08PY;g'&<  'Y;gd1>P''`'). ).Y;g'&P@@<@T 08PY;g'&<  'Y;gd1>P''`'). ).Y;g'&P@@<@TU Y;g`').yAY;gY;gY;gQ$f Y;gY;gY;gRAY;gY;gY;g>AY;gY;gY;g?AY;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gmK%Y;gY;gY;gX`hpx$@Y;gY;gY;g (08S$\Y;gY;gY;g@HPX`hpxP$tY;gY;gY;g;Q$Y;gY;gY;g <JAY;gY;gY;gCY;gY;gY;gAY;gY;gY;gAY;gY;gY;gmBY;gY;gY;g(08@HPX`hpx[$Y;gY;gY;g$Y;gY;gY;g$>Y;gY;gY;g$Y;gY;gY;g$sY;gY;gY;g$Y;gY;gY;gAY;gY;gY;gm Y;gY;gY;g$Y;gY;gY;g $Y;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;g$@`Y;gY;gY;g ($Y;gY;gY;g$Y;gY;gY;g$Y;gY;gY;g$Y;gY;gY;g$Y;gY;gY;g$Y;gY;gY;g$Y;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gAY;gY;gY;gdEbx+!;5fEZ5_dX"n]`nQ?(yndw@n5~ Blzh >u~YdOH.sQ vhG g.  9>rن'rXMGNָec). . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4%4 (**0"0"hh&$F2F2X TTT,,&$F2F2Ptd(QtdNetBSDpmAPaXU|SR ffffUSWVP[-t$$u,jPjjj\njr|$0F $uH!BtKj/VKt@Ƹ0"TL&PVt&uVhL0"h40"h3^_`SWVhL0"hW0"h3u 1۸0"TL&PІCPrFh3j wh3%h3/ uh3j j D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5D3ٴ u$1^_[Vh2"Vh3" 5@3hH3"jwVh(3"j܉USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%SO&tutD$D$$D$% D$t$@N D$l$hH3h k$hD$ @l$0tD$PhLQ$Cj YD$  |$\$4t$,s$L$)L >QPh&5" D$  L$s()@L$L bQPhG5"L$ D$  s D t 4N&hj5"L$ D dtPhx5"D$(@9XU6\$D$T$T$9tt$N9BD$4N&5@3h4"4 1h^_[]t$|hX4"%WS$h4"h4"j%U謾5@3h4"j:t$|h3"5@3h3"3$hs4"jhc 5D3耫 u15@3h5"jSWVPD$Hw#t$>O&Wt ubO&$h2"Wʴt N1AQhc5D3 u 1^_[5@3h5"jOUSWVP|$t$7 h2"WV謋 fu <@3u 3)u @3uh2"萆2"t @3hjQoY D3u 5@3h2"Ih[u3$(`O&SU躳t uUh2"jAh2"je$NPVShO& P\V3Ph5"VE Vjjh5"sdO&`O&h6"h3 uj5D3fYWVοVN&tuVhU3"j~N&^_VPΉj PQh x $9u^Vho3"jK~WVοVO&薲tuVh3"j~tO&^_USWV\$$1 3 3 3 3sV2oj=P=x<$h)jjhO&U  3H F H  3VP3u 3t;#=t%{  3##=uth6" 3tttut!tcu 3ȥ 3^_[]  3Vh46"W Wht6"4$ha6"4$h6"j|h6"h6"D$L$01ְ1PjPjt$h%8$q 33 3 31PjPjt$hR7"q 3 3hi7"j|1hjPPt$h~7"q 3 3 tj1PjPPt$h7"dq,p2tZj 3u$1PjPjt$h7",q 3 3ËD$ 3h7"jg{1hjPPt$h7"p 3 3h7"j3{ 3u$1PjPjt$h7"p 33ËD$ 3h7"jz1hjPPt$h8"vp 3 31hjPPt$h8"Np33fSWV 3t/ 3 3 t5x 3)փ>8F ux 33| 3 3 33;3 3r*jZ3x 33 3 3| 3^_[á 3 | 3 t 33hP&h k$jyhP&h k$jyhP&h k$jyhP&h k$jyUSWVt$|$6_1#SjSVW& u=3PM 3u, 3}$ 3 3P&Ah)8"j%y 3P&1QQPR 3y 5 3t 3 t 3 =,p2r 3uh8"롡 3u# 3 3 9" 3P&1 3H 3P& hQPCR 3yJ1 3H  3 hP5 3Q 3  3y 5 333 3utS1V 3 3 39 3r_ t 3t= 3 3E 3t# t 3) 3I 3" t 3ujl3 x 33 3  3t  3  3t  3h`u;5 3 3= 3  35 3VP5 3W  31Vhh 3Fvhjwhjh5353533hX-,p2e= 3 3 3 t0 3( 34 3, 39ss$x 3 3tQj QjP 35 35x 35 3P$ xd5 3- 31‰1  3 3| 3 3( 3, 3| 3 3 3 3xPh k$ _+ 3u6 3j5 35 35 3P  t5 3h k$^ 3 3 3 3 3| 3 3( 3| 3 3, 3C 3s 3 3| 3 30 3| 3 34 3u@s)tP 3T 3H x 3PQQI 3x 3 33 3j1 3| 31 3 3h8"j^Ph k$jAtWV 3=t=ȥ=u 7 33 3t;39щ5 3s))Rj53a 3 33 3 u\5$ 3= 3 tJ53j53 3 33 33ʉ3)Ɖ= 35$ 3 t jY= 3u 3jPu x8u* 35 3Pt^_h.#jsh9"USWV3|$,t33(p‰D$l$|$,u  3 xT$ $ 3 3 t! 3jQP5 3R !ƒ~t$VSh3 $~ D$ `藴18D$ Z $ 3 3 ʋ-d 3` 3t>5 353QPTX 3\ 38 3< 31$ 3 3T$<$t$ ` 3-d 3l$13L$ @ 3D 3D$11  3t,3u#35 3hw8"T$ 3L$ AD$)ʋ$tЃ|1@|p9@|5 3$ 3*31 3T$1 uK8 3< 3I$T$ 33)ѣ3 35 3-39@ 3D 3$ t 3)PQ53AY 3133 33 t(@ 38 35D 35< 3QPVR輢 tjhe%j>H$^_[]5 3h8"5 3hA8"5 3he8"jo5 3h k$joUSWVt$(|$,\$$Uh3j6H C4WVs(P( ޱ8jUjH ʱ8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h8"j@oV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu 8u F ́Ĵ^v$h k$jnVP P9v ViVPQ苠 t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV3 3t/jh?"j~E 3 3tjh?"j`E 1t$PV`lFȺMb׋ p 3-։+h 3D$H l 3iى tL$ 1FD$|$ 5D 35@ 35< 358 354 350 35, 35( 3h9"jdW,WgPWjwD T 3P 3 t?ƒ ʺmg%td#RQPh@9"jd|$4W\WgPWj'D L 3H 3 t?ƒ ʺmg%td#RQPhY9"jd|$4W WCgPWjC t$ \ 3X 3 t?ƒ ʺmg%td#RQPhl9"jd|$4WWfPWjC d 3D$=` 3jPt$ t$VÉiL$it$V)QPMRPVSt$Wh9"jdt$@V2$VifPVjB e^_[]EVt$;VEj裫fUSWV 35 3= 311C 3W5t 35 3P$ Mtg 3u5 3h k$S 3W5t 35 3P$ ݅~ 3t )u= 3N{T,p2rOH,p2d5 3 3= 3 35 3jVP5 3W !ƒt^_[]h9"jji5 3h k$jiWV 3uD5 3 3= 3  35 3jVP5 3W !ƒuuJ 3  3ti11 353535 3P$ ~J;5 3 3r,f  3H  3Phm5 3Q xw^_xof@  3Phm5 3Q tD;5 3 3s5353h3 333 3 t5 3h k$j3hfUSWVX $p $l 7h_1#jh9"WSss H-$Q& 3 3 3@ 3 3 3 3 3 3 3 3u 3i 3 3S 3G 3; 3 3 3 3 3 3 3=!3-<E= 3u =M= 3ui $X-0膪Ph#h3 h_>"'0]Ph#h3躽 hI>"N^_[ϗ0(Ph#h3腽 h&hN "3uá"3u tjwGjFUSWVjƋ|$11K< @u=@!3D!3"]1HD!3@!3<0蕨Ph#h3 h>"'0lPh#h3ɻ hI>"LV1^_[]Vt$5$3q0F,$3$3^WVL$ "35L!39})=,$379}>,!38p29~vRO9G9~-8p2(!3~Z(!3΋Nu#8p2)Ou9~8p2RN98p2 L!3u "3uu8p2^_É1jDjDVT$(!3t=(!31(!36(!3t@9uхt(!3uhz%hK1^SWV1"3D$3j?Tdhּ"X>"tWMt|8/uWh>"Wh>"hP!3K P!3tLPt$h>"P褋H!31ۅu@W@,5P!3h k$:>"j:>"PJVc^_[VH!3tAP藎xGH!3P!3t!P'5P!3薎P!31"I^Vt$H!3t3PP!3t!P5P!3P!3V襭jh$3h3Tb "x (!3(!3,!31T!3@=ujuSVL$D$ T$t$T"3T!35T"3T!3~A2T!3BI^[fV1X"3\"3d"3`"3Pk9PRIIp"3Fu^SWV5\"395X"3t$X"3Vjjhp"3襵ut=t"3p"3p"3jjPPDthG?"h k$[Hh"30x"3@u`"3=d"3VrhtVP#G~*hv?"5w"3r0hR?"h k$G1N1Nyh?"h k$G5\"3~X"3H X"3p"31H^_[Ë X"3u!T$7\"3X"31\"3xD$QX"3p"31HSVփuUh"30x"3@up"3jjPPBthG?"h k$Gp"3 t"3 d"3`"3aˍp"3)Qhh"3Pj w"3h"30x"3@up"3jjPPTBthG?"h k$FVjjhp"3b^[Vt$ X"3u\"3X"31\"3x 1H^USWVh?"