$.t$LdžPdžTdžXfD$(|$|$,<$)hD$ D$0-D$@L$L$ T$T$D$D$D$$]$3}u [^_],T$T$ T$T$ H*D$D$$fffffUWVSLED$dU T$hML$`UT$< 5L$T$1ҋ@0tD$HD$\D$@D$X2D$DD$`p8tAD$hD$<$deD$PuW%D$dPD$d9D$XL$T$3e[^_]ǀY|$dGt$`t$\(D$hD$$dtGGԉ<$gStȉt$\1D$8D$LVBT$`KT$`L$8L$8 16L$8T$`L$8L$8t$L DHЉD$LL$8{T$`L$8D$HT$`L$8D$HT$`D$@t$8GT$<T$<@L$\"L$8T$`L$8D$H ?L$8 T$`L$8D$HT$`D$0^FD$`1$D$ Ǻĉ -9t1 9r΋D$0n )ȈD$l D$4L$0D$ n D$`P<-<]$ ȉT$`ÉT$`T$`D$H D$8@D$8T$`D$HL$8qD$8D$8TD$4D$ D$L<-<+ T$hT$$~[% OL$4D$LFFPT$09*@D$L|$ D$hD$D$L$#[ D$4xD$LGFF |$4T$L|$$|$ P|$dT$hT$$\D$\GG~ ʉ<$Jv붃ET$LuD$LD$8ƃt$(t D$( |$d1 GG9t$L Љ<$I뼀|$$thD$LT$P"|$0T$X)`D$<0t$8D$T$LFP;L$0@D$LT$(T$L4$S:L$(jT$L;T$0\D$LD$(D$4D$ T$LD$hD$L$P$ IL$PT$Lu _OFF=T$PsD$`pt$0D$`D$44$9|T$09T$4nD$L|$ >D$pD$8\D$<D$D$lD$D$,$iZD$<8jt$PmL$L4$9L$L;L$0D$L*t$P|$<)T$L4$8T$L;T$0׋T$Pt$P|$t$,t$P+D$dD$D$,0$Sut$,t$8D$dD$D$,0$uD$ D$4|$4DD$4|$4|$4-D$8HD$4D$ |$4ϋD$ D$4zWVS蘡Zt$ D$4$ 'D$,D$ D$(D$D$$D$4$D$4$&[^_Ã3T$T$ T$T$ H*D$D$$mfffffffUWVSôl$,|$([5D$,$I&}0tu LJE uGpfE D$(D$Mw9bM@9o6T$T$$J…0t$ ljփD$ D$ M0T$QEHMT$(PED$,$%D$[^_]?fe ߋuEt9sp;t$M@01E $(Enċl$4UWVSšÄ|$,D$tD$C*,$_Nt6D$0D$|$,$蚥l$ D$D$<$D$($蝔D$D$$MD$$$DSD$ D$ D$D$D$D$$"[ffffffUWVS8ʙÉD$ |$Lt$Pt$D$\$OD$0D$ ,I*D$4t$ t$|$D$1ҾD$TD$,tC[  t1 D$\$ #\$ l$! t\$ !É\$D$!ЉD$D$T$ t1҉D$$T$(ŋT$,tvD$ @3D$0 twD$TupD$T@uT$\T$ŀtT$MōBD$,$\$ 蛎L$Q^~@D$hT$L$\D$$҃0Q0A0i AD$D$8[^_]D$T@u;4$\$ 5u> t9Fv1D$T Fv  D$ ,I*DptGD$7D$8[^_]ËD$-hT$ T$\B0D$X0<RD$@0@ 0D$D$\@aD$D$\@bD$D$\@tD$tD$\@nD$WD$\@vD$:D$\@fD$D$\@rD$D$\@sD$D$T@uN,$\$ 苌UD$$0<ED$\hD$T$D$$T$4BfA?T$cUWVS蹕{|$$l$(D$,D$t$0D$4D$ tk,$KtP t tl$5$Jt?=5GG W[^_]ÍE߃]wȃ=uD$ D$4t$0D$D$,l$(|$$[^_]!UWVS|ò\$ʼnT$(ʋ$D$$D$l 5D$X$x1Ƀ$$$$T$D$$\$cD$DlD$<$\$;D$PED$jJuerPftfD$ 9|1FĈ[^_]fupt$ ׋Rt$$u7$fuYF%=@=9=DĈ[^_]fztĈ[^_]%(t$G$/"o |1)tft Ĉ[^_]Ë‹nG8oD$LD$$D$PD$,L$$T$LtFTE(VV~,WT$D$D$H$\$ E(1ɉfFH|$$JPfv f7l$$F\$2t$0ED$ D$8 8ET$<E;D$ tE(taD$D$HD$DE+D$D$ }E(t6FFfFH { f{.+fFH FTD$D륉F D$HD$$\$ L$DE(tD$9Et|$(ul$HD$Ht$Pt0|$@t \$(E(\$0KD)T$(|$@uD$0f@HD$|$@D$D$T[^_]Ë\$ o8D$tp$\$ nuD$$t$  98D$0f@HM(D$D$T[^_]ËE$tD$(zT$T[^_]:\$ 84$\$ na1ɋD$D$0RD$,t$$t|$@u\$ \$0C D$0fHJ\$ ~D$,\$0S@ uT$$u |$@D$L@EMtPXT9t+PʉPH@uD$PDPXT9t+PʉPHPtՋPD$P|$0fGH\$ G 3D$0@\$ 1E$\$ v,D$0f@HM(D$D$PD$,D$LYUWVSvò|$0D$,$gƅD$4F$0~(D$,(t8lj1҉t$ ׉$x9sǃut$ VFV(F$8 [D$@DD$,(ZD$1|$ -fEHD$4D$ El$ D$,,,$V(F $Ņy@DD$EETEF(:fzfEHD$4xEL$ D$hl$D$,,e|$ T$4NjV(F$8 tKxf@H F(u D$$Oj[^_]Ë|$  o<$)juD$$jF$ j4$j1[^_]Ã|$,1t$ lj,$M9sǃ.ut$ l$l$ I|$ 냋V(F$8 :O;1D$D$@w$`FN(V(F$8 11WVSsE|$t6@Ju}HDy$hVDxpupƉ4$hGtp$huGt$hG$hw(t%<$zh1[^_Ë@$$wqG$(tG$U<$:h[^_0G$2<$ht0UWVSzr<l$,}*E(WLfGLOHfu1<$gVDFLf`}90EwuƋw<$hg~DUF(FDOE(B~ fFHu[^_]ÍQfv[fu@W8O<3M3U GJEtp$fuEfGH[^_]ùfGHfxE(nD$D$@w$G$JfOJ:u3EENQ(zI|/u/N,QT$VTT$$^u[^_]Ã1ɉfGH[^_]E(uE$y%F,F(~TD$|$E$D$/<$tt;9WP$T$@L$D$T$T$<$誹L$N,EFFF8V~Ut&OaubuE$#$E(t&D$D$@w$F$fNJaG fOJu>PRP@u'4$jc(E1$6D$ 6D$D$6$JG fGH8F$$8M(1F fFHSQmD$w T$ fBL1[s[UWVSmڙt$$D$(tA1[^_]Ë.*F)EHf tXfFtx$1bu|$(t7EDuE8/tF(t+IF[^_]ËE[^_]ÁN(T$ D$D$@w$ǃT$ t0F<$P!<$u%F1[^_]F11UWVSkÜt$85UuP>4${3Et!F$$UF$$JF$$ a4$a<$ [^_]ËF$$ffffWVS(Pk$8$@$D 5:$$1tf77T$ D$|$$<D$t$L$ $7D$D$t$$4$聱xD$t$$8 Љ뚃D$D$ D$D$D$D$$)UWVS4xj:$HD$$$P$T 5E$01DV?77L$ t$D$$LD$D$$D$|$ $7D$D$t$04$菰Du'ux$03E4[^_]ۯt$D$ {D$D$$0<$0ID$|$${Dt$0H1DŽ$0DŽ$4DŽ$HDŽ$Lt$ 9D$$0D$$dD8 ǃD7$^DD$+t$,A+wɋX7D$+tu֋t$,|$+7D,D$+ЃD$+ƃD$+뼃D$+벃D$+wD$D$ D$D$D$D$$|ÐUWVSgìD$xT$hDŽ$ $]D$\$ D$Hd== =DD$`ݜ$T$x$<-qȋ 8ȋt$\8D$pD$\D$8et E%t$pL$DD$x$D$hi$\$h݄$\$pD$pe[^_]D$LBD$X$Bt<0D$DPЀ |$XOD$PD$l1L$p8t$lDPЉD$lT$p$rt$ppЉ ~ÃЋt$PDPЉD$PD$LL$<-T$XD$L<0AD$X@T$4t$(|$$ƍtAЉ׉$ ȃ0< v|$0|$$t$(T$0+T$4=N~NT$@0P)Ɖ$ 0tt$pAσ9D$\e1D$83|$`D$`D$lD$pD$xD$HD$`DŽ$DŽ$D$Ht?$$D$x$D$p$}D$H$qD$l$e"BL$PD$D$p$D$pe$D$ $D$$F$$D$$$L$PL$$$I$L$DD$@D$D$x$D$xq|$D$x$D$xUuUD$@)ЉD$PD$X#*ܬ$ݜ$.)|$(D$8D$8D$<?؋4\$P$%|$`p DŽ$DŽ$ىȃt@%݄$4ݜ$XȃD$\" ݄$91tuF ؋D$\$D$pk)Љ~(DŽ$4 DŽ$p݄$ݜ$M$ȋT$XD$PD$l1ټ$$ f$٬$|$|٬$D$|‰D$(D$,l$(T$(z9|$ uBD$PD$Tl$P\$(D$(T$,D$8T$$0$%=D$lxu xD$D$l$D$l|$p|$$$|$\%pp$$D$x$D$p$D$H$D$l$ك(9\$Pك4$t$($T$\܄$ݜ$D$\iD$\j D$`D$d𿃼$G$5|$\%=5D$D$l$5D$l|$p|$$D$`D$dD$8$$-$D$HD$4$$ $$$!$.%- $DŽ$m #D$p$ܬ$ݔ$3($t$`|$\tw k)9t$`=%$DŽ$ݜ$D$D$l$|D$l|$p|$$Z\Bݜ$UMy H*U E UMU EUS Lèy H*D$ D$D$E D$E$l$]US LfyED$ D$D$E D$E$l$]UWVS8hL*yƉ׉t&== =p9l$D$D$D$ D$ T$|$4$趘=ƒw(X9tT$D$8[^_]1L$ L$ NjT$D$$D$(kD$,hD$4D$0T$$H̺"ك8[^_]16Kx H*T$D$L$ T$D$fffèrS[w[ḍ̀rS[àw[ ̀rS[Àw[D$L$9u 9tu1UWVSD$(t+wND$tX8utD$0[^_]É1SD[^_]r |$$9^D$03D$@\$$3\$< tQD$4T$8\$@T$<ӋD$@[^_]9\$$a"D$4D$8D$<yA<wɃ7 \$92D$<1\$3\$8 D$,T$0\$<T$8ӋD$8d$,ډ)ډD$8T$qkD$T$L$ 5D$8$1$(+ŅQ@ @85D$t'$|+E$D$$賨D$D$ D$D$$ $D$ t%<€tD$ teL$ atAD$ E D$D$D$D$,$ƅu*T$$3 up[^_]ÃL$ 븃d$ 00D$uE $2,$201렋E$$E$$2^0`UWVS=i|$D$`<$t=ƋL$ Džt [^_](4$N([^_]1҃D$D$ $}VS<Ai$D$ D$4$tOD$%=@u4D$D$4$gt"1҉dĈ[^V1Ĉ[^ffUWVS,;ôhD$@@ D$ 5~D$ D$t t$HUD$ D$(eD$$l$l$D1D$1D$w2T$T$D$D$D$$Y-|$)ljD$D$ D$D$,$4L$@AQt$|$,$Zt~')Ɓwz+8u L$$CD$ D$@L$H D$ 1wt$)Ήt$$|$T$L$9?6J9L$$(1u*N|$)94 J t t9t$w΅$c'uD$@L$H+|$xD$@@L$DL$ H $Y1,[^_]ÉD$@h,$ 'L$@A D$@@@d$ 똋D$@t$p ,[^_]ËD$$/D$ D$D$,${l$(_t$1ljD$K;D$ D$l$<$W?hD$ D$t$G td>tuG M L$$軙tΉ׋D$D$GD$@D$H$3D$DD$@L$H T$tG녋t$D$$-D$@@ D$CWVS-8d|$G $-Gt0$-uG[^_S7ìdD$ D$D$ $踘[VS7|dT$ t$L$˃w9BtJ[^BBӋF%t$3 ؉B볋FBVS<&7cD$PD$(5D$,D$0D$8D$4D$(T$XT$t$ t$T$T$ D$D$LD$D$H$o=t$D$ D$T$T$t$T$T$D$<[^Í9UEH@~L$$$v6$D$~ $$ø)ȉD$$$fffffffVS85æbt$Lt&== 0=9T$PT$T$T$T$T$ D$D$HD$D$D$(=tIƒw59L$>@fVT$ffVT$ fVfVtfN8[^øD$$@D$(ÿD$,?D$4D$0D$$HFfFuFfFufFdFfFjkl1ef̀rS[0a[UWVS |$44t$T$tpL$D$  D$t$9t$ sHt$ދ\$,3\$,$ׅ~.D$LL$ HS9\$u9l$ r‹t$t$l$u [^_]UWVST3`D$Lt$l|$pD$p~D$(l$pl$HE$\$L D$<Dž|$4Ǎ@ʼnD$D)֋\$pދ|$h߉|$D$t$L$pt$ :D$먋L$Y xD$TAD$XAD$\A D$`AD$dAD$hAD$lAD$pA D$tA$D$xA(D$|D$TD$8D$\$$$!‰L$<L$D$TAD$XAD$\A D$`AD$dAD$hAD$lAD$pA D$tA$D$xA(D$|D$8$|!ƒL$<)ȉuD$@ 1҅‹\$4:-/D$0D< u[^_UWVS ×6t$( F*<$uG5D$l$,T$8T$ T$T$l$4$L$4T$0w9t)Ɖ<$t[^_]1ST 6D$y L$9~*L$ L$LF*D$D$$1[ÉD$ p$D$$$L$ 6$D$ D$ D$T$D$$ssUWVS,t$@T$Dl$HD$PD$ 5D$(1w~wF@=L$(3S,[^_]ÃvD$t L$TtFVf~KFD$ 8=D$D$LD$,$|9D$Lw4E늃vD$t T$Tdt D$Ls1ZD$XD$ D$TD$D$D$D$L$-D$t D$TFfVT$D$ OD$D$LD$,$ɠ9D$LF F fbN ffɉL$D$ )=D$D$L)ЉD$DT$$fT$9D$LvI1rVNtuWNT DyD$ 5=1҅t$LD DL$L $D$LiviD$t$,$B1D$ =D$D$L)ЉD$DT$$T$9D$L^FD$ 5=D$D$D$ D$$>T$t$L$2!%tt$L$u+T$B9D$T}D$TD$D$D$D$$gDt$L4$}D$T$ OD$D$LD$,$臞2UWVS8[lj͋$LD$ 5D$$41ɋG ֨uH<$Tt$<$Ut9nuڋD$tD$F $NufD$$貒@=ȍQT$D$1D$2ffD$3D$ L$L$$D$D$T$1T$ D$5$D$,D$D$(D$ D$D$T$ T$G$fu"T$,T$ ;T$rT$(ff9ŋL$$t-1T$$43 uh8[^_]D$11Bt.B9uǃL$D$D$BT$$AT$uD$ D$ T$t$<$3V0VS Pt$$t$F $SD$$L$T$ F uD$4$vRD$ [^f̀rS[[WVSt$ D$ $XxmL$ t\tRP tzuR9uD$@D$D$$$^L$ t$$1 $ _8[^_ÿ11fffff̀rS[0[WVSS|$D$<$pGftD$<$p[^_þfffffffD$¹.߃At%.t:.t!HЀv v-t1Éu۸ÀvHЃ v_tUWVSD$T$ pz%2$;9,$t$t|$^D9]D\$@9~@|`x; $|{<$x9LII[:KuUtP9D[^_]Ëut[^_]É9v[^_]Ë\$t\$sD;wDtE1띉ttvD;wDt맋t$mut&\N^D9]DB{v-CUWVS$D$ d<$tc1|$Hƅtyt1O^[^ωمu;,$uՋPWT$ P$[^_]ËY[#l;ht΋I먍|$WVSñNjt50PtVP2$G0PuW$+[^_VS]8tSD$ ÌD$ D$ D$4$螌uD$ t8u x[^ø[^UWVSP#D$4։ 5D$D$L1D$@D$<D$LD$(=D$HGD$0T$8D$,{u E @|$T$,T$ D$D$(D$,$芧GM @|$81ǃFD$,D$0`~D$$D$(D$ D$D$D$F D$FD$ D$4D$D$,$Q$D$(NL$(ȋT$D$L3 XP[^_]É|$D$ T$(T$D$,$Y~E T$( D$D$D$L$D$ T$D$,$%WT$0RudL$0IfftQfL$@G?(D$@uMD$<twt]tDUD$0PЃD$<벋D$H$G`L$@(UWVS(SƉՉL$$<D$ 5$$14$tjD$,$L$D=l$t$ ?D$D$t$#4$L$T$$$3uX([^_]Í@=w1t͍i|.uD$ l$t$t$#4$ND,#'Vt `9t Ju1҉Í`UWVS@|$ 5D$0t$<1A<<D$ AD$$AD$(A D$,AD$0AD$4AD$8:|$D$(D$D$D$D$(D$_,G<$oW,"T$8Wuf1҉|$ |$%9$v8 t1" 7:L5=tԃv҃w9$wȋ|$ ;T$~T$|$?lD$D$t$\$<3uc@[^_]Í|$"1f1ۉ9r߃u*fD$ fD$2AD$4|$ ?f1Ґk\$%Sj,PtUu2PHu0X u)Hu"xu[a/[Àt0[Pt9 ttȀtÀu[@ X[^_]1;…tT$ u4D$DD$D$D$ $:D$ D$ E1랍L$DL$L$L$ L$$T$ uȋG;tL$.D$ D$@L$ $1ɋT$AD$ @usy?D$D$ $<L$ <GGT$ ;tuwL$D$ D$@tjD$$1ɋT$D$ u-uUD$ @uD$ T$_D$D$ $D$rh^D$ T$Ou땐F UWVSŬ$D$`$D$\$D$@$D$X 5D$T0$1$|$01󫍄$D$811\$8 r$D$d11t$d r\$`toD$@tyPu xD$< D$0$SB$t$D$XD$$D$4tD$ D$$1^xVD$hOL$\3D$`T$h99ruD$< D$ $2<11UWVSd[ljՍt$$11 rD$?.D$D$ D$D$ ,$N=DHL$D$D$,$+/ƒtJ@u7@< t5D$D$D$$Y+tPtt < uǃuGD$HGD$LG D$PGD$TGD$XGD$\GD$`D$DD$D$ D$DD$D$,$|t)D$ l$D$@d[^_]ÉT$Jl$ u ՋmtEtET$kmuD$ tFƋFuD$T$u1UWVStÝ$D$0$T7oL$411 rD$0D$EtύD$,D$ D$(D$4$imT$ T$T$T$D$ t$?D$D$$RD$P$t[^_]øt[^_]ÉL$$4$lL$,L$ L$|$(|$|$D$ t$?D$D$$L$$tϋD$($9D$0D$.L$ED$TED$XED$\E D$`ED$dED$hED$lED$pD$XT$TD$(DžL$tD$PNjGuxD$(tGD$($蟼UWVSX ùD$T$L$, 5T$( $T 1ɋT$TT$XT$ ?.T$D$ D$ D$ D$$>*ƅ8#D$ D$4$'D$D$4$'trŃth@t`1t$$K< tKD$D$4${'tAht$D$$zp,tt < uuD$!t$$l$D$$9puۋL$,AD$8AD$D$$D$$%t$Ft$T‰D$$@=wЋT$(ЉD$(=B1T$$<3 (@[^_]1D$$T$$yL$$ȋT$0|t$n`T$0D$8D$D$4D$ |$(GD$D$,D$D$ @$'9T$8T$(9$D$4D$,pD$$T$0t29D$D$D$D$,$qT$0|$,D$(L79D$t9BD$$D$l$0#9{|9m9uىT$D$$D$D$D$ $pT$ul$0D$(D$ D$,D$l$D$ $fu%u afvD$$0D$$VS ϬÑt$$t$F $D$$L$T$ /F uD$4$D$ [^fVS1   lLLLL9w[^UWVSP8|$hx<$x |$1ɍ|$\ t  4 t  @uӋT$|$:xj׋<$t$1!1L$1V1!1 ы\$;p $1!1ˋt$.ν1!1 ދ|$ |1!1|$$*ƇG1!1 ы|$(F01!1ˋ|$,7F1!1 ދ|$0ؘi1!1|$4D1!1 ы|$8[1!1ˋ|$<7\1!1 ދ|$@"k1!1|$Dq1!1 ы|$HCy1!1ˋ|$L7!I1!1 ދ|$b%1!1|$(@@1!1 ы|$<QZ^&1!1ˋ|$7Ƕ1!1 ދ|$$]/։1!1|$8SD1!1 ы|$L؉1!1ˋ|$ 71!1 ދ|$4!1!1|$H7É1!1 ы|$ 1!1ˋ|$07ZE1!1 ߋt$D㩉1!1t$1!1 ыt$,og1!1Ή1\$ \$@;L*|$ !1 \$$B9\$ 1\$0 q11 ы\$<3"am11ˋt$H> 811 ދ|$D꾤11|$ K11 ׋L$,`K11L$81p11 ًt$D~(11΋T$:'11 T$0ԉ11\$( 11 ӋL$419ى11ދL$@911 |$L|11ϋT$eVĉ11 T$2D") 1ڋt$,*C 1 ֋L$H9# 1L$$9 1 \$@Y[e 1ˋT$2 1 ދT$8:} 1|$] 1 ׋L$0O~o 1L$L1, 1 ًt$(C 1΋T$D:N 1 T$ ~S 1\$< 5: 1 ы\$3* 1ˋt$4>ӆ 1T$ |p$XL$H P[^_]ËD$@@#Eg@@ܺ@ vT2UWVSl$Eу? $t$ ЉEU‰ЉE@)ˍ| 9r[؋t$s{uouh}+$9D$ v&<$ߋt$\$ >ZG@9w<$\$)\$ D$ t$s?tft[^_]äftuCu*ju6u>fD$pCfUWVSڣÜD$0D$ |$4 5D$1Wl$)G?7w~8)‰ЉD$ AD$<$?D$l$<$+D$ X1u7u=tftD$3u([^_]úx)‰뀪WtfCffffUWVS$Ǥ|$t$8D$$[^_]1Ʉx4$DF@WFƒ߀XtVF1wD$ +kD$D$ T$ :D$T$ \$11-<.D$|$9|$OD$pPЋ<$DW D$D$D$$utD$ ø ø ̀rS[[UWVS8ƉD$D$LL$P 57t$41t>q\$D$u?\$t 8t 8ʍu u+D$1t$4378[^_]Í\$\$ 11ۉD$D$ , rD$\$`AÉAۃTTu߉\$t҉كTT ulɃL LLu=\$CUWVSé$$D$$T$$ 5$1ɍD$pD$HDŽ$DŽ$D$$$D$D$H8$p D$HǀPǀTǀXD$$B$\D$D$(tD$ D$,l$ T$T$D$D$D$$fŃt8D$ED$D$($Ώt苌$3u3[^_]ËD$(t$B p:T$T$ T$T$ H*D$D$$WÃD$ D$ D$D$D$D$D$$,ÃT$T$ T$T$ H*D$D$$WVS$ܜÞt$44$At$D$tT$D$ D$D$D$D$ D$C*pX4$ "D$D$4$D$4$" $[^_S CD$T$wx9wT$ T$D$D$$ [;UWVSö$D$ 5$1D$D$$tuōT$$1D$D$ D$$T$+7T$T$D$i,$^4,$t#D$($3Ĭ[^_]D$$x{D$D$tQmtF} tuD$ D$E$uGD$ D$$DD$ v D$$*@1V1OWVS蚚\t$F ǃtF 1[^_ËF0$F0F($׏F(F,F$辏FFN D$hA$Ft N [^_ÍJ]D$}A$!Nt N ^VVSʙÌt$F u&t$)F F [^ËF$DFF F VSl.t$ F uiteF0$ˎF0F u=D$D$ D$D$$'F0؃[^Ë$3f 본S\$$61T$  C [VS辘Àt$4$F$ FFF0$F0F($F(F,[^UWVSVD$$@0|$(?.L$L$$p< t< tgD$4$`ix4$fL$(Ay D$$hD$(hD$D$<$ƃ@ 1G< tGD$$@H9tUD$(hztD$D$4$tptdt]< uD=D$([^_]ÉT$ |$$OD$G$ŅT$ tSD$$hD$(huD$(h<1@ D$$ 觇ŋD$$h;0D$$$;01[^_]ËD$(h1=UWVS`"t$$l$(D$@ u1@(L$9i,ǃtftD$p(8ffL$ AF9 FA V|D)9P)ՍtD$@L$ A912D$ @OV>)t>9wfϋD$@P9uL$QD$A$t6L$AL$ A뗋D$@ $(L$AI:0D$$:01[^_]Í,(D$ [^_]Él$$菆tL$A(i,ǃFuu.UfVS.t$(F teu/tU4$tHD$$D$4$tߋD$$[^èu@F$T$T$ T$T$D$F$ t+1[^É4$ tF F$F 1벃F$D$D$ D$D$D$$D$4$[^ffffffUWVShRD$D$|$D|$ D$D$A4$0D$D$6D$(D$D$|$ ljD$D$4$>t$Dt$9_D$(1D$$1D$ fl$7u'|$ftf9xH L$,;D$sdxuPu@*x f|$D$ <L$$||$$;D$rD$$|$ |$ $D$0D$0 8L$Ήt$8|$D$Ɖ$+t$ l$(fD$$}u2E<tt<u&D$$ftf9EE %D$,E;l$rD$($辆t$ F|$09wPFD$|81h[^_]fD$E%fD$$E;l$]럺 D$|D$0$I1h[^_]ËD$Lt$ FD$PFFEFE lj1ɋt$,tƒ uD$41ҋD$4D$@l$G-wT$UWVSyz;p̉))`CQ)Ɖt$T$CD$ D$ D$<$t[^_]UWVS$y×$8$<$DL$ 5$ 1D$l$l$ t$$@‰T$$>xR|$D$t-D$D$,$%T$$ 3u)$[^_]ËL$L$$.$T$1̍t&fD$D$ D$D$D$D$$UWVSxät$(|$4D$8D$|$ t$D$0D$D$,$px1ʼn<$uH;L$8}f..[^_]À|.u1[^_]UWVS `x"$<D$ 5$1D$l$l$ D$$8D$$4$DžtD$D$,$$$3u [^_]&UWVSwÏt$|$ l$$Fu / Ft%D$<$ "utE[^_]ÅtE[^_]UWVSbw$t$(l$,l~t;.uX9.ftR ~u l$D$ D$D$<$qD$0t D$0[^_]ËT$0tD$0[^_]UWVSvÄt$(|$,l$0WlNt;>ufO9>tK Vu|$D$ D$D$4$4qtE[^_]ÅtEv[^_]VS+vt$$D$D$t$$T$uv C[^Ét$CD$ D$D$l 4$p[^à uq|$t"D$T$T$$ ÍVSou1t$$D$D$t$$T$uv C[^Ét$CD$ D$D$X 4$o[^UWVStîD$L։L$4$ 5T$H $1ɋ$!L$Dt"uD$H$38Ĉ[^_]ËȤ$aD$@D$0$FD$FD$F D$ FD$FD$FD$FD$F D$ F$D$$F(D$(F,D$,P[D$d1D$pD$8,I*D$Tt$*u|.t A[^Éȃ[^1[^WVS(YV5OD$8D$ D$$D$ $JPlPHH8|$x|$x|$@ D$L$ T$>ED$4$譭([^_UWVSYʅ|$(t$,D$D$|$$ŋT$ttD$[^_]D$CD$<$OuW,I*DPtD$ D$ D$<$uD$ 8{oD$bUWVS,X|$(t$,D$D$|$$+ŋT$ttD$[^_]D$XMD$<$OuW,I*DPtD$ D$ D$<$uD$ 8{oD$bfffffffUWVS BWD$T$υt A"T$|$ouD$4D$$guމŋ|$-+ D$n|$ 1T$D$1+Ƀ09~;x;D$wgft]D$ ȽNQЀ v͍QwWɃW9ŋ\$tXuS؋L$t^\$\$|$; [^_];L$~f"뒍QwɃ7aT$tt멀0tqD$D$D$ "rJD$rJD$D$\$1 [^_]D$@D$D$)ʋt$D([^_]Åu*vxE@@D$D$D뷋L$B?T$ ƉD$$}L$LL$($+D$0${MD$$$+D$D$LD$$+$q>ƅD$L$+)$+<$D$,$+$[T$,T$D$D$ D$dD$D$|D$,$pB‹L$0 $L$(D$4D$,bD$4L$0L$T$($L$$7K-32/0e 1|$Pl$8) VUUU)ȃ=D$0$L$(N1D$L+D$DxxT$ tt<.t:zt4|5u-|5.t&D$0$L$(wx2FD$$D$0D$D$($1ɺD$$iD$$|$@$+3b,Ĕ+[^_]ÃI-  D$P$+e$+T$ T$LT$D$$mt$L4$gD$LD$($+D$0%[1!!0#T$P$+D$8)Ѝ=M$+T$L$D$+ND$ D$dD$|$,<$?T$0$L$(‰3t$P9t$8D$~D$ ,I*D$  t$P|$0|$l$(l$D$ $$+D$<<$H2|$l$D$ $$+D$<j<$MMT$PD$8)Ѓ=M8L$LL$($+D$0$'N)t&&=&) T$P$+D$ND$ D$dD$|$,<$;T$0$L$(‰!T$P:lT$P 9D$8G$DŽ$DŽ$DŽ$DŽ$,l$$)ȉt1T$4L$4 T$$ 9rꋄ$+D$ D$LD$t$$sgt$L4$D$L$+)щ$+T$PT$P9T$8|$0<$t$(H`L$P|$t$   o D$P$+|$8)lj=M$+ 8 $t$D$PD$$+$3 !%tꩀu)D$0$L$() >t& t$P|$0|$l$(l$D$ $$+D$<9<$H|$l$D$ $$+D$<9a L$PD$0D$D$(D$D$ $$+D$<D$P|$8)1 T$ 9D$Ptۉ4$BD$D$ D$ D$dD$D$,$!8T$0$L$(‹D$,yED$P$+$+T$ T$LT$D$$lD$P$vD$PD$P$xvT$PJL$PRT$D$t$MD$ D$(D$t$T4$^7|$0<$L$(‰V|$Pl$8) VUUU)ȃ=D$0$L$(NrD$P$+$uD$PD$ ND$ D$dD$t$,4$6|$0<$l$(‰4t$P|$*D$P$+Q$0uT$PJL$PrJL$PRT$t$D$MD$ D$dD$|$,<$ 6T$0$L$(‰D$PD$ *$t$T$8)‰T$$(Džy 9 HT$ 1@)/~0.L$0 $L$(!098D$ $wT$0$L$(‹D$ yLt&vD$0$L$(t$8D$P^+D$P=Mc4H|$0l$(t$ t$8D$PT$PЉD$P9'9.<$y+t&D$P+  $+R ND$t$ D$dD$|$,<$64l$0,$L$(‰.D$PPT$P@D$t$ D$dD$<$3,$L$(‰D$PD$P8;D$8:l$0|$,D$PD$P;D$8D$t$ D$dD$<$v3,$L$(ynD$P$+.$ rfD$$D$PPT$PPT$4HL$Pp $qǃD$PD$$$|$t$T$4T$D$MD$ D$dD$|$,<$2T$0$L$(‰U,$9D$P}$oqD$P$D$*Xt$ D$dD$|$,<$O2l$0,$L$(‰GD$P$qD$P$D$t$ D$dD$<$1,$l$(‰D$P$pD$PD$ ND$ D$dD$<$14$‰AL$Pt$l$D$ $$+D$<wD$PD$ *$t$T$8)‰T$$$ǃHT$ 1@)/~0.L$0 $L$(096D$ $T$0$L$(‹D$ cyD$,f; @)T$ hL$P|$0|$t$(t$D$ $$+D$<i<$HLD$PD$P$nT$PDD$P$nD$PD$P$nD$D$D$L$蜉D$Pt$L4$LZD$8+D$PMM'uL$PD$0D$D$(D$D$ $L$P|$0|$t$(t$D$ $$+D$<]<$t$(HL$0 $L$(@09D$ $5‹D$0$L$(D$ y D$ $t$l$<$ŅBH|$ 1@)/~0>L$0 $L$(709D$ $T$0$L$(‹D$ yb$+T$ T$LT$D$$Rt$L4$?Ɖt$L$+)lj$+D$PPT$P@D$MD$ D$dD$|$,<$%T$0$L$(‰gD$PD$P11퍓NT$ 9D$8PT$P0MD$$ƀtsu&D$0$L$(D$$d l$D$ D$ D$dD$D$,$#%T$0$L$(‹D$,tD$PM$cD$PD$P$cD$PD$t$MD$ D$2D$$4$$|$0<$l$(‰&<$T$8D$PmT$P`ЉD$P|$0<$t$(H8<$T$8D$P`T$PЉD$P|$0<$t$(H<$T$8D$PT$PЉD$P|$0<$t$(H9L$P|$t$D$ $$+D$<jD$PD$0$L$(HCD$Pu 9D$8|$0<$L$(T$8V$+3mD$0$L$(H{T$PBD$P2 @NWt&T$|P T$}PT$~PP T$P҃P $P$@$Ƅ$=D$0$L$(D$,dD$PD$P |$<9D$8PT$PPT$P@D$$L$H1:L$HL$41|$ D$ tVD$4$D$D$$+D$D$LD$4$|D$L$+)‰$+|$,$1ɺM<$ M0D$P$ZƃD$P<$%N$+D$D$LD$4$cD$L$+)‰$+|$,$1ɺ<$M0D$P$ZZƃD$P<$%Na$+D$D$LD$4$>D$L$+)‰$+|$,$1ɺt<$ MD$P$YƃD$P<$%Na$+D$D$LD$4$%ƅD$L$+)$+<$M l|$,$1ɺO<$ M-$+D$ Nt$ D$dD$|$,<$l$0,$L$(‰uD$PPT$P@D$t$ D$dD$<$,$L$(‰.D$PPT$P@D$t$ D$dD$<$L,$L$(‰HD$Phl$P@<]/<<u7L$PD$0D$D$(D$D$ $$+D$<2l$PD$89J)Ǎ VUUU)ȃ=D$0$L$(N/t&D$0$L$(MVD$0$L$(M%$+v$+D$0$L$(wx$+D$ D$LD$l$$^Dt$L4$Ɖt$L$+)lj$+D$Phl$P$+D$ D$LD$l$$ Dt$L4$\Ɖt$L$+)lj$+D$Phl$PBD$0$L$(9MD$ D$ $t$|$,$ Džw+HT$ |$$1<0.L$0 $L$(%0l$$09D$ $vT$0$L$(‹D$ L|$$/T$$랃~#D$0$L$(MD$MD$ D$dD$|$,<$D$0$L$( i8D$0$L$(A9M|$ D$0$L$( k9MT$ D$P)D$0$L$(+9MT$ D$0$L$(9MT$ 2D$0$L$(M\+D$0$L$(M*f]D$0$L$(MNUWVS4dFD$L 8uwD$0l$HmD$\D$,D$XD$(D$TD$$D$PD$ |$t$\$L$T$ D$0D$D$H@)D$,$4[^_]EL$4D$# $UWVSSE|$ t$(l$(NlD$$tM9r#Ufҍ,t(|$,$Oy耽([^_]9r+D$[^_]UWVSDD$D$(|$0\$,É_H9H fOp9H@ fG 19w{NN fLG u1Do fu3Du9u?G$G(G,1[^_]ÉD$ l$\$4$x$t뵋\$m([^_]øUWVS CD$t$4|$8\$1t$|$T3>uX[^_]øMUWVS R6D$L$(D$,D$))lj|$))ƺų )ǺE.‰պ%I$))؉)úMnT$ 1fT$ugD$ tS~>T$t3t$,I*(I*wD1t3u݋D$,+D$[^_]ÅuuuL$,D$0$SD$xL$,D$0$WD$ x|,L$,D$0$DxTL$,D$0$H{x.L$,D$0$MUx fffffffUWVSb$4t$l$ 4$>H;L$$HL$ˉs[uMuEvtg|.tD|.uhBtA|\utV|\t׍D0ftuMu4E.D1[^_]EfM}T$被(UWVSD3$0 5$1D$|$|$$,$xQD$$T$T$ ,$vx.T$ T$<$T$3u[^_]øIffffSL$D$ &t@AuD&€tAt9AtAt9Au΋D$[fVS$1t$$D$,x*D$ D$(D$t$D$$ʴx9s$[^ÉD$D$(D$D$$X[^HVS }1t$D$4$-D$D$4$ff D$4$% [^Se'1D$ D$ D$D$D$D$$,/[ffffB B9ufJUWVS@@ pt]ǃ)k)9}IωՉƒ)щʍY)9}(‰UEEEu[^_][^_]UWVSX~@0D$ T$(L$8$lD$$$x|$0$pD$@ 5D$,$T1ɃD$4D$4;$tt$$|$(~F D$.D$ $u,I*8L$ tGt$wDou<.tfT$?D$:D$ $~uT$?D$ tOfu:t .luـx.X$tD$@|$$GPT$@$tWP T$@$tq@9t$4T$D$ D$D$($&D$$@T$@@D$4|$@lj|$@)Ɖt$(t$ 4$tP9PՃtftD$@L$$‰T$@|$8G y΃y L$(T$@I/1t$,$T3sX[^_]À:q|$0D$$D$DD$@D$H$tD$L|$Pt$ 4$蕥L$(L$D$t$`D$ND$ *D$D$D$D$`D$0D$$DD$4y.D$0Z1 D$ D$TD$D$ D$D$8$D$ u5u<N1D$ pD$01fCUWVSLe',D$$։L$L$dD$($hD$<$l$tL$H 5T$D*$H1$` [$`t0$`t&1|$D$H3 L[^_]ͪD$4$(D$@IT$$։t$BfBfD$f|$lj 9f$pD$,$pD$|$ l$L$$5DžpD$(@ uD$l$D$4ЅQl=9l$C$`t$`t D$LD$\*|$l|$\<$͢=T$<:D$lƉD$t$D$$%l$D$|$TD$@D$XD$(dtt$`D$<D$(@ tD$5D$$Gt$ L$L$0D$D$D$$$..DžL$0D$(@ 9x4$0xD$lL$,)9L$t$$贒D$lD$Llj|$lD$ D$\D$D$hD$$%o|$\<$藛pD$lT$,)9T$|$$D$l|$<D$lD$PD$P$舛D$H1GT$8L$0D$<04$ tT$8L$0t$lD$<0]D$d (D$<$tL$@)D$PL$04$.L$0h5D$lD$ D$<x T$lL$,r D$ D$1|$rT$(|$|$ ,D$`8l!;h1l!9h9u|$f wL$uLw9~t$9t$Tu|$D$:T$T9.4GL$`D$WD$T$H(f9~fhfJ*j 9uكD$;t$uZD$d (D$<$`L$@)<|$@D$Pu@C11 $Bf: f.8t$qUWVS É t$4D$<L$@BB D$$DžПŅD$|$D$D$ D$D$D$,$V T$VT$VT$ T$l$L$ $L$‰D$<$q,$苟D$t  [^_]ËF tbtV [^_]B D$<$F  [^_]É<$,$미머UWVS<S$P$X 5T$$2$818|$(UHJ @Bt$6t$,$7D$(xD$ OD$l$0ɉL$D$ D$D$)D$4$軡99|$ ul$0D$OD$D$,$S=vqE |$$$837t<[^_]Ë|$(D$GD$GD$GD$ ND$D$D$6D$,$ $"ƅK@D$2D$t$D$ D$D$,D$D$$U T$UT$UT$ UT$T$T$$ L$,‰ljD$,4$D$,PB+ut$0MI ;uBL$ Njt$(D$ tfD$ tUzu3T$B t)T$0;UD$,@@ D$$UE D4$E )l$04$D$$ E D$$E t)uuDu)L$  D$$袛cfl$ Jz l$ 3UWVShÄƉ׉L$(D$ P%D$ @ $(D$D$D$D$, ?.D$D$8D$ D$0|$$D$D$,$ODžtSpD$D$ D$l$D$$$Vlt!Gutt < u|$#uD$ (D$(H@T$+T$T$,T$$t$<|$ 9t$ N,9)9n)Љ‰D$|$F 91ҍL$8L$1tftD$ H,@ )D$9T$;D$wNL$΃rU5D$ D$ h[^_]Él$D$$8D$(@ D$ D$ h[^_]ÃD$< t< tD$0D$4$M1Ҁ8 hD$ T$4t$$#MT$4t$D$,L$9L$D$0D$%$E|$l$4l$W< tW< D$,L9z2D$D$4$Mpuj< uD$ @ D$ DD$ 04$?P;T${T$D$D$D$ (DD$D$)ЉD$D$$1=D$tfD$tD$ @ |$<׉|$)T$9l$$D$D$ $L$ 芏P;T$T$|$L$ ΃rL$_1fD$$W`L$|$l$8D$, (D$,$$)8)D$ @T$,D$$BD$ h[^_]f M}11ҋD$ 9D$ 0jfl$ D$D$, (D$|$<$(XL$)T$D$T$4|$l$l$4D$$eD$ M}D$fl$UWVS\dD$pD$D$x 5L$X1ɋx D$ .l$*l$T$<$tz%OT$D$ ,$L$$L$L$ L$D$ l$T$T$ $t[D$ $mD$@ |$X3>u]\[^_]ÍO넉T$ $DT$7ËL$D$ NjD$ $u+UWVS$f(D$@(x tl?T$D$,$L$ L$L$L$D$ l$T$T$4$ t.D$$qD$8@ $[^_]Í?뒋L$8D$ƋD$$2t$[^_]Í $&t <UWVSr4|$4Ētz@ u?|$ D$0D$D$,D$D$($D$$ʼn4$Ò[^_]É|$ D$0D$D$,D$D$($D$$`Ņt1WVSÒ&tCƋD$4D$ D$0D$D$,D$D$($T$$D$ lj4$([^_ËD$41VS0f(T$@D$Dt$Tt胊/10[^ÃL$HL$ L$LL$$L$PL$(t$,D$T$D$[T$8D$9HT$L$*Jt$$D$D$1ht$8tT$B9 L$*JD$D$ T$9)…~"1L$7t$TD9uD$(t$D$,FD$0FD$4F .D$ht$89{‹D$$Fl$d1q9t$t1dll$:ffffUWVS4։L$ 5L$01PT$PT$PT$D$ OD$D$l$ ,$辈L$9s"L$l$4$:tt$037u4[^_]}1UWVSZ T$$$$L$( 5|$ $1҃t/\$Q}/1T$ $32Đ[^_]ÍD$D$D$,ttW|$,|$Pt$8L$)F @a1ЍDHw|$Xl뵋\$]UWVS$5ZD$4$`ZF(D$$K$tC$t-yD$4$8ZĬ[^_]Ë$x1D$D$VF fu  |$fF 4$OŅz$D$ $$D$T$F$D$!ЃBF0tN@9t $@F0FFff D$4$HYĬ[^_]VfHD$0D$$YF ,T$8$VLfF $$$D$T$ F fD$&D$ D$D$F$D$Љ!у~ f|$&nl$|$+D$T$D$T$F0D$,D$(iN<ș)L$T$c4$MF qD$ D$D$F$D$ЉщD$L$!ȃF n)l$T$F0(tN<ș)L$T$D$T$$$$&DŽ$V`4$IRSFfuT$0T$$WV$$$$D$T$ F[Q+FD$T$@F0D$,D$(F fD$&nN<D$T$n8+nl$D$+D$T$<)|$fD$& nL݉#l$D$ !D$ l$D$F$D$!ЃtFFF0tN@9t $F0ff ߋD$)t"4$ib(F9.)FD$4$U1NF fD$&+FD$(1ҋ|$l$)ՉL$(L$D$( ~PnT|$l$|$l$ 99|$1;l$  L$9|$)NjVL$)N|$(t)F@9t<$F fD$&F0D$,D$,l$&fn D$4$T1FPVTl_tD$4$T{fffffffUWVS,äD$L@T$PT$@D$D$D$@$1T1D$D$(D$D$D$ t$HtD$HD$ D$D$D$@$Ņtt$(uCD$D$@$SD$PD$Dt D$D\$,[^_]À|$F| |$tND T$8 D$D$ D$ D$<$D$D$@$RS<$1,[^_]ËD$D$ 1뱍09st$ 9L$8uL$ tH9w p9t$ t2)ƉD$(0D$(f)t$1D$$;t$t 9D$ tD$$t9ut$ T$ tP9r@9D$ 8L$(D$ȉL$ D$D$<$莾L$ |$lj|$ʉtftT$ljT$D$ D$<$)?tD\$P\$\$|$ |$8T$ 8Ju|$!%tL$]Ã\$D$)D$fD$#D$\D$\1t$9S29t$ tt$yT$ ʼnHtF:L$tM:L$tv8|$PD$ u Nt$ L$ MMT$ |$|$PT$8T$t_:\$u|$:L$t:L$t8u뙋|$P8\$uډ|$ljsmtftT$ ljT$51맋|$P8\$FufuML$ŋt$ uRu9wt$fMfMVS~t$F0t$ T$$T$T$$StL$ F0[^ËD$ F @t n8Tt1[^n1fVS4t$,D$0D$t$ D$(D$D$$D$D$ $~>.t[^[^SãD$,D$D$(D$ D$$D$D$ D$D$$u[VSbt$D$D$D$$1tD$)[^VSD$ tu};u|$\$G9D$ vqT$WG+D$DqD$+$=?{T$(o9AAD$ D$(R$ D$LfT$@ryUWVS æ$@D$ 5$1D$D$l$l$ $<D$$8D$$4$t:Ƌ$DD$D$D$,$t$3u [^_]þUWVS +$8D$$@T$$D 5$1D$ D$|$|$$4$t'l$T$T$ $<D$D$D$<$$3u [^_]S\$D$ L$9st9w t 9s 9w[[UWVSH |$D$9s7i1t`1@t2ttQRY([^_]Ã9wD$1[^_]9v xǍL9v׍i1uǍL5WVS足xt$D$tcH~Ѕu V9r:)щʍIt&xЅttX[^_É)[^_X([^_1ܸUWVS*L$,l$4D$0ȉD$|$8|$1} uq19D$D=9D$v|9tl19D$vmD=9D$vc9uUt$l$ $L$ u7L$ 1}tDt tW[^_]1[^_]W([^_]1[^_]UWVS #|$ t$(l$,9l$$|1%5D$D$$;utG;Ft1 [^_]ø [^_]WVS踱zL$ 1D$$u u[1[^_ÉuZ9wDyL$,L$ L$(L$)D$7$x@9D$,~A\$(É:r[^_~V(lVոSV?UWVSŽL$T$t~B1Ӆtou99wL1Ӆt u 9r1L)Љ~@u׍F[^_]ÉU[^_]ÉU([^_]øS[D$D$D$$[UVS/uD$D$$dtD$T$ tV[^]øVSD$ L$t$t*€8t:u9t Yu[^ffffffUWVS薯T|$D$T$΅t A"|$t$ wnD$0D$$\$RuډËt$ -D+L1 T$D$ 11Ƀ09~Att];D$ )ȉMQЀ vǍQwCɃW9T$tt}|$|$t$7[^_];D$ 'tȻ릍QwɃ7o;L$~ۋ\$S"o;L$^\$gS"G0th D$ ډT$oOoO1SD$tq|$81[^_]Eu [^_]«T$T$ T$T$ H*D$D$$ÃD$ D$ D$D$D$D$D$$Ã`*T$T$ T$T$ H*D$D$$OUWVS %D$|$4t$8~D$4D$@@0tD$@@13tftD$@@D$)L$@A)|$ T$ŋD$@0l$D$|$([D$tD$C*,$[t6D$,D$|$,$l$ D$D$<$iD$$$D$D$$y[[^_]ffS蕧WD$D$D$$Q[Si+D$D$D$$Q[VS<Ƌ$詜Ft)VtF D$F$ҋF9t$S[^UWVSêNjt1t $F9u $5[^_]UWVS蜦^ʼn׋t$$t*L$ t$l$4$AL$ [^_]ÉL$ ƉD$$KDžtL$ 1WVS+t$|$GD$F$uD$${P[^_WVS,ä 5$(1D$D$D$D$ D$$${D$MD$D$ QD$D$|$(<$jU=D$<$QD$tnQT$$QT$$T$T$ T$T$$ЉD$T$ v-L$ D$T$$|$$ ti +T$ D$ T$$\1$(3uY,[^_ËD$;t$PD$|É뵋D$$PD$N\UWVS<$D$D$ R4$XTD$P 9L$T@ ; 2D$$J]D$4$Wt5L$ D$ t01tUEXEt$輘 ; rԋD$t$螘ǃ ǃ D$ t1t; rD$t$Iǃ ǃ 胲D$$2 u5D$PT$T D$$ <$% 1Ę[^_]Í+T$ D$ D$ $"WVS(3t$8|$)9Qкm)9D$4T$8x D$:D$8l$D$4D$<ҹEl$;D$T;)=vL$<\$@9| 9vD$dVp(|$LUDFdFډ 0[^_]|9~O9TD$PD$ D$LD$D$(D$4$ H|$;~| |$;~+L$\$Ή߁H9~}D$xT$;T |ۋT$;TrыT$Z|$P|$ D$D$@" $0[^_](9D&>nT$;TdnL$\$2%T1UWVS É։D$E D$E$ M 9uD$L$E$ [^_]UWVS@t$ljT$L$, 5D$0$<1 ~G \$$D$ D$;D$D$E$L$,T$)щ€|$;`w tD$,P~D$<9uL$,AD$0[1ۉt$0>| <uD <<uڋt$0!$<D$É\$ D$$D$$D$$9D$ w D$$D$,D$(hF9u͋t$D$0/dFL$(+dF)1W G 9t$ tG D$0L$,hF;T$0t׋dFD$(+dF1T$0G D$D$E$T$щ€|$;pT$0L$4\$S#|$ 8T$0L$4Љʋ|$$<37uA@[^_]Ë\$#TNj\$#묋\$UWVS}\t)p9~"9~ƉNjdF9dFt 1[^_]hF8hFuffLf9LuɋlFdVT$lFdV$UWVSĀ|ǹʼnӄ9@D$D$H$1ɉڍRD$ tL$<<\Ѓ0 HPՉȀw9ʃ0 v+v u+L$L$L$L1L$',;T$LD$ )|R|$X|$8,|$l|$8j8aCD$H؉dFƃhFǃlFƃpFƃqFD$L؉tFƃxF|FƃFƃFǃ[D$PD$TD$PD$\$ _Q9)ǃ瀮3D$ށ^t<t >pPuCCD$H؉dFƃhFǃlFƃpFƃqFǃtFƃxFǃ|FƃFƃFǃ[s dV $ȉ׉s.tft$[^_])Ή4$g봋L$QT$A>>t%ȍHPuL$HT$LT$)щL$,;CD$|$H|$>fTT$>D$>L$ f|;9uL$ 1T$ t$ |$l$ʼnމ>f|>qFuL$)L\dFt؉Ń;T$ul$t$ D$؉dFƃhFǃlFƃpFƃqFD$L؉tFƃxF|FƃFƃFCǃ[D$C dV $ʉljs\tft$XL$ʉߋt$stftD$uuf˨uvfEdVeV$[L$ DMfPxD$PifvUdVeV$SP{W\$ \$ D$$t$ D$ |$l$T$@T T$(D$ D$4L$,D$PT$TL$4DTT$0T$D$(u#L$,9ϋD$ >|$$D$ T$D$D$9t$$~oD$HD$(T$NjD$LD$,T$8x3})D$(+D$,9}L$0|$,l$D$D$@D$,D$$D$0|$(-ƉT$$BT$ ʉ։߃9D$u|$0yD$@\$,t$CSL$\L9D$,1\$t||$(|$$D$D$9D$@@|$$9D$<~11ҍw|$D$$9D$<~>t >9T$DuЋ|$_|$dF$lj|$8  ʃuyP"VP9T$L V9D$u1ҋ\$Lt$ dV9uЉD$$D$ƄdVT$P7dXD$@D$D$,D$0D$4l$DD$$D$|$( ljt$$F ʉ׉݃9u|$yD$$Ët$(40 Ѓuy\$x\$$+L$0\$4qt$,V9t 9gt$@>nF^ D$T$t$@|$0l$4D$,9T$Pl$DD$|$P8|$<pF1ɋt$T\$$9=tFع\$$ Ѓu|$0yƉ|&9r"9| 9t&\$D$,T$,L0|vD$XD$TDD$L6D$<D$DD$Pv$l$D\\$$ Ѓu|$ylj\$t$>L$t*DT+FVD$T$ D$5Y` 9u_D$8>t$w|$$>T$Nt,DT+DTD$T$ D$5Y` u|$$~+t$>t/>>> xt9u1|$[1f|$|tXF ztuD$hF1L$<:t9떋|$$D$@ZD$@D$H|$< O|$<M1D$@ D$D$D$(D$|$$ -D$<|$$9|$(ED$(D$,|$T$<|$D$dV1 ;|$tQT$T$0>$!T$0uڋD$t$,0D$D$$D$(q@D$8>u YA|$1ɍpD$t$$t$D$(;μr79|$t%\$t$$DD$(t$D$$9t}|$$|$D$T$CT$ϼ\t<\$މӉ>C9L$$~Y=~|$D$P1\$0JKf|t$ ST$<9D$uJ|$SWVSeÕ 4$ t4$[^_$[Rlj@" t(StSdƃ 4$[^_UWVSEeŅYր:ul@@@ @@ǀdFƀhFǀlFƀpFƀqFǀdVGMTǀ[1[^_]ù‰Džt>:t1ɉt΋} ~BdVRl$9tED$4$fuE_9ul$E~b1ҍRD$ Չ‰lFdVT$4$ T$v 1t$|$ tt$F;j|1[^_]ù1Dž%UWVS,cuƋ,! t9$=D$~*t$@! $fu,[^_]ÅxD$5/|$aSHDǃ ǃ i~cdFD$D$DT$ l$px9dVl$ |u 0މt$D$9D$u΀|$TA T$(>ЉD$D$#D$D$$DD$ L$dF؉D$(D$#9T$tBt$hFlF.dVt$ ,tL$D$$9T$u|$|$#D$,! ,[^_]D$t$@! $78 Rc$[Nʼn:SHDǃ ǃ D$,! zD$( aD$ D$$ 8UVSaٍօtɉ $N[^] $@" ]N[^]UWVS`ljՍ 4$$)l$ D$|$5$lj4$[^_]UWVSU`l$|$u~.hF1 9u BdV9ut[^_]Ít&K1WVS_ùT$|$r~*dFָJ9u9ut[^_[^_VS_\ 4$14$[^Sh_*$[VSA_ 4$$[4$f[^WVS_Ë$[#LƅtT$Džu [^_É4$HT81S^wD$ $"T[ÃD$D$ D$D$D$D$$f^0! D$T$D$gD$D$ D$D$D$$@S^֊+! D$ D$D$D$$[S]×! D$ D$D$D$D$@" $[ÃD$D$ D$D$D$D$$Sd]&! D$ t $[1S41]T$D$5tQUM T$L$$lƉ׋D$ $j[^_]Í$85uu} UWVSWÖ$$ 5D$($1ɅF00TD$8F /TD$u;[^_]ÍD$D$D$,D$$D$0TyP|T$$T$T$ T$ H*D$D$D$D$$]ÃO|T$$T$T$ T$ H*D$D$D$D$$ÃD$(D$D$$D$ D$ D$D$D$D$$WVSpO2|D$C*FX$F`F`x.FXPVX|$D$FX$[^_;Fp||$ uƍFXD$D$$SNì{D$C*Q`Q`xQXZYX[;Qp|< uQXT$$D[S NV{D$D$D$D$C*X$Y [S_N!{D$ D$ D$D$D$D$C*X$Y[UWVSNzl$0D$,D$(D$ u D$ [^_]D$,$tEyEE upD$ D$(tftED$$)D$,$EM;D$‹|$$΃r뚋t$ |$$}}u,$auiE)uECEEEED$,$D$,D$ D$ [^_]ËT$Ћ|$$΃suLuED$)EE뷋D$ )1t$(D$,D$,$mD$ +D$1t$(D$ ffT$$zPuu eD$fS )LxD$D$D$D$D$$(W [SKûxD$$D$ D$ D$D$D$D$$RW[WVSKÁxD$D$D$($KƅD$D$D$D$$$=hfFf~ vF$$F,F(?F D$u [^_D$ D$D$4$[^_É$胰.fF 1[^_WVSJÌw|$D$<$<w fD$<$F[^_fffffffUWVSrJ4wl$t$4$N;D$ 9v!T9rys$u;u=[^_]Í9rY9sԉru$u-tftä[^_]U}fS I~vD$;D$ wD$D$D$D$$f [ffffff!̀rS[0v[WVSSIvt$F0t tbFFF tEFt>|$)9N~\nJL$ 9Ft1F t t&[^_É4$u9Fǀ뒉4$tοlj4$u 렐UWVSHDu֋|$T$$T$ tct=t1ލ^ƒ0VuD$t 0tC0^؃[^_]É u؃[^_]Ín v|1l$ tލ[)‰Ѓ0FtˋD$(9ut ~^D$FD$(xtAD$(1똃0F؃[^_]ú)0NщX1YUWVS4GsՉΉL$ <p9sT$tSD$ $L$8DžL$T$)D$D$$}D$ 01[^_]ÉL$$3Džt8L$AGAGA G AGAGAGAGT$노막 $;UWVSTBFs\$$ljT$L$D$4D$11L$ rL$,D$0D$D$ u%u_D$(D$0D${PZL$$\L$(D$(UUU;t$0g9t$ st$ D$,D$vL$9L$ ||$ u D$D$ ' D$ pT$,L$T$(t$ \$(<9t$0wL$0T$,9t$ st$ D$,D$D$( D$(D$(BUUU;t$0X9t$ st$ D$,D$p<@\$;;D$ AT$(;T$j$\$$61e[^_]Í<@\$;qw<@\$;)<@\$;? D$(t~UUU;t$09t$ st$ D$,D$D$(UUU9t$09t$ st$ D$, D$_D$(tuUUUw;t$09t$ st$ D$, D$L$0T$,e[^_]ÃL$(@L$(D$( /UUU;t$0s9t$ st$ D$, D$D$(,UUU9t$0:L$0T$,"WD$(.UUUwt9t$0wL$0T$,#9t$ st$ D$, D$UUUw,9t$09t$ st$ D$,D$D$,;D$$\$$)4L$0T$,QL$0T$,4oL$0T$,\RL$0T$,5L$0T$,L$0T$,L$0T$,!UUU9\$0c9\$ s\$ D$,D$\$ D$(UUU;t$09t$ st$ D$,D$cD$( tUUUz9t$09t$ st$ D$,D$ D$(UUU49t$0wL$0T$,9t$ st$ D$,D$T$,L$iQL$0T$,LL$0T$,/jL$0T$,cM<$t&|$ 1eD$( UUUR9t$0wL$0T$,9t$ st$ D$, D$D$(IUUU9t$09t$ st$ D$,D$UUU;t$0 9t$ st$ D$,D$iT$,L$ GL$0T$,u*D$(UUUF9t$0wL$0T$,9t$ XD$,D$1e[^_]Ët$ v$\$$'L$QxL$0T$,?zL$0T$,"]L$0T$,@D$(@uZD$( qUUUR9t$0wL$0T$,9t$ st$ D$,D$UUU9t$0wL$0T$,u9t$ st$ D$,D$t$ WJЃ O\$ 1|BЃD$ D$ JЃ v$tbUUU{9t$09t$ st$ D$,D$SL$0T$,FT$,t&UUU9|$0vr9|$ s|$ D$,D$\$ UUU;t$0rL$0T$,P9t$ st$ D$,D$sT$,L$vQD$,T$,L$+$\$ 10VS8d։T$$!FF[^UWVS@7d$M$u t$<}|$8ut$D 5D$40$<1A0t.Ƅ$D$<$$0-D$0$C  Sf #DŽ$D$DD$$$$$DŽ$DŽ$L$8L$|D$HD$h$D$@D$(D$pD$x\$|%uZ\$|sƄ$Ƅ${SDŽ$D$tDŽ$BZ"$^3 &%u+D$|t|$x+$T$|A$$$$v$|$x5$X4DŽ$\$HtD$H$$+$@ @ftD$x$t$9t$$*D$x|$4$<37?e[^_]Ë$4$$ =F f $fx$$DŽ$DŽ$D$$$$2D$$8$袟$LJPLJTLJX 1;:tft$C f$f$Cf$C$C,$CD$$<$$DŽ$DŽ$DŽ$D$DD$ D$8D$D$$tDŽ$$@$$$$$9}$$|$`D$dD$\D$TD$St$${t$L$tʋ$9}T$xT$L'$$L$X\$t+$$"1{C)lj$$`$D$,|$l$Jƒ;$tHD$lG$B$vƅp1ҋ$;$u$|$l$8$Xމ$$$$tE$$G$$$$${tMƄ$z0$z$A$$$$|$X$+$$$KC)$$P$D$l$$Jƒ9$tK$G$B$vÅ11ҋ$9$u$$$8$x$$-$$ $$$CƉ$$$C$$\$t+$ $0{C)lj$$`$$$$Jƒ9$tK$G$B$vÅ1ҋ$9$u$$$8$Xމ$$v*$$]$D$LD$xDŽ$$$+t$|D$S$D$`$L$hq$/& I,$ۼ$|$SЃ$L$$L$$L$ L$`L$D$$$$;>Nj$ 3$)D$@D$Ht$$$s!$$<$$pD$H3<$$lt$h$$tƄ$-$D$T=V$$߃G|$SD$T$ DŽ$\$`u $t$t$`D0$$L$p T$Tx$!$t$H$DŽ$D$dD$\D$S$t$|$$$t$hV$ aK#V.v DΉDžyރƄ$-$T$h1 11Bލ Q&DŽ$Ƅ$~0$$$$T$$D$8萺$pD$DL$tD$Dd$~ۋ$ $$$$Jƒ$G$B$vÅu1ҋ$뷋$$`$$J$낍J$$``$D$h$$$$yD$D$D$D8D$D0$D$DL$DY\$Dt$DNL$DD$D01D$D`D$ D$ 4$|$$V0$?D$ D$ 4$|$$WÉѿ$?$@D$lX$$$$$$$s$$$d+L$TƄ$}- $t$T!ʉ$L$H$DŽ$D$dD$\fJ$$`$$$8Xމ$$$$$$t$$$$$?$$$$}J$$P?D$D8|$tD$DL$hD$D0xD$DT$h$$11[D$DD$DT$h$$1 11,D$DD$DT$h$$111D$DD$DGD$D0xD$DT$h$$1 1\$D CΉǃ\$D$$;$$$$$$$$L$h It$x0T$h1DŽ$|$D|$DD$DD$DDŽ$C|$D_\$D L$D1yY\$D]D$D( D$DdDŽ$$$$\$h [4|t$hv4|\$h[|$h t$h v$t$h\$h [4||$h $$$<$ ` D$~~D> 9t<t[^_]Åt̍D>tu9uD$[^_]ÅuD>tu9uqD>u`UWVS4u}E D$EE$vi`E܋a\$|$D$D$%-MMt.} )D$%-MMuE$T$2ÅT$DS 9v 9uS99C93ʃ9uL$9ȃ9u؃U}߃}  ?E tE 8G9wEK9u؍e[^_]ËED$E D$`$ 2É؍e[^_]ËED$E D$`$1É؍e[^_]ËED$E D$aT$1É؍e[^_]ËU}؋L$U{ t${L$E$UE|tEqmdUWVS}?um|$ D$U <$>I`m܋a|$ D$%-B}Mt,}'D$%-@}MuE<$0ÅD8S9v 9uS999L$ 9'ʃ9uL$9zȃ9u؃U}߃} ?E$tE$8G9wEK9u؍e[^_]ËED$E$D$`$r/É؍e[^_]ËED$E$D$`$@/É؍e[^_]ËED$E$D$aT$/É؍e[^_]Ë}؋L$U{t({ L$ɋE$U!E|tEaUWVS`æE(|$PD$YU|$X|$0D$0D$H|$ D$$D$L<$¿aD$DÿED$ED$ED$E D$D$DD$ D$HD$t$p$U:ue[^_]D$DD$DD$DD$D`fffffUWVSĀÏ}sy=k= ~=DD$LEU D$XT$\u %=D$XT$`zD$L~D$LD$xD$ D$|D$D$`$xD$@p|$x.T$`T$PL$d?L$TD$8D$Pأ$a܋8a܃@a݃HaT$`L$`|$nD$n fD$ll$lT$Pl$n1؋L$P@%D$X:L$PD$,)Љǃ)‰T$<1D$PD$P)D$<؉D$DD$0} E$+D$`JD$||$P@%|$PD$HD$XD$`xt$HƉt$H|$nD$n fD$l9|$H( ؋l$l\$hl$nT$hT$XL$XvJ0Oٞzu؋D$@$k;t$`D$P}E t~E 0D$`e[^_]D$LDt$\%=SE'D$Xu D$E D$`$)D$`D$`e[^_]D$,)Љǃ%D$<D$P*ljD$0D$D} 2}1|$Lƃ}. } }D$4D$PED$(HL$HȅD$|2T$XT$` n )Ήt$`t$`D$dl$`\$`T$`T$PT$dt$TPD$8|$L.D$L!D$L@)ʉ捈T$` 놃m1D$,D$E D$`$j(D$`it$8F$Xht@Vx BtftD$$oDž@D$`D$`e[^_]ËED$E D$aT$'D$`D$`e[^_]D$Pzl$PD$L}"D$4ES ED$(D$H$%'D$`R}~|$LtD$4|$H>6D$XT$t$P @%ЉT @%B ɺt@%t Ƀ Ƀu؋D$,t @ T$XL$X؃,a\$ D$ D$XD$$-@D$\D$H?D$HD$ D$PD$D$`p|$nD$n fD$ll$lT$hl$nD$hD$J0D$X@%D$ Dd$D$4 ػ4D$`ث(aٞ T$ T$`ك#ث(aٞ 9l$lT$Xl$nd$XɃL$X0Nv؋D$D$PD$HED$(t$8 3t$<$ iD$8D$4L$<ȅ~~9~))D$<)NjD$DtXL$4D$D$8$EjD$8L$@L$$hD$DL$@ $eD$DD$@$nhD$DxT$0}~T$4t |$LVD$ D$0p )ƒx )T$<ׅD$,D$HQ|$4LD$<t$ q|$8D$`D$L$(2Vu ~}~T$LnUT$Xt$@D$L$2D$DD$pD$LD$tLD$L؃,a\$D$D$0D$ -@D$4D$TD$LD$L$TD$0@%DD$$|$nD$n fD$ll$lT$0l$nʋ|$\wػ4d$0D$00ث(aٞD$pD$p9ك|$H.ث(aٞD$pD$p9l$lT$Hl$nd$HɃD$H0Fv؋|$D$X ؋D$d$3SE 8U$tE$0Et$X 0D$D$d${PD$pM L$<)D$H@%D$LsD$DD$D$0|$<u|$Dj@%D$D‹uL D$pD$L|$nD$n fD$ll$l\$hl$nT$hT$LL$L|$\wB0|$DٞzD$pL$T9tUكD$pl$l\$hl$nT$h‰T$LL$LB0FڞzD$p9u؋D$0. ؃g D$X]D$L؃,a\$D$D$0D$ -@D$4D$Lأ0aD$0  ؃|$<D$0L$$ID$@+D$HPT$puNt$<)9}}D$<)ȃD$p}~T$T~ ;D$TD$8t$(t$L|$,D$,$[SD$~L$8~9~ȉD$p)D$,))D$8|$(t4L$$t |$LD$(D$D$d$TD$d$RD$LjL$\}O+D$8x|$pT$,zD$8~D$D$L$KVD$LD$D$T%D$$Pt$|$D$pt$\|$H|$t$@t$d$rOT$84uMu U~ |$0 D$@D$@D$uL1$谨t"ǃruu ([^_]äft1h9t<.t1UWVS t$4$_h,$+tǃruu[^_]ä[^_]ft̀ffff̀rS[` [S腺G D$D$D$,D$ D$(D$D$$D$D$ $[S= D$tB=?BwBD$D$ D$D$D$$1[1[#_ǹ )S$踹z D$D$ D$0D$D$D$D$D$ D$,D$D$D$$؃$[SM D$$D$ D$ D$D$D$D$$g[UWVS l$EU @9vt[^_]ËU;U}BED[^_]ËE$=9tƋUx u s$tftD$,$.:D$Puux u fUWVS0# T$$L$L$(L$ L$,L$$DƋT$$:|$$D$()D$(D$,|$$5}}T$D$4$5D$ЃD$ D$(D$4$6T$D$,J9R9T$,E\"FD$,D$ u} #14$8e[^_]ËM tD$,D$D$ J9x)ljL$,9|$$}JFEPD$ |$t$D$$D$E$4E|$ 8hBuD$#DD$ |$4$y5ED$ D$,D$ Pl>M NJB T$ "9NjT$ D$(T$ D$4$4D$T$ T$D$(D$4$~4D$ T$T$ 4$jƋL$$T$ T$L$ FD$n9L$ 9ȋT$D$u FD$T$D$4$W4D$,D$,D$ T$!T$؉D$4$=ƋD$,D$D$ T$|$ |$ Lɉ )ȉ1L$L$4$2D$L$T$E U#DD$|$4$3ED$u0D$,D$,D$ AV3D$ T$4$ƋD$,D$ `CT$BR @9v tWVSƳÈ D$t$~9x|IPu-H 9vB9wt )j[^_ÃH 9w$5<$3ufUWVS8 }<$D$x$ XD$dDŽ$ݜ$DŽ$E$E$-(ʋaDŽ$M fE ]$e[^_]D$lpt$p$Pt0D$hE@D$\B< nD$pD$tDŽ$1$C$ ҍDJЉ$$$A$rЉ< ~ˋD$t ҍDJЉD$tD$l1$-D$pD$l0%D$p@E@$G$uD$xu D$hDŽ$$E$E@<+<-+D$XPЃ *0u$P$0tPσPЋ$HL$L$D$P@0 w>L$Pt$HƉ|$DTFЉω$10< v|$Lt$H|$DL$L+L$PN~NL$X"@$OT"$M t $} T$lt$-D$$D$E$,$$a0I{DŽ$E$$DŽ$)T$`E@ D$xD$Lu$$ƃ~$D$xD$|l$xݔ$$ ~)@%LD$tD$xD$|l$xݜ$؃$5l$q|$`cT|$`%+$;D$`,+$@%݄$ ‹L$`) ݜ$$$T$ L$LL$D$M $MU$D$x1V:Qt$x$8ʄu鉔$$D$x1HЃ wT$$ˋL$ tD$LS\ڃvԋT$$L$ t\$ \$ \$\$ ^FLA<^D$r9\$t$+t$$D$ p$\$ )ƋD$D(91D$Dt$9pD$DpD$9)9D$D@ >D$ $\$ \$ H."P,[^_]+t$(D$1H17rzD$DD$,1tu$\$ L$LhD9u9~ +L$TD$D@|$HD$\$ + )9~D$D$ $\$ #D$D$|$D9GPD$ $\$ \$ -",[^_]þt%D$D@ D$L|$ 8D$H|$8,[^_])t$D$ $\$ Džt)N|$$!t$D$ $\$ :t$D$@8FD$xt$8uˉƀ| ˀ| u)ƉD$D$ $\$ D$ uzNOtL$L$D$ $\$ NjL$L$$t)t$D$ $\$ CD$D@D$T)t$D$$1~D$(+D$PD$PT$PBD$ x$\$ D$ Qt$ 9~c!D$Pit$D$ D$|$$1l$Pst$Pbf|t$D$CpD$$ 8\9~l$D$ $\$ D$ @D$$L$Puo\$Ptb1"L$D$ $\$ 94|$D9t("A^q\$D$L#փ"|UWVS ô t$ |$$D$(H98)ʃ19 $>tVT$,P@ M|$0l> 9T$(~2t$()9t$U0T$D$ $u1 [^_]Ín )9t$U0T$D$ $ul$0v1QUWVS0ö }u D$(D$<$ \$ D$ T$$D$T$D$,D$4$ \$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]WVS|$L$2A<w 9uYu߉[^_1[^_WVSD$\$|$WLsS9s!ǥ9w)ڃD9v@9w[^_VSD$ p@T$9|"~L$t9t[^ÉЍ9s*SCu)у u9u[^1WVS7 01 5w/%ua1wuuA1w?u[^_UWVSl$(D$,U]T$9<|$ $ <$)D$D$ pD$9v9׉T$L$ ЉGF $9wߋT$+\$ KTt+D$4tÉ,$~[^_]ËL$tuOtMft11uuuut1ø UWVSD$,@D$ D$,XD$4D$D$t$01ɉ݉t$|$Dt$|$D$T$É։1\$t$D9L$ Ɖ ߋD$,t!|$ 9x~ |$,D$ T$TG[^_]Ë@D$$%T$,Rx L$,q s'tftD$D$,$D$D$,uux L$,q f҉D$D$,$D$CT$uHuuux@tø 1뼃$tT$P@UWVS0t$Dl$H~]9} ߉ÉŋF L$ 9N}$D$$D$L$ T$,9s 9wFD$(D$ED$ L$9rD$L$ 9L$D$ D$ ht݋t$|$(D$D$l$ƃD$c>1|$l$Չ1|$l$FP9\$wƋD$FD$L$ 9L$wT$ ~%\$,su؍LuuT$ D$$L$ HD$$0[^_]UWVSyÿ |$,t$0@% )|$ F*D$ut?}tDtl$D$ $DžD$ $.|$ uD$ [^_]859u@L$l$,$ljEL$tD$$rL$F*$}L$tF|$ D$ [^_]D$cD$<$sDžD$ D$ [^_]85uXL$ $ŅL$ @q@@% F*$sL$ F*$@% L$ u냋YF*$D$ ǃ@% 'UWVSl$0D$,PNj@D$XG9~ 9$2D$ xt19uV(T$?V/T$@V.T$AV-T$BV,T$CV3T$DV2T$EV1T$FV0T$GV7T$HV6T$IV5T$JV4T$KV;T$LV:T$MV9T$NV8T$OV?T$PV>T$QV=T$RV t$tFlj4$P[^_ÿUWVS @[ ƉD$@$Lu 1 [^_]ÉŋND$L$$KL$~ɻt<tPt<t0t$tt ue ك ك ك ك ك ك9X ىJىJىJ ىJىJىJىJك 9u%E Ub(T(VS Yþ D$T$uUtJp4u [^D$D$4$D#uwudž0 [^øUWVS|Y6 $,D$$;Jƅǀ$(L$L$tpE8PT$T$ $0L$|$$($#J84$/N81[^_]ÉL$$($pD$D$ $0T$|$$(<$#tL$x L$t$4\$4JJ D$t$$QD$VfFNF^nNNVF n N ^ N V ~^F^NfFFV^fFNFVnN^NF~^^ V N!~"^#F$^$V%f&F'N(F(^)n*N+N,V,F-n.N/^0N0V1~2^3F4^4N5f6F7F8V8^9f:F;N<F<V=n>N?^@N@FA~B^CFDt$T$XhH ݈JHXXhHJ݈ZJHXX h H J݈ZJH X X hHJ݈ZJ9D$Pt$|$J|$>asFdD$ hd$ ;F@D~F(dž‰Dž7N ^ DDTNIꉖD$ T$D$8$^$4t$4P D$4$0$(4dž$$$dADž-pwpWoXoG oW pnOgw8yo[^_]F*O$A8|1ɍ+F8FF F FFFF4F* ~D1 󫍾󫍔$T$$($jr$=~F $F$4P$4$4Xt^4$4Jt $4Gu$4Stt V1v4s$9P QDQHF F$D$ T$ D$4$躙nGF0F(|?~,NV<~$;VvV_L$~D8%F8FF F FFFF4F* 1tft1@1tfT$4$ F$F~ 8111$( f@ת?(1fB8:6D$P$\$0AUWVS OÆ| t$4F(F(NjN0!L$N9HF9T$ D$N $g@T$ F($Fn 9} LDLDF V,9r|$|$|$4$  [^_]ÉV0 V,ڍ L$D$$D$?|$(b1_O t$ 81T$-T$$!yD$$8D$l$$l$$D$D$l$$ѵŅ|$$x@@f@fEE D$D$T$$9D$T$T$$*D$l$$ l$0=D$<_ D$4D$8D$L$,UWVS uF7s D$4pFtD$D$$hFT$@D$D$D$8D$4$WDžD$tPD$D$D$Ek D$ pFtD$D$$vFD$$ toD$D$$輭 b1@hx HPD$D$$گ$Nu  [^_]1 [^_]UWVS q=3j |$ wFtD$D$$dFD$<$$YFt$2F Ft$d2dždžt$>24$02<$(2,$3؃ [^_]øfffffWV|$ t$L$uL$u1^_ù))1G1ҊV)^_S 6<h D$;D$ wD$D$D$D$$ [EP*t$&;p ŋMft DAfD$&tD$D$ t$L$<$~Y1D$D$ \G#D$DOT$Dы L$у΃T$ uL1ҋ0‰T$VPVFF0,[^_]D$D$$5)ƅ;G D$$)FMt L$DN FL$HthL$HqFNV2D$L$L$D$ L$DL$D$<$Iz,[^_]ÄtIFNV2D$L$L$D$ L$DL$D$<$y>T$ D$\$Lt$(F D$щT$ L$(L$D$<$q|VуF4$?,1TD$L0SD$P L$ TH}[UWVSk6-c t$(ty9toE uEtT$0t UucL$,tSEt"V T$D$$E$}+EUPU,$g+9u1[^_]Ëm{D$҉T$ D$ED$4$'{pST$D$ @@ @XYX YXBP[ffWVS C5b |$(D$$D$D$ @D$D$$誙ƃtt|$$3t [^_084$v!8UWVS@4Éa $T$XD$ 5E$<1jt$D$ dD$D$|$<<$w=$D$D$ D$$D$(D$,D$D$D$D$$苗<$ƃtG<$D$D$4$tiD$tD$4$tPD$D$D$$$<3Uuy@[^_]Í$t&8D$D$D$$轖4$՘8r?yhwUWVSt3_ $$D$ 5D$ L$p1ɋ$pFtD$D$$ۤF Y$r4$t*|$ t$p37At[^_]ËU|$O9D$$$D$D$$赡DžFfN @D$(W)‹D$@E 9#G fFD$0D$l$4$bvfdžV fT$(D$L|$0$iD$(D$,ED$4T$B ljD$@AfD$8QfT$>)ЉD$D9D$D!f9T$(sIAL$4L$,| )҉T$T8T$$zL$4AfD$>AfD$8ED$4T$>fQD$8f+D$@fAT$,fDQȉL$8T$4L$QPL$$Hx ED$ED$<$&zL$AD$D$}<$ zF( <L$8u$QA;D$,rD$L$$$  1EGuD$(9džD$|$$褡D$LD$l$4$@ljD$0D$Lf|$(|$0$  D$(D$,D$ L$L$4l$4$ǃL$4D$L$$dF(<EU|$O9D$$|$H9rb|$D$D$4$u+D$`D$XD$\D$HD$`D$@D$dL$$D$XD$E9|$l$4$uD$hD$PD$TD$HD$hED$lL$$D$@D$(l$P9;D$,D$D$@D$D$$D$D$D$ l$L$4$ -Dž&D$$D$FD$$/FfD$(D$069F5Ff;D$(&fF|$0GD$D$4$W>KAf|$(džfdžD$L$$GFD$0D$l$4$q~ tJWfT$(fV T$(f džD$(fkf|$(džupfffffUWVS(,X t$DD$<@(ƒ  D$H,FM<GGT ~>)L$D$ЉT$$wuT$fVUF\$HKftɍ\Hf9sf9u^L$Hуft#ɍ\HHf9sf9unfnD$<@(D$ <t 1([^_]ËD$<69puP;T$Hv߃t$&t$<$t$<$F;l$ mE\D$ED$$裕ƅeED$TF,EYT$L$E D$<$>nL$T$1D$t$$譗L$m N)ʉT$D$$5ofl$ fnD$lFFL$Qft*ҍTPfL$f9sfT$ f9uL$VfT$ft+ҍLPPf9sfT$ f9uFfD$L$fND$t$$ӖD$8t2D$D$<$Qt@ [^_]ý [^_]D$D$$肖1 [^_]ËD$D$<$Tʼn [^_]fFfFF MUWVS, $P t$HD$@hEtD$D$E$E t>uE(tȃ,[^_]ȃ,[^_]D$D$(D$|$DD$D$|$,$4ƅD$T$(u>D$@  Vf9sot$|$,$guJFD$ D$D$|$,$t|$D$|$E$ȃ,[^_]VD$H1f9D$BfFftVt$|$,$WguBFD$ D$D$|$,$I#VfuD$BfFfuD$@T$ID$D$ED$E$蛑ƅ@f"ED$ t$D$,$F1|$f 1ɉȃ,[^_]D$D$D$E$fD$%ċ|$D$D$|$E$9L$1L$D$t$E$L$rRD$|$E$Q'@D$t$E$踒ED$$L$(L$L$D$,$20E9fD$FD$ ED$t$$%UE,D$9GD$:D$t$$D$;|$cGRD$GD$E$^ƅU@9tϋfHt$XLH|9fAD$D$$PD$|$E$ƎEU1ɃufL$D$t$$ D$D$ D$E${ƅE9\D$t$E$D$ED$E$5ƅUL$t$ZL$D$D$E$^L$DrU0D$D$D$$D$,$/$0E,D$E9#FD$D$t$E$֏;L$,A1@D$T$T$ $藏;t$T$'FD$FD$E$…_FMftփfD$fPt~T$L$DV|D$t$E$D$|$E$`ƅP8fPL$ufT$D$t$E$胎D$D$D$E$ƅWm:fff1̀ffff ̀rS[H [S÷H D$D$ D$D$D$D$ $t D$[øUWVSaH $$ 5$1t $uc$xX$%GD$uFȀ9up+$D$PT$9щL$wD$/$L$tcRED$D$$3Ĭ[^_]Ã8u)ʁx?뽋D$xX<AD$dL$ |$$|$Xu&T$$>coT$E;l$uԉ|$L$ |$$D$)ЉL$D$ D$D$D$$D$ $L$K9r I9tB}/uED$,D$ $L$i1E/D$4%=@L$CL$(|$$|$$D$$  D$D$($~轾8}D$9D$oNjl$ dD$(@u0E8y9l$/ED$D$$uI$t>D$D$($0TD$$D$,D$D$($0%Խ8D$载D$sl$D$1\fffWVSFE D$t$T$;T$wx9v 9rmǃs!u4u6[^_Í 9rP9s؉ǃrߨu u(tftʤ[^_xf[SjD $H[S FD $$D$!D$$/ [WVS BD t$$I$IG 1$iID$!D$4$f/|$4$. [^_UWVS|D$\\$Hy|$Lqt$`A D$dil$Py|$Ty|$hIL$l*l$Xjl$pZ\$tR T$xL$T$D$ <$\$D$Tl$|$L|$L$Pl$Xl$ \$HD$D te k2-byD$nd 3expat$(T$$t$$ދT$ 11 މt$ 1T$,щL$01\$4t$\$މt$1։1 4t$1L$ȉD$81L$(|$1lj<$1 ȉD$1‰D$<1D$ ŋT$1t$1 ʼnl$@1,1t$ 11 މt$$1T$։4$1|$t$T$,11 4 t$1|$ t$1t$(|$NjL$1L$01 1t$1ȉt$ l$@\$4݋T$<1D$81 1T$1l$DPT$$D$$t$(expaD$\D$nd 3T$\B2-by׉Bte kj \$HZD$LD$Bt$`r\$d\$ ZT$PʉW \$T\$$_$D$h$G(|$l|${,D$XD$ C0D$pD$C4D$tD$C8t$xt$s<|[^_]UWVShi@ Ɖ׉L$ 5UT$d1D$D$D$D$ T$D$$D$~D$$D$(FD$,FD$0F D$4FD$8FD$;9uBfAA A D$L$D$$\$ w1[^_]ft4V|F1L$:>9uL$>11f,UWVSO1 lj֋l$$ fBfBP@F U L$ A N)fFfFL$ MH@ L$J T$ L$ $MT$ BusfFF F D$t$$u1[^_]M V)fVfVD$L$$T$ QMET$ B덋R _z1wUWVS(M0 ƉՉL$D$$D$4$c8D$$fAT$fQUQUL$ Q} |$ O MM|$@f9T$D$D$$D$T$|$D$ GEGfGD$fGE G D$DD$D$@D$D$ $L$Tt$tft;D$D$D$$D$(D$<\$ D$([^_]ÉL$ T$D$D$$‰D$ҋT$L$ |$T$ WUWfGT$fWU W D$L$$/qT$ PD$D$${suiurED$ f@ft$.\$<([^_]ËD$t$ t$$s11M}fzD$ D$$2D$ UWVSh`- D$l$|$$$$fD$N$L$P8L$0\$D$ND$,D$D$TD$4$$ P)fPL$NfTH CWVP$XP GD$D$$T$ \$IFD$D$T$ GЉ$\${I$8E,D$ 9FoD$$D$D$(D$`D$DD$XD$H~D$>D$D$,D$D$4$L$0FT$ ƅD$ $D$ G n:T$NfALV\$C%AFf+D$fFfDVWPD$ M$8u?D$TL$P D$ $$EzD$D$D$E$t$pD$|$E$p9t$ FD$PD$|$TD$FD$E$\$HmD$ VfT$NG Q(TGD$( D$Xt$ FV)9\$Nf9s0t$ VL)D$D D$ʉ$\$FND$ fHD$ G Ff+D$fFT$NfDVP L$$\$ H[\$كH\$D$D$ D$$\$=FD$@P ID$D$D$E$t$FnD$|$E$/nD$D$PD$E$|$nD$D$TD$E$mE$Uh[^_]ËV$XVT$T$$\$dE$8D$TL$P ($$7t v$ D$GD$C D$tD$@uqD$ pt`T$BDBЋT$\ D$X\$dD$ D$`D$DD$D$H$щD$$ 9D$vXD$BfwD$XD$$(ZF\$)fFT$NfDV\$D$(D$$T$\$DT$BD$ D$t$E$\$!lD$D$PD$E$|$lD$D$TD$E$k1h[^_]É$$yL$NL$aD$GD$$^OPf9A;|$uVSÄ t$Ft$(F FF(T$VT$fVF([^UWVS,m/ l$@E,D$ ED$D$t$E$]D$E@fD$D$fD$ GfD$ fft>ffD$|$ f} D$D$D$DD$,$2t+t$fu‹D$@ D$ ftbǃ D$@ ukL$fxDqtD$L$E$d_D$@ 11D$D$,[^_]ËD$HD$,[^_]  u+f|$ tBD$@D$f;D$ u D$@uPD$HD$ fE D$,[^_]ËD$@DfD$ 릍ED$  tfD$ D$D$E$\D$$tfD$(D$$D$D$DD$,$1D$D$D$E$:^D$$T$(EU D$H9t$ gFVD$FD$E$t[D$VM@9QD$D$D$ $]9t$ t Fu1ҋMD$D$D$E$ZD$$@fD$(D$$D$D$DD$,$/D$D$D$E$ ]D$$T$(EU D$H9t$ 7F&l$@|$@DL$ D$T$T$$\9t$ L$ FD$FD$$YD$Nftʉ|$@l$@t$60fP8D$MTPtD$D$ $[D$t$E$jYP1fQuD$MD$$D$E$[D$$D$E$x[fD$ \Rt$60fPD$WTPt2fBD$D$ $[D$t$E$X1҅t,MuD$D$D$D$ $ZD$fD$ ʉ|$@l$@Mfffff̀rS[0 [ÌrS[ [Ḉ̀rS[ [̀rS[ [ḹ̀rS[ð [S × D$@t@L=))t 19r\$,$ߺ81u~f럪g)fu`uQJуL$1ɉ;L$r,7`fbfx7ef먪UWVS ʼnӉL$@ U$ƒ?tV@)Ѝ|(9Q‰ރn_41u }$)D$ÍE(D$,$upD$?v-@t@\$,$E U$@9ud$?T$t*Ѝ}(ރtftD$1E U$ [^_]Ã|$?vu(D$@|@CFCFC F CFCFCFCFC F C$F$C(F(C,F,C0F0C4F4C8F8CT$T$,$!T$׻~1)|=Q1s4uYtt뻪ofu-ur΃1ۉ9rff۪fi}RUWVSÉՉL$@@SDƒtz)Ѝ|P9‰[D&<|$ 1S@KDS@KD9ro9T$ e)D$ōCPD$$|$SPD$D$ЃD$׉L${[tftT$T$ $Es@{Ds@{DT$ wwCHSL;l$ud$L$tFȍ{PtftL$1ȉC@SDC@SD9rCHSL[^_]ËD$vl$$C@SDC@SDw=wCHSL9uOT$ЉuouhL$1ȉC@SDC@SD9`b9Zt&IfEzuoft&tfua*뗃CHSLuu"VECP{QD$ffUuPHED$Zf(L$ t T$D$]UWVS l$|$ t,1T$T$%DTuݺ1u)u/tft[^_]êtfWSk5 T$ `e deJheJleJ peJteJxeJ|eJeJ eJ$eJ(eJ,eJ0eJ4eJ8eBx=}|:v;<D$D$D$D$ D$ D$D$8D$j$$T$ mA h[ÃG_Et@ED$S$Ӄ^tI XtYtn릸D$8D$<D$8D$t&D$8D$<8t&D$8D$<.0va*+OD$8D$XT$F8 $aF8L$(R9u&W8 N8T$(T$(N8WWUWVS4[ ʼnT$HL$8$HD$D$LD$4$PD$< 5L$@$01҅D$<D$D$D$%;$Tn =c D$$9D$Ƅ$Ƅ$pD$,$ $Ƅ$E8 D$$$D$LD$0|$$D$,$C$D$ t$ )iD$ t$l$D$$,Ƅ4?VD$D$0D$D$$QljՉD$(V0D$D$,uT$L:u\|$L$Dt$4tD$|$ $LD$8tL$$U$TD$$x@D$(D$LD$P$1DŽ$$L$ L$LL$t$Pl$t$(4$D$`D$ D$D$D$ l$D$<$ T$L9l$D$ D$`L$L$<$"D$ T$L$9 G9BD$ 411|$L$(l$,vT$*uB8ID$x9z*9t$(_9L$ w|$L$L$(l$,r xT$$D$$D$$<$D$D$D$<$t$PD$$L$( D$$D$ D$ h|$$ tD$ x|$ L$D|$4tD$D$ D$ $_ID$8tIL$$|$Ht1wtftD$8L$$L$ !%tꩀu+T$>;t$HvPD$4\$4$T$T~:tԃD$ L$KP;\$u;t$Hw|$D$;D$ x4[^_]T$T|$D$$T$Tt$|$|$D$H|$0HV9u|$L$Pى؉\$L$XJ;D$u\$l$9D$u}D$P+\$P9}+D$ u"L$L$ D$PL$ D$P1L$,t$449ut$q|$t(D$PډM]J9ub1l$, 9uD$P>9|$Pk9\$PT1t$P|$D$ L$P\$]XU9u\$D$Pl$0111ۉ)|$D$HƋD$H\$t$XQ;D$u\$D$()D$()Ѓ|$M]H9ui1\$T$ l$,  9u\$D$ L$PJ|$PD$HxD$D$HD$D$D$H$T$TD$D$L$ $T$TjD$D$D$H$T$T>D$ߍ>D$t$$T$TD$D$4$;T$TD$D$D$$T$T?t$;׉T$T$<$T$TT$\$$T$T$TT$\$<$T$T1l$\$T$t$H,,9ul$\$T$D$()Љ1҉\$L\ 9u\$1\$|$,T$H  9u\$1L$,|$<<9u|$T$TD$D$D$$T$Tt$T$TD$D$D$H$T$T@D$HD$3D$TD$ D$PD$1t$PD$D$()؉$,}D$TD$ D$PD$1t$PD$D$H$T$TT$x'\$<$T$TibD$D$NVS ԔÖ D$T$L$ ;L$$w-9w 4 9r"9r49rL$T$$! [^ffffffUWVS r4 lj֋ jtRT$l$$$Ћn1҉D$T$L$D$ L$$T$1 ‹L$ubD$T$D$ T$L$FD$$P;uCtVT$VT$$$Ѐf1 [^_]8UWVS耓B Nj; rH0u @vt9FuueVtuPVFV t\P V [^_]ËD$$ƅt@F[^_]Écu1W륋NT UWVS賒u $$D$D$<$D$%=D$($WƅtyF@@9u$ l$D$ D$hT$l$T$Č[^_](71Č[^_]ËD$T$T$ T$$VS褑f t$t{tlJ|$$\$ tFP@֋Kt2ACTP@VP PV@[^ËP븉C 1C*D$ D$%D$p$ D$D$D$D$$ UWVS赐w D$pHPt5QP PHtJ H4$1[^_]ËD$Hxl$T UWVS(J |$|e31zS31hi d1Y23O1GD$PBL$ t ȈB1VS躍| t$u3Q P $tHP uV $u4$1[^WVSZ |$7u "vtFtu[^_Ë$*؃[^_ffffVSD$ L$t 8trtl@͉ э&t&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^UWVS|$\$L$t1օt%VCBiut B9u[^_]VS D$D$D$D$ D$t$ t$$N. uǃ. 5t$} D$$'D$t$$$E $l WVS_! |$8t$4t$0u [^_ËD$,D$t$ t$D$D$D$D$<$D$D$<$1ut$4D$<$[^_É+D$1t$0UWVS ŠÄ l$4D$8HE U|$89|$ Qqt$M,]։ڋ\$ tLvD$\$$хT)ƋT$8RT$ )‰ЋT$8BtM,Uuw1 [^_]É,$QE Uut$}0D$1ɉT$D$ŋL$9v͋J9z19ʼnD$t$ eD$tfD$t$T$ST$i)l$l$ )l$D$8@D$)|$8Gr:D$OD$(HtD$l$ L$T$D$D$D$ l$ ,$T$~)D$L$1t$ QL$tfBfBt$9vЉT$D$t$ UD$tfD$t|$)}ET$1ҋ|$|$ D$8@D$)t$8FE ut$}Qd9}sQL$L$9sEȋt$ # T$t$u,$T$)kE9T$D$D$ D$E$U,D$T$)09T$Mu)ω|$׍6p9rT$D$ $t@1Fu:)t4\$|$F$V,fN @ [^_1 [^_ËF뽋FDtVT$ [^_WVSý t$tKD$4$i F t#4$KD$4$n [^_( @?*4$N$=lj4$[^_VSwD 5t&D$$D$D$ D$4$[x!D$$<[^D$  (ø<[^VS<à t$HD$LD$ D$ D$D$D$D$N>w6 DD$$D$D$ D$4$P[xD$$<[^'͸<[^S( /T$T$$?[fffff̀ffff7̀rS[à [>̀rS[À [VD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffWVSŭ t$5tlF t!Vt0F u8tL1F1[^_èt|uBVfF uЉ4$JF tFF؉F1[^_ËF덋V0 t~@9t $uV0F FV닸offffffVS! $FftYT$T$$,xED$%1= ‹$T$ptI$VL=tQĄ[^Ë$$Ą[^Ë$Ą[^9F(uUWVS|P $ 5D$x1F t*fF FCFFD$x3|[^_]ÍD$0D$D$,D$4$D$ F un9tll$,,$l5q T$ ʀFnD$0t*FfuT$$$\T$$tT$ ʁf V WEfxD$ pD$D$@T$8$T$$R.T$$$ L$$Q/ҋpF HL$$D$(L$$,I*DJuXL$( L$ D$ E HL$$D$(D$0HL$$D$(D$(딍T$4T$D$D$D$ D$D$D$$AT$4\D$,PL$ Np$3&FUWVS |ï Ɖ׋@0$F0P9D$D$$F0Pt$T$8$F0PuD$D$$n0VPF0ǀTu Xt$ [^_]ǀX\D$$YF0NjF0TXtXWVS{Ù Ɖ׋@0$qF0t Xt9Tt$K[^_ǀP8$F0D$\$F0P{ D$85u1=UWVS*{ |$850u [^_]ËG0$G0Po09t'Pt(,$|[^_]ÃT1Po0DžT1zT D$85u1{z1 D$T$85 uVVz D$T$85 uHVS8 z 5D$41D$D$D$D$JT$43u 8[^)fffffff̀rS[À [S yg D$D$D$t,@D$$u [UWVS4py2 D$(ϋED$M ED$ED$֋EL$pD$$eED$ |$t$D$($ljT$ 9U-L$$MҋT$ L$uW;D$(tF89 ;|$;T$|4;|$v.E"|$T$4[^_]ËEW9}|$ʉ4[^_];|$r;T$|~?Et|$T$4[^_]ÍD$0Et$,EV9|;|$v볋E"UWVSwø EU Mu}u} u} u} H*]]$][^_]9UVSEU M]u]u ]u ]u](]u$u[^]fffffffWVScw% t$D$4$Ft't|$4$Ls[^_1[^_UWVS wɣ t$ |$(D$4$tot]l$4$t;|$D$D$$$]9s1 [^_]";fffD$ 9D$røËD$ 9D$røUWVS!v . t. 5D$ 1/ t*D$<$t . PD$ uD$D$<$ ŅtBD$D$<$ . 8MtډD$l$<$ ,$jD$ŅuD$ / 9t$$jǃ/ ǃ. [^_]Ë. ) DL$D$$[^_]WVStú t$|$t%D$4$6tt=t1[^_À=t[^_WVStc D$D$/ <$tƉD$<$ 4$i[^_WVSYt |$G$xat%Ɖx @D$/ $XF[^_1StР D$D$/ $tT$9P [1[UWVSsÎ t$4D$8D$5D$D$ 81ljt$D$0D$,$ u |5=3T$ ,uȉ‰|$O/ u;D$ t'T$D$D$ / 9T$9sL$49D$ T$$]hǃ/ ǃ. 4$_ljD$ D$0T$rt$)|$ D$D$ $ / L$9. [^_]ËD$ 9. vt܉[^_]Ã%@D$T$t$$dD$ T$d뗾@D$1VS qƚ \$D$\$D$$t 5D [^1WVS qO t$D$4$pt6D$D$4$xT$  5D [^_1 [^_VS&q $fu [^É>01[^VSpê $(u [^É01[^VSpl $u [^É01[^VS lp. t$FfuT$ T$T$T$$xFP^T [^ff [^VSpҜ t$V Ft5ft_D$ D$D$$!Ѓt?V FfV fuT$$T$T$ T$$[^ø8u V F벸UVSbo$ uFft<ȋED$ E UD$T$ $A!уtfN FPVT[^]ùff [^]Snø D$ @ft $l[ø$Z[ffUWVSHσ4у ).K ω{H ىH{11ω{3HHt#HtY ؅u.A[^_]ÃHHtQ ЉAA[^_]ÉAWVSӋt Bσ4Su_t BVtBuvVu V;t][u뫉 $4S $t4teFu*t@uFt@uSN[^_ËtBuʉBB؃[^_o D$T$P@@ UWVS D$ h]8u 1tGƒWÅ{@|$ ukt$ q>D$ 9tD19‰D$(`9L$ AKK Qt$,XWVSt$D$|$VtRZu369t%B9u;@9t-9u1[^_ÉЋu)[^_ËtD+B[^_Ã)[^_UWVSl$,L$0Ex93CuD}|$ 1;\$ ωƒ4t;^C[^_]ËSЃD$L$,$Hփt$ ҃΃t$уL$9 ty~|$ q ‰Q Q ‰QHS1ʃ1ʉPK ʉPуS;XS|$ L$ T$[^_] }|$ 1҅‹3B3B J;\$ K ;XuPK[^_]Ë|$ u9D$ V;\$ ]U U&1*}|$ cqtqD$D$1TK|уH y|$ tyD$cyD$S6̀rS[ [USfä ED$E UD$T$ D$E$V []SD$L$ T$&&@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8tt& )[Í1[ffffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffUWVS@[^_]9\$$q"D$4D$8D$<yA<wɃ7 \$92D$<1\$3\$8 D$,T$0\$<T$8ӋD$8d$,ډ)ډD$8T$D$ l${D$C*$D0[^_]UWVSTXDq ljT$L$ $hD$$ 5$P1i(u!]($P3T[^_]D$ D$ D$/D$(D$D$ |$O|$$lD$D$$$QuFD$ $=D$D$(D$|$ D$D${D$C*$ERD$fD$<$Ƅ$OD$/?D$3D$7D$;D$?D$CD$GfD$KD$MD$NJJUWVSD$L$ Qx 11ۃ $ 9tm€xu 09uߋJuJ u JJL$ $ 9Ju $IT$9Ju $I9Ju $I 9J u1[^_]Ëp ~1ۍxt zt9tʉ|tzuif9juۋRt;Qu뗋JVUWVS4Awn $HD$($TD$ $X|$ 5L$$9$01h @fD$fL$.L$xuD$D$D$ l$D$D$L$ $wxvtn9l$ri4$zfD$V$zt$;$Lu;$PuD$(D$D$$t:l|$$$03u4[^_]ø1UWVS8@Gm $L$PT$$TL$$X|$$ 5D$,0$41u Ef9Q 9Ux(t8T$JfL$ff9t91T$,$43:8[^_]IL$ʃx(uHύT$2T$tl$(iƍ~9|$4$ök $$D$L$D$x 5D$`8$1D$,$RAu $ Mu atPC*pXt$ D$D${$߲t$ $D$D$xD$,$KMu 1$D$Hf9o u1$D$$$D$ t$~tz0 t[DŽ$L$$L$T$ T$$#~ut ЉD$T$D$ 9} fMfu{D$Hf~SU1L$fDŽEDŽzt! JOJOJ O 9uL$f@@E2D$d<D$8D$\C*XD$lG GD$@D$<D$@D$ht$<t$Tx$@<< D$X$T$< ЉD$$*|$||$ $|$x$L$L$ L$$T$L$LL$ l$|$T$$Ѓr6D$|t$`$3>[^_]F$D$DD$xD$0D$@@|$H }l$TE<}<a1L$<L$F}D$ |$D|$D$0D$D$$95>L$\L$D$ D$D$D$$$$T$(L$t$ 4$T$(u a C*PXT$ T$(D$D$|Gl$@E<D$@$@<AD$XD|$l$D$ D$DD$T$0T$T$$讙;D$Dy|$IvT$T$,$<$)D$<D$+vW|t$ D$L@D$~<M<B u/T$LBt%4$^$D$8D$Hsl$|D$8~`!!d t8C*FXD$ D$|;$~$D$D$LD$<$WD$Hri<$#X*t$|t$$L$L$LL$ $T$T$xT$$$Ѓ] t&u64$f4#`t~t$ D$8;C*xX|$ D$D$|$舣|$ $9~D$D$LD$4$uC*FXD$ D$D$}$3Wp`Zvt$\utD$TD$hD$h@<<D$,D$4C*XD$(l$Lx<$!D$D$PD$h@$AsD$,D$D$hD$$*$T$T$D$D$Qgt$pD$T$T$4$3D$pT$t$$D$DD$T$0T$4$D$pT$t$$D$$D$$t$DV9D$$fDŽ$$)f$ftoD$t$$D$dw}<$g |$d6R|$4G<$I D$4#,$efD$D$ 9$*Gt&D$(D$ D$D$|$蚠$f$t$Ht$$$)f$ftAD$t$$D$dw#}lD$$D$0uf90Gu a lC*pXt$ D$D$:|$Ɵt$ $t$ 9~D$l$<$,D$f$f aD$MD$f+$f$$fu"<$)‰f$ff=vD$t$$̎,$fDt$HD$d<|$d8|$ivL$L$,$b|<$:oD$,D$ D$|WЃ\=-Gt#D$ D$'|D$C*FX$3<$HD$d(nDŽ$$T$$t$$xT$hu<$A"hD$,|C*XD$ D$D$|$.C*Xt$ D$"D$T}$t$ $9~D$D$LD$<$d{D$dpw|O<$-K+wwbtW.{D$d wT$,T$T$h${@<$t&{kfffff̀rS[T [D$T$T$ PD$T$L$ HT$PSD$L$\$L$ \$T$ T$ɚ;~ ʚ;XP[VSD$ T$t$$L$\$+L$\$ 9})ʚ;XP[^)XP[^D$T$+D$T$ t ËD$ +D$|øVS C&S t$,D$D$$9uD$D$FD$F [^D$D$$Ax*D$ D$T$ VN [^FF [^S\$ $F؃[SD$T$L$ \$XP[SL$\$Mb)ډӋD$ T$QY[fffffffUWVS(%Q D$T$L$ 5D$$$1ҍw}$lJ]T$$DžƄ$#t$$,I*D$|$ D$D$4$8D$$T$ EDA@tED$D$4$uD$uUDQ@ut$tQEUu tDQ@tt$ t$D$D$l$,$bD5<$ <$1T$$$3:u ([^_]gUWVSD#OP $X$\D$0$h 5D$<$@1ҋD$4D$@D$(}D$8~u F$@C$l|$l$ D$D$(D$4$~L$, @L$41уlD$,.eD$$D$(D$ D$D$D$$dD$$`D$ D$0D$D$4$ FD$4$[T$<$@3:D[^_]Ë$dD$ $`D$D$0D$D$8$D7$lT$D$ T$(T$D$4$z fF |$(D$D$D$T$D$ |$D$4$B AL$,Džt}$\D$4$ZEFtiM fL$4L$0}fUfT$,T$($賽L$4ɉL$|$ T$,҉T$D$}$E<td<trD$4$ZY=$菃4Uff@f.}$d D$4$YD$4$YD$4$Y@dUWVS,æL $@$D$H$TD$ 5D$$(1Et6$PT$$LT$ D$|$ ~$<$WD$ 4$CL$ D=t$|$?D$ D$D$|$'<$$XD$D$D$$PD$ $LD$|$,$?T$$(3 uh,[^_]=w?tp|.uD$ t$|$|$'<$貉D4'v}D$,$WbUWVSVK t$|$l$ D$@ uu[^_]1[^_]UWVSH J $\$`$lD$ 5D$ $D1D$<$CWU1.փu9x.D$$d9L$$$pD$D$D$$hD$$dD$ D$l$<$,L$ $D39\H[^_]D$$D$ D$CD$l$<$~1d9YGtd9GTGDGDDD$0D$$1$pD$D$D$$hD$$dD$ D$l$<$HT$$D$0G $|$0$pt$L$L$$ht$ $dL$D$<$%$pD$D$D$$hD$$dD$ D$l$<$XKGyGDGDiD$0D$(D$8D$,t$<.$pL$L$L$$hL$$dL$ D$l$<$8=tg1ɃWuyt$ D$ T$L$$L$(@zl$UD$D$.D$U t t|$|$ |$KD$ @H$Qt ^Uu4,[^_]ÍE$͎t$ dL$#ʃ ЈdD$ @tdD$ $댍E$r|$ D$ @dD$$KD$ d늹 Qt` EtHE^D$ H@D$ HE $蜍~BD$ @D$ @@D$8$sD$ |$ GD$$D$T$~$gD$$D$D$D$~$D$ HD$ H et( hu D$ `D$ HEuD$ H@uD$ Hatu\|$(tH?.D$,$蹨ƃ>v?t$l$|$($轁Ƅ7T$#D$|D$,$KT$#uO|$(tŃ?.D$,$6ƃ>v?t$l$|$(($:Ƅ7(wT$#D$ D$,$զT$#R D$D$,$諦uD$ HD$aD$,$}D$ `VS 9 D$ t7D$D$$3qD$D$FD$F RfF [^Í$/ UWVSt l9 5ED$p1$tbD$D$ $pD$f3D$ fF|$<$fD$t$<$g|$4$QhFT$p3Uut[^_]Í$/ bPWVS 8 |$x$qLJft/1t$OqDŽ9Ӄ[^_UWVS S8 t$4$dt&tuOxu:<$džt$džf[^_]É$p뼋|TP9ut$p »7 D$tÍO •7 D$t(ÍUWVSt$\$|$ 4$fdž1Ʌ~`1tW{uGt+(khkhk h +(khkhk h 뀃9uN [^_]UWVS 6 $ 5D$8$1D$,$bCEF$uEEE$,$,$fE@$@1Ƅ$fDŽ$5E ddDž`DžDžDžDžfDžD$$ UUPUPUP ǀip6.ǀarpaƀǀ(ip6.ǀ,intD$HdD$t$,$$ u`D$D$4${ƅ_UHuDE` }\D$$< tC1)< t)t 2L$$1Ƀt"9 < t< uuD$4J]D$$D$QD$(D$<$D$D$PD$0,I*D$@l$,D$D$ D$D$D$$kf$<;t<#tĹ<4t$$< <  t$u$< < t$u$  t$ $< t< $(D$,9t$/$< t< T$4$< t< t~< v|$,w`D$T$4$qyƇ_D$ 4$xtL$,QHqDA`!y\1%< t%t21Ƀ9< u܋L$4$< t< t< |$,w`D$T$4$xƇ_D$4${fD$$nl$,D$\T$|$D1D$,L$(hD$DȅL$liD$(H,D$,t$(hD$ȅxSt$,D 3< u t< uD$$D$(H,D$Pt$,D%=t럸D$$%=t=D$$)sl$<L$,DuduKu*uhBff 댃D$D$ $AUWVS4N* |$Ht$Lhl38/ 34/ t?D$<$4/ 8/ FP/ x|$/ L5t$,>t/ / / !6/ / 4D$t/ $/ / 녋D$,8 u9uC*Xp/ / 1wC*t/ p/ ‹t$ |$$p/ D$ D$D$4D$D$,$-V/ / L$/ ht$,+D$L/ / D$8/ D$D0F,i/ FD$HЉD$(/ D$,D$<9l$(D$HT9+T$D$$D$D$ D$$';D$$tD$4$؅@[^_]ËL$O$`D$ D$D$$;]!փ-D$T$$R @[^_]UWVS â |$ wFtD$D$$5FD$<$4 uM1u@t)$Su)<$tO [^_]Ë$(t׽ЋD$$؉ŋ 뉽UWVS l$,T$0t$8|$fL$L$)Ǎl .;L$8 )ЉD$L$ljD$ $ D$89D$|OD$ DT$+T$8T$8\Vff@9tPHftffP9uTFfT.D.\$DfD.D$fD$0h8D$4H1[^_]Ë|$0W D$4D$D$0$t[^_]ljD$UWVS J l$4t$8D$} t+|$tT$Du8ff~fF1 [^_]Ã|$f҉|$E1|$$ 376$[^_]$@‹$@|D$ l$|$D$ D$$$Ht;V t*|$<HpP9uߋ|$L$ ʋD$|L&ΈP9u|$D$ $ӃD$qT$$@$x|T$T@$a|D@D$m]OUWVS4 |$(o ,$SƃD$0P T$L$L$ D$4$QL$ )͉l$D$ $QL$0T$D$,T$4fW81[^_]ø[^_]UWVS,m7 D$\$@D$D@D$ {4D$DHC D$D$(PDBsN|$s 4!Ɖt$$C$D$9Ƌ89t$IS ,9t$119|# 8u-|8 Ou 9~9t$}t$(VDc1  tuхyJ<сy  C t2;s$D$m1;sDbL$;tD~ B9+tD fD$ D$DD$ƉD$$\$z\$DCt@Hl$ MʍL | f\ ]\]f\ ft ffU,[^_]ÍFC$5fD$ffC4=K1,[^_]1S$r|$(wDL$tb+W@L$~UD$1t$(D$$Z1C4s1~ D$|${ tDt$(nDS 9T$$tI|$$Oʅx7x t$ T뷃׃ċD$*D$ D$|$ D$$PDJHDuD$t$t$s HHhD1dS #S$ׅyzl$$UWVS,茳N l$D}t$ 64t$$fAf8LL$ TT$ft$T$HRt$t$Lvt29t$sD$ D$L$D$@$xx/Wft f^ufftL뭉fv ʼnl$D$@$ƅtp@fxv"|$LO|$HWLTP9D$LD$ D$HD$t$D$@$l u ND$@@8D$@$^b,[^_]ø,[^_]ÉŋD$ LD$LPD$H@D9EEL$LT$HsMD$@@8D$L$@A8|$@O(L$IL$@;A4p1,[^_]ÉD$DЋT$l$DL$(L$ LOL$ )f D$T$HD$fL$$*T$LBL$)T$$f D$T$LD$fL$$f7T$L$(f D$fD$L@T$HRDT$)fTOL$fLGMD$@@8D$|$@G8L$LDND$@@8gUWVS蕰W |$l$ E f txҋT@%D9G$~G$OO 4!Ƌ8tCyVy !l$<$tz[^_]1닉UWVSĀ D$ $p uD$ D$$D$$$\$ tD$<D$ D$$D$$$\$ {tD$D|$fD$,D$(D$XD$0D$PD$8T$6)DwfD$6f4‹l$)ʼnl$D$‰T$$\$ D$( T$f+DwfwffTlwfT$6D$(9f|wwD$P͉L$)Ӊ\$T\$D$$$\$ _;$3TwD$Xw)ЉD$\L$0T$8D$$fD$,lw9pf+T$,fҍDt$6)fLWftGD$<`D$D`1[^_]l$6D$,D$LD$fa\$$9vfL$;D$$5T>f+T$L$L$D$ D$‰T$$\$ VL$L$ )L$$T$fT>fD>|$f)|FfTFuM\F{T$$>l$@ɉ9v9T$lF)|$D$ D$L$$\$ Xf,^f\DL$)f flFDT$)uql$@fM1([^_]|$qI\F{D$H\$$;XfD>([^_]ËL$H9Q+#T$fD$@D$D$<$\$ D$@t|$ pH|FOT$1UWVSߤ D$D$0@Pt$0D$1ˍzfvnDHND$ t$D$D$,$|$iƅtl$D$,$ FPL$tft+ˍzfwfuf|HuD$wˉT$0zD$0@fD$,@ T$0RT$T ۍL_=)ffDWD$0T$Pt$D$,$|$t9tl$D$,$D$,h81[^_]DHfGfGFBY[^_]ø)ffDGT$0D$BtUWVS' l$4}D$0p uT$8 )9t$@f|L$@L$T$l$ZT[^_]ø~D$D$lD$4$8@fD$fD$D$D$ D$u^j/VEZYtp ut0MPVWZYMu}] EEAe[^_]VhshshpD*:UWVS u] 3Yh{SV" tfu5J*ۋ=0=*)uuy=J*u h{VZtJ* J*{hj5J*.J* @u5J*h{jPh"4Xu&h{jfPMWRU@ZYMtFUk xuSEHPWxP0Rh|jOUWVS] 3h8 jh8 Su@t h0=*DP螤DK*Yu DK*"HK*TK*~5TK*~jjPHK* y 5DK* K* K*I=P)v@K*u h5jOK*u#K*K*K*~K*~K*%H%hPRrK* y<K*%H%hP5K*K*PK* K* =K*y5K*h9e"jN`K*`K*XK*u-xK*u8K*H躥 K*uj`K*J8K*K*=K*9=r;0s4011RP,(Ɖ׋110Nj,lj(Ƌׅt]CS(,01;w.r;0s$011RP,(\10Kc$ WVRPôSh'(P00h:'=8L*tYCKcʹA#yC,(ʹ? [C$ ʹ? =KL*0tQ19wFr;0s<011RP$ ? $/10$ $$tO019w>r;0s4011RP,(Ɖ׋110Nj,lj(Ƌׅt]CS01;w.r;0s$011RP!10Kc$ WVRPhB%\ t+j,(j@8PFtPhWw%Y^=4L*tUC0S4Ɖ+s8{< u\ uXjRPWVj@8PsPsQ*SPP߽à y =M*th@N*h\!hpD*$ Q*u @yPh9e""Y[hD*_ua=P*=M*hpD*hv[_h$#Z f%C*P*OP*| hYf%C*&tt CjP*hpD*hva_XhS$Zr=M*ujpjn[uh@N*5Q*hhpD*G#h@N*h\!hpD*.# hpD*hvXZjYX=M*ujh@N*5Q*hhpD*"UWVSXu} 7h }ZYu fu5hWV @utt 0=*)NvEU1эAE1@tAG;EvEPQMRU UuMt6QRh j"8빅u Rh/BE@t1j URPE ;F|E8tEphCj7E1~PS\YXF=m8@w{=m=m=mF dUuIfEERUhmW|` UWEffEERhm+fEEERhmW9` 1!EPhm8@W` x E 6Shyd j6f9tfuPhUEPshrKU K U uuuuuh$uuuuuhuhЏ uhXZQURPWC_ x%uShw ,URPW_ ySh9e"j5PhjjUWVSlu EE1ۃ}~F8-tEh62_thHPZYu Q*hL_thHPXZYu hVo_jhHhLaEEP1u hr0EYt/4 }4}6EeEKQ}eG}l5E0}w&}punh55EXZEE5EE0=*0=*}uC0=*Eu0=*E8tj@ulZYt}u U9sUPUxt}uEEU1ۃ1:t ˃SJV_$EEt2U)RPS1э\ Ext CE}u"hh"胚EZYu hÑ5}uEEuhQ*VuuEpEP`u] yj=Q*y hޑ}tLjuVjhSly h跷_jVjh5Q*ly h萷^hjuVjpSXljVjw5Q*El,uzBEEEEY1ؐH>v  DGu΍EPEPj =Q*u*1}tEIjEP4ؐ$@ Gu؃}uӨEy hZ j1Vh~f5Q*Vh~fSSMUE}u j uXZjUE 0}|jxU]f UVSEU kJ g*ueE1ۋ4HVh uUw D*H D*Y^yhD*j XZD*PD* Cu w1e[^]ÍL$qUWVSQpqT*X*\*`*h*t*P*p*d*L*DžDžDžDžhoV\ @2aBT2h&0J1I)눃3BAI)E#F<*1SRT5x*rOf8b}cIi1ۃl_u0s;t~1w] zv )H)9)*L*jP55) :u55h׾P*`*t*\*l*h0 uh*^d*SX*=5j/WY[ÅtC?t t1w@tj/SI_ZDžtG;t tv@tj/WZYtA?t,tv@Utt9k`T*Ph@*hD*hH*h55l\u5<t h=H*H*Ph*Ph*h$55\~!5<u**9v h.e*=5j/WY[t4PW5x_Zu!%=@u5)?5plk*p*))5|*55*[@hK55)Y= PhWj)uJߋ=0=*)x*tP*Zu hM=`*t2=t*u$=p*u=h*u=\*u =X*tt\*=P*t th/X*t=h*t u hͿt=)uhbatKu )j=<*uaDžtDžxjjVjjtSk@t,LYtjjVPjSE@t=)=<*u4P5).v_Zu%=u <*=P*u=t*u=p*u h*1ۅt=|*)=<*uRjhh`g*PRf)y'b8uh`g*hat*]N219u9tP*믃=h*u=t*u=p*u =P*=\*u^h1^=h*t=*u =*t h[h_gYtM*r*r2*r~ hZNZ*r~ hANXij[hjZË1ƃu h *11lj9*vGPP\ZYx+=w;uv *=**5*b1eY[^_]aUWVS] DžDžDžDžhSuf rfq1ŃstwDž<j P55i5 8uPh1:u8"XK55hjmDž*Dž0=*=P*j/W芵YZu]Whhhh`*{xPh`*Y@u"5P*hh :#hh`*EP*`*=*hj5P*藦à 0tPyphh5P*pà x29=H*~hPSͤG jjjS!y 0;P5P*hyd j5P*XZy 0;P5P*hyd WxPWsZYy x0;P5P*hyd $%= tn=t5P*hY^hk3#PA;XZDu DžDD1RP<=d*uFd*PLP5d*W5P*K:@u5P*hj2 u6h>YX4u8hk3#R$YZ$tRhk3#6hDu TDDС)HtH*1DH*5H*4t(hk3#P9XZt6%t!;wr;s @u"w=w Dž@ Dž@@w=v*@ u!wv hjh&B^. u Dž<jh V. u Dž<jh6 V. t <~ Dž~h ~Phr ~(Ah h  h H;$ *j P55{<+ :t55h h W55|+Zu55h  *Q*B52 )#*tRPh( j+*)*hb` 55I*Y^55hQ jj P55z) :t55h_ jphy ;+Z*K*<*u h jH50=*=*u )y`),t1MPRUZY UMu܃ SEPQj`)tRPh= j= UWVS`u] 3萖#_tFjPhJZ jkSd5Db54,h]Z SV膶 uft|hrnpP,TxzvD,X,u`,fp,Wl,Hd,9\,*h,L, H,0=*)Ѕ=X,t=l,u=h,u h,=p,t=\,thkZ $Y=l,t,=h,t#m=P,t%PhZ $$EEPphZ S u*,,EUx,|,1;+u[CK,I*DJP4k<,,EUx,|,YUʋ=,I*DOt Fu*:3#VVVF͈UhZ ;EPuߊU҉XZ $W S0k KDЃD8d30k SDkd-lFSK0k [LȉFڍZ0k RDωF0k SDЉF 0k SDЉF0k SDЉFVbx,|,_u uI+EU,,y hZ jE@hmA!P[^u ExtY]@,;t<1эy)v)@,9tJ W3QM,hM9 f E@,hC*h?,)PS܁t!;t >,sC>,uf>, @,1HT,, ,thx,fPhZ + hZ ҀY@,ugP`Z!t@,jjj =`,u6-_uhZ j0tPhZ j"j jh =,| =,,w 裾1=,,E|v`sP萘XX bX U;S}9r)Mt?jjs s4zEEE9U|9v Uu'_Su{|;,w sYC tø8Z =h,u!=l,tEZ =P,t)Z h@,5@,Ph [ jj蛗h[ ~=d,th>[ ~j7=p,t3hhhb[ :à xjhl[ P~Sh[ ~j:h[ ُjh[ v~=h,u=l,EEZ ?Z  E8Z 2Z E=D,t E[ E=L,t [ =H,t [ =X,t ?=\,t !=P,t !J;" 4,PtPHhY sjEPS¿0Sh[ ju访0Sh[ i$ jj#XZj躻UWVS@u} E@h<\ WVA tgmt>ht*lt-Hu^΃st%tt3nuGE북뮀π멀55荗)Y둡5)녋0=*)Ht4jVh tVhh :#j h,,jV}XZy Vh9e"jX ]EEEfE5)]SSjWf yhF\ ^jhyt W y/8thP\ 95)hCt W± yhY\ }tjjUZYt hd\ jEEEEEP{XUWVS8]u E6*XhKi VSo ety3atgAtUMh,ăbt{d ,뮃qtZftGn,둃wtSxtYruy<,u,jЫ) [5$,l,D,9 ,.d,#0=*)Ӄ=d,t=,te=,u =,t =l,u,u=h,E= ,8#=$,u ,U,,hXUu hYi j=,tEPWjj11ҍE1$,tlhZ PY[u5$,h9e"jz,jjh,jVfGÃt;tM;S ZVmX"4~FM K1=,ث)D*e[^_]UWVSQE p/-EX /-h L_t8t  /-[hUtPtv_Zu ,jA/-RN,x,ۨx/-1эD Y9s x/tHhUtPvY_u "-譶ʱ ="-u PZKZt@PP'_X0+u+zt%~KhA#WuZYtW_ u t ="-tt /-h J$/-Yt8u#h J$/-Zt8u $/-d!h J/-_t8u /- 1҃= /-tIjh! wiXY7U6YXUu>RWQijhEW7 KUŃ=/-u<iu+UOUOjUY=,t =0-u=,ujh8 読XZǔjj^_=!