/Ɗtx<0uFD uh$?"h k$$EGuȿ|w WjP耊 1T L ш @ux"3hjVN P/1Fth "3u"3utj8?"j&7WV "35"319}'"3FىDuw9@u1="3^_USWVD$L$9tV"3r="3~="39 t9|1C"3Mu9|1C"3="3 9u^_[]fUSWVl$}!uEh{"PPUT1h{"PjÅt*t$Sǀ}!u?SY=0KPUhB&h3觬h?"=eS誁x(="3uWh5"h3j 5$3+t$0膆0ߘPUhB&h3;h @"=^_[]USWV |$$Wơ"3$D$3D$,$31-"3-D$39-"3t\$=$3t$ gDž~w11"35"3Y6ts$3PPjJ Å "3u"3t$ Dž|$$\$9t$utt #@"<$u="3t!5@"9u D$3 uh3P 9¡D$3Ƌ "3Ӏu1A9|$t $ "3 D$3"3t )) "3u "3ut j4 ^_[]j3USWV1|$="3t WrGHOHt uG `-"39}"3V"39rFU5"3y-"3"3 "3u "30u D$3F8W<1ۍF-"39~N"3 "39wUQyt7-"3"3 "3u"3uhtk"30 F<0蕕Ph#h3 h&9 "3"3j2G @utL"30 F"380Ph#h3v hG@"Y9-1"30=D$3="3  )Ɖ^_[]js1USWV|$?!uGhV"PIt$WI,VPcÅt2l$t$ US NjD$8!u?SJ=0<PWhB&h3蘧h^@"{8mS|x-="3uWh5"h3[ t D$ )@ʼn3r0˓Pt$hB&h3$hv@"8^_[]USWVPl$Uƃ="3t1ۅtf;l$ `1V$th~;-,$3u=D$3t ="3u8 GWPt$ F x4EEs @6;l$ |="3tt$$$^_[]USWV|$\$l$19t[="33t UPrUP裸FyF0蟒Ph#h3 h@"61^_[]USWVP\$5($3FEx @u}|~PVq6tj"39~l"3"39SP)ugƉ"3"3 "3u."3_tO5($3;^_[]Ë5"3W5($3V8Y . ,1xщǃ|$uE$3| /5"39$~Z"39V5"3ftcÉ5"3"3 "3u"3t "3W5$3UX ,$+HPS5"3D( |$tM1BDžh?"4,~0腐Ph#h3 h&41 "3"35"39} "3|$N"3"39͋|$|MVP/st05"3"3 "3u "3umua(/ m}0ƏPh#h3# h&4 "3t1"3uj-j/,SWV113H 37h3-yu83@%f39u3H 3ÍF=$39~Y"39wW5$3r=$3$3 "3u "3t $30u D$3F  $3C|0qPh@"h3Ρ h@"2%31t $30$3($3^_[{0Ph#h3r h&U2 "3u"3u tj_+j*USWV\$ D$1tt$h@"詞D$ l$1uHD5d3J d3;t3у  \3Q\3;=Dp2|h\3h<%K1GD5 | <\t<d3H d3;t3h\3j\٣\3H \3\\5tjj Sh@"T tVG@")Ȋ@"d3J d3;t3Vу J \3Q\3\$ !0d3H d3;t3h\3P"\3H \3D50 d3Qd3ɋ\$ ; t3h\3Pբ \3Q\3D50 d3Qd3; t3h\3P莢 \3Q\3Dh\3Qh4 d3Qd3; t3~;ȃ t3 \3Q\3D$F9h\3Qh\3P똡d3H d3~\3H \3 h\3j ԡ1^_[]fWVD$L$L$$$01| $ |r1"3h@"t$t$ gA ot9EtzS"3ǃxtostypf<#3먡3  $)D$|$ta$8-uW"3D$|<3b"3S "3D"35$L$jjYth_jrt1FhVatVjVthjGth#3ƅux'"3|$t$8t$0|$t[h3h@"6$8u h@"_-jXu$h3h@"h@"--y ="3th$3h#h3 #3tPh k$蒙h\3N xt` $3| $3x51g$3QPP M=$3="3h3h@"h@":,jW%3$3h?",%3΃t0h3h@"j]W515$3h3h@"ah@"+V+WQ="3th$35 $3hA"h3hjrjksPhxT&h3B j8="3jVunh$35 $3hA"h3f$j0yjtVt$8!$h0h"3. uh$3h#h3蛙 jL$ ɸ!"3Phht@j[ x#$r@p2D$ rDp2ËL$="3t1@ "3Ql"L$="3t1@ "3Q#WV1F="3t9|$ ?!t!h#Wdtj/W Eth B")1^_$3$3 $3$$3x>$3 $3 $$3 $3 ($3;t,uQ($39;u$3빋 $3| $3 $3t9t$$31Ƀ USWVP3($3DJ@t t@($3@DJ@t uHH ($3~Ã=w$R&=$3!hA"  !=$3" ($3A1Qptntl  Ӊ ($3A˃=$3FP”^ U ($3@߈\$ ̀1ۈL$QuH ($3H1KDB@,Aǡ,$3 $3  Pj  5,$3j$1  ˣ($3@̃=$3t="3y=$36DB@jLǡ($3@1Hptntl   ˣ($3@̃=$3DB@8!hA"=$31Hptntl  ˣ($3@̋ $31PptntlN  ӣ($3@̡$3HQPN"($3@1Hptntl%  ˣ($3@̍H ($3 $3 p1Pptntl   ӣ($3@̡$3PPv ($3A1Qptntl  Љ ($3Aˡ$3PPH-$$3 $3=$3= $3 9=,$3 -$$3 $39 9w hA" $3PP ($3A1Qptntl  Љ ($3Aˡ$3PPl@ ($3A1Qptntl  Љ ($3ADB@;heA" 1ЍrЃ sOjj h($35($3 <$3wj8"%8$3 ($3:o t!gc ptrP  A ($3< b=4$3Ho1$3PP9 $$3- $3 =$3= $3 9=,$3$$3- $3($3@1Hptntl  ˣ($3@̃=$3F1Hptntl  ˣ($3@̃=$3hRA" 1@$$3 $3AQP2 ($3<hj h($35($3 @p2h8"h'A"N@p2 ($3x w =$3,$3t $30h\"讋 ($3x A =$3u;.5 $3O1@$$3 $3AQP@ $3jPP>($3x  1q1ۃ="3Ƀ=$3 ˃hz% ($3x  =$3u-5 $35$$3 5$3g ($3x ? =$3uL-5 $35$$3: $3@;,$3?7$3-($3x =$3u , $3IQ T($3x =$3u,$$3 $39QPn($3x QVP ($3y F( ($3y 1 ($3y P5 $35$$3g ($3A1Qptnt lu  Љ ($3Aω ($3y  $3,$3=@p29|PRQ 1=$3u ,$3 $3 ǡ($3@1Hptntl  ˣ($3@̉($3z !$3SPhA($3x  1@+"3"3uF%($3x <uEEp $A8GMi $$391 $3)@أ$3=$3t W6U$31 "3u "3u u^_[]jjSWV="3uj貽L$ɸ!"3,$3PjhV"hOB"Hy|h #tkP =Yà P;tGWPj|3/tf/V ed.hDhup5,$3jhV"Vj="3ujL$ɸ!"3jh#3USWVPl$5$$3'Ƌ= $3$$3-$39ʼn) u)E1u1$"3E@"3V}tzP蘹t_$3PPj DžtO$3"3H"3u "3u[uE6M$3@Pi1,$l& "3u "3ut j1^_[]jUSWV$"3 "3th B"ckjP~($3L$F$ T$39} P$3V"3P$39|BVPC5T$3P$3 "3u "3! ($3 u1C1E҃!%="3h"3PƉ$ T$39V"39V5P$3B5T$3P$3 "3" "37 09L$]9"39|WPB=T$3P$3 "3]9~["39V5P$3;B/5T$3P$3 "3u "3yt vP$3 ($3 (E ($3Q($39\u=Q($3I ( P$3G (E,$s ($3L$A ($3 @$3y X$3)9~_"39VPUAI5T$3P$3 "3u "3 X$3P$3| @$3A(EA@$3X$39r ($3L$A ($37 "33/ ($3Q($3 ( ($3݀ (5\$39}@$3R"3@$39|KVPe@t]5\$3@$3 "3u "3S5P$3P$ @$3X$3D$1!PvJ0\Ph#h3,p h& "3 "3u!u#^_[]hA"qh?"gj'jVj4tL$Qq p PIH1I0.\Ph#h3o h&n1^V$3t.L$19 h$3uh$3H$3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h$3jXWV ($3 td< uh?"1 Q($3I t;8t7P1ǡ &3t?=0$3u6PI &395 &3hVB"R5 &3j3 &3tV0$35"3WPw] &3t.h'h$3QP!5 &3KC &33/H0oZPh#h3m h&^_USWV=($3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-&39}=&3M"3&39|KUP<tYlj-&3&3 "3u"3uyS5($3W! 5($3=D$3tsj jSWmeF0MYPh#h3l h&1 "3u*"3u(tjhw$hjB"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u($3 u&3E#t($3 uE1^_[]8uP($3HЉʀπwREj h($35($3o 1wiE8"uh'A"1gu@($3ErUSWV($3H ($3H%u,8Xu'($3&3hA"t18u= &39 &3L1}5 &39~["39V5&3:#5 &3&3 "3u "3\t Y&3 ($3Q($3 u (\t u^($38uT($3H ($3 &31< u0=$3u't $3| t %3ى($38"3&39|NWP/9t8= &3&3 "3u "3uuuw5&30&3M1IeC0UPh#h3i h&1 "3u "3uu^_[]H($3,j'jUSWVPL$$3$$319 $3}%$3ȃ EhB"Kl$ $3PUVPt$$KǸ1$$3PP$&3"31S̪á$3tP芬EPPjM Ņtl9u "3l$ u"3ue$$3 $3+$$39}yF$3@$3P%Ut$ Pt$$hDž+9 "3u1"3uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=D$3tj jvS肮vލD$jPjSuyt1t$ED$$D$1E $A9T$ 4(&39Ɖ $T$~c"3t$ 9V5$&35\5(&3$&3 "3t$ T$u"3=D$3tjj RS藭T$=$&3RSW 4$D$D$ (&3 $9~bt$ "3$9V5$&3J55(&3$&3 "3t$ u"3=D$3tjj t$(S=$&3t$SWR Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuw&D$)D$(&39~V"3 $&39SQ?4(&3$&3 "3u"3|$~#D$$ D$ ud$thB"$=D$3\$tjj SV賫$&3SVP" $&3f |$%C< >0dPPh#h3c h& "3t e^_[]Ë "3u tjjUSWVPt$ =&3T$-&3E<\<&I,$D$h)(&39~Y"39W5$&32=(&3$&3 "3T$u"3%$9C $&31F9uEEπ;D$$,$L$l)(&39~Y"39W5$&32>=(&3$&3 "3T$u"3ml9}C $&31F9u,$y^=(&39}$&3_"39|W5$&31=(&3$&3 "3tT$ "3T$M 0E+&3;&35(&39}$&3J"3$&39|KVP0t)5(&3$&3 "3u "3u^u`I3;0MPh#h3` h& "3u "3uu؃^_[]jjfWV4&3 0&39|ld 0&3j Qh,&3 tJPMPh#h3]` h&@5,&351,&30&3k4&3L$t$T$ =,&3@Q葤 ,&34&3RDVu,&354&3@LF54&3,&3^_SWV4&34&3r9 ,&3@<u|L19tWW49u4&3$3Hp2,$3Lp2^_[USWV=Hp2=Lp2=4&3t $3$3$,$3D$j荣"34&3 ,&3ÍS4R4nr@44v\1L1 [ ,&3\1l1sRt6,lmL)1 ,&3t)|?wt)LI1 ,&3t~l)}L1 ,&3,u44vL1Y ,&3l1}w4R4Ӆ HA9~R,&34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=$3t׫Hp2$3$Hp2Lp2,$3D$Lp21 "3u) "3u&tj\hB"$^_[]jlUSWVL\$d3ʓhB"B"tNjt$`hB"SVO fttu=<߃u 3r|$L$ D$1T&FC"D$PƋO9rPSt$ ? tu;_Յuͅu t$hB"-|$dD$ Du$$1Fl$?uSt$ hB"jL$j QP  $;Fl$|1ƋD$8u&1zPU2y!Uh k$jD$ thB"jjNjC=m@!sHQPW' xs{QPW x4$Uh C"X =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W| y?60Ph"C"ӍL$fqQhmWN 3Uhu"D$ukD$Phh"hC"X T$"hjD"T$C"hD"d3H d3~\3H \3 PhC"kh\3j ]t$8t$8t$8t$8t$4hC"|Wt$Ht$Ht$Ht$Ht$8hD"[Wt$h7D"JWt$ hPD"9WjNZ2PhD"h3Y jNSWV֋|$t D"?tD"VQPV JB8d3H d3;t3h\3j<\\3H \3[\3H \3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hD"6thD"P#u8&3hD" thD"P#u hD"gjhD"hD") Pu hD"j0;D$ u h E"jt$,)݉\$D$$D$11D$$hE"SU8 c7~+Hr߃8tlH w&$Nf|$Dt1BuNfD$Dh|$u%j t$hE"jt$jEh#y?)hE"PhE"h3jPj`EPD$L$jQ5<&3W XUSWVA1K8uSt<։P*hU7[ ~WUV  ~)u1*1ۃ8#ۉ؁^_[]ÐSWVP|$\$WS=ƅu]jj.tqƉx jPS ǀ;t$8u<)8"u(G=w(rfljF^_[ÍG=rhhE"jh E"jfD$0ՅݾjDfP=@&3tD$L$ $QPj; XWVt$|$ t8PhF"j; 4# D&3A9tL D&3^_SWV\t$lt8|$jYPWy GYW&Ӄ(Ӄ,T6F60\#4N#8@#WVd^_[USWV $8 $4 5H&3V&PV90W5W&1WWPփ (JWWSփ _ƍ Wh PW& WjjWW& TVW&h <Ƹ jPPV(W& hVU V$"E=a==hD$\jPSW& 1Nxr$ SǃW90t^SWP tg0$8 h&F"j90hsF"j8 1N ^_[]þh&F"j8۾ShMF"j8 ¾hF"V!=bt =buk $}u+Zt$WSVL$ 9 FYD$t8ShF"#ShF"WVP 1QQt_0( Lt5L&3tQP%0,tt|@PqƉ4PY8tg04@tt| r>1A8Љ4DAtt;L5rShG"j6 10hF"WV|$x$t,WDWLDWDW8Dx uWjjtw\wX=p29}5PBt85p2WVhG"#|^_USWVT$/#5P&3Eƅt9$ tVj$4S8 Vx&3|&3$ th&3FD$Hl&3F D$X<D$DD$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,4* t$$jPf8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,W( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,u' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RPЫ̀ uCt1t RP萫L$`QRPVD$tP>D$du ppxjt$d>:3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP蘪$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$PhmJ",hQJ"$|$PQt$t$RhJ"jz%C$t&8$\T$XT$H|$RQt$t$Vh+K"j%%$L$l$8htK"hdK"hhI" USWV u|$Wp1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h`G"jQ$NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hvRj,PSD$HPhW& |$0hvRj,6StND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhG"jU"^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPhG" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ X&3X&3`&3`&3p&35t&3D$&35<&3&3&3th3jjjhK" 3)h3jjjhK"L$$L$$=&3x =&3tD$j)&1PPD$6l D$TH Qq T$T$ t$t$QShL"j 11KL$0t.SPhJI"jV5&3[S&34&3t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h=ljP88H H;1D$8<9&38D$D$ tD$tD$L&3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSPsM"PD$tD$t$t$8WSPsM"PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhM"D$8Ph&3Vt$,V'~GD$D$8D$HD$L$PD$LPh&3VD$HD$8L$ $\$(\$(u@,,L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L h&3l&3tt94 S.8L&3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$PhM""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVhN"D$8Ph&3St$,V~D$@s, D$¹tt;<FG;D$ L$?-VhZM" QhL"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP$;D$DT$@D$(4t$8t$t$t$0|$(WVhL" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1QhL"je1gD$4$DŽ$߬$D$D$D$@$߬$ W&a111CƋD$|$8D$|$H|$LjD$LPh&3VL$HL$8t/&3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh6N"b11ҋt$  t<=p&3t&3$T$p$1߬$$$߬$X&3X&3`&3`&3DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPnD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4s*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=&3$t1J8D$<D$ۋL$؋&3k,L$1T$9|L$$)щL$ Ɖ$D$HPWhfN"W $PhD$(W& yN\L$ L$tL$L$8]:u*t$ tD$PhO"j ,uhO"j uhO"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P'D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPCD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP賂3D$ t(Gdt;<r61@h t 