-uhmA!5l)sY[uWh~jhb ZjJ5!-=ZtjG4/-/-Bu@t桴/-/-)hu6TTu2jUWVS]u 6=<8-2|9-<8-9-nXh P)s u08-VSM[^~jݗY1u!h< j0|59~!vu+88-hc VS @u k |Љ=8-vhP [XZʡ0=*)Kutp,I*DPua1Ivhho  hSh@:- ;tC9-@:-58-h j ]S>hp\j詍hp\j蝍hp\j葍hp\j腍 S*^u hd j@uhs jhD*Yh P4:- u 4:-)h,= Y[=9-t"5)Yt5)h jMt Ph j=9-u5)wZu€=9-t8jj5,9-[u y h /Pj5,9-9u xh@9-jF9-@9- 󥾀9-%9-%9-%9-f9-`8- f9-9-dh8-h 8-h9-h:j# =08-u/ Ph9e"Q48-^_H;f=)t j̊[fE8,)ut6E؋08-u tb8)u1f=))< t< u>jEP5,9-y f=)t<[ } t8 Pqbut8L)uEE5)P+ZYf=)tCۡ,I*t $I*fEjEP5,9- f=)EP~Xhh jUWVS E 0蚁@;-V1P;-;-h 0_Z ]b58jRP :1ҋ @;-bT<-X<- @;-h u u:à fvoRmu8, 5\ BScthe @;-닃nu @;-vtvW @;-X55h `<-d<-/ @;-) @;-5u#h/ h hR @;-h> SkY^4>hB VX_Zú :mSWVW u <n̋55uh ht h:h 81k$<-t!VPrlYZuà<-H;-?Gh Vh j$=0=*u)@;- uj ~Ѓ=D;-u,PyZ@u h j, f @;-D;-ZӉƒ!t~ t%Ft!áD;-0Rh4 U  sD;-0hT 6_X sD;-0hu Y^t Sh XZj uh tth  jE ~C\<-3hRfVǃ u R3hyd kPhP{ uL;-@;-t B!1 j#h<-hRPnP;- uW5L;-h jthT;-P萏Y_@u5L;-h> H;-t*h@;-PZH;-05L;-hY j=\<-t|H;-<-H;-8uH;-8u^5L;-h| Jh@;-P_u܃H;-$ɡ;-%=D;-B=@t{sh jq=D;-uh h htwhjsl;- u sh h;-PmZY@fsh 5;-m;-_ sh& hC;-@;-5L;-hB >H;-ZYtpp 0h[ ! @;-uB;-%8 =@u  u;-u RPh Ը \<-t Ph 轸_X@;-D;-th@;-P [ 8th@;-PY #Nu@u h jh@;-PZ? u Rh Y\;-%=u5P;-k_@u5L;-h @i5P;-Fl^@u 5L;-h+ ;-tP%l[@u5;-hD jjKh+#V͠ZYVPhc  %@;- B@;-Ju8=WhE  8=tWhg  Y[뺉th+#V[[ZËttu{91эYVJYh1 jPV< 9w! t,u< QWh 6VS2h UWVS}u 1ۃ~^;-t0=*1Dž8Dž<Dž4h# VW t5it Dž4 )|:9;B 8uGd$1jSVxCtjjjIǃuhi$VhiPF @u h; jMWi^ )7tyFtmNta}HuTItBQāY.0Q6Z0u hJ j댃끃<t@4t8tjUBu 5BpPrSh<"h  Riuuߋ5>ouDž<*DnDž8US] 3vh8 j h Su 6lDbBjj55qU@-뮃etwfA-뗃tntzs@-ouv@-N@- A-5@-A-A- @-@-@-jhD*PYXGPh hpD*q 0=*=A-tBEEEEEEPj jf @u hjN= A-u-=A-u$=@-u=@-u=@-u =@-tSLSXhD*6Zu@-]UWVSE 0th8 j 1DžtDždDžp11jh`)h| u uf2LtWtZH1ۿ봃RtNXtvPtur}bhtN|[oPPBj55aDžpRDždCDžt4 0=*lM lL9-uQ9uyu lJ0=*0=*U)tuJupt3tt h jADžlpt1)ttDžlDžlpM u0ShSzuXDž`hu4Sh xPVUZY@u Vh jE`1jWR诇h 1ۅuh thXGHHf wa$ puNjWh ;w Pwhyd w iPwhyd J`tGPpV=hQ.u =Q.tDžt %=@Džt1:t&OOv:π?/uj|Vȁp 1Džx9pXqFHft%wfu8vh ![^aftf uv Pvhyd :t;=)F,-)=~ TVh)h  ]NF(l~DugxttXj/QhZYDžxht )@xh` xȉhPXZYhuxxȋl+x8/t /t/Gс)vPh)h -RlPWLGl׉=) )=)vx/uP)@߃=Q.xt Ph) Ph)[Y_VP@xz9|uW;uSEz9}uH;B uCvh)h DFP@% =@jVp=B%=@t,M1@uvh)hD 1z@tjw t,`fu|u|t~DuPVj_Zm$PV NH=hQ.u2=Q.u)fIuvhx 3Y[jVp fuX A-Q A-@A-Uh h h6nU@\Bfug=Q.u* A-P A-@A-y+h h h?jR!ZYu5h ^tiFPph)]_X1Svh CZY8=hQ.PR=hQ.PRR=dQ.h)vh若 y]8t h jpqSΞxAUWVS|]u >j/WYZtxh$WT_ZuZh8 VSȇ @u|0=*)Ãupp0ZY[@u jj膽jLHFu>Q.hk VSn htz~ǃs9itwntc.PtJfuQ.Q.Q.띃vtfwuQ.Q.xQ.iQ.ZQ.Q.AQ.2Q.#0=*4)ËQ.-Q.u Q.=Q.u=Q.uQ.Q.ttu#ww#V1ɋ+P\=Q.xt)WS YZuE%=u WS7 XZt Sh9e"j諻E%=@g9t ǃWCU]3(UWVSu 6eh8 jj~ЉÁtDžlh #Vu1 tVmtpuoDžl55cgYu55h jںhPftW7 딡0=*p8th1m;lh VCPYZh VĊYZh V%PYZtthdPSYZdx0tupplc)dxPSTYZcyd=E%=@t !t/tSX^Z@lSh9e" ?Y[lTtS^Zx,t2tp0_XY[@p0h9e">XZWՙUWVSu] 3bh8 j h SV tGit vt1fuHpR.tR.tR.pR.lR.륡0=*)ƉlNt94j4thR.h?jjl\tP3hu|%=@tluVb:Ph3W葉p =v3h j謷pdpt/t@dpƄ/p$QRdZ79 ulltm1э\ ;/u 9t KCj/SY_څtP1ыpD=vSh XZDžhhƗUWVS@] 3`h/pD*SuG]SjB6uEUEUSjY^Sj6_ZuEUEUSjY^Sj5_ZuEUEUSj_Y^Sj5_ZuEUEUSj;[^h!td/$/(/,/0/$/P]E}ȹEA uVSjxVSj x"}ujVj y}tVSj xjVjv y}tVSj[ xjVjH y{}tVSj0 xjVj yP}tEVSj y1jVj yVSj xy eh!0j Jjhww#6O)ZYy ֏h>!0jP/ ~\@hrXt>u1ЍXtC|/uCP[l/_uhd!jmP/ZYtlj؍Pt//h@.9hjdf )tJ HuL^Jt u;e9=L.t h!j裳c= )u )ye\t P/P/e[^_]UWVSu} 7]h8 j 1h1b"WVC} tLtPu޻950=*thY0!{qY8/u|h!P3$_Zukh!S"$Y^uZPS,_Z@tHxPhww#Y^@t2|9u;xuM9 u;Etjj6XZu jjNSVKj UWVS]u 6[h8 j// DžphF!VS| ft{:RP/Wt|d/맃rtqi//끃vt-xum/h//O/@/1Džp"0=*)Å=/0"h`o jsc^_Džt1эD H>9v 8/uj/WhZYtx?.uCGt <.u8u2txu hP!X/Pttti;jl/^ph5/u=/utp1=/t =/t@jPSnǃ uhp!C =/t.u)W#sXCHHf $!Pis Pshyd jK=/tC ?utu)CSHfffs gPshyd /F=/9KPSCP#jSWrwC C C  CS=/RKPCO?P|PJYq=/F虉8\=/us#Zu?1Ptx=/W8]I8?O;8<(8t h jWAp[=/tQ8u3sxWVZYt3=/tEL8?t趈8tVh9e"3N=/t"jPVhyd /끋E%=@u%=/uVh!/^_M=/u=uE%=uV0I2 Nu=@uV轾=/uVYta(Ot=/uVh9e"2/XZ+誇8蜇8?莇8u=/wV@EYk5/sh9e"1/XZI=/u =/3/sDX1e[^_]UVS@jj<^XZEEEEjEPjD >G09u 219ˆЃE /j juF[^/H /h8 jXZh8!i)E$ /mNY/tt6Hu=/1& / / /E ///t.U=v)v= /i`=/tEPUX//tA:()HyP^()H J hD)[EHuye/ /*% / /jEP+Xu ukXZ}uvE t18-u,Eh8!E^E= /u WEuE=v)uEjY=v),<= /uwhdO[ud /jh8!PjÃP譃$&Yu=)uL= /uCEP7$8!Zu EP蹆X8tEP$MXE/=)t = /t1j4L! ^XCuEP[ /)u=)RP%ZYރ= /)/5/htY w$D)XUWVSpE 0Qh8 jE4=* 10=*] ;E:hQ!Wc=ZYƒ1I9uphQ!Suq tZetK auN뤃ft gu=j55AE[_y55h9e"j$]0=*E }WhBt @uu yhQ!]Su+cZYy hQ!jҦEPhht@uu y h)Q!A,XEPht@uu y h4Q!,XtsE 8uVWuEPSSQYEEE 8URU} W^ZURWZYuURW^_uoE 8,I*DPt"WYPSJWSJE9jh?Q!Wu uWSEZYWh6N!G#E B}tSju y hF\ }t#EPhgtuDt y hEQ!*XjUWVSE 0Nh8 j>!/ xo/1Džh1DžlDžt11ۉpjh)hR!u u8gptyPtHtWLt^Hux5빃ft)RudDžt롃ht vuNDžhDžl|r1fZ0=*M)tuIu<"tt$ۃtt h%R!jԣۃu 4//=/j:QpLZYpt@j j55]ƃ u{8"u 55hd!D5D/j j55"ƃ t 5H/z8"u55hd!jsj j55ƃ uz8"t5 /55hd!뺸o55͟^@jbST/R@/C@/4`/%P/t9t  /v jh$e!uhBe! </tt hve!j/D2/0/ƃ;5@/u;;D/u.4/;H/u1/9wu ))d/h/5T/t6Pu=\/ۃ0=*M)L„t =X/<1jhh`2/P7APy h`2/=h/u>xPPVYZYu&%=ud/h/w.$t u>1:u4U1ۃ jj@QMQMCMQh9e"O~UB띅u) D*yhD*j iXZD*PD* 1e[^_]UWVS ƅY-ƅ[^Zuh7s!SH5;/t)TW6,ZYTu FvӉ;/=hV!衿_.M/"M/BN/-AN/M/M/@N/M/Pjhjjj j55pCM/ 6Pjhjjj j558CM/ e55h2$igu ƀ`N/lt[Lt>at/C#)stAmwtcz ))))))`)))=0=*=BN/u u =M/t7)jm Y=@N/ =N/=BN/u u =M/tjL} ZBN/tM/ttDž PPtSVE PE)P9)qƅuh !h!PS) @u hg!t*HkttVPAY_uh !ht!GSSvXZuW-Y@u h !h!SZuh !h!j˂Wi Yuh !h!j脂@ uh!h !h(VSй%1󫍅Ph!Sqtghy#S/_Zuhr!h!hsPH^vp󤍅PhiS0 @u h!Xh!SY_t\PZ th!h!hgh!`LVe󥍅Phui S/@u h!XSjObUjmZt h!jjh hM/hM/ Uh)hN/yhN/h hN/|h h N/{hN/ h N/XUh`)h N/%h N/Sh h0N/(h h(N/'h0N/e h(N/uXUVS8ny h!Yhx=#eZy h*!Xjh!l[^]uYjj1hL55XPO/DžH0=*)ÍTH bƅ~h/!W ZYt"hWu ZYthr!Wd Y_uLv3=_ZuF .#2u>h3"W, ZYu%F2\u vh>"yWhPoƒ uPh9e",NFjjDWv XPj5Hj\PvW[_1ۅu?hV"jtiL\P7h3"W YZu=uT/\u/\tӋ\N^v TWhP ljjjVXPT‰T0hPà $LEh"T0d _ZthpD*h"vTY^aT"jSb XZunM8t Shs!jqhSVECj/VXtP19sAIrjV _XhN/hzd@V;@ uV ^pO/n\PhedAV@ @u V YHV 1DZax(9}Xl< w 4"u@"THjjjjXPډO1Ã؍e[^_]US] 3QSu[:US] 3:Su&/|=?w $Q/$|=w $Q/ $Q/@Q/9$Q/Q$Q/Dt  Q/$Q/ Q/#t$Q/=hPh " =Q/t Q/=~hPh "軚 =Q/u= Q/Q/=pQ/u $Q/pQ/=(),=Q/t#jh5!"hR!"hz!"WQ/=lQ/u Q/=,)lQ/Wpgt(9uXXu݃=DQ/@Spn_Xtth"aj @Ph!"jdWEpj:j3j,h s`Q/XQ/@Q/ jx|PQ/@PSh"q@:0Vh!"jdWBEj@PS y Sh"jX_WPZYu1jZSP4. uh"PZYjPV u h j 19iuąLP̎PSh!"jL^h!"j @^0?UWVSX ]Z0DžDžDžDžh/"u S,( @Z:Nw,FIDSbVOjjjjj5^!))mQfqibTjjhjh5#"腐U/svnjjhjj5"7 Z0{DžjP55ef) :uPfVPh."dZ0=Z04Z0%jjhjh5""藏Z0P55h_"j[jjjjj5 XZ0jjhjh5R".U/ujjhjj5$" Z0Qjjjcjj5$")0Phjhj5"轎Z0Z05U/8h."DžDž0=*)Ӄ=Z0u Z0Kt1󫍵p4E =Z0u Z01=Z0u =Z0| =Z0vhP @uh"SVY[@uh"=Z0/jhhU/j yhU/h"S_Z@t=Z0jjhU/" yhU/h?"SjPE<[^uhU/hR".DžU/jhU/h( u DžU/OxxjVhM( u ƃrVZYtVRZYuôShU/ha"ô녍pPPjhU/q@uhU/h-"f=Z0uZ0u hu"j#Xt] uhU/h"u7h_-# P[^DžU/t hhU/h+"jWDžU/t(Z01RP5Z05Z0=Z0Z05Z0=Z0i|wbLP t Z01SQRP 5Z0=Z0=Z0| =Z0w h"t7Z0Z09wr9sSQRPh"jVtTUZ0 Z0%Z0RPC @u5Z05Z0h "jV@P\ZY@uh+ "_X LSj+}Y^u Sh? "j%VZ0 Z0%Z0Ɖσ=Z0~SWPhY "G=~A؋9|9vP u h "jU)|wZU/Z0Z0Z0=U/uft U/h@11;|;v U/+ 11;|;wU/ U/u U/= Z0 Z0t1RP8 Z01SQRP@11;|;v( 11;|;v Z0ˏ9t tWvXj4L$qUWVSQLyEƅjjjLd1 yh|9"CjjjHd1 xjPZY@u h9"^cPd[@u h9"jOS7 YDž`DžX1h:"WL. -C4$x4" \d1jEP55 U:u 55h9"qb0됁 \d1넃 Xd1x \d1l0=*p_EP55C;hb0XZE8u r55h9"jR@B"ٞPP$h9"jQjEP55 U:uy 55h :"릣|b0 \d1 \d1\d1t h':"@\d15Pd1z\d1@u \d1e \d1Y \d1M Xd1AjEP55"à E8uy55hE:"ha:"jP \d1 \d1 \d1@jEP55g2` E8u`55hz:"hjEP55o U:u Pv55h:"1L \d1jjd15 ! \d1 jj(d15:"YXEP5588b0XZE8u55h:"DžX\d1hb0ݝ(zuu8B"hb0t!ݝPR_݅Pt h:"]hb0v(_t h;";=|b0~ _t h1;"ٽzfz fxhb0٭x߽d٭zdhXb0\b0PT߭P-hb0B"٭x۝P٭zP `b0 ݝuPu hM;"z\d1%=u hs;"*Xb0t |b0b0 b0LHu 90=*t 9}hhb18d18  - b0ݝp݅p݅=(b0ݝ Dž8Dž<" B"ݝ8Dž Dž$h,b0j"_X݅(݅ zt,-,b0ݝp݅p݅=4b0ܭ ݝ8b09xb0݅(݅8vp,b0b0*B"s=@)t#\d1t誣,b0b0v݅8ٞvs݅8iPb0B"hb0vݝXb0,b0菚݅X݅8vr jݝXLd1EfEjhc1jp @݅Xu h!=" B"ٽzfz fx٭x۝l٭zlPjEPA (S !8E 腞h1#EEPuVj5`d15dd15Ld1XÃy3z!8 2h<="hpD* [^ h,b0jdd14DZY93\d1 ҝu褶PShE="-l +DL4DXX@;tb0, xb0HfXf9Gu @)a0,b0a0a0 a0ua0pb0\d1DžPDžT sCX@`X@ P`ȉEEPiE'%UtXp Ua0谗ݕPHb0Hb0݅P@b0@b0݅PH)vH)Pb0݅PٞvPb0؋Xf@ffd1!Hthd1 pb0DžHffd1b0@Dž`94xXf@f`fuETPWH‹L4b0P)؃t0(u\Td1Dž`ub\d1t@Td1hj=")Td1Dž` u7\d1 t Td1h="+*XRSh="* Dž`HukXf@f@ff8)f~8\d1t1KQBRPh=")\d1t 1uf8)\d1u[`uR4pXf@fuTPVH‹LҢDž`5d1F9L\d1d1)P$c0PXDP ; i9~X$c08DuC`uO4xXf@f`fuTPWH‹L XDP$c0P+d1Sh>"L(d1;d1}+u hr",(XXDPh!(C^_Dž`<$L5"jLXϠ[.X@<$5"hP>"Ihl>"?h>"5h>"+Xf@fPh>"h>"h?"h?"h1?"hK?"ha?"hx?"h?"h?"h?"h?"Ph?"jLXݟY<h@"&LXbjLX衟ZXPtrt u"hU@" h@"h"@"m&Xh0@"Rhw@"X&^_X譕Ph@"2jLX"[Xf@fX@fRPh@"% jLXϞY.h@"jLX詞Zh@"jLX胞_XPЄt uhA"h@"]%^ Rh#A"O%Y[LXݒ%jLXZ{X@Ph?A"%LX薒_XjLXӝ^2hcA"jLX譝[ hmA"jLX臝Yh}A"gjLXdZh#DjLXA_hA"!jLX^}hA"$[DžPDžTDž`qjLXלY6XPhA"#XZDžPDžTDž`\d1HtLXDžH4XD<^<<Dp{C@IG`hA"#s\Xǒ9u@\kD: +ˍC@CDw{09~00X`;a0uSSha0@4 u;`t hA"H"X0H)ƉD@7a0a0Nj@󤃽`u!蠒hA"!XDž` hA"!_@0t8)葑.0@\kDDD 붃`hA"c!^w`uR4xXf@fu蹪TPWH‹L訚Dž`PhA" ZY DžDDNC@D@Z`t hD*BX虔pb0;b0]d1)Ѓ EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh;"RiƋd1d1H19}L$c0@91B\d1h<"_9~d1$c0Ph@ CZYj XzUWVS} cÀ8-uChEZ S^Zu&l1EEE'h)Z SZY1ۅul1ŀhB"Wu t[dw<$HB"Eσ=l1t 뾁북뮁OEE돡0=*1;EtcE11 Mwt}э|VWZXEtPVhH$VED>mtj3gPh9e"j6}tVSh8Z j6}DžucFP\3_!t8=l1tj jhEZ gWhB"=l1t j jh)Z fWhB"jPg8j jh8Z f tVWhC"j(gWh!C"jg h8 hh hjjh8 hh  h }ujjYjjPjjGjj> jj2jj )jje@u h0C"j5jjJZY@u8th=C"=j X}u!j_j j ZY@uq8t+hSC"輺Y2 u hiC"nZ WXVS hC"芺 (01ejj 8 @uB"SRh :#j4UWVSDu] ]&Wa^ha$svZYjjp fMS~1Tdu8s1hG"SVY uLuLs1փstYnt7qup1빃ttZvvp1p1p1p1xDs1i@s1Zp1K0=*)ƍîp1=p1tjjhW$# jjj"誮 p1 = p1y hi$jF3;u=p1  WZt1t*t% ) /  =p1t1ɉڸcEhjYE؉EhjYE܉EhjYEȉEhj~YEĉE hjiYEEhjWYljEhjFYEMU у} у} ʃ} ʅuu hԟ Ep18gtj5 p1uY_EEE8 E8 FEą$CE{?-LGWnZP3 $l#g p1FHw,=p1uhL"hM"h>l#og p1SEP1ɸ͙_]up1Ã]uh+M"1];au uhMM" p1Hs1t]ĉ]thkM"j%-MȃMu}t EȃE]=p1uMEĉEPE0?p11atctguEEp1Ep1p1l1@l1p1p1p1p1@p1p1p1u8q1p1tu9sHxt)tŋU؊JwuD T 9sJU L }؍W9vIH }tHpVWh8q1蚫8q1 =p1t=Ds1u M"貍p1tG}tHPRUWVIUփ =p1t=Ds1u M"bp1tG}tHPRUWVUփ =p1t=Ds1u M"p1tG}tHPRUWV詪Uփ =p1t=Ds1u M"Œp1tG}tHPRUWVYUփ =p1t=Ds1u M"rp1 tG}tHPRUWV Uփ =p1t=Ds1u M""p1f5p1=p1t!=Ds1u=p1t菎p1I=8s1Vhp15 p1ǃ 87tCPh3L";cXZ83u =p1tH8tupds1t&h!S9^_thT"S(ZYt2=ds1u)U Ps1|ujNuShU"hpD*Sh9U"hpD*j=ts1u,ts1hOU"u V A9v蟢$TQ"=ts1uts1뽃=ts1uts1먃=ts1uts1듃=ts1uts1{=ts1uts1 c\s1Tps1Els16ps1'=ts1<ts1@ ps1Ts1Xs1hs155BPs1X=ts1ts1=ts1ts1=ds15ds1h.#PY_Z`s1K=ts1`ts1/=ts1C0=*E+EtH-:u =hs1=\s1t =Xs15ds1tEt h!VPYZt&hT"V?YZth.#V.^ZE U;  OPs1btW8 @5ls1jj5hs15ps15Ps1uag5ls1jj5hs15ps15Ps1辥>5Ps1Sj3 #Sh9e"j>#股!=`s1/jEPjQ3 @u heU"{EUuuhU"ܻ[h`RPWhU" t S豻YxE  1SQ%RPhU" G1=`s1t[5phd.#V1_Zt2h-T"V ZYt!ujShU"n j ShU"_ jUWVS] 1h0X"Su tRtfu"s1Ծ͡0=*1;Eu ޫtue[^_]UWVS`$h8 j>Q_XE 0%1 1]"h1z"@1$z"Zt@1 @1z"D11 11`11<1T11P1,1H1 1$1111118111111`1hz"^t/hPh`1 =vj?/P$Shz",ʼn1hM[1u 1h {"/Yhg"PO_Zu 1h(~#SzOY^u1`1QhM"SSO_Zu 14h.#S6OY^u1`1 Sh{"XXZ$h8{"Pݵ^_u1`1h{"S趵ZYu 1h={"<_1t8u 18 =1t18uhG{""X^1hHl#[th PXpp851UWVS] 3ih8 jjB1 1hw"Su fyIEfaeT2=51P薴55PcBhtY W踷#bnitxlrtu1"5u8 1 2251蝬5u8 1 2jjjhD*Bh"/2jjjhD*NBlhА"~X\PPh"hpD*j0=* 52ut ث6;tt1>j52hD* t hjW5$2UWVSPE11hے"u u= t4gt$utGu45E8 5;u=5?50=*E)t3S Zt@E'UMM@uSh"jvEEt EE}t,h8 h8 h8 hr#j+PtPh Y@uhPT#hr#|_XZ[PuhPT#hr#ShjhPU#PY@uhPT#hr#k@PPY^_@uhPT#hr#ESfY@@0=*;Et(tR})WPSfj, Zt @S0=*t4Pb_Xhj#Y^u hPT#U0=*;Etj+t4W ;SKtJHCf~uHfDž~t61156f~f~f~f~;f~uS9Z@؉f~ 1f~uS_@މptlt r0=*t4d*h^hujM*h[htOhr#\tuS*S,~h s#H\Y1hPT#h(s##8thPT#h9s#\XZxLS@OƍxXVlhJs# \xVXÃtvxt#xt8t hfs#&\Xv8thN![_PXxxxxVhys#Y[DžDžDž_XdjPaP1N @OuVhs#Z[xSUXhhs#GY[@u!8ths#hPT#hs#Z hhs#F_Z@u!Y8ths#hPT#hs#Z SN^t5uhPT#hs#SPhs#Z xt$jP.'ZY@uhPT#ht#CZ_Xht#Yƒ@^8  tn#8 tn#!n#r0=*tQRPh$% t =uSaY@uhPT#hGm#ur Sh4PMPS\a 1ۅu2hPT#hr#j44Pn]_Ztx tC940h0t#XY^֋t x tI@ % hSt#PWXZuhmt#XXt{ ttUV7[ፅPV(] @u 1V2_1ۅl{ u [u#.t{Dtۿԋs Ity t󋉰uGul11s7r1 ht#PTVV1 1ۅ+|&v@tVh{SQjPNV踑Y^Pt { tShʂjjjPN[֍@RPSXZDžyhPT#ht#V_XtPU^V&Y@uhPT#ht#VXZt=t HxtyzP P"WXR Dž_VːTZYtP誺_X`V觝4tjPPvJ4諏VVD*V[PQ @tu ht#TUYVKZtS辧xD1؋}3= 5tme[^_]ÍL$qUWVSQ@ YDž,21 2DžDžDžDžDžhٮ#S#ƃ SH0X$# 4% 455f021ɊStMCt< AuI@WGt:Lt+8gt. atct%ltst'" f02FDž(j (P55Ɖ,P 8u!58t(8u 9,h#pj (P55z ~5:t (:t55h#2 4@sDth8#jG 4jhD*3*3*3*Y^5 4j (P55y3*5 :t (9t RhX#j@=Rhl#塈5 4 (P55_5_Z8t(:t Pv)ݝ݅tj Ph#@B"ٞv55h­#;ٽf f٭߽٭ 53*=3*߭ B"٭۝٭3*xy55h# u=hح#)3*^ 4?th#j (P55w x58t(855h#% 4 4 4 4 55,I*tDFu h4#B卅(R$R RRRRR RRRRRRRRPh;"QƃH1Ʌ~ )1 4h<"@Y12@9u919~2Ph@ GXZj  4t1DžDžDžDž:h4Vj55=GtPCPh]#j44rJB4RC 4@Yj (P55u3* x5:t (:t55hx#=hh# 4% - 4U 4% 4%  4-(P55@2XZ(8u55h:"#(P5582^_(8u55h#f020=*)Ht"4j.SvZYuЍD)؉?wPSPєƄ t@ ,I*t (I*fBۍ1V{djdPV{SV{VP|$Vh#jE HhSVjHSPeX1DžDžDžDž:h4VjSDtP@Ph9e"4Bt22ru h#g4Jr rr e4 y hi$Q!4@t"54h4Pm# t hB|#&1DžDžDž:PPj*CtP?Ph%#jxt!4t hH#"_ppj0j)54J#t ho#cC?^!4tVDžjSj'j)54#t h#jSj(j)54"t h# PP 4ƒY[u h¯# u23*1Ƀ `2Dž0 r,0`23*Dž0 Zu h#P 4tfC%221$22Dž  4@t6j Pjh54!;s2@Dž$@=4u(j$Pj j)54v!@u h#4t/҉$j$Rj*j)P9!@u7h#SDž$j$Rj+j)P !@u h,#& 4%u) t DžDž j Sjj:54 y hI#!4t-DžjSj&j)54e t hb#~փ =3*t1ۅt"V_u h}#+$25(21҃t9S 1 C)C.K,(2$2 9v1ۃt/-BYuh#:3*tC)C/C !4@"Džjjj`à y h#\444f4'u44tjRj.j)St h# =3*t"jh3*jj)St hݰ#=3*t"jh3*j j)St h#h4Sl y h##Ph4Sy yh/#uSUX,3*tf9} h;#SXj,Shh54yhf#$jShh54yIh|#jX= ~ h;#XDž j Phh54Dž$j$Sj$j)54py h#yhXjSj%j)54Ly h#UhX 4  r)r  rr3*PR(Phͱ#4zPh#4eP`{t\h@j诔h@j裔222u 2h|2j+82^_ɞݝv2-|2ݝ݅B"=2ݝݝ B"ݝ݅ݝh|2j++2Y[t"zjjݓ\jP|j2tO2݅݅zt,-|2ݝ݅B"=2ܭݝ292݅݅|2d2JB"r  4t=3*t# 4t|2d2݅v݅ٞ݅X2k 3* %3*ʉ߭vݝp2|2能݅݅v݅744fDž8 B"ٽf f٭۝٭Pj4Py B"ݝy臺8h1dDžT\1󫋅TXDžDžjP54x y&ݹ8h#$dj0XZ {)uj{,ud,u_jh4CP uS$t*4t!9t!4C Ph#CC(=neL 9Se!4?Ph # #Dž0j_X0p닅@9u|009v+P" ,I*DQt9#RPU0Y_ǿ0P9sZPh8 h :# ;0v]HW0Zuh!ٻX*8ut1Ƅ 0|1!4hk"蓻X@<t <uh³#h1$pXDž)̸@ʃtj,FX@uRh#yRh#Rh#YXtj,h#09uj,h$#迺XZ@9OGj,边V@Ph,#膺"!4fPh/9"UЃ wE0wtqdLh#wh#l@<w*$#hC#`h[#Yh#Rhl>"Kh>"DPh#J@Phд#PЄt uhA"h#j_ Rh#[^豯[h#PYtrt u"hk# h0#hB#Ÿ_hV#Rh#谸[^@Ph#蒸'h#hȵ#h׵# hD#h#h #h #h7#ij.SPj?.uj.h S? Sh@#j.SPj .uj.h S ShP#h`#護ph 葷@ffZYfw-$ȩ#h#!hw#h#h# h#h³#>_!4@<t:r <uj.SVj.-h#9u h#hǶ#hѶ#ȶS1ɋ蠲 t Shk7"h޶#>u4j.SVj,tS@4#h#h#L[h# ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6s"/b$ %3$bp-# , s sC s)t`,tw,t,)t,3t65tM !M>g"i t~t~!Wtt"t7#'7#L#etU8C"t x!#tB7#t[T"tt:t:Y-#S#b8Z EZ 8"te"I]"'S# (t (t (V"*t,55#.2s#9tIs#+|,}2|6|;|@|"H|j,$s|E \||8 9|8 ||2Y |}8 3 }}|2}7}usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOSPICKER%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportalN!;nLH}W"P@@sL"w=@@}ʐ.r# @@t!@@ʐunblock and -DNO_CONV?p0 pPP Poflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input 0100prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%˨#4EVdƨƨƨƨƨƨƨrƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨƨr@ Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark charactered.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undo>U^mdw$ mbmfm3 !mm mjm "m nmrmvm~m@m@ mmmm mmmY m8@ǐm̐mm Аm usage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dlfs_cleaner_mainbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getiblfs_dino_getdb0(pPbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALL%s: clean_fs returned %dincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NDADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NIADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free list?B?6Usage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. forcesuccessfully scanned %s. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s Wedge dk name too long; max %zd charactersstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]; a1Z%;\o  6 a } \ Gl !###$ &#1#23#4#5/6#8:9@9G:`;z<=@ABC;DbExFGHJLMNOPQ RS9TBUJVbW|\acdefg/h/i/p6q#s#t#uLv#wRxf @`|!3Jf~ @HU9_####&9FXr.C`x;Vq## 3M#`#)Y/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionDo you really want to delete all the extended partitions?Outside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d Partition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Nested extended partitions are not allowedThe data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdB0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableȷ!}b$ L#Ul!" '3ȷ!}b$ L#Ul!" '3b$fjow|L# "l!"j"   usage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware Reserved# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd/!.#D";!# j.#   o-#@p-# =##%@z.#@0-usage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead./!.#D";!# j.#    =#%@0-usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-s-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidbcaseinsballnames/!.#D";!# j.#   %@usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %slfs_copydirnamelfs_dir_setnamlenlfs_dir_settypemake_dirlfs_dino_setibww#` A0-]0s-]0-]0]0-]0]0F--. .]0]07.^..]0]0]0]0]0]0]0]0]0]0]0]0]0.]0]0]0.]0]0/]0]0]09/]0]0]0]0]//]0]0//%s: can't read disk label; disk type must be specifiedbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getiblfs_dino_getdblfs_writesuperlfs_ss_setocreatelfs_writeseglfs_newseglfs_dino_setiblfs_dino_getiblfs_dino_getdblfs_update_singlelfs_updatemetalfs_gatherlfs_fi_setblocklfs_writeinode0(pPzero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s50rf_ReadSpareTableT7 q*DK q)Qs q*R jpC jpI jp0 jp1 jp4 jp5 jpE jpe q*L jp5656886687888>788N887,88n88888888888858688d6687887)788A88788c88 "     ****************************************************************************************************************************************************************     Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]Can't determine queue type and/or max outstanding reqs from line: %*sUsing %s-%dCan't find "disks" section in config file %sConfig file error: unable to get device file for disk at row %d col %dConfig file error: warning: unable to get device file for disk at row %d col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNoRAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d gettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. RAIDFRAME_CHECK_COPYBACK_STATUSCopyback is %d%% complete. Reconstruction status:Parity Re-write status:Copyback status:absentUNKNOWNdisremainBad last unit %sa:A:Bc:C:f:F:g:GiI:l:mM:r:R:sSpPuU:vUnable to open device file: %sstat failure on: %sinvalid device: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_HOT_SPAREUnable to create RAIDframe configuration structureRAIDFRAME_CONFIGUREhardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s Copyback.RAIDFRAME_COPYBACKRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELSInitiating re-write of parityRAIDFRAME_REWRITEPARITY# raidctl config file for %s START array# numRow numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNIToptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid* B$tI_xJJJJJJJJJK KJJJJJJJJJJJJJJJJJJJ)JIJJJJJJJJJJJJJJJLKJKKJJKnnnnnnHp+֟֟+֟mLm>&G]2- - }tk- bYPusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*llu / quitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d 23Ldf/a~  ~ ~ ) @ ? @ @ @ A $A ;A \A xA A A A B B 6B GB ^B B B B %C PC {C C C C D  *D  @D  WD  kD  D  D  D  D D E E 4E NE cE E E E E  E  F  F  GF {F F F F F G $G 9G RG oG G G G H 1H ZH H H H I HI uI I I I J ,J OJ aJ {J J J J K J K 3K VK  lK !K !K "K $K % L &'L &GL &_L &wL 'L (L (L )M *7M *2M *JM +aM ,M ,M ,M -M /N 06N 0TN 0xN 0N 1N 1N 2N 2O 3*O 6SQ ?|Q ?Q ?Q ?Q @Q AR B5R CR DfR E~R FR GR HR IR JS KS L(S NOS PmS PS PS PS QS RS SS SS S T T#T UIT WaT XT YT ZT ZT Z U Z)U [HU [VU [nU [U \U \U \U `U aU aV aV b*V cFV dqV V V P V V V V L V V W W "W .W >W :%13u %8u %4u entire track defective%10u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: scsibus%d target %d lun %d <%s, %s, %s> current disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. failed to clean Unit Attention: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %sresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identifyreassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Begining Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x "TRT TRTSRTSRTSRTSPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip:;==[>>q=\DDDDDDDhDtDDDDDDDDDDDDDDDD_EFDGG!FNNQNQN!1l#fi mi ri yi bitmask_printbitmask_scani $0i .i i .j j .!j .j (j .6j Hj .tUj .dj 9-rj '+j .j j )j y"y"j j .j j .j  k .j k .j .k .:k Mk &(Yk .:k fk .xk k .k k .k k .k k . k .l +l .Il Ql .Il yl .Il l .Il l .l l  & &l .m m .m m 9-+m =m   \m .gm .nm .sm .%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x -> 0x%0*x0x%0*llxunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%s%s%d%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %lld.%9.9ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor-u ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. A]=*A--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)Waiting for dataHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%tCannot allocate memoryLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESCOLUMNSkrklkukdkPkNkh@7kDhcxndaticmsovb|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundoooooo disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)no_editbootno_clearbootno_setbootgetmachinegetfstypeparseoptionsmain #a" ,#0 8 DU"< @N!4' @" . @7 H= L"Pset_sunsumcompute_sunsum)i386_setbooti386_editboot4##### # + 3 .#, Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINEInvalid block number `%s'-moption != NULL, =,Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'Unknown option `-o %.*s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallinvalid console name, valid names are:console %d console %s Reading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrap/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbd4(Uacsb i z       usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] [ %s ]SIOCSIFFLAGSSIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0xSIOCSWAVELANstring too longmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] %s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvt:u:ut:utu:u:uu:uttUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpopdnepushdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvwȪYh.-K=VL̬_<Ziuϭ %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longquf . 6 v e ] T   L  L  % L L < < K( ( 5% ( <( ( ( ( ( ( ( ( ( Z( i( x( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ' ' ( ( ( ( ( ( -( ( ( ( ( ( ( ( ( ( 5% ' ( ( ( ( ' +' ' ( ( ( ( ( ' ( ( 5% +' ( ' ( ' ( ' ( ( ( ( ( ( ( f% % ( % % ( % ( % % & & ( $& ]& & & & & & & & & ( & 12 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 "2 2 x2 x2 @2 O2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 - x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 x2 10 F0 x2 0 0 x2 1 "1 x2 x2 x2 71 L1 L1 `1 o1 x2 x2 x2 1 1 1 x2 1 1 2 x2 x2 x2 x2 x2 x2 - - - - x2 . x2 x2 . &. 5. G. x2 Y. k. . x2 %/ -/ I/ [/ m/ / / x2 "0 .  /  /  / .  /  /  /  /  /  /  / .  / . / 3 3 "4 "4 3 abcdfiklnoprstuvwxABDEGHLMPTUVXYZC C xC C aC C HC C B C C ] ] ] ] ] ] ] ] ] g g g h ~h h Jh ~h ~h h ~h ././@LongLink-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./I~Ӎusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directory y 8y x #y Oy %x vy x x zx x y x y %x ey 1!  1!О1!*1!71! ]"*1!71! ]"!M1!a1!u1!E1!Z1!1!1!1!#1! 1!_1!^1!F1!<1!>2!?#2!62!    ϓ  F u ړ ' ' 0 9 Ք Ք G Ք Ք Ք Ք Ք Ք Ք Ք Ք Ք d  PATH=                          & & & &  \   $ $  k  , w ~   4 4 k   M      - -    ^$#t f!9!d9!9!sD" c:!9!m9!9!l :!:! rs#$p:!5!n :!9! v(:!  b   K B H I WJ K J K RK [K L K H B B Y Y Y Y Y Y Y Y Y Y Y Z Z Y U Z Z Z Z V V V Z Z Y Z X }-+?=EOF reading here (<<) documentL">!>!>!8!>!>!3!&#7!E8!h 78!;#">!>!>!>!>!>!>!>!>!>!?!=!p ?! ?!?!?!!?!&?!.?!6?! 7!> $ !"k- X , #_"y ($o ^!r ;! a"8 TE!X $ WE! O!Ԉ E! ]E! Q#h aE! dE! M6#s $" lE!0 $ P7!k 6! t !ƌ tE! >g"! k# {E! h E!Ɋ #r X$ E! E!r r! E!Is E!"  # # N! E!  P ^         p      Ú Ú Ú Ú Ú   Ú Ú ֚ ֚  = i         }                 Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directoryinterruptedpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%zu more than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchp:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnv%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Illegal eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalbgchdirletfcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20181212 BUILD:20240511144838Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedpBO!^M!dM!lM!  m rM!"5 N!wM! %  }M!6# Y 6# mM! ^$IO!:G2#q KN!& *$ W  RN!  YN! }O!ح dN! N! #z 0O! C#z N!ܮ kN!  ͯ  #B rN! fN! ! N!# $ z xN!wN!N!N!O!O!O!O!P! P!@N!C$N!CN!C$N!C?j N!O!O!N!N!O!$O!N!FO!O!,O!4O!@N!@=O! N! O!N!QO!YO!@aO!iO! qO!N!N!O!O!O!O!O!O! O!@O!O!O! O! O!O! N!N!N!N! #N!3N!#N!3N!2N!3N!3N!#9P!P!P!"P! *P!@`@1P!AP!JP!RP!option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZ))ޚ)))))owner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.М ܜ[LƜ֝18GVetz̤Ue!e!e!f!f!%f!5f!Hf!jf!wf!f!f!f!f!J;"f!g!g!]i!#g!(g!/g!6g!=g!Dg!Mg!Tg! ]g!bg!ig!rg!zg!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!h!h!h!h!h!$h!*h!2h!:h!Bh!@g!@Hh!@Ph!@Wh!@_h!@hh!@mh!@rh!@yh!@g! @~h!@h!@h!@h!@$h!*h!h!h!h!h!h!h!g!h!h!h!h!h!h!h!h!h!i!@i!@i!i!#i!)i!4i!;i!Ai!h!Gi!Mi!Ui!Zi!ai!hi!ri! &h!xi!i!i!i!i! ]g!i!ȷ!}b$ L#Ul!" '3b$fjow|L# "l!"j"ȷ!}b$ L#Ul!" '3b$fjow|L# "l!"j"ȷ!}b$ L#Ul!" '3b$fjow|L# "l!"j"changing %s byteorder to %sline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskusage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environment%s: unknown machine typeattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes failed to read bootarea from sector %uread sector %u len %d looking for labelno space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tableD5can't get msgbuf[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]Y.#,7#3.#k3#_-#,7#ȷ!}b$ L#Ul!" '3returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %d%y z y y Rx Rx n{ | | | { |        a [ [ [ a returning to single-user after filesystem check  `x!`x!`x!`w!        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?`  I B ` ` wapbl_replay_readwapbl_replay_can_readwapbl_replay_writewapbl_replay_freewapbl_blkhash_freewapbl_blkhash_clearwapbl_circ_advancewapbl_blkhash_remwapbl_blkhash_inswapbl_circ_readwapbl_blkhash_initwapbl_space_useduntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d!!ȹ!Ϲ!!!!$!M!W!g$!0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ȷ!P!۽!!!!#!7!E!)d)))) )8)T)l))))|))))()H)!ȷ!}b$ L#Ul!" '3Z%;\o  6 a } \ Gl !###$ &#1#23#4#5/6#8:9@9G:`;z<=@ABC;DbExFGHJLMNOPQ RS9TBUJVbW|\acdefg/h/i/p6q#s#t#uLv#wRxf @`|!3Jf~ @HU9_####&9FXr.C`x;Vq## 3M#`#)Yd e Oe 'e 1e ;e Ee e Bf SFH0eC!SFU0eC!UHah!IdontNeedEFI!!(s*K>; <#!|nQn- q+ !!|nQn- q+(!2!|nQn- q+?!H!|nQn- q+Y!d!|nQn- q+r!{!=rGy=iG}!!;Mt?!!mWC 3KOO!!yD<#*=(!!3Dh& !\ M}-!!-чH!-чH"'!ZIчH,7#A!IчHk3#T!IчH!_!2IчHz!S'@ )Ѹ!!*1@ )Ѹ!'1x )Ѹ!!a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedsector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in6_statusin6_addr_flagsin6_constructor#)ψ#`)!!)!\!in_statusin_addr_flagscommit_addressdo_setethercapssetethercaps!!!setifbssidsetifnwkeysetifpowersavesleepsetifssidsethidessidsetapbridgesetifpowersavesetifchansetiffrag1!4!7!:!setifrts`!@)_! )g!`)f!g! )C!)B!C!? * )_# )l!)r!\)q!5 )P# )3!P# * )w#)?!)= 8 !! !!d !!H do_setifcapsdo_setifpreferenceusagemainclone_commandsetifflagssetifcapssetifdstormasksetifaddrstatusprintallsetifbroadaddrsetifnetmasksetifprefixlensetifmtusetifmetric!zi)qh yiE!E!E!)4!)Jg"E!E!)|#@)V#),!@)!y#)P")!U )!x)!ξ )!)!)! )! )%!0!;!G!S! _!k!w!@!!!! !0!@!!!z|#K%!! !@"%#media_constructormedia_statussetmediainstsetmediasetmediaoptinit_current_mediasetmediamodeq!z!"!@)!z!"!@)"z!"z!)!z!!q!)!z!!"$)% z!% l)!(~# !(~#`!!@!!!(~#!٣#!      paddr_match   R  1 @ 1 t 1  1 u settunnel! )!)print_link_addressessetvlanifsetvlan!)!!)!!_ 8  [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6%s: getsockSIOCGIFAFLAG_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %sinet6 address lifetime not allowed for the AFia6flagcould not determine link local addressinet6IPv6 keywordsia6flagsanycastSIOCAIFADDRSIOCDIFADDRSIOCGIFADDRSIOCGIFAFLAG_IN inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeNONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAaf_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVtoo many fields for formatinvalid minor numberinvalid major numberusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrixffs@-"dM!:"l#.#B".#@x.#p.#h.#h"-M" ." _"r""""""t ! "@""""@@"Y.#,7#3.#k3#tY"^"_-#$t,7#g"E.#k"o"%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]realpath `%s'puffs|already mounted%s on %s type %.*s: %s mount_puffsrump_%sexec:Cannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrnocoredumpsoft dependenciesexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecoreudfefsnilfs              bnorripbgensbextattbnojolietbnocasetransbrrcaseins/!.#D";!# j.#    =#%@"""""""" egijo:rextattgensmaplcasecasetransnrrrripjolietrrcaseins/!.#D";!# j.#   o-#@p-# =##0z.#@ "l#%@:"dM!softdepbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror/!.#D";!# j.#   o-#@p-# =#%@usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s                  z               '   ~   f         & b n            $   a   r   * bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac/!.#D";!# j.#    =#%@TE!" "5 " "@%","4" +#:" g"@: or @ speccan't get net id for host "%s": %s( d! d! d! d! d! B `  d! d! d!  d! 2!  =#/!.#D";!# j.#   %@0-usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o )eeejbeyeeeeeee eeeeeeeeeeBfeweeeeeQ%s partition type is not `%s'!"!"""<""t""""""#"#"K#"h#"#"#"#"#" $"-$"T$"|$"$"$"$"(%"O%"o%"%"%"%s: can't read disk label; disk type must be specifiedWTWTbSS usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk labelwtfsiputallocinit_resizeinofsinitrdfsSSSWTWTbilog2usage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Z@4O[&]l{O(dj"Eh 0:DNXblvusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%uCannot resolve "%s" (%s)%s only supported with IPblocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x(knNzDK A-C6??333333?{Gz?`RMb@Ajusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()f f f f f ɦ f ɦ ɦ ɦ ɦ ɦ ɦ ɦ ɦ   ɦ ɦ ) ɦ [ [ [ ä ʤ פ   ޤ   Ĭ    Ь   j :: :^  :9  :M         :/ > ::   #     X     :  ::::: v a :: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARM"M"N"=N"UN"~N"N"N"N"O"0O"\O"O"O"O"O"(P"VP"dfLnqSsTtv0123456789abcdefUGHRBD M@dmCLS1@2plbatalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s InternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecy)8GVeAhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityAvailUsedDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Y@Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_urlrecvrequestsendrequestw"x"@x""""""""""{""""""""""""""g" "8!"a!"3""""""""""" "" $ 0 "? """"N ]    G!R!!""L"***************************************************************************************************************************************************************************************************************************************8 }"~"~" ~"~"~"TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamA$8bҸ :WYxqNetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directory%s is not a regular file.gzb)oXz$i0IIIIIIIIBIIIIIIIIIIIIIIIIIIIIIIyCII"uIIIIPUbIIQIy\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i 9 E Q f      - < i H         &      <&0!#< #R" Dk2G #P #`Q2] #8 c2e #8 Z2q #z #^2*"# #_2 # #~`2 # #S2 # #`R2 #]"}a2!#8 a2!#8 b2!#8  e2#!#+!#`O28!#(^2?!#F!#^2P!#8 X^2Z!#,7#d2c!#0!#`P2m!#~!# O2!#ĭ"d2!#ĭ"`S2!#| #U2!# #V2!#!#W2!#!#T2!#]"X2"#8 X2 "#8 Y2"#| # f2#"# #g24"#8 h2?"#M"#[2_"#]"i2k"#8 ;i2w"#8 :j2$#,#$#0,#mount_disksE.#g"_-#k3#3.#Y.#NAME=ȷ!}b$ L#Ul!" '3str_arg_substget_available_cds   !"#$%&'      edit_and_check_labeledit_fs_type_ext0Jc:s#: ȷ!}b$ L#Ul!" '34##### # + 3 ;#<#disklabel_set_part_infodisklabel_write_to_diskdisklabel_change_geomdisklabel_freeghx-BB2E3<@E31C4;4u1/1LIb<x?> 4|,&3Ei86q,2622151ȷ!}b$ L#Ul!" '3,""@K2NNNOROselect_part_schemeouter_fill_part_menu_optsedit_outer_parts"D#= D#E#E#h E#Q!E#&i! E#0E#3E#$9E#0O!@E#!FE# 8!OE#\ )E#WE#E#aE# #gE# qE#l#{E# 7!E#%#E# E# {$E#$E#"E#  E# N#E#_E#tE#7 E#!E#F#F#F#&F#normalize_clones  replace_by_default----------------------------------- - --------------------//tmp/usr/var'1GQ[ƭ٭=eȮ'IƯ+MoڰX#{2z2 P{2 0{2 )_u%FW\sLu]0 QxMUZZk{pm_from_pepm_whole_disk/01234567ȷ!+r#Qg!~N#N#N#,7#3.#k3#N#N#t Y"N#^"_-#$t"N#k!l!g"E.#k"o""N#!N#gpt_get_uuid_part_typegpt_get_part_alignmentN#gpt_get_part_deviceDetails for index GPT part - gpt_read_from_diskgpt_create_newgpt_free"D2mL2SLIHJUj,7#   <#!k3# !!"!!!! !ȹ!!!M!g$ SFH0eC!SFU0eC!UHah!IdontNeedEFI!!(s*K>; <#!|nQn- q+ !!|nQn- q+(!2!|nQn- q+?!H!|nQn- q+Y!d!|nQn- q+r!{!=rGy=iG}!!;Mt?!!mWC 3KOO!!yD<#*=(!!3Dh& !\ M}-!!-чH!-чH"'!ZIчH,7#A!IчHk3#T!IчH!_!2IчHz!S'@ )Ѹ!!*1@ )Ѹ!'1x )Ѹ!!mbr_get_generic_part_typembr_get_part_deviceadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_read_from_diskmbr_create_newmbr_init_default_alignmentsmbr_free "d"@"P,466+=6N(, /  m'b(''(g>%%LI7ObA!9W[NFE34"%22o*))@@9 P#P#P#@!P#AP#nP#P# Q# Q#-Q#/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconf9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureForce umountRemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionKeyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the first serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv1bootxx_ffsv2progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.cvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousdisklabel -r %sinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishde.nodeadGreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)Ukrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.c%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGE/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cparts->disk_size > 0parts != NULLgpt destroy %sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2100: internal errorparts->dp.disk_size > 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1773: internal errorwedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2067: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot***************************************************************************************************************************************************************************************************************************************8 }"~"~" ~"~"~"usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_writeonecontrol_handle_datacontrol_handle17"c"0c"signal_cbmaindhcpcd_getinterfacesdhcpcd_handlehwaddrdhcpcd_handlelinkdhcpcd_linkoverflowdhcpcd_handleinterfacedhcpcd_prestartinterfacedhcpcd_initstate2dhcpcd_reportssidconfigure_interface1dhcpcd_selectprofiledhcpcd_daemonise Copyright (c) 2006-2019 Roy Marplesduid_geteloop_starteloop_signal_maskeloop_signal_set_cbeloop_requeueeloop_exiteloop_q_timeout_deleteeloop_q_timeout_add_tveloop_event_delete_writeeloop_event_add_rwxsocketif_discover*9Ma ɿݿ4H\p)))))B ))"ѷWh))>A=) "6J)WyAS;`LtFh[o<,غsplitvadd_environparse_optionread_configdefault_configj#b cK%d&|#ev#f*|#gSw#hyw#i j0!#k6|#l|#m@|#nM!oG|#p qm"rR|#sY|#tw#utm va|#ws#xh|#z8Z yx|#A~|#B|#Ct#D|#E#F|#G|#Hx#I4!J|#K|#L٣#M|#N|#O|#P|#QH"S #T|#U|#V|#W}#X }#Zj#1}#4$}#6|#|I~-}#}8}#6}#?}#O}#a}#o}#m}#v}#t}#{}##5##}#}#;!#.#Jz#}#}##.z#}#}#}#}#}#}#}#)#}#}#}#"~#~# ~#~#~#&~#{#/~#rt_deletert_addrt_buildrt_descrt_recvrtrt_freert_proto_addrt_newrt_setifrt_new0rt_disposert_headclear0rt_compare_protosa_in6_initsa_in_initsa_cmpsa_addrtopsa_fromprefixsa_toprefixsa_is_loopbacksa_is_allonessa_is_unspecifiedsa_addrlensa_addroffsetscript_runreasonscript_buftoenvmake_env$}#|#$)#a#<"!i#`p#z##E!w#8!#dhcp_envoption0123456789abcdef###N#|##Մ###>#]###߅##$#O###ņ###F#n###LJ#ه###,#M#n###ˆ#ֈ####3#I#Z#3#x###3#x#ˉ#߉###;#O#_#o#~###o#~#Ɗ##ֈ#ˆ#~##%#L#e###‹###4#J##h##)if_ifaif_initrtif_copysaif_routeif_opensockets_os!##č#PT@P HEPT$ @DC( dhcp_initdhcp_start1read_leasedhcp_dumpdhcp_informdhcp_recvmsgdhcp_readudpdhcp_bindget_leaselog_dhcpdhcp_handledhcpdhcp_readbpfdhcp_openbpf###/#>#J#_#S#[###c#p# k#ipv4_handleifaipv4_addaddripv4_getstateipv4_deladdrinet_dhcproutesipv6_tempdadcallbackipv6_newaddripv6_addlinklocalcallbackipv6_getstateipv6_regentempaddripv6_addaddr1ipv6_deleteaddripv6_readsecret^^^ipv6nd_sendrsprobeipv6nd_dadcallbackipv6nd_handleraipv6nd_recvmsgipv6nd_handledataipv6nd_startrs1ipv6nd_expireraipv6nd_applyraipv6nd_rtpref@Sfyqjjjjjj&}1 T<dhcp6_dumpdhcp6_startreleasedhcp6_startconfirmdhcp6_startinitdhcp6_openudpdhcp6_startrequestdhcp6_validateleasedhcp6_checkstatusokdhcp6_recvifdhcp6_recvmsgdhcp6_recvdhcp6_start1dhcp6_startdiscoverdhcp6_writeleasedhcp6_startrebinddhcp6_startinformdhcp6_sendmessagedhcp6_startrenew5#=#Q#h#s### '')*PQ'|}w######Ũ# p## Ψ#/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][master]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtsrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwexvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable again%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.cdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: ignoring unicast option as not master%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6`?eA?LLQQQQmNQQQQOQQQPCQQQQQQQQQ\JJ`KKQKL.LLQQMSN^N|NNOQUPPQPPP kkkk%k6m=mDmKmRmnnnnn5## #Ƕ#y#-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu ping6: wrote %s %d chars, ret=%d --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s RefusedIPv6 address?V|W|W|W|W|W|WQV|WcVV|W|WV|WVV|WV|W(W@W|WXW|WpW|W|W|W|W|W|WV|W|W|W|W|W|WHV|WZVlV|W|WV|WVV|WV|WW4W|WLW|WdWgfVU%I@843.*c'$#" rbFCV{JZ#"ig!8i`#Nif#hi%M"il#i#i$ir#ia"i#jx#2jBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~#4I*#@#H##@#P#Z#g!`#f#%M"l##$r# a"@#x#%%%/etc/group/etc/master.passwdZ Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%s%0*jusnaparchivedsappendschangesimmutableuappenduchangeuimmutable ,?`mN/Alink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x=.b-~(z((((((((((((((4(((((.pqrstuwxyzPQRST/dev/ptm0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZjanuarygmtmidnightyeartomorrowa.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtyesterdaytodaylastthistwothreefourfiveseveneightnineeleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayM9) %%hW.hh}1(fC8kHh"Jjj||]=L:./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U !#$+: *0- ).+(/, '!% #34    full-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetetherTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT.sysctl hw.disknames failed/rdkno match for `%s'sysctl kern.root_device failedkern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot allocate %zu blocks of size %zuCannot re-allocate %zu * %zu bytesCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]Cannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string,----z-s-l-e-^-W-P-I-B-;-4---&---- --,,,,,,,,,,0%llo0x%llx4444444444444444444444444444T3444444444444444444444444444N2444T3%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sInkey wstate screwed - exiting!!!SCDELAYTABSIZEInkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU 5MS7) vlylywlylyly\w\wlylylylylylylylylylyxlylylyxlyylylylylylylylylylylylylylylylylylylylylylylylylylylylylylylyly\wlylylylylylylylylylylylylyJwr?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n      #$  acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$^G^M^Ikbskcub1kcud1^M^JmM$..!!!!H!!HH!H!H!!!!!!!!!!!!HHH!!H!!!!!!!!!!!!!H!!!!!!!)!!!!!H!!!!)!V!*!!ՇH!)!!n!!!)!!H!VÍÍÍL]Í?ÍÍÍÍÍÍÍÍÍÍÍÍÍÎÍÍ.ÍÍÍÍÍÍÍÍÍÍÍÍÍwÍÍÍÍÍÍÍÍÍÍÍÍÍÍ%ÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍÍ___L_.____________________________f__________________________________________ӎunknown error%s: generic terminal%s: hardcopy terminalTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo database%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range&/////////////////////////////& /////////Ү2Kn,X` %K<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i       # " "  "$acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerombitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon/usr/bin/rshRCMD_CMDCannnot exec %sR%zu W%zu L%lld %d *0*1./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz   !"#$1234%&'(5678)*+,9:;<-./0=>?@                                                                                                                                   #& +6 )4%/7(3-!0,1'8"5.*2$ 91)! :2*" ;3+# <4,$?7/'>6.&=5-%      :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'$sha1$%.*s%s%u%s%u$%.*s$%2.2u$ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error neg**non-integral: DOMAIN error @5{S3IsK8W\)2$b"BL`_@5{S3IsK8W\)2$b"BL`_)-DT! @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checktoo many length or distance symbolsinvalid code -- missing end-of-block7*h'') . #$" !c!!$$*J%%fW$.*-A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfaneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version  0@`  0@`  (08@P`p        L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c      src != ((void *)0)/usr/src/common/lib/libprop/prop_string.cprop_string_append_cstringctx->poec_capacity != 0ctx->poec_buf != ((void *)0)<>&plist version="1.0"!((*cp) == '\0')?xml !DOCTYPE plistncnt != 0objocnt != 0po->po_typeparentdictinteger/usr/src/common/lib/libprop/prop_object.cctx->poec_len <= ctx->poec_capacityret == _PROP_OBJECT_EQUALS_RECURSEprop_object_equals_with_errorprop_object_release_emergencyprop_object_releaseprop_object_retain_prop_object_internalize_find_tag _prop_object_externalize_append_charrpn == pn/usr/src/common/lib/libprop/prop_number.c_prop_number_allocpd->pd_count <= pd->pd_capacity/usr/src/common/lib/libprop/prop_dictionary.c(pd->pd_capacity == 0 && pd->pd_array == ((void *)0)) || (pd->pd_capacity != 0 && pd->pd_array != ((void *)0))((pd) != ((void *)0) && (pd)->pd_obj.po_type == &_prop_object_type_dictionary)pdk->pdk_size <= (sizeof(struct _prop_dictionary_keysym) + 128)pdi->pdi_index <= pd->pd_countpde->pde_objref != ((void *)0)*stored_pointer1 == *stored_pointer2pdk != ((void *)0)keylen <= 128pde->pde_key != ((void *)0)pdk->pdk_key[0] != '\0'ctx->poec_depth != 0pd->pd_count != 0idx < pd->pd_countpde == &pd->pd_array[idx]idx < dict1->pd_countrpdk == pdktmpkey != ((void *)0)_prop_dictionary_internalize_continue_prop_dictionary_internalize_body_prop_dictionary_remove_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_free_prop_dictionary_emergency_free_prop_dictionary_iterator_next_object_locked_prop_dict_lookup_prop_dictionary_get_prop_dict_keysym_put_prop_dict_keysym_externalize_prop_dictionary_iterator_reset_locked_prop_dictionary_iterator_next_object_prop_dictionary_externalize_prop_dictionary_equalspd1->pd_un.pdu_immutable == ((void *)0)/usr/src/common/lib/libprop/prop_data.cpd2->pd_un.pdu_immutable == ((void *)0)pd->pd_un.pdu_immutable == ((void *)0)pd->pd_un.pdu_immutable != ((void *)0)(pd->pd_size == 0 && pd->pd_un.pdu_immutable == ((void *)0)) || (pd->pd_size != 0 && pd->pd_un.pdu_immutable != ((void *)0))*src == '<'*cp == '\"'_prop_data_internalize_decode_prop_data_internalizeprop_data_data_nocopyprop_data_data_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_object_internalize_match((ctx)->poic_tagname, (ctx)->poic_tagname_len, ("false"), strlen("false"))/usr/src/common/lib/libprop/prop_bool.c_prop_bool_internalize/usr/src/common/lib/libprop/prop_array.cpa->pa_count <= pa->pa_capacity(pa->pa_capacity == 0 && pa->pa_array == ((void *)0)) || (pa->pa_capacity != 0 && pa->pa_array != ((void *)0))((pa) != ((void *)0) && (pa)->pa_obj.po_type == &_prop_object_type_array)pai->pai_index <= pa->pa_countidx < array1->pa_countpa->pa_count != 0array != ((void *)0)data == ((void *)0)idx < pa->pa_countopo != ((void *)0)_prop_array_internalize_continue_prop_array_internalize_bodyprop_array_remove_prop_array_addprop_array_setprop_array_get_prop_array_free_prop_array_emergency_free_prop_array_iterator_next_object_locked_prop_array_iterator_reset_locked_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_externalize_prop_array_equalsstack->used_intern_elems < 16/usr/src/common/lib/libprop/prop_stack.c((&stack->extern_elems)->slh_first == ((void *)0))stack->used_intern_elems == 16_prop_stack_pop_prop_stack_push%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s: Recursion limit exceeded%s `%s': illegal number%s %lld is less than %lld.%s %lld is greater than %lld.WXXXXHXXXX\YXYXXXXXXYXXYunknown option -- %sunknown option -- %coption doesn't take an argument -- %.*sambiguous option -- %.*soption requires an argument -- %soption requires an argument -- %c%s: unknown option -- %c %s: option requires an argument -- %c pos >= 0pos == 0/usr/src/lib/libc/stdio/open_memstream.cmemstream_seekResolver internal errorUnknown resolver errorResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameREG_NOMATCHREG_0x%xregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTREG_EMPTYempty (sub)expressionREG_ASSERTREG_INVARGrepetition-operator operand invalid"can't happen" -- you found a buginvalid argument to regex routine*** unknown regexp error code ***NUL[:<:]][:>:]]SOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdef?NNNNNt0NNNNNNν++++ww++++++++++++++++++w++++++++++++++++++++++++++++b++++++++++++++++++++++++++++ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~/bin/rcmd%s: unknown user: %s%s: socketpair%s: dup2%s: second fork%s: setuid(%lu)%s: exec %srcmd: socketrcmd: connect to address %sTrying %s... poll: setting up stderrrcmd: accept/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts ownerrcmd: address %s not listed for host %srcmd: socket: All ports in usercmd: write (setting up stderr)poll: protocol failure in circuit setuprcmd: protocol failure in circuit setup..rhosts writable by other than ownerrshrcmdUr|,0123456789abcdef %x:%x:%x:%x:%x:%x %x:%x:%x:%x:%x:%x/etc/ethersethers.byaddrethers.byname %x:%x:%x:%x:%x:%x %256s 0123456789abcdef[inet_ntoa error]0123456789abcdef0123456789abcdef)K>K>K>K>K>K>K>K>K>K>K>K>K>K>KK>K>K>K>K>K>K>KK>K>KKKKK>KKK%lld%s%s%s%d%s%d%s%s%skMGTPEBKMGTPEKMGTPEBkMGTPE BLOCKSIZE%s: minimum blocksize is 512%s: unknown blocksizemaximum blocksize is %ldG%ld%s-blocksbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb%s, %lu: Missing fields : b0simulated/etc/disktabTLS allocation failed, terminating %H:%M:%S%Y-%m-%d%m/%d/%yEDTCDTMDTPDTCSTMSTPST8g۽Ǻz½3z[z]˻8M>˾rEMG˻#0F;Zx0Nm<[y1OnjeJGqZ{saO=+rAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~#$@[\]^`{|}~0123456789ABCDEF0123456789abcdefclen < 0 || (size_t)clen <= mbslength/usr/src/lib/libc/gen/vis.cclen <= MB_LEN_MAX(size_t)clen <= mbslengtholen + clen < maxolentmp == sp->fts_cur/usr/src/lib/libc/gen/fts.c_fts_read, function "LIBC_DIAGASSERTassertion "%s" failed: file "%s", line %d%s%s%s jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjkjjjjjjjjjjjIlUmUmUmUmUmUmUmUm@m@m@m@m@mUmUmUmUmUmUmUmUmUmUmUmUmUmUmUmUmUmUm@mUmUmUmUmUmUmUmUmUmUmlUm3m5ؗҜ<3#I9=D2[%Cod(h@AA5?55?5?y}Zׇ}khӛěӛ5kRk@ÿ?-0%e-%b-%Y%a %b %e %H:%M:%S %Z %YOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOA ԿOOO.OOOu;ZվOOOOO$һmߺPOһO)sܷ~O%ODYѴl-%%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dUnknown error %d?%s%02x phase %u range %u - %ulink#%ukkkkkkkkkkkkkkCkkkkkk;; res_nquery: retry without EDNS0gethostby*.getanswer: asked for "%s %s %s", got type "%s"Address family for hostname not supportedTemporary failure in name resolutionNon-recoverable failure in name resolutionNo address associated with hostnamehostname or servname not provided or not knownservname not supported for ai_socktypeSystem error returned in errnoUnknown error0123456789.xabcdefXABCDEFgetaddrinfohosts.bynameipnodes.byname_%s._%s.%sdnsnisInvalid value for ai_flagsai_family not supportedMemory allocation failureai_socktype not supportedInvalid value for hintsResolved protocol is unknownArgument buffer overflow)&gethostby*.getanswer: asked for "%s", got "%s" @/var/db/services.cdb/etc/services"NBCDB \WJVJVJVJVJVJVJVJV\WJVJVJVJVVJVJVJVVJVJVJVJVJVJVJVJVJVJVJVJVJV\WJVJVJVJVJVJVJVJV\WJVJVJVJVVJVJVJVVPWXVXVXVXVXVXVXVXVWXVXVXVXVWXVXVXVPWXVXVXVXVXVXVXVXVXVXVXVXVXVPWXVXVXVXVXVXVXVXVWXVXVXVXVWXVXVXVPW d'@Bʚ;%lu.%.2luBADTYPETYPE%dBADCLASSCLASS%d;; memory allocation failure ;; ns_parserr: %s ;; %s SECTION: ;; %s, type = %s, class = %s ; NSID: ; NSID %02x ; OPT=%u ; OPT=%u: ;; ns_sprintrr: %s ;; ns_initparse: %s ; flags: qr aa tc rd ra ?? ad cd, %s: %d; %s: %daaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2noaliasesedns0nsiddnssecno-tld-queryno-nibble2?0x%lx?[af%d]%04d%02d%02d%02d%02d%02dNOERRORno errorFORMERRSERVFAILserver failedNXDOMAINno such domain nameNOTIMPREFUSEDYXDOMAINdomain name existsYXRRSETrrset existsNXRRSETrrset doesn't existNOTAUTHnot authoritativeNOTZONENot in zoneBADSIGbad signatureBADKEYbad keyBADTIMEbad timemail destination (deprecated)mail forwarder (deprecated)CNAMEcanonical nameSOAstart of authoritymailboxMGmail group memberMRmail renameWKSdomain name pointerHINFOhost informationmailbox informationMXmail exchangerTXTresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressNSAPnsap addressNSAP_PTRPXmapping informationGPOSAAAANXTEIDNIMLOCSRVserver selectionATMAATM address (unimplemented)NAPTRnaptrkey exchangeCERTIPv6 address (experminental)DNAMEnon-terminal redirectionOPTapldelegation signerSSFPSSH fingerprintIPSECKEYIPSEC keyRRSIGrrsigNSECnsecDNSKEYDNS keyDHCIDNSEC3nsec3NSEC3PARAMNSEC3 parametersHIPhost identity protocolSPFsender policy frameworkTKEYTSIGtransaction signatureIXFRincremental zone transferAXFRZXFRcompressed zone transferMAILBMAILAmail agent (deprecated)URN Naming AuthorityKey ExchangeA6IPv6 AddressSINKKitchen Sink (experimental)EDNS OptionsANY"any"DLVDNSSEC look-aside validationPKIXPKIX (X.509v3) CertificateSPKISPKI certificatePGPPGP certificateURL PrivateOID PrivateRSARSA KEY with MD5 hashDHDiffie HellmanDSADigital Signature AlgorithmEXPIREONLYNo algorithmAlgorithm obtained from OIDPREREQUISITEUPDATEADDITIONALANSWERAUTHORITYCHAOSHESIOD; EDNS: version: %zu, udp=%u, flags=%04zx ;; ->>HEADER<<- opcode: %s, status: %s, id: %d %d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %s%d.%.2dm %sm %sm %smwell-known service (deprecated)geographical position (withdrawn)next valid name (unimplemented)endpoint identifier (unimplemented)NIMROD locator (unimplemented)dynamic host configuration identifiermailbox-related data (deprecated)IQUERYCQUERYMCQUERYUNOTIFYZONEINITZONEREF "\ RR format errorunknown RR typeunknown IPSECKEY gateway type@ ( ; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u ( 0x%04x %u %u ; key_tag= %u%s %d %d %lu %d %d %d record too long to print( %u \# %u%s ; %s0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/gethostbyname%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpahosts.byaddripnodes.byaddrgethostbyaddrgethostby*.getanswer: asked for "%s", got "%s"0123456789ABCDEF0123456789abcdef%u.%u.%u.%u%1x/%d]+R+RRR++RRRR+RRRRRRRRRRRR+RRRR+RRRRRRRRRRRRRRRRRRRRRRRRRRR+  0123456789nss_%s.so.