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWNJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RPu4$]0hVPZ ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhQ"jT$$BRt RP̀RPVWjt$$VhQ"t$$k,P=D$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`PhQ"jl D$,|$D$T|$XD$TPhW& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$&3 &3 p29|[5&3tFNu &35&3t5FNHNFy F4VPV&3@&31@j@PU1@P F ~4D$F(^$F0^,n#p2^8&3 &3t q4&3^G FtH 7~ F^_[]É &3=huS"hnS"hhS"hnS"hh!S"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP &3H&3N^,H &3&3&3H@&3P &3 &3H&3H4I&3H89t;tprp&340&3t4F &3H^hS"hS"h4h!S"USWV}]uuu W@t &31@&31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gW&sW&G4$O,5p2w0VPww D$0^_[]USWVPt$ffW&sW&F4$N,=p2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p '3HtƒQ '3@ '3^_WVt$ '3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv v^_USWVPT$|$:%4'3\$ '3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4731ہ='3| t Pt 73'31t 98t@^_[]Ã^_[]`V15'3573hVh'3 5'3^ft$ t$ 賦jISWVt$frLN4F,=p2~0WPvv 1W&t\fv4V1AN4F,=p2~0WPvv 1W&1;NuN^_[hO"d1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRj׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSi$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h W"hV"h hI"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPe3T$3D$M u1^_[]USWV(t$FFF ]F F$|$0tfhjTljPLtLXt uB\I\$$|$ C$|$4Nh$X"^&<1ɺPt`tLtt l$,\$(|$0uej&ttPttPԦA 芇t u_4u_4_HoL_HoLUS6jjW'hޛW>q$ 1=p2ljp2l$1 UPQSWVhj[Ë}Pw St P G1PWH¹tTt p2߀<$u1 t1 L$QWURPVhj誥Njl$hu Pã P E1PUtA|$4t hW"#SW1^_[]u C4CHKL1}Mt|$4t7hW"{#t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW":$  $ V 19tQRhZW" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhT"ܞN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthT"h\3负D$(u KHKpStURQPt$DljT$t hZX"P!u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhT"^ 73VRh9U"G T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhU"D$L$9tQP$$hU"݋t$Ht$nL$tI9ȋt$ tPQ$$hV"衋1t$\^_[]h~U"hpU"hhT"!h~U"hpU"hPD$L$ $QPjp2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$aV"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttS|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$V"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ޢ,LD4@hD$D$D$,$D$ 询,@o M|$@ t"D$D$D$$D$$V"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$aV",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D73uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW{EƋD$0T$UW_EƋD$0 u$$$UW$EljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPDERPD$GW #RPDERPD$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaV"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaV"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaV" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW7@Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP?t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP,?T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPy>|$FV D$t RP\>|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP= t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPG<|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP;$ D$TBL$?ttXLT$BtJ J T$$T$ QPO;L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP:ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV8D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv Z t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hV" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hV"hW"h h W"hV"h h W"hW"h"hI"ؘUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p zA L$H SjQ ^_[]USWVL$T$ B73ulF1GpY&UhZ#,$d3H d3~\3H \3 h\3j =u q1^_[]VS3PPh]"VVjjh^"p`X"@XY&Ph#h3LdY&uj7USWV׉΋*h`X"UBX&tCt[PU(jhh73s 573;3t27373WVS5;3,5^_[]Uh2"jgZ573h k$jZUSWV$:$D$VuPSW 9$j uP6W e1ɉ\$QSu Ƌ8<8"u11F9Ή$<$1ɉQSu NJ ËD$8Չӛ8"u !t$$Vhyd5;3у tbVhY"޾^_[]jhY"7jh7Y".uhiY"$hY"hY"$p hY"hY"jX$0573hu"jXUSWV}E ph%VҌFhHZ"V輌h$V覌SD$(P5;3K}Z#D$0= M$L$A1yyy D$Phwd5;3臂 D$tG\$ D$ L$|$j 贄ljL$ NjL$IuɉNjD$ D$|$uhj,D$v1111O w+Ow?u$L$A1AAA D$Phwd5;3蝁  \$tmt$ NL$,D$(73D$FD$FD$ FD$$~D$(PPWt$,t$t$t$hZ"K KuD$1D$|$Ynhxd 5;3R5731111VQRP573hZ"hxd 5;3讀 73LQhZ"豻ww ww573hZ"舻w_G|$9w  jPQ5;3Q!¡73tNSVPh["5Wt$ 5;3. $9t"Qh\3 pSVPhZ">كT$;r ZƉ[|$?e^_[]jjU573hZ"lh}"hqZ"hNZ"h3 jQh9Z"WV$u>$jvWQ s'Wh{dЀ5;3  t^_jh["j5T6573hu"jQTVPPhtd@5;3~ $t%t573ha["赹$y["uJ["573Q蓹73$$["["s_1#QPh["i 73$$ ["s_1#QPh["D 73$$["s_1#QPh[" 73$$["s_1#QPh\" 73$$s_1#VPh>\"ڸ^573h=["j#SWV$u^Vhzd@5;3~} tH$D$PWVh}\"~$PwwwwVh\"\^_%573hl\"jRUSWV}D$Phd@5;3| tzD$Phd@5;3| u573h\";73$|$\$ t$jVSẄ́VRPSWt$h\"蟷e^_[]f573h\"jQSWVP|$uX|$_h0#SƅthX"S܅u+1Qhwd5;3 | t ^_[7573hu"jaQUSWV|$0t$,1@<3$1ۉ؉D$h\"WV\ qt\$te+$9531|$7wWh|d5;3_{ D$ ;D$t-i9l$sUt$yƉD$l$묅hhPV;M73L$ _1#t#RQPh]]"|$ t\ư1P`VvvvvQPhn]"輵 G;|$ ru573hC]"薵$t1^_[]W573h\"jO573h]"jOjŬP|$u1Phd@5;3z 73tQh]"!XD$ 0Qhu"jdOSWVP|$t$^h"ShtDh{"SVt@hV"SDtMWVD$L$ 9։9|1H^_fUSWV\$t$p1 ;3$;3(;3,;30;34;38;3<;3@;3D$D;31H\$1A $D$ D$D$,h3^"UWX R~'$Y&,;3ЍHwf$Y&Shd;3Sh`;3h^"5<ӊ<L$< d;3`;39uld;3bHЃm$pY&p2@8;34D;3jD$LP5<ٽ p2L$H9WJH;3P;3p2p2<l[35<j/V_$PV_ $!=@i<p2n(;3b4;3V5<Ip2=>t$'L;3<p[3$;3<j/S^F@;3 ;3Sh\;3hX;3hT;3h^"5<Ո<L$<=T;3xT;3i5<JR0;3Ap22p2#p2 <1Bh[3<;31;tٍT$d3D$dD$j/V]tC1ۀ>tT$d3D$dD$ tTj/Sb]tF1;tٍT$dm3D$dD$,t>\$At$8\$/X_&_&ho^"B u1\^_[]h^"TPh^"Lh^"E53p[3t4PHu'h}"hx^"h^" 5<hS^"jG=,;3u8=4;3<;3u~0;3uu(;3ul$;3uc$;36 (;3=8;3u th_"-" 0;3$;3t uh:_"t=p2uhW_"$)|u Dp2j=H;3|$\G1PPL$lQPjW9>t2t$dtt"1PPD$lPVjW >t5p2=H;3u4$P5p2# u#$=uH;38;3 4;3 <;3 0;3=l[3 ɡp2=H;3t&jQP2  p2uT5p2hJ#jhh`3QPtp2y葈8uvh`3hh}"蝾tp2`3 p[3u0=H;3u_L$dQPk5p2h}"RQQF5p2h}"1h`3h}"/:h^3hrdAP/p 5p2h}".h^3hedA5p2o 5p2h}"hPh^3a $$t(hQP5p2h}"{$$ƒ ^3>s1@![Vs ) ȣ^3^3^3^3? ^3 ]3]3^3x`3^3|`35^35p2=^3=`3?w<^3@^3=D^3L[VD^3?@^3) <^3>r$r$<^3 x^3|^3l[3u p2p2]u1hQP] p2u25l[3h k$,5p2p2j莠5p2|VDpt[3u Vh~_"8 11hx[3t1A1A1ۉL$@1hx]3]3 ]3h]3= ;3u#T;3<^3X;3@^3\;3D^3 t$\F|$LSSWSjV9t$Lxot^3n 1QQWPjVp9y5t^3t^35p2j/Vut@ 5t^3~( SD$hPuu {TOuށ=<^3w=@^3w =D^3@D$D$t^3u B0~*9rڋH9r ӉNu T$L$D^3?@^3^3)19w <^31ɉL$4T$D$0PD$@PD$ P4 D$0+D$]3 B]3uM `;39w>UUUU)ʹ3333!!сisd;31:]3t!tt6]3v]3cԋ>]3 L^3P^31B]3‰ T^3X^3`^31 \^31AhQhH^3 i-H^3=\^3 / L^3ًP^3P+==w !r%1H$D$ ʀŸw1D$ $}ȹ>]3yt0]3t  u\^31I $L$9 H^311O|$ytyt F9u1H$L$$L$ 1D$(1uhru"$D$Nj ^31҉19ʃ$\$ڍD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Eu9$r$$<^35@^3=D^3P^3D$L^3t T$$T$0;3=D;3uu p2; \^37=(;3l ;3_h|""Et^381uh"t^3L8L$(L8L$$L8L$ L8L$48\$81=p2Ɖڋ\$4PVQRPSt$@t$,t$4t$`31K1Kޅ`1PPPPPP =p28hw"z16]38LFu=(;3uRh|"%tajh0|"1\|"WjWWWP+hm|"t҉v]3u 6]3=8;3u0;3u <;31g=8;3t^3D$tD$|D$h"= ]31N=t 蹵@ 1v"WhVVWP+9tigfff։f5 ]3\^3L$ȃjPlD$ u hnP"j6h"1HL$ Ajhv"菛1 ]3D$z]3tB?t=]WShA"[ ~]3L$ DD 3$ D$tD$D$݃ u ]3 \^31H^3|.tq<tk؍}PWhA" P^3L^3H^3t BD$,T2D$ TL 3$3L$ щtT$ \^3T$D$,F9u|$~O1l$GVWhw"S T$ L D3$3L$ tT$FЉT$9uT$1۹(w"VWSSSP)T$ ‰ $DD$Rq4]3=ue ]3$@D$ $#D$u D$ _&1$L$19;ta $Ȣ]3=0;3u4;3u<;3u 8;3=(;3t8x]3~ h `"߫]3~lh*`"ī]h;"=0;3u1I]3 ]3t h"h_"tx]3o]3e$jt1 ]3>]3t 0]3t3$ D$ ]3 u=\^35H^3P^3L^31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ ]3|$E9u KD <^3D@^3DD^3DL /x^3 |^3WQD$lP N D-d;31ۉl$(-D$D$D$;3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$P^3 L^35\^3d;3D$t$]31ҋB]39߃91Ouω‰ӍQ|;-]3]3|7P;3L$ T$t$u.h-"h;"\$ L$ T$t$=(;3tt$1|$4uʉx"PhPPPV @;3D$ \$1 X^3T^3]35]3$L$$L$|$ u4$T$T$4ȍDD$5d;35`;3h{"% USWVPˁˀ D^3 @^3 <^31>]34]3~t=u0]3t 9r u֋ \^3~:H^3”>u~t:t  Iu8;3 щ $ <;3t&=u ]3օ4$u ]3G(;3tih[3Ȩuhu"hU% h[3tj$=3=u<3Ѕ$tNl^3=(;3u"Phu"芑0hu"{Phv"t h[3 =h[3uQ#$t5%t5%1h[3ti<3х $t4$P5l^3hWv"=(;3u5l^3hv"1t"14]3=u <3 ]3^_[]VPD$ L$ $QP)hS"}3H 3~3H 30h3~VƉ t9tD3H 3~3H 3h3>Vƒ1Y^hw"jmUSWV1=L;3˃y CS t ]35]311 uY1ɉNVt11@5C CW"t"Ph "F h"G1He^_[]SWVP$p2;p2u+H;3u"QhmdP*A y h#11hx[3<=p^3u;5h[3|- h;31Puh"V=\^3~e1H^3111 L^3P^3Pt,H^38C;\^3|h~"-Sh"$p2;p2u+H;3u"QhmdP@ y h#^_[USWVP։W1ɉQPU 1O}t#Ë$8uW8"u r1^_[]USWVP։ϋl$=,;3T+H^3 x[3tú_1#t$76PSRhr"T$nz7St$hr"UzD$7UPS\$ Sh0r"0z7PUShDr"z77PUShWr"y7PUShhr"y7?PUShzr"y77PUShr"y7PUShr"y7?PUShr"fy'1PPPUt$(SRhr"=y^_[]USWVˉ1u=@;3hH"T$$8$43|$͉u@;3$Uu*9s~h_1#Wh_t"u @;3}Ks"|s"Qh_1#Whs"t$PhDt"t=@;31\$tS|@tj!;Wh?&jjSPVh~t"h_1#Whu"YtV L|$>)uh_1#Wht"6t |$Z)uh_1#Wht"t D$|$>]3:=]3<]3 ;]3l$M?>>]3B]3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$w"tD$x"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4hnw"p D^3@^3D$HL$LVSQPj=D$T$D$PVSUPN=D$|$ D$@VSPW2=ljӸ1=p2ƉT$ L$@PVt$QR<PSW|$LWVUl$lt$,t$,t$(t$@hK|$(@D$Phw"S $ϋT$ t։t=t$h%S t't$hw"St ct$ |$@D$1=p2ы5`;3jVWRv;D$ՋD$D$D$D$D$$t$t$D$$  T$d;3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th+B#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhw"~m`3VIƀ`3t$Vhw"Nm 5`;3D$,$t$P։ω,^_[]hw"j<USWV΃ twttuy"^T$(|$$+d;3уD$ ;L^3Dy"L$ P^3|.