%dnss_module_register/etc/nsswitch.conf%s (%d source%s): SUCCESS=continue UNAVAIL=return NOTFOUND=return TRYAGAIN=returncompat,M3.2.0,M11.1.0posixrulesabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pagemnGMT %s %s%3d %2.2d:%2.2d:%2.2d %-4s %s %s%3d %2.2d:%2.2d:%2.2d %s JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSataUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksResult too large or too smallOperation now in progressOperation already in progressDestination address requiredMessage too longProtocol option not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress already in useNetwork is downNetwork is unreachableConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedOperation timed outConnection refusedFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedAuthentication errorNeed authenticatorIdentifier removedNo message of desired typeIllegal byte sequenceNot supportedOperation canceledBad or Corrupt messageNo message availableNo STREAM resourcesNot a STREAMSTREAM ioctl timeoutAttribute not foundMultihop attempted Link has been severedProtocol errorOperation not supported by deviceInappropriate ioctl for deviceNumerical argument out of domainResource temporarily unavailableSocket operation on non-socketProtocol wrong type for socketAddress family not supported by protocol familyCan't assign requested addressNetwork dropped connection on resetSoftware caused connection abortCan't send after socket shutdownToo many references: can't spliceToo many levels of symbolic linksToo many levels of remote in pathInappropriate file type or formatValue too large to be stored in data typeЎЎЎЎЎXЎn6[nn*n`nnn`|" ׎ܑܑܑܑܑܑܑܑ ܑܑܑܑܑܑ ܑܑܑܑ;PܑܑB`pıԱ)P-kGH{WPm-kͫDKT%s/%sXXXXXX0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzexpand 32-byte kɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlg jgrn<:ORQhك[؞|6p09Y1 XhdO/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqkern.aio_listio_maxkern.aio_maxkern.posix_aiokern.posix_msgkern.mqueue.mq_open_maxkern.mqueue.mq_prio_maxkern.posix_schedkern.sched.rttskern.sched.pri_minkern.sched.pri_maxkern.maxproc/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesThe maximum ibase/obase values in the bc(1) utilityThe maximum array size in the bc(1) utilityThe maximum scale value in the bc(1) utilityThe maximum string length in the bc(1) utilityThe maximum number of weights that can be assigned to any entry of the LC_COLLATE order keyword in the locale definition fileThe maximum number of expressions that can be nested within parenthesis by the expr(1) utilityThe maximum length in bytes of a text-processing utility's input lineThe maximum number of repeated occurrences of a regular expression permitted when using interval notationThe version of POSIX 1003.2 with which the system attempts to complyWhether the system's C-language development facilities support the C-Language Bindings OptionWhether the system supports the C-Language Development Utilities OptionWhether the system supports at least one terminal type capable of all operations described in POSIX 1003.2Whether the system supports the FORTRAN Development Utilities OptionWhether the system supports the FORTRAN Runtime Utilities OptionWhether the system supports the creation of localesWhether the system supports the Software Development Utilities OptionWhether the system supports the User Portability Utilities OptionThe minimum maximum number of streams that a process may have open at any one timeThe minimum maximum number of types supported for the name of a timezoneThe maximum number of functions that may be registered with atexit(3)mpool_new: page allocation overflow. STDBUF%dSTDBUFUUUUUUUUUUUUUUU=UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU=U @SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberPM%a %b %e %H:%M:%S %Y%I:%M:%S %p^[Yy]^[Nn]C  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB )߇Ј{{{{{{{{{܄OQxyֆ;; rcode = (%s), counts = an:%d ns:%d ar:%d ;; res_nquerydomain(%s, %s, %d, %d) ;; res_nmkquery(%s, %s, %s, %s) ;; res_nopt();; res_opt()... ENDS0 DNSSEC;; res_nopt_rdata();; res_setoptions("%s", "%s")... ;; res_setoptions("%s", "%s").. ;; res_init()... default dnsrch list:ndots:;; ndots=%d timeout:;; timeout=%d attempts:;; attempts=%d ;; debugno_tld_queryrotateno-check-namesnibble:nibble2:v6revmode:singleip6.intLOCALDOMAINnameserver;# sortlist;; %s ;; ..END..RES_OPTIONS/&duplicate sourceerror addingerror adding entryyacc stack overflow'compat' used with other sourceslibc nsdispatch: %s line %d: %slibc nsdispatch: %s line %d: %s '%s'\M)]:[=              libc nsdispatch: %minput in flex scanner failedbad buffer in yy_scan_bytes()out of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()libc nsdispatch: %s line %d: %s at '%s'MZgtuC;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::   9876543210/.-,+*)('&%$#"! :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::DEAE216+-.99+&%/ /E!()*!!# E          I~_hashHASH: Out of overflow pages. Increase page size ;=<<'=;<<<<; ʹĻQqo# # # b`  <  xRz"   i  ,  hd m -" N# XK;"  4# ؃! % Lխ" Z  !E!   \6$  [    ! lݿ$ 0[  k# m;  # # ## <^$ x# ! #:! 9#H# ,R#,4# h>#h# ## ## ## X#Xt X# X,%# # # # # ## ## ## # Ll# .# # J   # $ \#  #  # # ##  '#  +#  /# 9! 3# 8#=#B# G# L#Q#V# Z# 0^# 0c#0.g" 0}#h#`r#Z x# }#xM! ! E# # i  # i  # i  # i   i  # i  # i   #  i   m#  i   #  i   #  #x# ##N#`'# <  %~i  $ c######### # # # # !#(#+#2#5#=#W#B#L#S##X#a#g#K#l#\ s#H"#h $O!k $| $ $#n $# $q $\ u $\ { $ $! $K$l$ $9P$X$V$${\$X $c$0%$ mpp py yy y y y$Г$8 ۓ$K"$$$$8 `$@$$$@$gnts_)`_2Erbmn<U~e: yekdtcidňUatad>loob:yarau4U\$q$$$$$ر$$$$$0$;$W$b$ {$$ $$ $˲$ $! $0$$$$T$$$x$8 $$г$Գ$س$ܳ$$#$$$K# $ i5! >! $ $ $ $ # $ $$b"'$+$/$3$#7$;$j= y?$y C$G$ K$ݪ O$ a" S$!d$"s$#$$$%$&$'$($)д$*ٴ$+$,$-$-$.$."/}$//!0E#1#2#3#4#56#7#8#9$:$;$<'$=3$>E$?S$@a$["\u$\$]$^$^$_µ$_˵$`ص${${$|$}$}^ ~$$Z#0$8 g!p$8 `#? 8 f#$8 %M"/ 8 l#̸$8 #($8 $,$8 r#$8 a"C$8 #J$8 x#e$8 8 ȷ!}b$ L#Ul!" '3b$fjow|L# "l!"j"߿$$$$$#$$$$$bl#1l# ^!(> @> 8 I> R>  0!#8 l 8 = 8 0 K%p# f> 8 Fn> 8 6#8 6#8 st> 8 28 |x> > 8 K> > > 8 > x> t\ %6#~i i i i i i i i i i i i .pD* (prog_root)`_)#*#./000>0A0MNƤ0k` psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s O!R!!!##'$?$K$_$&&&''' ' '('('L'L'N'N'S'U'W'W'_'`'''''''''''++$++/,/,_,_,m,s,x,,,,&-/-f-n-p--------------------........////@0@00011-10111111122D2O222MMǤ",?x./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@            4 7 ; > H O Y o##c$o$t$')szFW_rUU  ::??EEGIQQצ oK^pp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks *0/000 %& #      8 : ? ? gi{BD0 6  # #F          Ƣ  Ѣ ܢ            & , 4 > I P  W  b  i  u  |           Z"  ǣ ϣ أ ߣ  ߣ      xM! % 2 9 F % M T #a 6  ,q   ܢ   Ƥ &  4  I 3 ߣ U f m     ڥ  xM! Z" 9 ) % A T b   ϣ Ϧ )))))))))""    l h b  w  i x X      0  $  k  j  e j    ky ( JKYdu f    bv z!w" (F2F8R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ is not a regular file (use -f to see it) is a directory))a)(0-ϱ   b)@/-6 V B)/-u  c)/-Ų   d) 0- 2 )A0-H d e)/-y   f)0-dz ߳ F)/- % g)/-I h  h)/-Ŵ ޴ i)/- ! 9 j)Xa o J)!/-|  k)HvK|)0- ׵ Lt)/-  ml)/-+ 8 F nd)"/-R i z o\)z OT)# pL)HPD)  Ot \Np O| uB$ dFC: G+: GcY =.j +>j +>x `K `Ks I? ^# -K3 X5- E F P cg"a lN!s h T5- !"$'(+-.03569: 8-A $M <R aZ x9-_ ah 9-m at9-  ~q a!8-O| d\ 9-"#aO!9- a4:-K % $ 7##a P8-a9-  ~C !bN !j !j!cfV !hb !kq !l !m !o !o !p !pI !p !q#r =#u_#t vD w !w< x_]"x'S#ztz !B CB"J !O !P !S !T["VCl V$ !X3 !Z1 !Z< !C !R !Y !n ! z ! ! ! t !z !n ! Y !B" ! !  !(Y ! [ TY ! l] CY pY zS gZ  !(` ` ia TY ` e CY pY zS U4 /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin /}-+?=###%%%}d /` /;!a;!;!EV;!eZ F;!ID i;!L;!m;!Cp.#n;!f;!;!p;!b;!u;! o!2!n o! !R %p!Fe >p!!& _p!f np!  ݣ  p!t# p!#Mt! ... ...|!=!B!"& )@i!!!$ )!! )!qh " ),!8"B 4)8 ˶#BC L)@!̻!O!,S h)@W!! X )@8  Z )@a` !!N[ )@!!^ )!!"Yc )!!J;"K!k )P!X$m )@!!J;";!n <)!!J;"$!s \)@a` !!t x)!g"@X"*  @X" g"@X" #@X" 4~#@X" g"@X" ]]"@X" g"@X"$@X"? = @X"q$@X"b g"@X" g"@X" g"@X"q g"@X" q"@X" g"@X"c !"@X"3g"@X" !@X"< ze"@X" Y @X" e @X" g"@X" "@X" Y\"@X" g"@X" 6c"Ԭ"ݬ"|  FOR7Zl  G"p""c"7Ԭ"Jݬ"]ί"""b@";<x)uhi5)3.#,7##    ~kPZ?k WmWA- s/C  9) f Rwl#!o-#;.#U.#ox.#p.#h.#.#""Ѱ"  !#"!,= %s#t"""""$""""Ų""ϴ""""""͸"""$"!"$""W"<"ȼ"","9"!F"S"f"""""۾"""\"ƿ"8"n""",}"!X"\"d"w"tx!#"H$"""""!"t""""3"g"r"""o"%""""""""""k"z"""D"""""T""c"""N""""3"C"R"d"x""""""""\"q"~"""","K"""""""t""":"""d"}""""""""6"z""""""""$"3"A"W"`"u""""""""""""%"?"["q""R"p"""{""q"""T""_"""""&"0"t6!:"C"R"j"""""""%"1"["C"_"k"x"""""""""1"M"""-V""غ!"""""""""","E"Z"n"r@"{"""""""""""""$"1":"I"^"V"j"v"""""""""" """"""]"""""",|#O""H7!%"*"4"@"I"^"""""""""""%":"c"/"G""/")"O"n""N ""@"V"V"f"""""""" "z!"".#"""A"Z"""""F"""""4"""""$" A"j"q"""""""""X$6#!p"#"R""""!"?"`"z""""""""""##\#w###!!######### # !! !#$"##!#O!#4Q##!### #&#R#######tY tY #8 &#J##K#h#r####### # #; #h # # # # # #J # # #< #J #= #3#Z##j#######n######(~#Ƚ:!# #$5#P#y###"#Q##I#S!b######+#Q#### #&#<#Q#d#q#y#$########!#D#R#^#d#k#v#D}######### ##+#=#D#N#!_#i#~###"#######"#.#9#B#O#^#r#~########## ##!_##%#:#G#O#c#{########### #>=Q,#U,#Z,#^,##d,#h,#O!l,#pisi/$!1#1#1#1#1#1# 6#@.#u!6#c"7# 7#2#@##7 "#8 "#9 "#: "#; "#<8#8 0sK0cI_sKsU[ZKJC#XC#gC#tC#C#C#C#C#C#C#C#C#C#[Z̩[%Zè#dA.+M ww#8 8 8 8 8 8 8 8 8 C  ## #  @#@ ###)#o<"/#2! ٣# ;# C#@K#@H]"@]#@k#@q#@{#`#`###;!## #@##.#$&#,= ##########$#$#$#$#$#%#% #%#%#%#&##&-#&3#'>#'H#'N#(Y#(c#(i#)t#)~#)#*#*#*#+#+#+#,#,#,#,#-#-#-#-#.#.#.#/#/&#/-#69#;G#;S#0^#0h#0n#1y#1#<#<#=#=#>#>#?#2#2#2#3#3#3#9#7#8 #:!#4+#46#4=#5I#5T# [#! #" j## v#$ #% #& #' #( #) #* #. #+ #, #- #/ #0  #1 #2 !#3 .#4 9#5 D#6 N#7 Z#8 f#9 r#: }#; #< #= #> #? # @#!@#"@##@#$@#%@#&@#'@ #)@#*@ #+@,#&`7#'`D#,@Q#-@^#.@k#/@y#0@#(`#1@#2@#3@#)`#4@#5@#6@#7@#8@#9@#:@ #*`-#;@:#<@G#=@T#>@a#?@n# `{#!`#+`#,`#"`##`#-`#$`#.`#/`#%`#C #C#D#D'#E-#E7#F<#FG#cM#cY#d]#dh#e#el##q##}#&#&#0################ ###&#1#>#K#J# N# W#@]#@}#`g#l#w##.#|#######I= b$3333338 8 $$ $$$<$3333r!/!-T"d.#}$UTC3333))9c988433333P549㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž33?*>*>*>* 33UU33UU33UUC*C* r5C*?$?*D*?$@* pD*?$@B*$$ $$$B$Z$m$$$$$$$$-$x   @ 3333 F* $$)0000000000000000 @ÿ? `53333p733P 33DG*LG*TG*33 (root)` )C%%%%%%%@#)О) ) )%%% %I*B|ad+C,)U@Service unavailable(#%+#JL6xڡOa罖-:XWv$’"T-[ K,U!HLBa O{{jN4HZx6jš__<XyP4*\3sYܾ乽= GՍ•;iGkn|q>9}Q^joy؃w3-88}&=2빖\}W[)T5WtkVa>!y]qgX}jO=NיsAC׹u>XWq/}|"80ܖu.]gq[Vj;:E|~auvt}]j1 D)>9(?vV5ZŲ6_z(1f`ppjwLs/<ء24A_*DmRfvwyQf˟AVsш'!rήr 5.bRuԔ[9)MYa/zQ R_檲(ԦBKu 27x.shstrtab.note.netbsd.ident.init.text.fini.rodata.tbss.ctors.dtors.jcr.data.rel.ro.got.got.plt.data.bss.SUNW_ctf Ԁ $B*`s` 0s 8t)̴ >t)̴ (Et) Lt) Qu) * ^) c) l ) r J* !0 w !r~!MSGTXTS613 4920 4956 4973 4988 4992 4996 5001 5012 5018 5024 5027 5030 5033 5037 5049 5061 5071 5101 5113 5545 5572 6148 6508 7193 7254 7332 7427 7467 7489 7495 7504 7534 7538 7542 7545 7548 7670 7855 8083 8612 9030 9059 9072 9085 9092 9112 9131 9154 9197 9217 9236 9259 9303 9332 9373 9439 9551 9665 9719 9748 9780 9819 9825 9903 9909 9913 9918 9959 10096 10106 10114 10133 10147 10156 10188 10229 10242 10367 10425 10444 10563 10619 10671 10682 10698 10737 10987 11159 11331 11386 11421 11673 12079 12380 12650 13011 13191 13510 13530 13543 13732 13876 14072 14206 14226 14259 14278 14379 14534 14722 14909 14929 15008 15106 15144 15167 15257 15278 15301 15320 15344 15374 15418 15451 15474 15486 15504 15772 16091 16122 16157 16221 16296 16366 16397 16427 16519 17010 17040 17057 17197 17338 17535 17654 17801 17968 18526 18822 19003 19048 19211 19265 19400 19436 19496 19546 19837 19946 20003 20100 20105 20120 20144 20149 20165 20172 20189 20204 20223 20255 20259 20279 20297 20309 20322 20340 20364 20382 20401 20428 20455 20467 20488 20513 20546 20581 20619 20872 20941 20996 21057 21175 21334 21388 21649 21700 22076 22231 22375 22483 22668 22698 22741 22751 22759 22769 22781 22802 22811 22817 22849 22892 22928 22966 23003 23051 23075 23087 23101 23109 23117 23147 23164 23193 23214 23237 23246 23265 23277 23321 23359 23386 23430 23458 23511 23522 23533 23540 23550 23559 23593 23597 23602 23606 23641 23651 23681 23704 23733 23755 23777 23799 23826 23838 23850 23869 23903 23936 23960 23973 23985 23998 24004 24030 24040 24051 24075 24085 24105 24125 24142 24168 24192 24205 24225 24259 24266 24295 24318 24341 24357 24372 24387 24402 24416 24604 24909 25340 25531 25766 25954 25996 26046 26100 26148 26170 26211 26222 26230 26254 26258 26262 26271 26282 26293 26308 26339 26385 26398 26411 26441 26455 26467 26479 26491 26509 26532 26577 26600 26660 26912 26939 27201 27219 27246 27295 27325 27356 27488 27495 27539 27588 27611 27635 27659 27686 27701 27718 27732 27751 27782 27806 27837 27844 27858 27866 27876 27884 27889 27942 27991 28031 28097 28130 28174 28197 28298 28303 28380 28394 28404 28428 28551 28632 28742 28770 28775 28791 28820 28828 28869 28877 28891 28904 28912 28931 28964 28984 29004 29220 29251 29271 29277 29284 29288 29303 29322 29348 29357 29369 29423 29481 29516 29535 29552 29564 29599 29605 29609 29626 29637 29662 29840 29894 30585 30604 30639 30669 30715 30721 30728 30732 30756 30772 30778 30853 31003 31122 31135 31203 31205 31207 31209 31219 31232 31249 31276 31280 31286 31291 31300 31305 31332 31334 31347 31359 31374 31402 31446 31493 31509 31531 31542 31575 31595 31644 31646 31648 31664 31667 31718 32040 32056 32087 32107 32143 32160 32176 32192 32208 32224 32246 32291 32339 32390 32509 32536 32561 32581 32610 32664 32789 32822 33048 33072 33354 33637 33911 34098 34222 34347 34364 34387 34392 34398 34403 34506 34558 34804 34965 35120 35191 35244 35251 35269 35276 35303 35353 35356 35399 35445 35500 35559 35628 35675 35780 35923 35948 35952 35986 36003 36041 36094 36134 36210 36275 36369 36390 36428 36468 36504 36528 36551 36590 36620 36627 36636 36644 36652 36666 36682 36710 36762 36779 36800 36844 37186 37190 37205 37216 37224 37243 37255 37262 37269 37278 37288 37305 37321 37375 37383 37391 37401 37412 37430 37447 37463 37481 37488 37506 37523 37530 37540 37571 37590 37609 37629 37639 37658 37671 37691 37711 37732 37742 37761 37780 37790 37807 37821 37844 37868 37881 37891 37896 37900 37918 37937 37956 37961 37980 38000 38025 38040 38044 38051 38061 38070 38091 38105 38113 38133 38159 38176 38184 38195 38226 38231 38244 38266 38281 38290 38311 38329 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-9.4_STABLE. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :ttessecteurspoint de montage (ou 'aucun')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-9.4_STABLE est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-9.4_STABLE est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-9.4_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-9.4_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseSystme (/etc)Outils de dveloppementJeuxPages de manuelDiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-9.4_STABLE Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-9.4_STABLEExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouLe fonctionnement n'est pas pris en charge!Point de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsModifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Drapeau d'amorageFonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selection Type de clavierfrInstallation de la table des blocs dfectueux ... Voulez-vous installer le programme de dmarrage standard ou sur port srie ? Le programme de dmarrage standard utilise les priphriques dfinis par le BIOS (en gnral le moniteur et le clavier). Le programme de dmarrage sur port srie utilise quant lui le premier port srie. Programme de dmarrage slectionn : Console du BIOSPort srie com%d, baud rate %dPas de modificationSlection du programme de dmarrageConsole du BIOS port srie com0port srie com1port srie com2port srie com3Vitesse du port srieConserver le programme de dmarrage existantInstallation programme de dmarrage sur %s ... Ce disque correspond au disque du BIOS suivant : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %#6x %9d %5d %8d %20u %3u C'est la bonne gomtrieEntrer la gomtrieUtiliser l'un de ces disquesCe disque correspond aux disques du BIOS suivants : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %-1d: %#6x %9d %5d %8d %20u %3u Note: puisque sysinst a pu trouver une correspondance unique entre le disque choisi et un disque connu du BIOS, les valeurs ci-dessus sont probablement correctes. Modifiez-les uniquement si elles sont manifestement fausses. Choisissez un disque : La partition de votre disque rserve NetBSD se trouve en-dehors de l'espace que le BIOS de votre machine peut adresser. L'amorage depuis cette partition ne sera peut-tre pas possible. Voulez-vous rellement faire ceci ? ('Non' vous ramnera au menu d'dition des partitions.)Vous avez plus d'un systme d'exploitation sur ce disque, mais vous n'avez pas spcifi d'entre dans le menu de boot pour la partition active ou la partition NetBSD sur laquelle vous allez installer. Voulez-vous rediter la partition pour ajouter une entre dans le menu de boot ?Vous avez ajout une partition tendue au menu de boot, mais il semble que le BIOS de votre systme ne supporte pas la commande de lecture utilise par cette version du menu de boot. Voulez-vous vraiment faire ceci ? ('non' vous ramnera au menu d'dition des partitions.)Votre configuration ncessite le selecteur de boot de NetBSD pour choisir le systme d'exploitation dmarrer. Il n'est pour l'instant pas install, voulez-vous l'installer maintenant ?Le code d'amorage dans le secteur de boot ne semble pas tre valide. Voulez-vous installer le code d'amorage de NetBSD ?Voulez-vous mettre jour le code d'amorage dans le secteur de boot avec la dernire version du code d'amorage de NetBSD ?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypeMountMenuVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activemenu de dmarragedfautType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (Ac)tive partition, bootselect (d)efaultConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?n?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes? . ..chio dd df ed mtrcmdsync catchmod cp ln lsmkdir mv pax pwd rm shsttychgrpMSGTXTS613 4920 4945 4962 4984 4987 4992 5000 5007 5015 5023 5026 5029 5032 5036 5048 5057 5070 5099 5114 5679 5713 6396 6685 7397 7453 7534 7641 7688 7711 7717 7726 7755 7759 7763 7766 7769 7874 8073 8312 8753 9191 9226 9243 9255 9261 9273 9292 9312 9352 9369 9386 9401 9448 9486 9534 9617 9742 9878 9919 9957 9994 10029 10039 10189 10195 10200 10204 10224 10334 10354 10360 10374 10386 10397 10434 10468 10492 10594 10631 10653 10752 10807 10865 10876 10892 10944 11112 11320 11493 11548 11603 11876 12429 12961 13397 13736 14069 14182 14197 14206 14366 14536 14686 14852 14875 14899 14914 14989 15129 15306 15461 15473 15553 15654 15700 15726 15794 15805 15814 15827 15853 15868 15884 15897 15924 15935 15950 16154 16387 16417 16432 16501 16569 16643 16673 16711 16765 17219 17245 17274 17378 17484 17669 17781 17896 18000 18687 18945 19084 19120 19290 19331 19468 19491 19527 19572 19821 19917 19971 20050 20061 20088 20097 20104 20131 20145 20160 20175 20189 20205 20214 20236 20254 20271 20282 20301 20327 20345 20368 20385 20400 20415 20433 20455 20494 20512 20549 20777 20851 20894 20940 21087 21243 21287 21566 21593 21952 22136 22288 22435 22593 22614 22662 22672 22680 22691 22702 22712 22719 22734 22746 22786 22816 22855 22908 22966 22987 22994 23013 23034 23041 23066 23088 23108 23130 23161 23198 23220 23234 23280 23309 23343 23383 23418 23486 23495 23504 23509 23518 23527 23544 23548 23553 23557 23592 23601 23628 23648 23671 23690 23717 23739 23771 23787 23792 23802 23825 23847 23864 23877 23886 23895 23901 23928 23935 23959 23980 24004 24017 24036 24061 24084 24100 24106 24118 24148 24156 24199 24210 24221 24232 24249 24266 24280 24297 24513 24817 25266 25481 25750 26026 26078 26114 26150 26201 26218 26258 26272 26279 26296 26299 26304 26313 26325 26336 26345 26366 26408 26424 26440 26471 26488 26503 26518 26533 26554 26565 26606 26635 26683 26920 26955 27162 27181 27218 27280 27318 27358 27515 27530 27564 27610 27637 27660 27683 27710 27742 27765 27785 27795 27806 27838 27854 27865 27878 27888 27898 27909 27914 27977 28025 28069 28136 28164 28209 28227 28367 28389 28514 28528 28538 28561 28668 28725 28840 28871 28876 28902 28941 28951 28993 29003 29019 29034 29052 29075 29102 29123 29149 29360 29403 29407 29413 29419 29424 29435 29449 29478 29510 29522 29569 29619 29659 29686 29702 29711 29754 29760 29764 29781 29793 29824 30083 30131 30707 30734 30770 30798 30850 30856 30862 30867 30888 30904 30926 30955 31096 31229 31242 31379 31381 31383 31385 31395 31408 31426 31453 31457 31463 31468 31476 31482 31522 31524 31534 31549 31566 31600 31632 31670 31699 31728 31750 31793 31819 31865 31867 31869 31884 31887 31936 32210 32223 32261 32273 32296 32309 32334 32359 32384 32409 32444 32475 32514 32569 32676 32705 32736 32766 32803 32859 32974 33010 33434 33457 33727 34033 34343 34559 34670 34769 34786 34809 34813 34820 34829 34951 35020 35308 35446 35587 35668 35715 35721 35730 35743 35766 35812 35815 35860 35903 35968 36030 36100 36168 36261 36480 36505 36509 36545 36563 36591 36633 36677 36741 36791 36867 36889 36941 36985 37024 37058 37088 37119 37144 37153 37165 37173 37184 37196 37215 37239 37288 37305 37329 37372 37694 37697 37711 37724 37736 37743 37754 37761 37768 37777 37787 37804 37820 37870 37878 37886 37896 37907 37925 37942 37963 37985 37994 38004 38031 38037 38047 38066 38082 38100 38120 38129 38140 38147 38164 38183 38204 38214 38231 38237 38253 38268 38283 38304 38326 38345 38355 38360 38365 38383 38402 38421 38427 38446 38466 38486 38504 38509 38515 38532 38548 38569 38582 38590 38610 38634 38651 38659 38670 38691 38697 38709 38731 38745 38754 38775 38793 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-9.4_STABLE. Dieses Programm wird Ihnen helfen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Durch Bettigen der Eingabetaste aktivieren Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Diese Prozedur ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte aus. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Ich kann keine fr NetBSD nutzbaren Festplatten finden. Zurck zum Hauptmen... Ich habe nur eine Festplatte, %s, gefunden. Ich gehe somit davon aus, dass Sie NetBSD darauf %s mchten. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenKpfeSektorenMountpoint (oder 'kein(e)'))ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie nicht die existierende Partitionen weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Roole. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie wollen, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' existierende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNachfolgend sehen Sie Ihre $2 Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Prozess abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil der Prozedur ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. Konnte %s nicht ffnen, die Fehlermeldung lautet: %s. Das Mounten des Gertes $0 auf $1 ist fehlgeschlagen. Das Extrahieren der ausgewhlten Sets fr NetBSD-9.4_STABLE ist abgeschlossen. Das System ist somit fhig, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-9.4_STABLE ist jetzt fertiggestellt. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-9.4_STABLE ist jetzt fertiggestellt. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-9.4_STABLE ist nun beendet. Sie sollten nun die Anweisungen im INSTALL Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0 Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket mu direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0 Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuel ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0 Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0 Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare schnittstellenUm das Netzwerk nutzen zu knnen, bentigen wir folgende Angaben: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der NetzwerkverbindungWLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. Konnte /etc/resolv.conf nicht erstellen. Installation abgebrochen. Konnte nicht in das Verzeichnis $0 wechseln: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Wollen Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Wollen Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypIch konnte die Datei nicht finden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig" um das Paket zu installieren. Whlen Sie "Holen abbrechen" um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ------------------------ ---------- BasispaketSystemkonfiguration (/etc)CompilerSpieleHandbuchseiten (man pages)VerschiedenesKernel ModulesRecovery toolsTestprogrammeTextbearbeitungX11 SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel QuelltexteBasissystem QuelltexteShare QuelltexteGNU QuelltexteX11 QuelltexteDebug-InformationX11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenInstallieren der ausgewhlten PaketeBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-9.4_STABLE InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-9.4_STABLE ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1 Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenAlles lschen, anderes Partitionierungsverfahren statt $1 verwendenGigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVD / install image mediaDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Fhren Sie die automatische Konfiguration?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen mit dem Kommando 'pkgin' zustzliche Pakete installiert oder entfernt werden.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisExistierende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenAdd a userZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, muss man folenden Befehl von einer root-Shell ausfhren: pkgin install Weitere Informationen finden sich in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von binr-Paketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenOperation wird nicht untersttzt!Mountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenPartitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Boot-FlagSafe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Kein Root-Partition definiert ist, kann nicht fortgesetzt werden 8 character username to addDo you wish to add this user to group wheel?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren. Bitte whlen Sie ein anderes Partitionierungsverfahren. Einige Verfahren knnen nur den Anfang einer groe Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem Typcode (0 .. 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem code (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Dies ist ein bereits existierende Partition. Um die Gre zu ndern, muss die Partition gelscht und spter neu erstellt werden. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSLinux Ext2 (old)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1 Partitionen erneut editieren?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3 Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6 wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?Bearbeiten der $1-PartitionstabelleDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD Partition. Wollen Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2 Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C)loneInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellselektion OK, weiter mit der Zielauswahl TastaturschemadeInstalliere die Tabelle der defekten Blcke ... Mchten Sie normale oder serielle Bootblcke installieren? Normale Bootblcke benutzen die BIOS Konsolenschnittstelle als Konsole (meistens der Monitor und die Tastatur). Serielle Bootblcke benutzen den gewhlten seriellen Anschluss als Konsole. Selektierter Bootblock: BIOS KonsoleSerielle Konsole an com%d mit %d baudUnverndertAuswahl der BootblckeBIOS KonsoleSerielle Konsole an com0Serielle Konsole an com1Serielle Konsole an com2Serielle Konsole an com3Serielle Geschwindigkeit whlen...Vorhandene Bootblcke benutzenInstalliere die Bootblcke auf %s ... Diese Festplatte entspricht der folgenden BIOS Disk: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- --------------- ---- %#6x %8d %5d %8d %13u %3u Das ist die korrekte Geometriedie Geometrie von Hand setzenBenutzen Sie eine dieser FestplattenDiese Festplatte entspricht den folgenden BIOS Disks: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- ---------------- ---- %-1d: %#6x %8d %5d %8d %13u %3u Achtung: sysinst hat festgestellt, dass die von Ihnen ausgewhlte Festplatte einer anderen - dem BIOS bekannten - entspricht; damit sind obige Werte mit hchster Wahrscheinlichkeit korrekt, sollten also nicht verndert werden (die Werte fr Zylinder, Kpfe und Sektoren sind wahrscheinlich 1023, 255 und 63 - dies ist korrekt). Sie sollten nur die Geometrie abndern falls Sie wissen, dass das BIOS falsche Werte liefert. Festplatte auswhlen: Der NetBSD Teil der Festplatte liegt auerhalb der vom BIOS dieser Maschine adressierbaren Bereich. Eventuell knnen Sie von dieser Partition nicht booten. Sind Sie sicher, dass Sie fortfahren mchten? (Antworten Sie mit 'nein' um die Partitionen erneut zu editieren.)Sie haben mehr als ein Betriebssystem auf dieser Festplatte; allerdings ist kein 'bootmenu' (Eintrag fr den NetBSD Bootloader) fr die aktive Partition und/oder der Partition vorhanden, auf die NetBSD installiert werden soll. Wollen Sie die Partition zum Hinzufgen eines 'bootmenu' Eintrages editieren?Sie haben eine erweiterte Partition in das 'bootmenu' eingetragen. Doch scheint Ihr BIOS System den 'read' (Lese-) Befehl fr diese Version des 'bootmenu' Codes nicht zu untersttzen. Sind Sie sicher, dass Sie dennoch fortfahren mchten? (Antworten Sie 'nein' um zum Partitionierungsmen zurck zu gelangen.)Ihre Konfiguration bentigt den NetBSD Bootselect (Bootauswahl) Code, um das zu startende Betriebssystem beim Start des Computers zu whlen. Dieser ist gegenwrtig noch nicht installiert; wollen Sie dies jetzt tun?Der Bootcode im Master Boot Record scheint nicht gltig zu sein. Wollen Sie den NetBSD Bootcode installieren?Wollen Sie den Bootcode im Master Boot Record auf die letzte Version des NetBSD Bootcodes updaten?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypOrdnerBootmenSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivBootmenStandardbootPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition, (S)tandardauswahl$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzeMSGTXTS613 4920 4961 4977 4995 4999 5003 5013 5022 5028 5034 5037 5040 5049 5059 5072 5080 5091 5116 5128 5639 5671 6163 6452 6997 7043 7147 7233 7269 7284 7292 7300 7331 7335 7339 7342 7345 7456 7641 7869 8345 8679 8708 8723 8738 8746 8760 8778 8799 8850 8866 8876 8896 8942 8972 9025 9082 9193 9314 9358 9391 9430 9464 9471 9548 9554 9561 9568 9597 9709 9715 9726 9743 9760 9769 9798 9810 9820 9921 9983 10003 10123 10160 10216 10230 10251 10288 10498 10673 10822 10857 10909 11128 11444 11970 12334 12624 13017 13152 13165 13176 13322 13501 13632 13766 13786 13819 13838 13921 14036 14177 14302 14316 14424 14517 14546 14566 14642 14659 14677 14693 14712 14732 14749 14761 14787 14799 14817 15018 15257 15284 15301 15357 15419 15479 15510 15534 15593 15969 15999 16016 16124 16234 16374 16448 16524 16602 17094 17314 17425 17456 17583 17619 17747 17774 17814 17860 18076 18200 18268 18348 18353 18367 18390 18394 18413 18418 18433 18448 18467 18492 18504 18526 18543 18556 18568 18586 18610 18625 18642 18655 18666 18677 18697 18721 18756 18791 18818 19005 19054 19086 19134 19231 19364 19410 19602 19632 19954 20083 20223 20340 20475 20519 20562 20570 20580 20592 20604 20612 20623 20650 20684 20722 20753 20788 20824 20871 20891 20908 20926 20931 20938 20966 20982 21003 21020 21037 21055 21072 21085 21116 21141 21172 21203 21238 21291 21301 21311 21317 21326 21334 21349 21353 21358 21362 21397 21407 21436 21452 21478 21495 21514 21535 21551 21564 21569 21577 21592 21618 21646 21664 21675 21681 21687 21708 21718 21729 21747 21769 21786 21799 21820 21840 21860 21871 21884 21906 21913 21938 21953 21973 21985 22002 22019 22039 22058 22235 22519 22829 23009 23220 23408 23474 23521 23576 23620 23640 23669 23681 23687 23703 23707 23711 23719 23729 23741 23756 23775 23811 23822 23833 23872 23884 23894 23904 23914 23930 23948 23997 24018 24063 24307 24333 24587 24602 24628 24685 24719 24754 24896 24913 24944 24993 25014 25030 25046 25073 25092 25112 25130 25141 25162 25176 25196 25203 25222 25227 25232 25238 25243 25282 25317 25347 25402 25435 25481 25495 25574 25579 25633 25647 25657 25681 25767 25815 25921 25955 25962 25977 26004 26013 26052 26059 26081 26100 26116 26134 26166 26185 26202 26359 26390 26397 26406 26414 26421 26435 26453 26472 26482 26494 26535 26580 26609 26630 26653 26672 26710 26716 26720 26737 26746 26765 26911 26953 27463 27471 27495 27513 27557 27562 27567 27571 27602 27615 27624 27670 27796 27887 27899 27963 27965 27967 27969 27979 27993 28008 28035 28039 28045 28050 28059 28064 28091 28093 28108 28119 28134 28162 28206 28253 28269 28291 28302 28335 28355 28404 28406 28408 28422 28425 28464 28564 28577 28608 28618 28635 28653 28681 28709 28737 28765 28778 28807 28842 28888 28993 29020 29049 29073 29100 29144 29255 29287 29555 29570 29803 30016 30276 30442 30532 30618 30635 30658 30665 30671 30681 30780 30836 31112 31236 31347 31409 31447 31455 31472 31481 31503 31552 31555 31598 31643 31698 31757 31826 31873 31978 32121 32146 32150 32184 32200 32225 32273 32309 32370 32424 32505 32527 32566 32603 32635 32659 32686 32712 32726 32734 32744 32752 32766 32779 32791 32815 32856 32882 32899 32928 33252 33255 33269 33281 33287 33303 33315 33322 33329 33338 33348 33365 33381 33424 33432 33440 33450 33461 33479 33496 33509 33535 33542 33550 33567 33575 33592 33616 33635 33654 33673 33683 33694 33708 33726 33746 33766 33775 33798 33818 33829 33844 33856 33875 33894 33905 33915 33920 33926 33944 33963 33982 33989 34008 34028 34053 34070 34076 34084 34094 34106 34127 34143 34151 34171 34191 34213 34221 34232 34255 34262 34276 34298 34315 34324 34345 34363 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-9.4_STABLE. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiglowicesektorypunkt montowania (lub 'zaden')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-9.4_STABLE zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-9.4_STABLE zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-9.4_STABLE zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-9.4_STABLE zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? --------------------------------- ----- BaseSystem (/etc)Narzedzia KompilacyjneGryStrony PodrecznikaInneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-9.4_STABLEWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-9.4_STABLEUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo sieOperacja nie jest obslugiwana!Punkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjeEdytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)RozruchowyBezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieUSUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selection Keyboard typeplInstalowanie tablicy zlych blokow ... Czy chcesz zainstalowac normalne bootbloki, czy te do uzycia z zewn. konsola? Selected bootblock: Konsola BIOSPort szeregowy com%d, %d bodowBez zmianWybor bootblokowUzyj konsoli BIOSUzyj portu szeregowego com0Uzyj portu szeregowego com1Uzyj portu szeregowego com2Uzyj portu szeregowego com3Liczba bodowUzyj istniejacych bootblokowInstalowanie bootblokow na %s.... Ten dysk odpowiada ponizszemu dyskowi BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %#6x %8d %7d %7d %13u %3u To jest prawidlowa geometriaUstaw geometrie recznieUzyj jednego z tych dyskowTen dysk odpowiada ponizszym dyskom BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %-1d: %6x %8d %7d %7d %13u %3u Notatka: od kiedy sysinst jest w stanie unikalnie rozpoznac dysk, ktory wybrales i powiazac go z dyskiem BIOS, wartosci wyswietlane powyzej sa bardzo prawdopodobnie prawidlowe i nie powinny byc zmieniane. Zmieniaj je tylko wtedy jesli sa naprawde _obrzydliwie_ zle. Wybierz dysk: Czesc NetBSD dysku lezy poza obszarem, ktory BIOS w twojej maszynie moze zaadresowac. Nie mozliwe bedzie bootowanie z tego dysku. Jestes pewien, ze chcesz to zrobic? (Odpowiedz 'nie' zabierze cie spowrotem do menu edycji partycji.)Masz wiecej niz jeden system operacyjny na tym dysku, ale nie zostalo wskazane menu ani dla aktywnej partycji ani dla partycji NetBSD, ktora bedzie zainstalowana. Chcesz zmienic partycje, aby dodac wpis do menu?Wskazane zostalo, ze w menu zostanie zawarta partycja rozszerzona. Nie wyglada na to, ze system BIOS wspiera polecenie odczytu uzywane przez te wersje kodu menu. Czy na pewno chcesz tak zrobic? (Odpowiedz 'nie' przeniesie z powrotem do menu zmiany partycji.)Twoje konfiguracja wymaga kodu rozruchowego NetBSD, aby wybierac, ktorego systemu operacyjnego uzywac. Nie jest on obecnie zainstalowany. Czy zainstalowac go teraz?Kod rozruchowy w MBR nie wyglada na poprawny. Chcesz zainstalowac kod rozruchowy NetBSD?Chcesz uaktualnic kod rozruchowy w MBR do najnowszej wersji kodu rozruchowego NetBSD?Kernel (GENERIC)Kernel (GENERIC_KASLR)RodzajMountWpis menuNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaw menu startowymdomyslnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partition, bootselect (d)efaultKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?tor?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas? . ..MAKEDEV_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"} MSGTXTS613 4920 4958 4975 4990 4993 4996 5001 5009 5017 5025 5028 5031 5040 5052 5064 5073 5082 5108 5119 5657 5684 6250 6550 7191 7238 7351 7444 7478 7497 7505 7514 7545 7549 7553 7556 7559 7681 7866 8094 8614 8965 8994 9007 9020 9025 9045 9064 9085 9144 9161 9175 9197 9242 9268 9309 9387 9505 9619 9673 9702 9734 9773 9779 9902 9909 9913 9921 9945 10027 10033 10040 10052 10066 10075 10108 10127 10139 10249 10311 10330 10449 10500 10552 10564 10583 10635 10839 11047 11238 11298 11347 11616 12077 12745 13170 13492 13917 14049 14081 14093 14271 14468 14629 14763 14783 14816 14830 14899 15012 15184 15319 15339 15451 15543 15566 15589 15648 15663 15684 15699 15720 15740 15765 15779 15803 15815 15833 16043 16293 16314 16330 16383 16451 16524 16561 16587 16663 17158 17184 17206 17313 17420 17621 17694 17778 17878 18373 18611 18762 18796 18931 18975 19114 19155 19200 19247 19491 19624 19686 19760 19765 19780 19808 19815 19833 19840 19855 19870 19890 19930 19947 19967 19988 20010 20025 20045 20067 20082 20095 20109 20121 20133 20147 20165 20208 20259 20296 20481 20544 20580 20629 20720 20850 20903 21163 21210 21571 21721 21890 22010 22142 22182 22229 22239 22247 22257 22265 22276 22287 22301 22326 22370 22403 22436 22471 22525 22550 22569 22591 22596 22602 22634 22651 22678 22696 22717 22739 22758 22768 22798 22824 22851 22900 22928 22981 22991 23001 23007 23017 23026 23046 23050 23055 23059 23094 23103 23134 23151 23178 23199 23219 23238 23264 23277 23285 23301 23332 23363 23389 23402 23410 23421 23427 23451 23461 23473 23491 23502 23522 23538 23564 23586 23602 23614 23634 23660 23666 23696 23710 23724 23747 23766 23785 23803 23821 24044 24350 24768 24969 25209 25393 25471 25526 25593 25633 25656 25690 25701 25709 25732 25735 25738 25744 25755 25767 25780 25810 25854 25867 25880 25917 25931 25942 25953 25964 25981 25992 26039 26062 26111 26352 26385 26640 26661 26694 26747 26773 26800 26956 26962 26985 27028 27048 27067 27086 27113 27131 27151 27164 27187 27202 27223 27237 27244 27258 27265 27272 27279 27284 27333 27371 27405 27462 27490 27535 27552 27653 27658 27735 27749 27759 27783 27906 27987 28097 28125 28130 28146 28175 28183 28224 28231 28245 28258 28266 28285 28318 28338 28358 28574 28605 28610 28617 28624 28628 28642 28654 28669 28702 28715 28770 28828 28864 28882 28900 28918 28955 28961 28965 28982 28993 29015 29193 29237 29939 29963 29997 30016 30061 30068 30075 30079 30103 30114 30119 30182 30303 30426 30439 30573 30575 30577 30579 30589 30598 30611 30638 30642 30648 30653 30662 30667 30694 30696 30709 30721 30736 30764 30808 30855 30871 30893 30904 30937 30957 31006 31008 31010 31026 31029 31071 31340 31353 31386 31398 31422 31440 31463 31486 31509 31532 31553 31579 31621 31675 31778 31805 31835 31860 31885 31942 32051 32084 32457 32472 32712 32963 33276 33430 33548 33668 33685 33708 33713 33719 33728 33837 33896 34147 34288 34415 34483 34520 34527 34536 34544 34571 34617 34620 34667 34712 34763 34822 34891 34938 35043 35186 35211 35215 35249 35266 35290 35342 35393 35465 35531 35629 35646 35677 35713 35747 35771 35795 35828 35848 35858 35866 35874 35884 35895 35909 35935 35983 36006 36026 36067 36366 36369 36383 36395 36402 36421 36435 36442 36449 36458 36468 36485 36501 36549 36557 36565 36575 36586 36604 36621 36640 36660 36667 36684 36701 36708 36721 36756 36773 36792 36812 36822 36838 36851 36869 36889 36910 36920 36940 36960 36973 36992 37005 37029 37052 37065 37076 37081 37088 37106 37125 37144 37152 37171 37191 37216 37234 37241 37248 37261 37270 37291 37304 37312 37332 37360 37377 37383 37394 37425 37433 37446 37468 37490 37499 37520 37538 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-9.4_STABLE. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblescabezassectorespunto de montaje (o 'ninguno')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-9.4_STABLE ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-9.4_STABLE ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-9.4_STABLE completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-9.4_STABLE. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ------------------------ -------- BaseSistema (/etc)Herramientas del compiladorJuegosPaginas de manualVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-9.4_STABLESalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-9.4_STABLEEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorOperacin no admitida!Punto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesEditar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)La bandera de arranqueBorrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountQUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selection Tipo de tecladoesInstalando la tabla de bloques malos ... Le gustaria instalar el set normal de bootblocks o bootblocks por serie? Bootblocks normal usa el dispositivo de consola de BIOS como consola (normalmente el monitor y teclado). Bootblocks por serie usa el primer puerto serie como consola. Bootblock seleccionado: Consola BIOSPuerto serie en com%D en %d baudSin cambiosSeleccion de bootblocksUsar consola BIOSUsar puerto serie com0Usar puerto serie com1Usar puerto serie com2Usar puerto serie com3Baudios puerto serieUsar bootblocks existenteInstalando bloques de arranque en %s.... Este disco coincide con el siguiente disco de BIOS: BIOS # cilindros cabez sectors sect. totales GB ------ --------- ----- ------- ------------- ---- %#6x %9d %5d %7d %13u %3u Esta es la geometra correctaAjustar geometra a manoUsar uno de estos discosEste disco coincide con los siguientes discos de BIOS: BIOS # cilindros cabez sectors sect totales GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Nota: como sysinst es capaz de concordar unicamente el disco que escoja con un disco conocido por BIOS, los valores anteriores son probablemente correctos, y no deberan ser cambiados (los valores para cilindros, cabezales y sectores son probablemente 1023, 255 y 63 - esto es correcto). Solo debera cambiar la geometra si sabe que su BIOS reporta valores incorrectos. Escoja disco: La parte NetBSD del disco est fuera del rango que la BIOS de su maquina puede acceder. Puede que no sea posible iniciar desde ahi. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicion de particiones.)Tiene mas de un sistema operativo en el disco, pero no ha especificado un 'menu de arranque' para la particin activa o la particin de NetBSD en la que lo va a instalar. Quiere re-editar la particin para aadir una entrada en el menu de arranque?Ha pedido que una particin extendida sea incluida en el men de arranque. Sin embargo la BIOS de su sistema no parece soportar el comando de lectura usado por esa versin del cdigo del menu de arranque. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicin de particiones.)Su configuracin requiere el cdigo de bootselect de NetBSD para seleccionar que sistema usar. Actualmente no est instalado, lo quiere instalar ahora?El cdigo de arranque del Master Boot Record no parece ser vlido. Quiere instalar el cdigo de arranque de NetBSD?Quiere actualizar el cdigo de arranque en el Master Boot Record a la ultima versin del cdigo de arranque de NetBSD?Ncleo (GENERIC)Kernel (GENERIC_KASLR)TipoMountBootmenuNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activabootmenupredef.Tipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctiva, bootselect (p)redefinidoConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sec#!/bin/sh - # # Generated from: # NetBSD: MAKEDEV.awk,v 1.26.2.2 2020/06/20 16:19:43 martin Exp # NetBSD: MAKEDEV.tmpl,v 1.205.2.3 2020/03/19 19:08:31 martin Exp # NetBSD: etc.i386/MAKEDEV.conf,v 1.30.2.1 2020/08/13 14:40:44 martin Exp # # Copyright (c) 2003,2007,2008 The NetBSD Foundation, Inc. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # ########################################################################### # # # Device "make" file. Valid special arguments: # all makes all known devices, including local devices. # Tries to make the 'standard' number of each type. # init A set of devices that is used for MFS /dev by init. # May be equal to "all". # floppy devices to be put on install floppies # ramdisk devices to be put into INSTALL kernel ramdisks. # std standard devices # local configuration specific devices # lua Lua device # wscons make wscons devices # usbs make USB devices # # # NOTE: # # * MAKEDEV is used both as a standalone script (via "sh ./MAKEDEV # all" or similar), and as a function library for MAKEDEV.local (via # "MAKEDEV_AS_LIBRARY=1 . MAKEDEV"). Because of this, the script # should consist almost entirely of function definitions, apart from a # few lines right at the end. # # * MAKEDEV may be executed in an environment that is missing some # common commands. For example, it may be executed from a minimal # system used during installation, or it may be executed early in the # boot sequence before most file systems have been mounted. It may # also be executed in a cross-build environment on a non-NetBSD host. # usage() { cat 1>&2 << _USAGE_ Usage: ${0##*/} [-fMsu] [-m mknod] [-p pax] [-t mtree] special [...] Create listed special devices. Options: -f Force permissions to be updated on existing devices. -M Create memory file system. -m mknod Name of mknod(8) program. [\$TOOL_MKNOD or mknod] -p pax Name of pax(1) program. [\$TOOL_PAX or pax] -s Generate mtree(8) specfile instead of creating devices. -t mtree Name of mtree(8) program. [\$TOOL_MTREE or mtree] -u Don't re-create devices that already exist. _USAGE_ exit 1 } # zeropad width number # display number with a zero (`0') padding of width digits. # zeropad() { case $(($1 - ${#2})) in 5) echo 00000$2;; 4) echo 0000$2;; 3) echo 000$2;; 2) echo 00$2;; 1) echo 0$2;; 0) echo $2;; *) die "bad padding" ;; esac } # hexprint number # display (base10) number as hexadecimal # hexprint() { val="$(($1 + 0))" hex= set -- 0 1 2 3 4 5 6 7 8 9 a b c d e f while [ "$val" -gt 0 ]; do eval hex=\$$(($val % 16 + 1))\$hex val="$(($val / 16))" done echo "${hex:-0}" } # linecount multiline_string # count the number of lines in the string # linecount() { local IFS=' ' # just a newline, no other white space between the quotes set -- $1 echo $# } # nooutput -12 cmd [args...] # run a command with stdout and/or stderr ignored. # "nooutput -1 cmd" is like "cmd >/dev/null"; # "nooutput -2 cmd" is like "{ cmd ; } 2>/dev/null"; # "nooutput -12 cmd" is like "{ cmd ; } >/dev/null 2>&1"; # except they should work even if /dev/null doesn't [yet] exist. # # The "{...}" wrapper used in cases where stderr is redirected # serves to capture shell error messages such as "cmd: not found". # nooutput() { local flags="$1" ; shift local junk case "$flags" in "-1") junk="$( "$@" )" ;; "-2") ( exec 4>&1 ; junk="$( { "$@" ; } 2>&1 1>&4 )" ) ;; "-12") junk="$( { "$@" ; } 2>&1 )" ;; *) warn "Incorrect use of nooutput" ;; esac } # check_pax path_to_pax # Check whether pax exists and supports the command line options # and input format that we will want to use. # check_pax() { local pax="$1" echo ". type=dir optional" | nooutput -12 "${pax}" -r -w -M -pe . } # check_mtree path_to_mtree # Check whether mtree exists and supports the command line options # and input format that we will want to use. # check_mtree() { local mtree="$1" echo ". type=dir optional" | nooutput -12 "${mtree}" -e -U } # setup args... # Parse command line arguments, exit on error. # Callers should shift $((OPTIND - 1)) afterwards. # setup() { PATH=/sbin:/usr/sbin:/bin:/usr/bin:/rescue : ${HOST_SH:=sh} : ${TOOL_MKNOD:=mknod} : ${TOOL_MTREE:=mtree} : ${TOOL_PAX:=pax} status=0 do_create_mfs=false do_force=false do_mknod=false do_pax=false do_mtree=false do_redirect=false do_specfile=false do_update=false opts= while getopts Mfm:p:st:u ch; do # Note that $opts is only for options pased through to # MAKEDEV.local, not for all options. case ${ch} in M) # "-M" sets do_create_mfs; # "-M -M" is for use from init(8), and sets do_redirect do_redirect=$do_create_mfs do_create_mfs=true ;; f) do_force=true opts="${opts} -f" ;; m) TOOL_MKNOD=${OPTARG} do_mknod=true opts="${opts} -m ${OPTARG}" ;; p) TOOL_PAX="${OPTARG}" if check_pax "${TOOL_PAX}"; then do_pax=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -p option:" \ "${TOOL_PAX} is missing or broken" do_mknod=true fi ;; s) do_specfile=true opts="${opts} -s" ;; t) TOOL_MTREE="${OPTARG}" if check_mtree "${TOOL_MTREE}"; then do_mtree=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -t option:" \ "${TOOL_MTREE} is missing or broken" do_mknod=true fi ;; u) do_update=true opts="${opts} -u" ;; *) usage ;; esac done shift $((${OPTIND} - 1)) [ $# -gt 0 ] || usage u_root="0" u_uucp="66" g_gpio="29" g_kmem="2" g_ntpd="15" g_nvmm="34" g_operator="5" g_wheel="0" dialin=0 dialout=524288 callunit=262144 # only allow read&write for owner by default umask 077 # Set fdesc_mounted=true if the fdesc file system is mounted # on the current directory (typically "/dev"). # Later, this will be used to suppress creation of device nodes # that are supplied by the fdesc file system. # fdesc_mounted=false if [ -d fd ]; then # Parse the output from "mount -u -o nosuchoption .". # We don't parse the output from df(1) because that's # less likely to be available on install media. # # If the current directory is a mount point for the # fdesc file system, then the expected output (whether # or not the current user is root) is: # mount_fdesc: -o suchoption: option not supported. # # If the current directory is not a mount point, then # the expected output is: # mount: .: unknown special file or file system. # # If we are not running on NetBSD, or mount(8) is not # found, then we should get some other error message. # case "$({ LC_ALL=C mount -u -o nosuchoption . ; } 2>&1)" in *mount_fdesc*) fdesc_mounted=true ;; esac fi # do_force requires mknod if $do_force; then if $do_mtree || $do_pax || $do_specfile; then die "-f option works only with mknod" fi do_mknod=true fi # do_force and do_update do not work together if $do_force && $do_update; then die "-f and -u options do not work together" fi # If no explicit method was specified on the command line or # forced above, then use one of mtree, pax, or mknod, in that # order of preference. # # mtree is preferred because it's fast and designed for the # purpose. However, it's unlikely to be available early in the # boot sequence, when init(8) may invoke MAKEDEV(8). # # pax is usually acceptable, and it's likely to be available # early in the boot sequence. However, it's much slower than mtree. # # mknod is just very slow, because the shell has to fork for # each device node. # case ",${do_mtree},,${do_pax},,${do_mknod},,${do_specfile}," in ( ,false,,false,,false,,false, ) if check_mtree "${TOOL_MTREE}"; then do_mtree=true elif check_pax "${TOOL_PAX}"; then do_pax=true else do_mknod=true fi ;; ( *,true,*,true,* ) die "-m, -p, -s, and -t options are mutually exclusive" ;; esac # If we are using mknod, then decide what options to pass it. MKNOD="${TOOL_MKNOD:-mknod} -F netbsd" if $do_mknod; then if $do_force; then MKNOD="${MKNOD} -R" else MKNOD="${MKNOD} -r" fi fi # do_mtree or do_pax internally implies do_specfile. # This happens after checking for mutually-exclusive options. if $do_mtree || $do_pax && ! $do_specfile; then do_specfile=true opts="${opts} -s" fi } # specfile_before # This is called before the bulk of the makedev processing, # if do_specfile is set. # # It simply prints ". type=dir optional", which must be the # first line of the specfile. # specfile_before() { echo ". type=dir optional" } # mtree_after # Output in specfile format is piped into this function. # # It uses mtree to create the devices defined in the specfile. # mtree_after() { nooutput -1 "${TOOL_MTREE}" -e -U } # pax_after # Output in specfile format is piped into this function. # # It uses pax to create the devices defined in the specfile. # pax_after() { # Run pax in an empty directory, so it pays # attention only to the specfile, without being # confused by the existing contents of the target # directory. Without this, pax would complain "file # would overwrite itself" for already-existing # device nodes. tmpdir=./tmp.