|$,T$0 X^3|$9=T^3|=(;3u|$4u 1^_[]Ë-\^3~} ʉ$9twH^3|(tk L^3t( T( (t1+d;39\$ \$$}2;T$}#=(;3u6|$4ttD(OG1nFiy"t(n9Չػ}n9l$\$QAuƉ:]3tt  $tt ^>]3 L^311 P^3t$ -\^3t$|$$|$}H^3] ʀ|(tP L^3t( ;L$T$|L( (9Ή} =(;3{|$(t ;H^3KC P^3L^3y"1$t=t L^3 P^3Sy"=(;3|$(5`^35H^3A1d^3`^3\^3X^3T^3P^3L^3Ɔ:]3t$ |$(P:]39`^3u85H^3;A1d^3`^3\^3X^3T^3P^3L^3H^31Ƀ|$(T$3\$1 5\^3n H^3|+D$Nu H^3[\$j5d;3L^3)؋ H^3P|$(t$ hhj9H^3VfǀU`^3L$ P^3D$L^3ƋD$$ȉ5T^3X^3\^311\^3uH^3=(;3hz"Kz"ucz"y"=(;31|$(9 `^3u85H^3z?1d^3`^3\^3X^3T^3P^3L^3H^3Ju UPQ \^31|$(tD$L^3D$P^35T^3=X^3^_[]hnP"jWVH^3t^ tڋt֋|҉tΡH^34 \^3 QPV \^3ƀ^_USWV T$L$\^3@hPhH^33  \^3H^3~CP^3L^3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR8 H^3;UjP> fDŽ;UtZF , M ;M;MU;; L^3 d;3T$)ʉUL$  d;31 EE=D^3 @^3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M\^3 ^_[]hz"jWV1=@;3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV p2D$Ӌ5p2݉t$މ$!!jVWt$(!1Kl$ p2p2uhUPzQ5t[3P ;p2u[jVW5p27(!1Kt?D$H5t[3#$SUP 5p2V5p2x ;p2tÉ؃ ^_[]h;"jUSWV$0$,1@D$l$D$D$ $1hQ"WVl suM?j U5<n á<8=L$90>8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-3)1<$L$jhQP41*hd3hedAPt& =e3m09l$| `0@fe3UjDž\$ t|d3H d3~\3H \3 h\3j gjhd3h\3 d3H d3~\3H \3 h\3j f<$ D$tt_1#t"Ph"`D$fe3d3Wafe3gdWPVE% xnu)D$PhwdV*% h"h6"$V 1^_[]PhX"25<h"j,4 h"h"NjLW;Ph΂"h37b j-WUSWV\T$d3< $S&D$9d$ՉjRPt$ Vp$11 Sl$UV 9 1U\$tL$j@PQ 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4_&hk"^T$l$ e31ɺ,e31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$ e3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf e3ŅtMaQ4_&h&"]T$ t tuf f111 e3|$ $e3(e3T$,e3-e3f.e3l$E<$g\$ttXaQ4_&h" ] ;B Q4_&hɃ"\ <$\$t4_&h"\<$l$!F1D4 =$f3L$ه"`/0APWt$h/"j$f3{<|$\$W4$3*Wh"h"S4$u h E"jF j/Pt|4$4$)jIUSWV\$ l$|$t$1E f3*&$f3(f3h"WV h~n3itVn$f3Ѓa~.btCd,f3봃otBs4f3띃NuS< f30f31=(f3(f3mjShHc&5<tHP`EuA3)ރu4t$$V41ut$(t^_[]h·"jB,PhP"h38S j.H$4"=(f3uD$ D$@J" f3t #P=4f3u r%=,f3u M"=0f3u G$@P0h4"h(%jWVPh{"QRt1ƉPjPWb Wʟt jP+Vr'P^_ÐWVt$|$ VW7Et$?/tWhÈ"pbVh܈"bb^_Wh"jfWVt$ |$7諈WVUSWV $$l$WVSU$ $ hU3Wh0"vuWVh"jGpD$@tF$j$he&hV9V$$$h"Nj,FUSWV$$$$D$1 h"SUQ $D$D$1G$D$ȃ 1$d&N|w5<Ft|$`N|Z5<Fx|$Cj$hd&5<DP5<UFp<$h"SU~ V3H9$|U4n$W^.l$\$t <$tu;D$ PWȩtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h·"jLWh$jG? (Ph"h3:O j@0DWVPt$jWV> 9u9t x^_Vt$h"jVt$Vo t@^h"V^Vt$Vkt@^hQ$V|^WVPt$jWV 9t9u x^_Vh"j0WVt$|$ VW_At$?/tWhÈ"^Vh܈"^^_Wh"jfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h&"q-1VWt$ t$)P:1@PPVVu4u0u1OËPhhe&P }D@u hhj& hhl&S }D@PE,CEh/%V\$th/%Vh:", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Php"+%t9\$t h"+\$pD$p\$D$D$ 9\$~\$~tSh"+\$9|1} t h"s+hW5df3h "[}4xME0;E4ru0hH"(+},u,D$D E4t hk"8[D$T 1u D$D5 t$ D$<$$L$$$E@$D$(D$$A$AD$|AD$,A $CD$0D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$8X$$AP$$p$$$$tD$lD$`$$A`$AtD$xD$tH$$x$$DŽ$|$<S(L$ L$(tL$$|$1F9tSh"(D$ D$L$01۾ËT$||$|tL3L$0 3tD D$ WI(\$tt$1F9tWh"((D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"3PG |$)Wh."3PF D$ $L$t$}D@tCW&1@9tWh݋"&L$G$D$$|$tD$|D$P$\$hT$(T$ T$8tD$X$\$\T$$T$ T$,\$dT$@ÉȺ$L$dD$ L$@uD$ $L$t$L$}D@D$t1ɉD$h|$tD$\$D$8tD$,8$t$D$p1ۋd|$tTt˹)\$E3},|$|tE P|$t$ \$tT$ ltL$U<$ugL$$|$t$$t$ \$1ҋ} P$$t$D$1P$L$lT$tL$`},D$hD$tD$\0l$1T$$L$t$D$ltD$`0Mt$  L$t1D$uAAQ 1D$1L$LD$tL$H $L$l|$tL$`$tT$LD$@ u M։ ut$@ uƋ$ș)Љ$T$ uD$ D$u D$pD$pL$@H E‰Ɖt$@|$ D$dD$Dt$T t T$@1҉19\$dىrD$@)D$D$@u|$G1ҋL$(D$8|$GWL$$D$,$u 1$\$ u1PVRt$LDPttt4D$@$Xt$1F$ӉljѺʃ ʊ$ˆ t1L$\$|$$1T1}$t$D$t$@t$U$%t$@$D$t$w }(t$D$t$M(A$D$t$wr9v{} uS;$~J$u2Wh?"h3@ ;$uh3jjHht"$$D$tD$|0Wh" $tt$SWh+"h3Z@uDt$ vh`"= ~$r-D$ t$$$0h|"=j <}D@uh "lth;"_tD$ttt$$DŽ$߬$$ڌ$ W&|$D$ \$$"=F T$tT$ uD$(D$tD$$D$LD$tD$Ht$x$t t$t$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VUttPFx HIt$41VRtRRP*t$ tPhaV"AQL$xtL$tD$4@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

K K\$t L$Y L$) T$) Qt$S. VjWp t$ uT$BtfD$T$tf|$0+|$‰T$D$1CD$< D$4H4PQ|$HIht|t<7t1ۃË|$71ҍt$4VRtRSP#tPjhV"}I D$ uD$4r&1ɋT$P: $D$41ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8quu"5pf3h"h4%hhtf3'pf3tf3 Ph%"Ku =@f3hjSN |$4tg$y\hh5pf3$ D$xD=lf3~1hSP肊D$ F;5lf3|1QQQPD$ u D$y05pf3j0PVu hu"E 1HD$j5pf3蘋Åy'5pf3$0}PVu hu" $DPSy'5pf30APVu hu" $L%=ta= uDhf3u Dhf3L$t$QRPS5pf3ul5pf3ho&5pf3h"NDŽ$$lfsD$tjV$$$ $L$ Z$ $ u4hÑ"L$ u.$$lfst!$$Ph/%4hՑ"L$|$u$=p2|$Ttlf31lf3ɉ\$Hu0lf3tL;$$ s5$$ %DŽ$$lfslf3t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s h" h"'L$8J#$L= j|$W$($(AD$8T$ t$V謘N|$(O11VSh$Pt$X蟍xHWrD$(+D$L$,L$ ʃ|*5pf3hh"'1D$(+D$L$,L$QPVSOD$DT$XD$PD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$肧D$\D$8L$\ W&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$X葌x>WdFD$(+D$L$,L$ ʃ{1QPWV跏th"j蠭1F\$D1VPSh"#D$XWVPS$%|$$u1Ʌ|$t1ɉAw1@|$PhΒ"D$tt$5\f35Pf35Lf3t$\t$dt$<5Xf35Tf3Q5Df35Hf35p2PWt$L@ƃ|$4tV USWVӉ $|$j W\$ S)! Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph "1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h0"3QPWUt$t$hQ" QPWUt$t$h" t$t$h"jUSWV31F/WVUh͓"tWVjh"cWVj!h"RWVjh5"A WVShP",WVj+h]"WVj;h" WVj$hŔ"WVUh"WVjh"ؿWVjh3"ǿhK"WyWVj hf"訿WVSh"蘿VOfD$t1B9| p2I p21j3Iu顴p2Pj3 p2~ t1@j3@9uUSWVD$9p21A9|Gp2SCƉ<$~ SjV p2D$~Q1ɡj3t<p2*tBEB(B$B4!؉B8<:tWBuA;L$u5j3_5j3$p2^_[]V$j3 j3D$D$ W&T$ t$ p25j3t$T$L$D$\$ $R"5$^Vt$FtN H N tNHNfr v V j3^VD$`sH) j3j3 j3HtP4BPQ@@1ҋj3v9tj3j3rh S"j諧tp4F@j3^USWVD$T$#p25j3tC=j311-j39| n-j39t%9P4uH$3L$X(3\$ t Fu1^_[]h_S"hXS"hh!S"USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv /F V>j3 j3 p29|[5j3tFNu j35j3t5FNHNFy F4VPVj3@j31@j@PJU1@P;F ~4D$F(^$F0^,n#p2^8j3 j3t q4j3^G FtH 7~ F^_[]É j3=huS"hnS"hhS"hnS"hh!S"OVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP j3Hj3N^,H j3j3j3H@j3P j3 j3Hj3H4Ij3H89t;tprpj340j3t4F j3H^hS"hS"h4h!S"USWV}]uuu W@t j31@j31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$go&so&G4$O,5p2w0VPww D$0^_[]USWVPt$ffo&so&F4$N,=p2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jN8p j3HtƒQ j3@ j3^_WVt$ j3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd,Fhjv, v^_USWVPT$|$:%4j3\$ j3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4z31ہ=j3| t Ptz3j31t 98t@^_[]Ã^_[]`V15j35z3hVhj3  5j3^ft$ t$ jySWVt$frLN4F,=p2~0WPvv 1o&t\fv4V1AN4F,=p2~0WPvv 1o&1;NuN^_[hO"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRu׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS#u$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h W"hV"h hI")USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPq3T$3D$M u1^_[]USWV(t$Fl|F|F -}F F$|$0tfhj脳ljPLtLXt uB\I\$$|$ C$|$4Nh$X"1<1ɺPt`tLtt l$,\$(|$0uejVttP.ttPA 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=p2ljp2l$1 UPQSWVhj英Ë}Pw S褯 P G1PWH¹tTt p2߀<$u1 t1 L$QWURPVhjڰNjl$hu P P E1PUtA|$4t hW"/SW1^_[]u C4CHKL1}Mt|$4t7hW".t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW":$  $ Vx19tQRhZW" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhT"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthT"h\3D$(u KHKpStURQPt$DljT$t hZX",u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhT" z3VRh9U" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhU"D$L$9tQP$$hU"t$Ht$L$tI9ȋt$ tPQ$$hV"X1t$\^_[]h~U"hpU"hhT"Qh~U"hpU"hPD$L$ $QPjp2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$aV"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttE^|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$V"nu0|$ r]@hD$D$D$,$D$ <,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ߭,@o M|$@ t"D$D$D$$D$$V"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$aV",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$Dz3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWPƋD$0T$UWPƋD$0 u$$$UWTPljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPOERPO$GW #RPOERPO$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaV"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaV"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaV" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWgKNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPJt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP\JT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPI|$FV D$t RPI|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPI t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPwG|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPF$ D$TBL$?ttXLT$BtJ J T$$T$ QPFL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPEي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVCD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv 芪 t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hV" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hV"hW"h h W"hV"h h W"hW"h"hI"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p ۅA L$H SjQ ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP}1 ^Vt$ V(1y?1I+F$ыT$ptj42QP11 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jD#Ɖ t,UFtf^81FF}L$$7ʋLt$,t$1t$L$ T$D$D$($L$tD$L$$V"|D$(t$,L$ GhD$L$D$$D$ =t$<$D$wuuAQ AQt T$$2NdQEKHL${LL$Q,q0tt  t1ۋuuJV4KD$,D$$p D$D$ D$D$$D$ oLL$|KVH^L\$z3GhD$L$D$$D$ '@V t$$z|$D$X,p0tD$(tM  t1L$$D$(uZZBA4 $Pu\$ tu\1)׋N tut ⹐t 1¸ u1ɉL$ |$$D$;L$IIlt|t1҉D$M41ˋTt$0t$t$1ɉL$T$ L$D$D$$tD$ t$D$$ڎ"{L$0u%ltUH#D$'ltD$1ҋ}47RA 1҄1t$4 t$ 02ua r u:1GX tX U<T$A4 $Pe^_[]D$ ڕ"D$˕"D$C$"ؓUSWV(D$@h+h1T$<PD$ AHltl$|$D$@@0|t1ҋl$H1|$<΋t$  z3uN z3NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPULr$K\$ tSD$hD$@p$Fx~"1ɋ@ L;H|PHsu"l$\$ z3{z3 z3\$L,D(Pl$tttt$T 1¹pt Ѝ t$@F03FHD$ Pt$0KCLLtPQ4$}Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(z3y z3z3Py`PD$@z3 z3C9݋|$\$"V$( @V T$g"Vg$$ h"h4"3uD$ $PUh"SShuU%%<ShhǙ" $( aPWh"Uh"$( x?$( Z1ىjPySh$P? uSUh_"e j2PW% E2$( ;h||$jt\h"@PUWD $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph."WfL$\\L$\\ $\]u^E p&Yt8u1҄tʋ$( t?r QVR Vdqi8uUh "Ih:"Ph\"4USWVՉt$hR  1I t uFjh.