$$ mkdir "${tmpdir}" || die "can't create temporary directory" cd "${tmpdir}" || die "can't cd to temporary directory" "${TOOL_PAX}" -r -w -M -pe .. pax_status=$? cd .. # back to where we started rmdir "${tmpdir}" return $pax_status } # makedev_main makedev_name args... # Perform most of the work of the main program. makedev_name # is typically "makedev", but may be the name of some other # makedev-like function (if we are invoked from MAKEDEV.local or # some other script). The other args to this function are the # command line args with which the MAKEDEV (or MAKEDEV.local) # script was invoked. # makedev_main() { local makedev="$1" ; shift # Parse command line args setup ${1+"$@"} shift $((${OPTIND}-1)) if $do_create_mfs; then # Count inodes and create mfs file system. # The makedev call merely updates $count_nodes. count_nodes=0 $makedev ${1+"$@"} create_mfs_dev $count_nodes unset count_nodes fi # Set before, middle, and after variables, so we can do # something like "( $before && $middle ) | $after", # except it will have to be more complex so we can capture # the exit status from both sides of the pipe. # if $do_specfile; then before=specfile_before else before=: fi middle='$makedev ${1+"$@"} && (exit $status)' if $do_mtree; then after=mtree_after elif $do_pax ; then after=pax_after else after=cat fi # Actually perform the "{ $before && $middle } | $after" commands. # # We go to some trouble to ensure that, if any of # $before, $middle, or $after fails, then we also # exit with a non-zero status. # # In the block below, fd 3 is a copy of the original stdout, # and fd 4 goes to a subshell that analyses the exit status # status from the other commands. # { exec 3>&1; { { eval "$before" && eval "$middle"; echo $? >&4; } \ | { eval "$after"; echo $? >&4; } \ } 4>&1 1>&3 \ | ( read status1; read status2; case "$status1,$status2" in 0,0) exit 0;; 0,*) exit $status2;; *,*) exit $status1;; esac ) } } # # functions available to create nodes: # # mkdev name [b|c] major minor [mode{=600} [gid{=0} [uid{=0}]]] # create device node `name' with the appropriate permissions # # lndev src target # create a symlink from src to target # # makedir dir mode # create directory with appropriate mode # mkdev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then case $2 in b) type=block ;; c) type=char ;; esac echo "./$1 type=${type} device=netbsd,$3,$4 mode=${5:-600} gid=${6:-$g_wheel} uid=${7:-$u_root}" else ${MKNOD} -m ${5:-600} -g \#${6:-$g_wheel} -u \#${7:-$u_root} $1 $2 $3 $4 fi } lndev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $2; then return fi if $do_specfile; then echo "./$2 type=link link=$1 mode=0700 gid=$g_wheel uid=$u_root" else ln -f -s $1 $2 fi } makedir() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then echo "./$1 type=dir mode=$2 gid=$g_wheel uid=$u_root" else nooutput -2 mkdir $1 chmod $2 $1 fi } warn() { echo 1>&2 "$0: $*" status=1 } die() { echo 1>&2 "$0: $*" exit 1 } # makedev special [...] # the main loop # makedev() { for i do case $i in # As of 2005-03-15, the "init" case must not create more than 1024 entries. all_md) makedev std wscons wt0 fd0 fd1 makedev wd0 wd1 wd2 wd3 wd4 wd5 wd6 wd7 makedev sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 makedev flash0 flash1 flash2 flash3 flash4 flash5 flash6 flash7 makedev tty0 tty1 tty2 tty3 makedev st0 st1 ch0 cd0 cd1 mcd0 vnd0 makedev bpf makedev ccd0 md0 random makedev cgd0 cgd1 makedev amr0 iop0 mfi0 mlx0 mly0 dpti0 dpt0 twe0 icp0 makedev ed0 ed1 makedev nvme0 nvme0ns1 nvme0ns2 nvme0ns3 nvme0ns4 makedev nvme1 nvme1ns1 nvme1ns2 nvme1ns3 nvme1ns4 makedev nvme2 nvme2ns1 nvme2ns2 nvme2ns3 nvme2ns4 makedev nvme3 nvme3ns1 nvme3ns2 nvme3ns3 nvme3ns4 makedev raid0 raid1 raid2 raid3 makedev ld0 ld1 ld2 ld3 ld4 ld5 ld6 ld7 makedev xbd0 xbd1 xbd2 xbd3 xen makedev usbs makedev ipty makedev local makedev lpa0 lpa1 lpa2 makedev lpt0 lpt1 lpt2 makedev ss0 uk0 uk1 makedev speaker joy0 joy1 makedev apm makedev cmos makedev audio makedev radio makedev music rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 makedev scsibus0 scsibus1 scsibus2 scsibus3 makedev ses0 ses1 ses2 ses3 makedev sysmon makedev bktr makedev tprof makedev ttyCZ0 ttyCY0 makedev agp0 makedev pci0 pci1 pci2 pci3 pci4 pci5 pci6 pci7 makedev pci8 pci9 pci10 pci11 pci12 pci13 pci14 makedev pci15 pci16 pci17 pci18 pci19 makedev altq makedev cir0 cir1 irframe0 irframe1 makedev dmoverio makedev kttcp makedev nsmb makedev io makedev bio makedev cfs ;; xen) makedev xenevt xencons xsd_kva ;; floppy) makedev std bpf wt0 fd0 fd1 wd0 wd1 wd2 wd3 sd0 sd1 sd2 sd3 sd4 st0 st1 makedev tty0 tty1 tty2 cd0 cd1 mcd0 ttyv0 opty ld0 ld1 ld2 ld3 ed0 ed1 ;; ramdisk) makedev floppy md0 ;; all) makedev all_md makedev std fd ptm makedev dk0 dk1 dk2 dk3 dk4 dk5 dk6 dk7 makedev dk8 dk9 dk10 dk11 dk12 dk13 dk14 dk15 makedev dk16 dk17 dk18 dk19 dk20 dk21 dk22 dk23 makedev dk24 dk25 dk26 dk27 dk28 dk29 dk30 dk31 makedev ccd0 ccd1 ccd2 ccd3 makedev cgd0 cgd1 cgd2 cgd3 makedev filemon makedev fss0 fss1 fss2 fss3 makedev md0 md1 makedev raid0 raid1 raid2 raid3 raid4 raid5 raid6 raid7 makedev vnd0 vnd1 vnd2 vnd3 makedev iscsi0 makedev bpf npf makedev tun0 tun1 tun2 tun3 makedev ipl pf crypto random makedev lockstat clockctl cpuctl makedev atabus0 atabus1 atabus2 atabus3 atabus4 atabus5 atabus6 atabus7 makedev srt0 srt1 srt2 srt3 makedev tap tap0 tap1 tap2 tap3 makedev gpio gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 makedev gpiopps0 makedev pad pad0 pad1 pad2 pad3 makedev bthub makedev putter makedev drvctl makedev video makedev dtv makedev drm0 drm1 drm2 drm3 makedev altmem makedev zfs makedev lua makedev hdmicec0 makedev dtrace makedev veriexec makedev autofs makedev fw0 fw1 fw2 fw3 makedev ipmi0 makedev local # do this last ;; init) # unless overridden by MD entry, this is equal to 'all' makedev all opty ;; audio) makedev audio0 audio1 audio2 audio3 makedev hdaudio0 hdaudio1 hdaudio2 hdaudio3 lndev sound0 sound lndev audio0 audio lndev mixer0 mixer lndev audioctl0 audioctl ;; gpio) makedev gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 lndev gpio0 gpio ;; gpiopps) makedev gpiopps0 lndev gpiopps0 gpiopps ;; lua) makedev lua0 lndev lua0 lua ;; pad) makedev pad0 pad1 pad2 pad3 lndev pad0 pad ;; qemufwcfg) makedev qemufwcfg0 lndev qemufwcfg0 qemufwcfg ;; radio) makedev radio0 radio1 lndev radio0 radio ;; video) makedev video0 video1 video2 video3 ;; dtv) makedev dtv0 dtv1 dtv2 dtv3 ;; iic) makedev iic0 iic1 iic2 iic3 ;; altmem) makedev altmem0 altmem1 ;; ramdisk) makedev floppy md0 ;; usbs) makedev usb usb0 usb1 usb2 usb3 usb4 usb5 usb6 usb7 makedev usb8 usb9 usb10 usb11 usb12 usb13 usb14 usb15 makedev uhid0 uhid1 uhid2 uhid3 uhid4 uhid5 makedev uhid6 uhid7 uhid8 uhid9 uhid10 uhid11 makedev uhid12 uhid13 uhid14 uhid15 makedev ulpt0 ulpt1 makedev ttyU0 ttyU1 ttyU2 ttyU3 ttyU4 ttyU5 ttyU6 ttyU7 makedev ttyY0 ttyY1 makedev ttyHS0 makedev urio0 makedev uscanner0 uscanner1 makedev utoppy0 utoppy1 makedev ugen0 ugen1 ugen2 ugen3 ;; std) mkdev console c 0 0 600 mkdev constty c 0 1 600 mkdev drum c 4 0 640 $g_kmem mkdev kmem c 2 1 640 $g_kmem mkdev mem c 2 0 640 $g_kmem mkdev null c 2 2 666 mkdev full c 2 11 666 mkdev zero c 2 12 666 mkdev klog c 7 0 600 mkdev ksyms c 101 0 440 $g_kmem mkdev random c 46 0 444 mkdev urandom c 46 1 644 if ! $fdesc_mounted; then mkdev tty c 1 0 666 mkdev stdin c 22 0 666 mkdev stdout c 22 1 666 mkdev stderr c 22 2 666 fi ;; usb) mkdev usb c 55 255 444 ;; usb[0-9]*) unit=${i#usb} usb=usb$unit mkdev usb$unit c 55 $unit ;; uhid[0-9]*) unit=${i#uhid} mkdev uhid$unit c 56 $unit 666 ;; ulpt[0-9]*) unit=${i#ulpt} mkdev ulpt$unit c 57 $unit mkdev ulpn$unit c 57 $(($unit + 64)) ;; urio[0-9]*) unit=${i#urio} mkdev urio$unit c 70 $unit 666 ;; uscanner[0-9]*) unit=${i#uscanner} mkdev uscanner$unit c 75 $unit ;; utoppy[0-9]*) unit=${i#utoppy} mkdev utoppy$unit c 174 $unit ;; ttyHS[0-9]*) unit=${i#ttyHS} for j in 00 01 02 03 04 05 06 07 08 09 10 do base=$(($unit * 16 + ${j#0})) mkdev ttyHS$unit.$j c 196 $(($base + $dialin )) "" "" $u_uucp mkdev dtyHS$unit.$j c 196 $(($base + $dialout )) "" "" $u_uucp mkdev ctyHS$unit.$j c 196 $(($base + $callunit)) "" "" $u_uucp done ;; ttyY[0-9]*) unit=${i#ttyY} mkdev ttyY$unit c 172 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyY$unit c 172 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyY$unit c 172 $(($unit + $callunit)) "" "" $u_uucp ;; ucom[0-9]*) makedev ttyU${i#ucom} ;; ttyU[0-9]*) unit=${i#ttyU} mkdev ttyU$unit c 66 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyU$unit c 66 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyU$unit c 66 $(($unit + $callunit)) "" "" $u_uucp ;; ugen[0-9]*) unit=${i#ugen} for j in 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 do mkdev ugen$unit.$j c 64 $(($unit * 16 + ${j#0})) done ;; wscons) makedev ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 makedev ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 ttyF6 ttyF7 makedev ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 makedev ttyH0 ttyH1 ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 makedev wsmouse0 wsmouse1 wsmouse2 wsmouse3 makedev wskbd0 wskbd1 wskbd2 wskbd3 makedev wsmux0 wsmux1 wsmux2 wsmux3 makedev wsmouse wskbd makedev ttyEcfg ttyEstat makedev ttyFcfg ttyFstat makedev ttyGcfg ttyGstat makedev ttyHcfg ttyHstat makedev wsfont ;; wsmouse) mkdev wsmouse c 65 0 ;; wskbd) mkdev wskbd c 65 1 ;; wsmux[0-9]*) unit=${i#wsmux} mkdev wsmux$unit c 65 $unit mkdev wsmuxctl$unit c 65 $(($unit + 128)) 200 ;; xenevt) mkdev xenevt c 141 0 ;; xsd_kva) mkdev xsd_kva c 141 1 ;; xencons) mkdev xencons c 143 0 ;; ttyEstat) mkdev ttyEstat c 47 254 ;; ttyEcfg) mkdev ttyEcfg c 47 255 ;; ttyE[0-9]*) unit=${i#ttyE} mkdev ttyE$unit c 47 $unit ;; ttyFstat) mkdev ttyFstat c 47 510 ;; ttyFcfg) mkdev ttyFcfg c 47 511 ;; ttyF[0-9]*) unit=${i#ttyF} mkdev ttyF$unit c 47 $(($unit + 256)) ;; ttyGstat) mkdev ttyGstat c 47 766 ;; ttyGcfg) mkdev ttyGcfg c 47 767 ;; ttyG[0-9]*) unit=${i#ttyG} mkdev ttyG$unit c 47 $(($unit + 512)) ;; ttyHstat) mkdev ttyHstat c 47 1022 ;; ttyHcfg) mkdev ttyHcfg c 47 1023 ;; ttyH[0-9]*) unit=${i#ttyH} mkdev ttyH$unit c 47 $(($unit + 768)) ;; wsmouse[0-9]*) unit=${i#wsmouse} mkdev wsmouse$unit c 49 $unit ;; wskbd[0-9]*) unit=${i#wskbd} mkdev wskbd$unit c 48 $unit ;; fd) if ! $fdesc_mounted; then # Create the "fd" subdirectory, and devices "fd/0" to "fd/63" makedir fd 755 n=0 while [ $n -lt 64 ] do mkdev fd/$n c 22 $n 666 n=$(($n + 1)) done fi ;; wt[0-9]*) name=wt; unit=${i#wt}; chr=10; blk=3 for sub in $unit $(($unit+8)) $(($unit+16)) do mkdev $name$sub b $blk $(($sub + 0)) 660 $g_operator mkdev n$name$sub b $blk $(($sub + 4)) 660 $g_operator mkdev r$name$sub c $chr $(($sub + 0)) 660 $g_operator mkdev nr$name$sub c $chr $(($sub + 4)) 660 $g_operator done ;; md[0-9]*) makedisk_minimal md ${i#md} 17 24 ;; fss[0-9]*) name=fss; unit=${i#fss}; blk=163; chr=163 mkdev $name$unit b $blk $unit 660 $g_operator mkdev r$name$unit c $chr $unit 660 $g_operator ;; ss[0-9]*) name=ss; unit=${i#ss}; chr=19 mkdev $name$unit c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev n$name$unit c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev en$name$unit c $chr $(($unit * 16 + 3)) 640 $g_operator ;; ccd[0-9]*|cgd[0-9]*|raid[0-9]*|vnd[0-9]*) case $i in ccd*) name=ccd; unit=${i#ccd}; blk=16; chr=18;; cgd*) name=cgd; unit=${i#cgd}; blk=21; chr=93;; raid*) name=raid; unit=${i#raid}; blk=18; chr=62;; vnd*) name=vnd; unit=${i#vnd}; blk=14; chr=41;; esac makedisk_p16high $name $unit $blk $chr ;; sd[0-9]*) name=sd; unit=${i#sd}; blk=4; chr=13 makedisk_p16high $name $unit $blk $chr ;; wd[0-9]*) name=wd; unit=${i#wd}; blk=0; chr=3 makedisk_p16high $name $unit $blk $chr ;; fd[0-9]*) name=fd; unit=${i#fd}; blk=2; chr=9 makedisk_p16high $name $unit $blk $chr ;; ld[0-9]*) name=ld; unit=${i#ld}; blk=19; chr=69 makedisk_p16high $name $unit $blk $chr ;; flash[0-9]*) unit=${i#flash} flash=flash$unit mkdev flash$unit b 199 $unit mkdev rflash$unit c 199 $unit ;; spiflash[0-9]*) unit=${i#spiflash} spiflash=spiflash$unit mkdev spiflash$unit b 208 $unit mkdev rspiflash$unit c 208 $unit ;; altmem[0-9]*) name=altmem; unit=${i#altmem}; blk=182; chr=182 makedisk_p16high $name $unit $blk $chr ;; bio) mkdev bio c 181 0 ;; ed[0-9]*) name=ed; unit=${i#ed}; blk=20; chr=79 makedisk_p16high $name $unit $blk $chr ;; xbd[0-9]*) name=xbd; unit=${i#xbd}; blk=142; chr=142 makedisk_p16high $name $unit $blk $chr ;; dk[0-9]*) name=dk; unit=${i#dk}; blk=168; chr=168 mkdev r$name$unit c $chr $unit 0640 $g_operator mkdev $name$unit b $blk $unit 0640 $g_operator ;; tprof) mkdev tprof c 191 0 ;; ttyCY[0-9]*) # Each unit number creates 32 pairs of {tty,dty} device nodes: # ttyCY0 => device nodes [td]tyCY000 to [td]tyCY031; # ttyCY1 => device nodes [td]tyCY032 to [td]tyCY063; name=tyCY; chr=38; off=32 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=000$minor nminor=${nminor#${nminor%???}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; ttyCZ[0-9]*) # Each unit number creates 64 pairs of {tty,dty} device nodes: # ttyCZ0 => device nodes [td]tyCZ0000 to [td]tyCZ0063; # ttyCZ1 => device nodes [td]tyCZ0064 to [td]tyCZ0127; name=tyCZ; chr=73; off=64 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=0000$minor nminor=${nminor#${nminor%????}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; tty[0-9]*) unit=${i#tty} ounit=00$unit ounit=${ounit#${ounit%??}} mkdev tty$ounit c 8 $(($unit + $dialin )) "" "" $u_uucp mkdev dty$ounit c 8 $(($unit + $dialout)) "" "" $u_uucp ;; ttyC[0-9]*) # some archs call com_chr ttyC traditionally unit=${i#ttyC}; name=ttyC; dname=dtyC; chr=8 mkdev $name$unit c $chr $(($unit + $dialin )) "" "" $u_uucp mkdev $dname$unit c $chr $(($unit + $dialout)) "" "" $u_uucp ;; opty) # Create 16 device nodes, [pt]typ0 to [pt]typf, # same as "MAKEDEV pty0". for j in 0 1 2 3 4 5 6 7 8 9 a b c d e f do case $j in [0-9]) jn=$j ;; a) jn=10 ;; b) jn=11 ;; c) jn=12 ;; d) jn=13 ;; e) jn=14 ;; f) jn=15 ;; esac mkdev ttyp$j c 5 $jn 666 mkdev ptyp$j c 6 $jn 666 done ;; pty[0-9]*) # Each unit number creates up to 16 pairs of {tty,pty} device nodes: # pty0 => 16 pairs, [tp]typ0 to [tp]typf # pty1 => 16 pairs, [tp]tyq0 to [tp]tyqf # pty16 => 16 pairs, [tp]typg to [tp]typv # pty17 => 16 pairs, [tp]typw to [tp]typL # pty18 => 14 pairs, [tp]typM to [tp]typZ warn "$i: creating BSD style tty nodes with ptyfs is a security issue" class=${i#pty} d1="p q r s t u v w x y z P Q R S T" if [ "$class" -ge 64 ] then warn "$i: pty unit must be between 0 and 63" continue elif [ "$class" -lt 16 ] then # pty[p-zP-T][0-9a-f] offset=0 mult=0 d2="0 1 2 3 4 5 6 7 8 9 a b c d e f" else # pty[p-zP-T][g-zA-Z] class=$(($class - 16)) offset=256 mult=2 d2="g h i j k l m n o p q r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X Y Z" fi start=$(($class * 16)) set -- $d2 nt=$# s1=$(($start / $nt)) set -- $d1 shift $s1 t1=$1 if [ "$t1" = v ]; then warn "$i: pty unit conflicts with console ttyv0 device" continue fi s2=$(($start % ($nt - $s1 * $mult))) set -- $d2 shift $s2 t2=$1 unit=$(($start + $offset - $s1 * $mult)) end=$(($unit + 16)) while [ "$unit" -lt "$end" ] do mkdev tty$t1$t2 c 5 $unit 666 mkdev pty$t1$t2 c 6 $unit 666 shift t2=$1 if [ -z "$t2" ] then break fi unit=$(($unit + 1)) done ;; st[0-9]*) name=st; unit=${i#st}; chr=14; blk=5 mkdev $name$unit b $blk $(($unit * 16 + 0)) 660 $g_operator mkdev n$name$unit b $blk $(($unit * 16 + 1)) 660 $g_operator mkdev e$name$unit b $blk $(($unit * 16 + 2)) 660 $g_operator mkdev en$name$unit b $blk $(($unit * 16 + 3)) 660 $g_operator mkdev r$name$unit c $chr $(($unit * 16 + 0)) 660 $g_operator mkdev nr$name$unit c $chr $(($unit * 16 + 1)) 660 $g_operator mkdev er$name$unit c $chr $(($unit * 16 + 2)) 660 $g_operator mkdev enr$name$unit c $chr $(($unit * 16 + 3)) 660 $g_operator ;; ses[0-9]*|ch[0-9]*|uk[0-9]*) case $i in ch*) name=ch; unit=${i#ch}; chr=17;; uk*) name=uk; unit=${i#uk}; chr=20;; ses*) name=ses; unit=${i#ses}; chr=74;; esac mkdev $name$unit c $chr $unit 640 $g_operator ;; cd[0-9]*) makedisk_minimal cd ${i#cd} 6 15 ;; mcd[0-9]*) makedisk_minimal mcd ${i#mcd} 7 39 ;; lpt[0-9]*|lpa[0-9]*) case $i in lpt*) name=lpt; unit=${i#lpt}; chr=16; flags=0;; lpa*) name=lpa; unit=${i#lpa}; chr=16; flags=128;; esac mkdev $name$unit c $chr $(($unit + $flags)) mkdev lpt${unit}ctl c $chr $(($unit + 256)) ;; bpf) mkdev bpf c 23 0 lndev bpf bpf0 ;; npf) mkdev npf c 198 0 ;; bthub) mkdev bthub c 175 0 ;; tun[0-9]*) unit=${i#tun} mkdev tun$unit c 40 $unit ;; joy[0-9]*) unit=${i#joy} mkdev joy$unit c 26 $unit ;; ipl) mkdev ipl c 44 0 mkdev ipnat c 44 1 mkdev ipstate c 44 2 mkdev ipauth c 44 3 mkdev ipsync c 44 4 mkdev ipscan c 44 5 mkdev iplookup c 44 6 ;; pf) mkdev pf c 161 0 ;; crypto) mkdev crypto c 160 0 666 ;; cmos) mkdev cmos c 88 0 644 ;; speaker) mkdev speaker c 240 0 ;; lockstat) mkdev lockstat c 177 0 ;; cpuctl) mkdev cpuctl c 188 0 666 ;; audio|audio[0-9]*) unit=${i#audio} audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit : ${unit:-0} mkdev $sound c 42 $(($unit + 0)) 666 mkdev $audio c 42 $(($unit + 128)) 666 mkdev $mixer c 42 $(($unit + 16)) 666 mkdev $audioctl c 42 $(($unit + 192)) 666 ;; hdaudio[0-9]*) unit=${i#hdaudio} mkdev hdaudio$unit c 195 $unit 644 ;; hdmicec[0-9]*) uint=${i#hdmicec} mkdev hdmicec$unit c 340 $unit 644 ;; gpio[0-9]*) unit=${i#gpio} mkdev gpio$unit c 173 $unit 664 $g_gpio ;; gpiopps[0-9]*) unit=${i#gpiopps} mkdev gpiopps$unit c 344 $unit 664 $g_gpio ;; lua[0-9]*) unit=${i#lua} mkdev lua$unit c 209 $unit 664 ;; rmidi[0-9]*) unit=${i#rmidi} mkdev rmidi$unit c 58 $unit 666 ;; music|music[0-9]*) unit=${i#music} : ${unit:-0} mkdev music$unit c 59 $(($unit + 0)) 666 mkdev sequencer$unit c 59 $(($unit + 128)) 666 ;; radio|radio[0-9]*) unit=${i#radio} : ${unit:-0} mkdev radio$unit c 87 $unit 666 ;; video|video[0-9]*) unit=${i#video} : ${unit:-0} mkdev video$unit c 193 $unit 666 ;; dtv[0-9]*) unit=${i#dtv} makedir dvb 755 makedir dvb/adapter$unit 755 mkdev dvb/adapter$unit/frontend0 c 200 $(($unit + 0)) 666 mkdev dvb/adapter$unit/demux0 c 200 $(($unit + 16)) 666 mkdev dvb/adapter$unit/dvr0 c 200 $(($unit + 32)) 666 ;; iic[0-9]*) unit=${i#iic} : ${unit:-0} mkdev iic$unit c 201 $unit 600 ;; spi[0-9]*) unit=${i#spi} : ${unit:-0} mkdev spi$unit c 347 $unit 600 ;; amr[0-9]*) unit=${i#amr} mkdev amr$unit c 176 $unit ;; apm) mkdev apm c 21 0 644 mkdev apmctl c 21 8 644 ;; random) mkdev random c 46 0 444 mkdev urandom c 46 1 644 ;; cfs) makedev cfs0 ;; cfs[0-9]*) unit=${i#cfs} mkdev cfs$unit c 60 $unit ;; sysmon) mkdev sysmon c 67 0 644 mkdev watchdog c 67 1 644 mkdev power c 67 2 640 ;; scsibus[0-9]*) unit=${i#scsibus} mkdev scsibus$unit c 61 $unit 644 ;; bktr) makedev bktr0 bktr1 lndev bktr0 bktr lndev tuner0 tuner lndev vbi0 vbi ;; bktr[0-9]*) unit=${i#bktr} mkdev bktr$unit c 71 $(($unit + 0)) 444 mkdev tuner$unit c 71 $(($unit + 16)) 444 mkdev vbi$unit c 71 $(($unit + 32)) 444 ;; io) mkdev io c 2 14 600 ;; iop[0-9]*) unit=${i#iop} mkdev iop$unit c 76 $unit ;; mfi[0-9]*) unit=${i#mfi} mkdev mfi$unit c 205 $unit ;; mlx[0-9]*) unit=${i#mlx} mkdev mlx$unit c 78 $unit ;; mly[0-9]*) unit=${i#mly} mkdev mly$unit c 80 $unit ;; twa[0-9]*) unit=${i#twa} mkdev twa$unit c 187 $unit ;; twe[0-9]*) unit=${i#twe} mkdev twe$unit c 97 $unit ;; icp[0-9]*) unit=${i#icp} mkdev icp$unit c 102 $unit ;; agp[0-9]*) unit=${i#agp} mkdev agp$unit c 82 $unit 644 if [ "$unit" = "0" ]; then lndev agp$unit agpgart fi ;; pci[0-9]*) unit=${i#pci} mkdev pci$unit c 83 $unit 640 ;; dpti[0-9]*) unit=${i#dpti} mkdev dpti$unit c 84 $unit ;; dpt[0-9]*) unit=${i#dpt} mkdev dpt$unit c 96 $unit ;; altq) makedir altq 755 unit=0 for dev in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq jobs do mkdev altq/$dev c 77 $unit 644 unit=$(($unit + 1)) done ;; wsfont) mkdev wsfont c 81 0 ;; cir[0-9]*) unit=${i#cir} mkdev cir$unit c 86 $unit 666 ;; irframe[0-9]*) unit=${i#irframe} mkdev irframe$unit c 85 $unit ;; pad[0-9]*) unit=${i#pad} mkdev pad$unit c 189 $unit 444 ;; qemufwcfg[0-9]*) unit=${i#qemufwcfg} mkdev qemufwcfg$unit c 342 $unit 660 ;; clockctl) mkdev clockctl c 89 0 660 $g_ntpd ;; nsmb) makedev nsmb0 nsmb1 nsmb2 nsmb3 ;; nsmb[0-9]*) unit=${i#nsmb} mkdev nsmb$unit c 98 $unit 644 ;; kttcp) mkdev kttcp c 91 0 ;; dmoverio) mkdev dmoverio c 92 0 644 ;; veriexec) mkdev veriexec c 170 0 600 ;; ttyv[0-9]*) unit=${i#ttyv} mkdev ttyv$unit c 12 $unit ;; # arm, acorn32 mouse-pms[0-9]*|mouse-qms[0-9]*) case $i in mouse-pms*) name=pms ;; mouse-qms*) name=qms ;; esac unit=${i#mouse-${name}} lndev $name$unit mouse ;; ipty) mkdev ttyp0 c 5 0 666 mkdev ttyp1 c 5 1 666 mkdev ptyp0 c 6 0 666 mkdev ptyp1 c 6 1 666 ;; ptm) makedir pts 755 mkdev ptmx c 165 0 666 mkdev ptm c 165 1 666 ;; atabus[0-9]*) unit=${i#atabus} mkdev atabus$unit c 166 $unit 644 ;; drm[0-9]*) unit=${i#drm} makedir dri 755 mkdev dri/card$unit c 180 $unit 660 ;; drvctl) mkdev drvctl c 167 0 644 ;; isv) mkdev isv c 192 0 644 ;; tap|tap[0-9]*) unit=${i#tap} case "$unit" in [0-9]*) mkdev tap${unit} c 169 ${unit} 600 ;; "") mkdev tap c 169 0xfffff 600 ;; esac ;; srt[0-9]*) unit=${i#srt} mkdev srt$unit c 179 $unit 600 ;; tpm) mkdev tpm c 204 0 600 ;; dtrace) makedir dtrace 755 mkdev dtrace/dtrace c 207 0 600 ;; filemon) mkdev filemon c 202 0 666 ;; fw[0-9]*) unit=${i#fw} for j in 0 1 2 3 do mkdev fw${unit}.${j} c 171 $((${unit} * 256 + ${j})) 660 ${g_operator} mkdev fwmem${unit}.${j} c 171 $((65536 + ${unit} * 256 + ${j})) 660 ${g_operator} done ;; # create putter device and symlinks for all subsystems using it putter) mkdev putter c 178 0 600 mkdev pud c 178 1 600 lndev putter puffs ;; zfs) mkdev zfs c 190 0 600 makedir zpool 755 ;; iscsi[0-9]*) unit=${i#iscsi} mkdev iscsi${unit} c 203 $unit 600 ;; nvme[0-9]*ns[0-9]*) unit=${i#nvme} unit=${unit%ns*} subunit=${i#nvme${unit}ns} if [ 0$subunit -le 0 ] || [ 0$subunit -ge 65536 ]; then warn "bad nsid for $i: $subunit" break fi mkdev nvme${unit}ns$subunit c 341 $(($unit * 65536 + $subunit)) ;; nvme[0-9]*) unit=${i#nvme} mkdev nvme$unit c 341 $(($unit * 65536)) ;; nvmm) mkdev nvmm c 345 0 640 $g_nvmm ;; autofs) mkdev autofs c 343 0 600 ;; kcov) mkdev kcov c 346 0 ;; ipmi[0-9]*) unit=${i#ipmi} mkdev ipmi${unit} c 354 $unit 600 ;; local) if [ -f "$0.local" ]; then umask 0 if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + \ $(linecount "$("$HOST_SH" "$0.local" $opts -s all)") )) else "$HOST_SH" "$0.local" $opts all fi umask 077 fi ;; *) warn "$i: unknown device" ;; esac done } # three variants of disk partitions - max 8, max 16, max 16 with highpartoffset # hack; only the one used by port is retained in final MAKEDEV script # routine is called as: # makedisk name unit blk chr makedisk_p8() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator } makedisk_p12high() { ho=524280 # offset for partition 9 to 11 (same as ...p16high) name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator } makedisk_p16() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 16 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 16 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 16 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 16 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 16 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 16 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 16 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 16 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 16 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 16 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 16 + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 16 + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 16 + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 16 + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 16 + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 16 + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 16 + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 16 + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 16 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 16 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 16 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 16 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 16 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 16 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 16 + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 16 + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 16 + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 16 + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 16 + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 16 + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 16 + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 16 + 15)) 640 $g_operator } makedisk_p16high() { ho=524280 # offset for partition 9 to 16 name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 8 + $ho + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 8 + $ho + 15)) 640 $g_operator } # make only the very few basic disk device nodes - 'a' partition # and raw partition makedisk_minimal() { name=$1; unit=$2; blk=$3; chr=$4 doff=8 ro=3 rn=d mkdev ${name}${unit} b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * $doff + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * $doff + 0)) 640 $g_operator mkdev ${name}${unit}$rn b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * $doff + 0)) 640 $g_operator mkdev r${name}${unit}$rn c $chr $(($unit * $doff + $ro)) 640 $g_operator } # create_mfs_dev nodes # Create a memory file system for a given number of device nodes, # and mount it. Attempts to use mount_tmpfs, or falls back to # mount_mfs. # # If do_redirect, then also redirect output to the console. # create_mfs_dev() { ndevnodes=${1-1200} dev_mountpoint=${PWD:-/dev} # Number of inodes is the specified number of device nodes, plus # a margin to allow for extra device nodes created later. ninode=$((ndevnodes * 11 / 10)) # Add 2 reserved inodes (needed for both mfs and tmpfs), and round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev . ..group master.passwd netconfig protocolsservices dhcpcd.confwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/bin/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - -  . .. dhcpcd-hooks lfs_cleanerddhcpcd-run-hooks# $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostname# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search, host_name option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private omain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if type "$resolvconf" >/dev/null 2>&1; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if type "$resolvconf" >/dev/null 2>&1; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi  ... ...#!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if type sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if type sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if type cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif type diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if type logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try and guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do for skip in $skip_hooks; do case "$hook" in */*~) continue 2;; */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook" fi done # Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" NL=" " : ${resolvconf:=resolvconf} build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify ${srvs}); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_d# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=localhost} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if type hostname >/dev/null 2>&1; then hostname elif [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi # Always prefer hostname(1) if we have it if type hostname >/dev/null 2>&1; then hostname "$1" elif [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" else # We know this will fail, but it will now fail # with an error to stdout hostname "$1" fi } set_hostname_vars() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" case "$hostname" in ""|"(none)"|localhost|localhost.localdomain|"$hostname_default") return 0;; esac case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac set_hostname_vars if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { need_hostname || return set_hostname_vars if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif [ -n "${hostname_default+x}" ]; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_up; then set_hostname fi ... . ..dkctlfdiskmbrlabel mount_lfs mount_ntfs newfs_lfsraidctlrestorerrestorescsictlshutdownslattachsysctlchown disklabeldmesgfsckfsck_ffs gptifconfiginitmknodmount mount_cd9660 mount_ext2fs$ mount_ffs mount_msdos mount_nfs mount_tmpfsnewfs mount_mfs newfs_ext2fspingreboothaltrouteswapctlumountdhcpcdping6 ... ... . .. bin!mdec"sbin#share . ..lessmore tip tar ftpgzipgzcatgunzip sedhprogress! . ..$boot% bootxx_ffsv1& bootxx_ffsv2' bootxx_lfsv2( mbr)mbr_ext* mbr_bootsel+` gptmbr.bin~fҶxx%Ȏff|Ѷxuf xvxfXfм"f^"X8L)1 u1USR_ W"Pd^dBoot2 failed: 6"UE7]U=Vt]X]Ã=xV~hPUE09]PUS M MM9uO MX]UhO9h@B)'O'h[9US]hm9SZYu KLhcFSZYthu9SZYu K!h~9SZYtE9]]UWVS]E 9Mu M}Ph9j(hLELMuM} Muj:Si^X)؉E'~ h9S ZY9u6E@PShLd ELEE_ a<w1ҊLB a<vƂL9U~N 0c woU1k BDt A< wU9U~Qdw;Ua11ɸ9Uu"ELE0E_;tE1e[^_]US ];uF_6Mt5M5MPh9MaP5M5Mh9yj:SZYu h7X^EPhMhMEPEPSuj(uh@L M@Lh9u ;Eu MM]UEPEPEPEPEPux9uWh9u UYY9uuPh9jPhLc"uEaPuRh9jPhL?LUVSÉsPbVPh:h/1=TPVjS y$5TSVPh4:< h :-Xe[^]USEPEPu[ t@EUtW/uK1ۋ!Uu:De[^_]UWVSDÉ׉ƊtB< t< u7hSR)ރ Ӂw Ƅ5Fj:S-ZYt6x/uSh3<hh@MOUpVV";/uSWh <hh@MSShKWh;hh@M@Me[^_]UWVSSÉMjP>^ZMtJNustoW'Mj3XZMtJNuKtG3h<[_7u33h<W3t Wh6<ZYhDXe[^_]UWVS8U<<tA<tG< U@B1d1cu011Rjc1PVhO<j@hK&t"R1PVhj<j@hKT11ɍ8ƒu CFdxPR4ZY@4tEЃ}u0u+43h<4R0CF CR\Y[ lbTuh<BjMXZWjP=PNT(@T Dž,Dž0 {8|4@LN%LNhP4Gǃ 9C~!JNt3h<YXh<T@(,,\0jO3R$LN$BXzT C<tr <uBPBPBPBPJNu hDZ~=LN4X[ TLNP t4<uDPVh< e[^_]UWVutTTTT^_]U1ҋE]UE]UE]UE]UWVS ]} ;tIKuԉ9t#/uu 9t FCـ>t h<X;/uC벍e[^_]UWVSSƉ׉M](FME} P-PSV薩 t@PSYt jP?XZBZBCCLNT1e[^_]UWVSR}< uG< t Åt#W pXu jE =e[^_]VWRULUsC$M u$MPtXe[^_]UWVSL|\Uj jh`UCEHNjj]S = M}ľe= DElEE EjMSEP u Pu܋E E E}P-@$Suۧ tPa]+] SZt jP~Y_T TjjhTBA{@u܋EELNT Suu MUE OEEE5\U=E̋EEЋEEԋEEZ=Kt"EGTt5PNj PB $M1ۅtC@kP DNu h$=XFSjPd @NDNC5$M tjO6SDN@vPߡDNt5@Nj PoA EEEEEEjjEPMA9j8j hT:A}tUE %PEPju>hW=T1ҡ\U^\Ue[^_]UWVS uV ZÅuV_uVhn=Y[R}WjjMԍU؉ u1=KtE C E؉CEԉCC{SS(ZSS,Xe[^_]JNuUE PuXZUWVSH juZY1ۃhD WP Cvy:ubZZORuT0ECDCC$C(C,qjDRP  )9w1VX؍e[^_]US]CD0[]UWVS uxFCFC~ tIv|v rTЉUv vh=URPCW C Ttj@ETxU1ɡT@9~1MGXGTBUW UBB \MAXà Cu^ CX{ SH h+WPFp;1e[^_]US]CtPS ttRjC t 0Y0[]KUWVS@ff$!ADž%s %fDžsp pWjjԿp Cp pWVS裿d=!h"h"h"Wjjmpt) Ch"h"h"WVS==TDž1T;HWRHZt3HKOhKOdK @PRCPv 독A@A@A ycAUAUA A:9N1xksCC  Dž;HKPH SK Pt!w Ju.C,tuCCCCC뇅tAfTfAA fAAP PCP .T Tu u&PTP Y^OC(fCTT u-C C CPCCCC9SC TCTCTCTCCuCCt6ubTC TC!TC"TC#TC$TC%0fC 1 &T"!&T#"&T$=uؾ(@@Sj4VPgCjh=V,<t%<0.2$"&w sSC Kjp觾XZjDžQ9u-9u%WSQG 19ۋQоX4ph=ZY1Dž1jWRAh=ePh=Wu։h=:Ph=Wauut/jPVA 71tUjPEA pt" sKS PSA !tkA @ANuS@ HtAAu;A19t%9\t%B 111}7e[^_]UWVS,]C Eȍ}Ծ@"-\UEȋ@txtf.E1TuԍEP1ɉ+YFu݋ẼUȉBUȉpEMЃt,T}ԍEPZuoE9Ev h=&G̉FCppp ph>[CxEȋ@tx[ V[hb6SPW2e[^_]UWVSujV[_1ۃhWP 1Ɂ<9PR   *u0p~C0qC j0jP$C$ C(fC,j1WQż9׋u9t9?h)>sV 9th6>yFS )9vA8Of w)$`"BB BBBBB,xO볋B t @uhB>B,t@uhh>YSS,ZY1X؍e[^_]O&7u#fPfRf1ȣ"f1Ҍ҉"f)ff"f """"""f"f"fZfXfP." "5# ؎%"XPQjYYf0؎f#( f".."Ȏ؎"f+&"UFu]fXfþ#MBfF"Bprot_to_real can't return to X1f"D$`WÈfÉD$a`t$,fL$(D$0T$$\$8D$4Sf[f%D$a`R[s Àu1Of ȉD$a`fUAfrfU ȉD$a`ֈ}ff؎؃BÈf2ÉD$a`ֈIff؎شHfÉD$a`1ɺO11fa`fa1`f\$a1`1۴f\$a1`1۴fm\$aUSQRVWf1f tȉӝf:}1fȫfЫf_^ZY[]USQRVWEPAMS} -Wf_f fE1_^ZY[]USQRVWf$f_^ZY[]`ffЉD$aUSQRVW}Wf_Ofa%_^ZY[]USQRVWM} lWf_Of&%_^ZY[]USQRVW]@.Of%_^ZY[]USQRVW]Of%_^ZY[]USQRVW]U }Wf_ Of%_^ZY[]USQRVW1ǸOf_Ou_^ZY[]USQRVWU} UWf_Of %_^ZY[]USQRVWPf11r&G$u&o&Of KX_^ZY[]É1`r&&G$ufffЎشfL$aUSVWff\_^[]USVWfT$fL$lĈf31_^[]`Nf\$a`:ffD$a`"ffD$aUWVShj0S)؃ 19~02t!J tHJ@p@ C$̍e[^_]UVS1ۋPt $$u [^]eUVSƸ йÅt'h jP}3jS4t 1ۉ؍e[^]Ã=\Ut$Uj(jhT+jXkHߋ<pGGEG k$Ptj'PGPR GdhG8WPXh jP jjZVPP~耉VS#^_t h>YCt?t0Ph>ʩPh>躩h>Ph>蘩XZCtfhS?膩rnωjƉXrwvRPh>RPh?- hD ^{jj11ɉZY8DžHF FuHٍTt>Xt hA觨YFt8tPh ?菨XZHaPPh?q F tpF 4%h3<PhGA_Xh@5X1H$H2hD YPPtDžDD9T@CP]ps3h ?襧 {tCPh??莧XZ&C aPPHPhM?g C@SDHL1RVjhA9Lr4w9Hr*@11RPLHRPh>(11RPLHRPh?֦ hDɦS8K<@sDs@Pg P8DžHaF FF@t hAPYFt8tPh ?8XZH3hZ?" F tpF 4%h3<PhG_X>@rDPh=ϥZY1$HH{/u hD觥XPDHe[^_]UWVS<8DžHj'PLSj:StDžD 8Åuh>Xh jPDjS{jj11ɉ_Xus8G t]GtVuVٍHt'Y:Gt3LRPoYZu <k$ދ04kF$uFDDtDžD:F4LPGPZYQDHD9HOGÅW8O<@wDw@pXZuDž@k$< 8_@P@P+4LQP)ZY4kDH|<@k$048W8<O\UV@K4u@@ckDH|<@k$0480x8<MQ1e[^_]UWVSÉXTDžph;P^_9ujxWЀ w^Dž`k` |Љ`Hl@ύWЀ v؈ȃa<w 螠Åuh>聡YDždTh jP1;jSDuU{uOjj11ɉXZu8k$< 8t@uVٍptXFuȉGOlA\tDžll9p8`9FÅ V8N<@vDv@EUWVS]} ?sBS % @CЉS9}CCC҉SCCu KuHt {u]$uX$Puft4Pjjjj3tCCC1҉Ѝe[^_]W|$ L$f1_VWt$|$L$f1_^VWt$|$L$f1_^UEtH t u8t u@ t]USEP1#tBF9u6FP~ u>7ƅt2F뢋1WM9M@ ff%f=%x˯YC7@P>P ;wW4PV@p4t@PRVjpPƃWP /u DžƍVGI@SjD. Ke[^_]UWVSEUˋptHF19V>|9s8MUEu(}9vWuu1>V}) 1}tUe[^_]U]UWVSS}@Ettu3H"EHEp1)΋MqEPY[^_]UVSӋpj|jR蔮F CFCF$CFCXC\1e[^]UWVS$EU؋pFEEFF19VMUEE;E]؉E;]s]f{twtHC<w `)u huDrXQMЉUԍ{W腬MQURPU؍EdC랋E1VO9SEeEPee[^_]UWVSE1ɋE< Ew<w uEa<w 9u Au1ZY[^_]UWVSSƉӉ qVEPWE P1SQjvRe[^_]USË@t q<{q1[]UWVSƉӉMׁt\)] ;XtHjڋlZ^])U9vRU~Wu UU)U }E)Et! PMYu>]MM1t/ ;^tNjڋZu^Wvu蜬 1e[^_]UWVSÉ֋x41Ƀ L @( E uuUQMZu,[4 t Uу tUuʁe[^_]UWVSHƉӉ:/uC);kj/S葪ZYujS}ZY)ځ?RSP菫Ƅ G _~4 u G Éu;EtE u)=RunRu u~4 u F$uFFDžDžDžuF, ;F8~OF095j RJXm=Ru KG <$@u$ÍP;W ;G ؃?Hf?Kk 1))щ9t/ t Y_v?BJɃuu:11 A u;u, tY< uH1Ҋ B9}Ȁ t*. u 1ɀ 1Ҋ\\B9~Tuƅ单Dž 9VÅu8V4 t1H%9 RkR48/u81 ?؍e[^_]ËJB t}Ru @kUWVSSƉU1ۋEwV4 u$3;F8wUht&C̃J9v܋N1Y[^_]É1UWVS EU<jjËE=v#]E%ET]]EHURWu1؉RPjEpQEE9EGO11ӉMĉ]ȉEE8E8/uEEE9fFf;E^]]1ۋU 9]tQw UC9uۀ/tU؃ ֋UBPE]؍DEFN11ӉMĉ]ȋUfFf;Et %B9uw݋E܉U܉EEċUȃEЉU1E1uQEU[EHEPWhEЋURPjEpQQ}IĒu!9u %}uC ECurC!K M؋MMM؋M }t%u ;u )Qw 9u4E@̄u*>.u9x;uU@;u9u0 vE9u9uZjjPkEpFCFF C FFUZSvE 8EEEEEEUZEe[^_]U‹@BZ1]UWVS(XSs{;| ;Dž s{ u2;|;swXHPWhRPjpQS9uuʁw)ʉ{)9v Pޔ1 S) US/;|;v+1}tE1e[^_]U]UWVS}@ttu$HHpx)ω0xP[^_]US@B$BBHXJXZ\1[]UvE]JUtt]UWVSDE؉UMXCESEȉŰE슀$EEtEЋE싈EЋE싈EȋU tǃ w's t1щ9Krw9rE}t@@E##uЋE}t!Ɖu܉}EċE;u ;  t4.GEE;tvu!}?;E)}u׊M;}~勃EԋE1t`)U_UCSM؋QUURuԋMqψ t1WVjEpEPJEU9P6EMMԋ4}tMH!Edh}EԍPPuE uuj葐E܉ TTE|U؋z}썋Qu܉ψ t1WVjEpEPutEUĉE#Eȋ‹MU)‰UE׉CS [}EƉ)9}rw9uv)ȋ]1 e[^_]UWVS$EUBEX}u;tsH{L C4Ɖy t1U{shE1U؄ts|tƄtKKEЉUԋE1EUԋMQMUE9}Etpx @Ɖ t1 E؉U܋E苰`REH}WVsE؋URPjEpQ}9{u_tSd΋}9~tJt<ƀ} }LJLJLJ ~e[^_]USX@t.t SR:RC -R!R1[]UWVS0ƉzQhjP'H NQHP@Rh jjjqPǃ( 8b ЋAVYpڃtGaPRDž!Dž>V}) 1}tMe[^_]U]UWVS}@ttu$HHpx)ω0xP[^_]UVSӋpj|jR߇F CF|CCFVCXS\1e[^]UWVS EU܋pEF~9~MUEE=]؉E;]sVtHC<w *u huD_LXRMԉU؍{WMQURPU܍E>C륋E1V\ ;F_E>E>e[^_]UWVSBPx ug…t3{B눋1S7V;C6HF f%f=^}Y @PP 9~SF4P^G@4BORXRPjwQƒSP /u Dž8?zFS}E4 e[^_]UWVSEUˋptIV9V?|;Fs8MUEu(}9vWuu%~1>V}) 1}tMe[^_]U]UWVS}@ttu$HHpx)ω0xP[^_]UVSӋpj|jR|F CF|CCFVCXS\1e[^]UWVS EU܋pEF~9~MUEE=]؉E;]sVtHC<w @*u huDSAXRMԉU؍{WzMQURPU܍E3C륋E1V\ ;F_Ev3E3e[^_]UWVSEUBExE1U؉E䋇E܉ueGމ֋E1wxO`1Od t1É֋E싀E:?E@URuw0VSjMqPÃuTE9G0uGE1wxu֋Ex @ǀǀǀ ǀ$؍e[^_]UWVSLEȉUMXCEԋSEUEԋ8EEԋHPEU tEU}0|} w(Cu} t19{ |9rEԋ@0#E}@#GLE̋E9$uE9 H}|} wETD WEUEUEUE;u E;t s{ [M]EE+UM9]rw9v+uE01 e[^_]USX@t.t SR0;C ;(;1[]UWVS4(;h(jPvx :G:L SqQh Dž RPjpVƃua u@K9u;u \TtOT@0=~]=_vދJtʃ t F 9Dž!Dž8tTC(FF9u6FP(u uUƅt3?F됋1S;;C:zG f%f=:_rYK?@PPs 9(~ SG|P@@|F7@ƍPp0Hd t1RPjpVƃSPs /u DžƍK;Ge[^_]UWVSEUˋptIV 9V?|;Fs8MUEbu(}9vWuur1>V}) 1}tMe[^_]U]UWVS}@ttu$HHpx )ω0xP[^_]UVSӋpj|jRgqF CFCFCFV CXS\1e[^]UWVS EU܋pEF~ 9~MUEQE=]؉E;]sVtHC<w *u huD5XRMԉU؍{WtoMQURPU܍E'C륋E1V\ ;F_E (E>(e[^_]UWVSEUBExE1UO!O1֋G֋E1wxO`1Od t1É֋E싀E3E@URuw0VSjuvPÃuJE9G0u=E1wxu֋Ex ǀǀǀ؍e[^_]UWVS@E܉UMXCESẺUЋE싀8EEHPE̋U t Sp9{|9r }0}#UM@#qLuEĉuȋu;u ;  |4 EE;tE؍@uؿ E?9)Uu؉;U~狃Eԉ1u؋|`+2E܋@E؍EPuԋEp0CHdRWjEpEP'EM9H0E}ԋ=_3WttF/Dž!Dž8tTC(FF9u6FPj uuƅt3F됋1S;;C:q@ ff%f=X+hY/#@PPqi 9(~ S4Pt@p4,@Qw0OdRVjpPƃSPVi /u DžƍK;>@, ee[^_]UWVSEUˋptIV9V?|;Fs8MUEzu(}9vWuumh1>V}) 1}tMe[^_]U]UWVS}@ttu$HHpx)ω0xP[^_]UVSӋpj|jRgF CF|CCFVCXS\1e[^]UWVS EU܋pEF~9~MUEfE=]؉E;]sVtHC<w *u huD+XRMԉU؍{W%eMQURPU܍EMC륋E1V\ ;F_EEe[^_]UWVS@}u jjjW$Bu@j@]SW# u=hE*T_tP;PhC* hD*^@tDhE*T[tPPhC* hD*YTOjh=S6f u}uUuVSW/jh=Sf u}uUuVSWuEtF+PhEZXZ1Te[^_]UVSujV [ZyAuEVh.<)TZYtPPhC) 0hD)#uu PGƃ tS !5TX؍e[^]U]UWVS]uhjhUd|V Vju ǃxPWZY@uW [EЋUԃ|"v9|9sWp Y@'1uhE(WG XZ 3hRtW t~W XDžl1;ppt1< pQt<#u ppҋppttt7ty<=tUtyu(VFp`VtHt(9 ~=|V~ VV ~=|V~ 5xV=$Vy $V195$V8N5$V,t tt@jht;Sl] u*B<(VG:jhES.] u&l l9EtFFA^SuuvvU؋E@t~EȋU+EUFV1]UE@ZuȁuЋ]@]Su/UЋEEMHu؉p EbUЋEKuFfG8k8EEuPW O$EFZY@]EEEEEEEEG89E;CxtEEt`M AuC%E؉AS fF}tDRPhkFNs sss sU؋E @>EKt EEtXCSu NuM؉N9Ur w9EvEUC S$EЉUԋE9EwrE9Es EЋUԉEȉŰS C(s,9s$w6r9s0Et*)PhqF#NC S()RC%EPC S$EUC(S,9Uw:r9Es3Et*+EUEUԋE9EwrE9Es EЋUԉEȉUE8\UEVEȋŨƃuUEEE tEUEUE@UEUEUECEEG<E`uPW(O,EY^@E1EUEUG>f؋PHUM@ EEuTEEuPUMEl^Z@O>EU+EUD T Eȃ1EU3uuuuuUE@u)EEEEG;EuD3tjwHtlt8Y}Oj hvFE3PbQ 1#CD8uU;P$tA@;Mr EuKEU+EUD3T3D3 T3$|U|UEUET3 fF}thFRPhF9Kt3 uut3t3UEW @nE@ty|3$w|3 v[T3L3jEPEZY@}u6}u0}u*jh*EPU ujEPhUXU D3D3EFEt)uE%EPS薔 }u hAXJXU}tFUȋE9EEUE}UȋE]]E t/G G$G(@G,G6j@SW E%E؋uG%E؉FF ^uu؉wUE1EEe[^_]UWVSÉ΋}j1RPS Bu @uh F%WVSg t19tBTh6F9TZu hD%YPw PhC Ѝe[^_]UWVSƉ׋] j1RQPBu @uhKF0SURV҉ t19tBThYFTZu hDYP PhC{ Ѝe[^_]UWVSL} EE؋GU@U=fHtT8EXG0k(E'E̋W uԉEyZ@+]؉]GG 4G*%E؉Ej4PWӑEЋMԍ3ẼE EG09EFFE=ہ D 1ÉEċtuQuȋE%EP5YXN uuċU؋E/YZ@E+EЉF EȍDE1ÉE(ZMċ]EW09U}}twt3 uZ,E1Ƀ8uu;ptA(9|G29Et C ,sK VuċU؋EYZ@tqE+EЉC uEȃ(zuԋ]Ѓ4]SuKUԋEE}xE%E؋}G EUuFfG,EE̋WuЉEAZ@]EE1EG,9E';CtEEtSM AuC%E؉AKfFtDQPhkFEKssU؋E.@#1ҋCt EEt+sM Au %E؉A9uvus9usuԋKC9s6Et0U)PhqFDCK)QC%EP葎UċKC9sEt )9usuEȃ UЋEEԃEEE t E4EȋEȉEEEEG0k(E'ËW uĉEz^@[EEȉEG2ftrk(؋p@EEuAEEuЉE2Y@!G2k(U+UTEЃE+uủUEYZ@uEEEEG0E9E_G2;EJku(D3tjwHt+t8}j hvFE3P^H #C,8uU;PtA(;MrEu#E+ED3D3EEfF}thFt3PhF^BL3t3űUEm@uE@td|3vUT3jM܋EZ@}u6}u0}u*jh+EPL ujEPhUL D3EEt)uċE%EPSۋ }u hAAXUĉI}tCUЋE86EEUĉE}UЋEE%u؍0E t!GG 4G*j4SWB E%E؋uG%E؉FF ^E%E؉FUЋEEEe[^_]UWVSujVY_x8xPS_ZxE%=@uDžt SAXj/VkEXYthЉt)p@loDž#tBtpVWJpjW/ËljhDY_ty5TLPhF xPS_Zy5TPhF {E%=@tjPVh::Tk`X`Xu T 0t T-P Jt t hF6YSZe[^_]UWVSSË} u.ME ƅMu,uQuWhF XRQMS^ZMuCxEF~ uQWNIED t PWGZYy3ލe[^_]USÅu hh?t XsC PshF] u]ÅuUS1 ؅u[]UPhF& XZUSMkw `Xu T tT-`XH U QT[]UU19s f3B]UM +Bt 9 tQh Gj$hS SUEPuu uGUWVSW]E E߉);Eu Ge[^_]苂tY t tut't`tucTE e[^_]*9vOjj j j ^9sPFYj ZWwPԁXFUWVS]E CKpVu uII?u8t*t13Pt܍pWSEZYtXVSZYt뷀?uɍe[^_]Ãx<ucUSÃxuEThpDp@ C<=TtC8CCDKP]ÃUWVSÉ}ljtÉcuF8[^_]UWVS@u.4=u)CLƉǃu1&CL@tC 1{t C8Nut$Ɖƅt N@ut @wt x@wtf_C)~)~ FPv v@< t)FuK~<uEThvDu F<=Tt F8FFDjV= F8ZYHub~ )PSvH FH5É,9^Hu9Ft F8&V~8uV jjj?FH~8u ~<F )PSvH FHE+Fe[^_]UWVSQMqyA vT k`XuPWVƉ׃S{Lu*PWVQƉ׃u CtZc C1׋C19|j9vdjjj=Bu@7SSDjPjS,@j8huHjSL SDC@ C19|9)Ӊ|" vDžDžP ;u>;u6)h|2Y#TgTeY[^_]UWVS MU ukw`X`Xu T DEtOEUKEPURVsFV RPjsQTt*E1F^u{ PWTZu։+Ee[^_]UWVS 5`Xt*=|Xt(=Xt+=Xt.T`X"|XX XE @CC CCEEPuS'ǃ uwu{tkUt:ug1ɿ9 J~6kMEڋEMJMuMJK ,tAuC@ tSX=Te[^_]UWVSQMȋQIp kw`X`Xu T &t9t NuPHPHTgktXxXX VSYeY[^_]UWVSukw `Xu T c`XuW t R1k`X`XuRt WR Z1kdž`XtT tTe[^_]À=DXu,USPS|HP@wj9wXZUWVS HX1HXt19r tP9s׍QICu;4LsH\ 4Lv PRhH. B H e[^_]UHXHX]U=SuSE Pu hD)US1k`XtSXCu]UE PuXZáT;SsUPTU]W|$wUWVS,E̋]؉ƉEPWVQR1CMЊ,Kщ‰ uKPEЍEZ9we[^_]g_UWVS ljUˋuFF%tPX1NMQ$+~luNMu̓sPsCSuRXt sK syHڃىUMj-XUM.t sK1ɍsj@t sK1ɍsj 'Ej0jxY^Et sK1ɍsjwZZt QXKe[^_]UM UZ]US]TE DSMUT)[]UWVSUM1w/;us*} 7׉8uCu )߉1F̉ZY[^_]UWVS׉΋X{8t#{,uDK(C,C4C0'jK(Rp(P C8 uK,C89wQ)WP8C4;S4U)щ9vRU)QEP|8 U)tV)Ws8f8s4C,C0 1$C4ЉC4s,9uC4C019v‰S0ȍe[^_]Ut'x t!x$tHt;uA-4?1҃‰]US]SB CCCJ tK0B4?BBBB$B<B@4JpJTJPǂǂ[]US]uC@,@0@4[]/[]UWVSQu] u^~y/tSw7W8t9_(tERv(V$G8XZEG _(ue[^_]Qe[^_]UVSQ]U:1}8C{ uC C({$uC$hjs(S ƃ t?sF8F4?u SYZtEVs(S$CXZEe[^]Uuu ju+UWVSQ]M MuA[MyC<C@,"{@49 wJ#US?11{u,EU܉P UPUUP{9v"}MEE@ǃڃ!CD)CDCJ?CTEċK\ЉE̋E!Uč A‰E9v"},MEE@ǃƊfIfM̨utUԍ ҉UẺE̋E!ME̋Uč AE9v"}MEE@ǃ뾊fIfM̊M+uԋMʉMԈ+uԋU@tE@JỦSHCLCK?SLt>9v"}@MEE@ǃڃ!CH)CL?}E+ESH9vD)9S0stE@JSK4C89s ))C,)ȉE̋KD9v E)ЉE̋KDEE9vMԋM)M)KD1ɋE܋Ů A9MuMM܃{DCH?}SCDM܈MCH?@EC w"}MEUR׃ًM+MUJK t0t,U)ʋC{t QRPLQRP CMA0C tL{u#%%9CtE@5JCQ?EEEE11CO?{ tA{t;w}tGMEE@ǃ9{ tE@JJ11CP?EEEM܉H MHUMH{?t+T=>?t"U  …t2CR?+jjjVu P{9CtCЍe[^_]UVSu] uVB t Z$C0[^]UWVS uNj^~u {@{S?tJCS?C@cu!]̋Mt1F1EEF}̅u%tE1F1ɋE1E}utE1VԍYut #]E^ɋEɃ])كvrEUVbAEE )ÉE܋EM‹EOuOt #MFEEܹ )UE ‰U؋E؋U܉EUM)ύG!EԋEEȃ} u E}w9E +]ԋEȈE܋EM‹EË}ȊM@+MԋEE؍G}]Ȉ ߉}1ҋ]dɃ])كAEE] u ؉E1ҋ]+ +}ԉ؉E܋EM‹ENJM }܋E؉EEЉ‰EۉEM ϋM MĉM É]E ЉEЉEEЉEM]M]ЉȃEċE!ȉE#MЉMEU+EUEU]EMm}܋EȉE؋M؋]ۋE ȉE]tEUVEEEUDY[^_]VWST$L$1t8uЄtZB͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^USM1t#1ۋEU 8t) tC9u1[]UWVS]tSE"vSh7haJEpN uу v-upHEE+upHu@06u ;Ewu9M|FNEv} ue[^_]S\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^ËD$t8t9@€tuuuuH+D$VS\$ t$tCFtD8t>u(CV9u!€tފCFt8t)[^VSD$ L$t 8tft`@͉ ыލ1΁ €t8u.t(8u!t8ut 8uHu1[^ËL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_V|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊V|$t$ L$uD$^ÃrfftFGWV|$ t$L$uL$u1^_ù))1G1ҊV)^_; ;%;*;/;4;<;D;L;T;Y;^;XIa`;;e;p;l;t;Cb<y;W~;;lN;e;vrD;;;;;;;&@J "" """" " " ""9.4_STABLENetBSD/x86 BIOS Boot5.11 (Sat May 11 14:48:38 UTC 2024)p%s?`%?P%?@%?0%? %?%?%?$?$?$?$?$?$@$@$)@p$@@`$S@P$^@@$i@0$t@ $~@$@$@Hah!IdontNeedEFISFU0eCSFH0eCyD<#*=(mWC 3KOO;Mt?=rGy=iG}`1bOh3qJiX~B4ϳ3Dh&\ M}-|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+AM3iǁ(s*K>;-чH-чH2IчHIчHZIчHIчH@@@@@@@@@@@@A; A@AA$Az??)A@-A3A7A?ACA?IATAcAoAǁYZ Z Z Z Z9Z9Z9Z9Z@DDDDDDD. !.. !USTAR.volsize.USTARFS@DDDDDDDE@DDDDDDDE@DDDDDDDE@DDDDDDDENetBSDNetBSDa!Gb4GcJGd[GeiGfGGGGFGOG HH.H?HgOH cHtttttttt@tt'ttPt0123456789abcdefQ{,~ CJ\c&{~=A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler    strtoulcommands are: boot [dev:][filename] [-12acdqsvxz] dev syntax is (hd|fd|cd|raid)[N[x]] or NAME=gpt_label (ex. "hd0a:netbsd.old -s") pkboot [dev:][filename] [-12acdqsvxz] ls [dev:][path] dev [dev:] consdev {pc|{com[0123]|com[0123]kbd|auto}[,{speed}]} vesa {modenum|on|off|enabled|disabled|list} menu (reenters boot menu, if defined in boot.cfg) modules {on|off|enabled|disabled} load {path_to_module} multiboot [dev:][filename] [] splash {path_to_image_file} userconf {command} rndseed {path_to_rndseed_file} help|? quit No menu defined in boot.cfg /Exiting... Could not reboot!enableddisabledoffinvalid flag, must be 'enabled' or 'disabled'. ufsNAME=%sNAME=default NAME=%s on %s%d default %s%d%c (invalid)%s:%s%s%d%c:%sbooting %s (howto 0x%x) boot returned multiboot: %s: %s >> %s, Revision %s (from NetBSD %s) >> Memory: %d/%d k invalid console device. boot.cfgPress return to boot now, any other key for boot menu booting %s - starting in type "?" or "help" for help. Wrong password. pccom0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdautohelp?quitpkbootconsdevmenuloadmultibootvesasplashrndseeduserconfonetbsdonetbsd.gznetbsd.oldnetbsd.old.gzdiskhdfdraidcouldn't allocate module %s%s/%s/%s.kmod%s%sLoading %s WARNING: couldn't open %s (%s)i386amd64generic/stand/%s/%d.%d.%d/modules/stand/%s/%d.%d/modulesWARNING: couldn't stat %s WARNING: couldn't allocate module list FAILED WARNING: %d module%s failed to load module name too long couldn't allocate command WARNING: couldn't allocate userconf commands list exec returned/prekern%s is not a multiboot kernel %s %sELFError reading ELF sections from %s _SM3__SM_%s, Revision %s (from NetBSD %s)multiboot2 info size mismatchStart @ 0x%lx [%ld=0x%lx-0x%lx]... lseek failedread failedUnsupported multiboot address header Unsupported multiboot relocatable header EFI PARTUnexpected raidframe label version , bootmeOut of memory disk cd0 cd0a fd%d fd%da hd%d%llu GB%llu MB NAME=%s( hd%d%c(raidframe raid%d serial %d in NAME=%s size hd%d%c size raid%d%c(%s not found NetBSD RAIDNetBSD FFSNetBSD LFSNetBSD SwapNetBSD ccdNetBSD cgdEFI SystemMBRFreeBSDFreeBSD SwapFreeBSD UFSFreeBSD VinumFreeBSD ZFSMicrosoft ReservedMicrosoft Basic dataMicrosoft LDM metadataMicrosoft LDM dataLinux dataLinux RAIDLinux SwapLinux LVMApple HFSApple UFSBIOS Boot (GRUB)unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660ADOSFILECORELinux Ext2NTFSjfsvinumUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedVBE not available DDC [DDC1] [DDC2]: no EDID information : EDID %dx%d Modes: VBE2none foundVESA[?] 0x%x=%dx%dx%dmode 0x%x invalid mode 0x%x not supported mode 0x%x could not be set WARNING: failed to set VBE mode 0x%x list0xmode %s not supported by firmware invalid flag, must be 'on', 'off', 'list', a display mode, or a VBE mode number default boot twice, skipping... command(s): %s %c. %s %s%d. %s Option: [%c]: Option: [%d]: Choose an option; RETURN for default; SPACE to stop countdown. Option %c will be chosen in Option %d will be chosen in promptbootinfo too bigunknown command > com%d seconds. 0 seconds. -%c: unknown flag invalid arguments diskbufp %x diskbuf crosses 64k boundaryufs/ext2fsbad dir entry REGDIRCHRBLKFIFOSOCKLNKmsdosdosfs@Warning, unexpected short transfer %d/%d Please insert disk %d, and press return...%9oDisk is not from the volume set?! remove disk %d, ustarfs read512blockustar%99o%12o%8oustarfsCD001cd9660lfsWHTread header failedread header short=0x%lx Could not allocate memory for boot configuration bannertimeoutdefaultvalue:%c clearPassword: lseek section headersread section headerslseek sectionread section+ [%s%lu+%lu.SUNW_ctf%s%ldls: %s stat: %s no ls support for this file system %d: %.*s (%s) %d: %s (%s) The ls command is not currently supported for %s Unknown error: code %dbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryinvalid file offsetPermission denied1.2.10|/-\heap full (%p+%zu)incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check%s: invalid base %d~Iv=ڃ/ֲOH9?d͡CM֢&7Aʗi0ionpxppqy}{*}4}}~;.EG"H/ Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~fѶxx%} f W*))1_WVRVR ufZf[fYfgNP) 00<0u ^Boot failed (errno xx): j & } jh)ZYUWVS$P))$)hW)jh)r )lÃ)@){Ã))$T$|$7~) j$Sjt$t$h)t 11"f$~Uu뀼$BujSjD$ T$RPh)[ujSD$?PID$$ |$u$u$w$D$($D$$T$D$ T$$1t$$u$D$ uD$D$D$D$ D$,D$0L$9L$(j$Sjt$0t$0h)uŃ|$@1jD$DPSP C7ts K$ D$ D$uC D$C$D$ |$@(t$@$9t+jVS uD$ D$uC D$C$D$E\$;,$LD$,T$0D$ T$$<$|$D$ D$t D$T$D$ D$D$T$ ))Ãuo=WEVt )=WEVu=tᡘ1ң))$V=u@))~Ãt$PSZY@t$VhS" ')9u1ҁ=Ҷxt;)ЁĀ[^_]ËT$D$|$uOuBtt6jt$ RD$T$))RPh)@u1ɉËD$`ffaËD$`faUWVS \$4t$@D$D$8T$<$T$CtHuwKș9T$|k9 $rdCuL$uփfD$ft$D$DfD$t$DfD$D$fU ȉD$a`ֈIff؎؃BÈfÉD$a`ֈff؎شHfÉD$a`fP$0'@GX O&7fPfRf1ȣf1Ҍ҉f)fff fffZfXfP. "e ؎%XPQjYYf0؎( f"..Ȏ؎f+&UFu]fXfþfFprot_to_real can't return to X1fD$UWVSD$T$ ZsD$1T$$D$D$Pt$v0F#D$ F1틆L$ ʋD$ ՋFՋD$1vxN`1ՋNd t1RPjD$$pEŃuJD$9F0uѶx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~fѶxx%} f W+L+)1_WVRVR ufZf[fYfgNP+ 00<0u ^Boot failed (errno xx): j &jh*gZYUWVS$P++$`+h*jh`+r *lÃ+@+{Ã++$T$|$7* j$Sjt$t$h`+t 11"f$~Uu뀼$BujSjD$ T$RPh`+[ujSD$?PD$$ |$u$u$w$D$($D$$T$D$ T$$1t$$u$D$ uD$D$D$D$ D$,D$0L$9L$(j$Sjt$0t$0h`+uŃ|$@1jD$DPS C7ts K$ D$ D$uC D$C$D$ |$@@*t$@$9t+jVSR uD$ D$uC D$C$D$E\$;,$LD$,T$0D$ T$$<$|$D$ D$t D$T$D$ D$D$T$ ++Ãuo=WEVt *=WEVu=tᡘ1ң++$V=u@++~Ãt$PSkZY@t$VhS *9u1ҁ=Ҷxt*ЁĀ[^_]ËT$D$|$uOuBtt6jt$ RD$T$++RPh`+@u1ɉËD$`ffaËD$`faUWVS \$4t$@D$D$8T$<$T$CtHuwKș9T$|k9 $rdCuL$uփfD$ft$D$DfD$t$DfD$D$fU ȉD$a`ֈIff؎؃BÈfÉD$a`ֈff؎شHfÉD$a`fP$0'@GX O&7fPfRf1ȣf1Ҍ҉f)fff fffZfXfP. "e ؎%XPQjYYf0؎( f"..Ȏ؎f+&UFu]fXfþfFprot_to_real can't return to X1fD$UWVSD$ՋB$pD$1T$$\$SWv0ʋNL$L$D$T$D$T$D$1vxN`1D$T$Nd t1RPjuRŃuTD$9F0uFD$1vx4$x @ǀǀǀ ǀ$[^_]UWVSHD$,T$@L$8XCD$SD$0T$4D$8D$:t'~uf>?tV4fX uftfufff:2BZR}s0״t 00);v堐,;:us ZPf1$ffu?HBbZ1ZRRf.:2BZR2r۠|t}=U3ufZ|Error Fn: diskn0: I`uaUѶx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~fѶxx%} f W-z+)1_WVRVR ufZf[fYfgNP+ 00<0u ^Boot failed (errno xx): j &Q Zjh*ZYUWVS$P++$+h7+jh+r *lÃ+@+{Ã++$T$|$7^+ j$Sjt$t$h+t 11"f$~Uu뀼$BujSjD$ T$RPh+[ujSD$?P D$$ |$u$u$w$D$($D$$T$D$ T$$1t$$u$D$ uD$D$D$D$ D$,D$0L$9L$(j$Sjt$0t$0h+uŃ|$@1jD$DPS C7ts K$ D$ D$uC D$C$D$ |$@*t$@$9t+jVS uD$ D$uC D$C$D$E\$;,$LD$,T$0D$ T$$<$|$D$ D$t D$T$D$ D$D$T$ ++Ãuo=WEVt *=WEVu=tᡘ1ң++$V=u@++~Ãt$PSZY@t$VhS +9u1ҁ=Ҷxt+ЁĀ[^_]ËT$D$|$uOuBtt6jt$ RD$T$++RPh+@u1ɉËD$`ffaËD$`faUWVS \$4t$@D$D$8T$<$T$CtHuwKș9T$|k9 $rdCuL$uփfD$ft$D$DfD$t$DfD$D$fU ȉD$a`ֈIff؎؃BÈfÉD$a`ֈff؎شHfÉD$a`fP$0'@GX O&7fPfRf1ȣf1Ҍ҉f)fff fffZfXfP. "e ؎%XPQjYYf0؎( f"..Ȏ؎f+&UFu]fXfþfFprot_to_real can't return to X1fD$tËtUWVS8D$T$0L$,X{SD$T$$$tD$D$D$T$ tƃ w'k t1щ9Krw9r<$tGGD$"#l$<$t!ʼnl$t$ D$$D$$;u ;  l4F$D$(;tDmD$ !4$?9t$ )$Љ;$~拃D$ 1l`+CdD$4Pt$w t1RPjD$(p(=D$49G+$T$ ,t H!$ht$D$PP D$4 u t$jD$ HPt$ t1RPjD$(p_uxD$ T$$D$#D$‹|$0l$)ŋD$,(CS3{,$D$)9\$rw9v)T$,1 8[^_]UWVSD$$j]|$u5tsH{Ls4 t1$r{shD$1T$ts|tƄtKKD$ T$D$1D$ T$EUL$T$$ 9|$D$tpxp t1 D$PRT$sWVjD$pr|$9{u^T$tKd֋|$9~tIt6ƀ} DžDžDž [^_]SX@t.t SRC 1[UWVS,ƉT$hjPD$h D$ ED$4Pt$h jjjD$(p8ǃ(|$( $8bD$$D$ Ћ $A $IpL$ʃtGFT$D$ aD$!D$>'t$D$b< u . ..- db. run/ log0spool- .... .../ ...0 . ..1lock1 .0..