#V/ u<^Ft t u^F t tW"PWV tt$hU荟 u1I1ɉ^_[]WV׉RhQd t6< ~< t<#t< t >t< u6AWhV0 űD$ 1GtPh k$^_V!1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىhw"+C< t< t< uh{"S`ƍD$$VhPS L$T$\$PQRSD$0PD$Ph"D$@P-d t$$$ىh_"rC< t< t< uS =$<rLjSh"Sh"ZShܜ"Wh."Et$<L$D$D$L$ oPQtXljo 1tX L@uH~vCtTjhh"Ϝ Va$^_[]V}a )UjSb D$ D$ CD$CD$C D$C$Cl$Uha1#V!; u D$CV a)1$<;obD$D$PSh" =USWV$0xjWZƅ~F$0h$1jUY~4$hPa C9uЋ$4h{"S蛋Ǎ$ىh"$0Sat| uƄ$ $0phɞ"QUD$$0qhӞ"QPdžىD$PUPUSB u׋$0EED$1ɍ$D$ $PhS賚 D$PD$PD$PD$PhH%S`D$L$ T$ ыD$E L$ T$ D $A9L$D$uP^hH"h+" }ShH"hZ" ShH"hz"  $02t$t$h"$@t$Ph>"襙 |$Wh^}~14^G;}|Vs^1^_[]USWVD$(}~;$ ~VE pS $PjVWjSND$11D$D$D$D$$D$ D$h"u Vu+ H5$q&D$>j 5<P7 Cr{3밋<$PCrj h0#V, ىVvS1PyuE$ ~S4V $PhjSPt$VKuVh" ,Whq"jÍD$LPS@u $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h%"Qhr$PPrr @r ,r .%r0B$PPh%r0BVD \8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQo. $Ph"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh|"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP\- $Phѧ"Phr j"t"PShg"| .1$P;$hΡ"Shrt$VW"9;$PVh"@||$$Vh "'|h۠"jhr t$j={3:$hC"Whrt$h"?c.\$jhC"WhrS$d|1$XAA$Pj2PQ* $Ph"Phr9rhǬ":$`>ߋN8&w8t&PVh"z `Ouet$$P\$ ZSh"yhF"$P\$;$PPh"y Vxh"Sh*rt$  09rh7"hhC"[$\>$Th'%Py VgxhU"*$X~:$\1j h$VW "tQC`;$X|j x~-hz"˯$`>V軯`Ouj w$X1~$1:t @`9u9u$\Ph"}x1@\D$,\$H|$PS$hjVQ L$,9F Vh"VhrW ha"F0Ph"wF0Pv,v(v$hA"wj vhn"跮$ThN"wPh?"h/"Fhl$VAfD$0L$4$PND$8Fh"Vh(r WO  FtsSh"Ew$PtPhZ%,whգ"w$Tt*Mbi)QRh"v j v$XqPSh"v ]h"螭$X~n$1Wȃw,"$r&L$7"!""& ""PRh"Cv F`;$X|ۋt$~G$`>G8tu #P&w Pt&QWh"u `Kut$hΡ"VhrP>"t"P襬t$1 E$`$d $jj h$QPjVyjh$V  V$`t$VhZ"Cu$XMbi)QR$\Vh" u$|$|$|$|$|$|Vhɢ"t $\uM#1wh"衫L$!rh"$PPVtt$h "!11҉4hӀB9u_1#t#QPt$h"4t={3~S$h1hU"t1PQh"s C uߍ_ j s rt$h8"Vh&r@t$";$Pt" j"t"RPt$hX"st$ USWV`p׉͋$tph"SA,$tSÃr t1C1|L$PVQ) Ou vu hu Z$1hoVWK owt1$0 j2t W  F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghhx"WD  Ƈ$L$hy"Qh+rU9uh۠"jhr U`p^_[]WV1VFF FFFFF h%"VhrQFĘ^SWV։ϋ\$1D$$jh6%S  tVjh;"S  tBjh#S  t.jh@"S  jh0#S  u$D$D$hE"PhrWh^"PhrW={3t?|$2"t."PVhq"ep |$u$4(t&Vh"Fp ^_[$oWVYKƿ3Ph$"Wr Vhg"Wwr Vh"Whr Vh"WYr Vhש"WJr Vh"W;r Vh"W,r Vh>"Wr Vh_"Wr Vhv"Wq Vh"Wq Vh"Wq VhӪ"Wq Vh"Wq Vh"Wq Vh0"Wq VhG"Wq Vhh"Wq Vh"Wxq Vh"Wiq Vh"WZq Vh֫"WKq Vh"W"t 4{3~?-|$h"VS  M~%Hwv$ht& ${3${3ǃDt*Mh)#5<ei0{3u5<Md3{3nNRt {3j W5< 8{3L$9&-<p2{3 {3{3p2j W5<) p2L$9]`<{3{3} {3nPw,tWP\,ujjrQPh"j4D$كL$l$ umt$<l$ 1  ut$)K${3h"5<h"p5<hb"` $L$L$GȍQw[sV?P&Pt+-G A6PuZGu$t L$-AGL$AL$$j= {3us5={3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$he%S+t jh{#S t ;/u f. Gf./W@S59SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSYtH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 5p2 3H $s-t$$tHfHxt P2)1^USWV={3th\3jjh"jj9#tvƃ={3th\3jjh"h31GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk={3tV$Ph""h\3bK ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h."d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+={3tW"PhF"h\3J W_1l$$ttF9u t G9t$du&Qt$h3h+"h3I<$WbWE&F~X|$<th̵"V_VCbV&vfFt$ t$ t$ h"h3(IEuFufFFV!|$WP`WV&N={31ۈ 33|NIL3h3$3ǀ3|NAMǀ 3EFNDt$h3h"h\3tH1N1@={31ۈ 33|NIL33Wǀ 3FNDǀ3|INOW$3ǀ3|NAMǀ 3EFNDVdPt$h3hj"h\3GC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@={3#~VPt$hw"h3BG1t$h3hH"]a >W\Ut$$t$$|$$WX ƃ*Vh"V%]1@KGufGfG1@={3$ WbPt$h3hj"h\3~FUt$$t$$|$$WƀH1@={3ىV_bPWh3h" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@={3t-ى,VaPWh3hj"h\3E؃^_[]S1 33|NIL3t!h3ǀ 3APEǀ3|ONTt!h3ǀ 3FNDǀ3|INOt(h3|ǀ3|NAMǀ 3EFNDƀ$3t(h3Oǀ3|MODǀ 3ECHGƀ$3[SWV={3th\3jjhc"3=31VWftmxtg 3W sJX tCf{u7={3tSPh}"h\3 D S\S [빃;=33k53tc~ tWuLfth"W Z={3tWRPh}"h\3C Wy\W9 륋v$^_[SWV={3th\3jj h"3tS31{ t$C$Su[SFuՅu53thԶ"VKYv$^_[USWV=${3R{3utDh\3jj"h",th\3jjh"5({3t$G!jj#^ơX{3;3\{33,׋-({3WV]Ɖ׋ \{3X{39sAWV2ÅuWVh%"p\ SPh5"h3B c렉1‰1 u`WVÅu hm"%\Cuh"SXCt SZcSSPCcQPWVhL"h3A:K({39tPt$ ZU-({3X{3;3\{33^_[]USWV={3th\3jjh"`fP{3jY9T jj\ʼnT$3 3PQ\D$5\{35X{3J\Ɖt$U9\ʼn$St$p\Él$9$\$\{3 X{39ˉs6fP{3j8DTk D$;X{3\{3rM\$ -({39sI\{395X{3s9-({3tS ({3E9u\{3 X{39\$ \{3 X{39ΉsZWVÅu h."YSCPh5"h3? cWV[Ɖס\{3 X{3911 uU9t$D$ rIWV<Åu h."|YSPKAc9-({3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5\{35X{3fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ={3th\3jjh"FtVPXfvu݃={3th\3jj h÷"q3=31ҹ$RL$QtMƋhtDEt9VP|$ W11ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV={3th\3jjhη"3=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h,"VRWh"h3p< 1^_[]fUSWV`={3th\3jjhW"u535354{3hv"hhp2<8${3 t=Ĭ3uFFF%)Fu9rV9={3tJh\3jjh޻"F {3t(t$h\3jjh"F {31V9vtRPh "h\3{6 {3th\3j H$ 9̓>t9߁^_[]á@3tPjt$t$Xuùt2WVIAfF=L3|CP3)fX35<3jQhT3u5L3F1T3PVQ< =P3FL3^_ùp2Qhw"蠶8u"hݼ"h"54{3h"h345j**WVjhp2謦1t)h t 8@ W\^_VX{3 \{3t7#T{3=@u%o>X{3 \{3tT{3!=@t^USWV$$$ $jhWV,T3tE1M1 tmjWVS$8jWVS$8t$Sh8%hV<0Vs$ H3U Rh5H3DžtGhe%PtShI"h33 5H3DžtGh#PtShq"h3t3 5H3[Nj5H31jPP6+^^$DOGrhPD$Ph"h33:hPt$V $(j7V@ H3u D5H3Nj5H3j1PP64+^^X^_[]SWV׉1jPP1+FF9tX\$)yWh4"h3M2 %؉jQP6~tF hP6c F^_[USWV|$_ OtGhS75 GO9}vDty)9|n4 ȉG.uFh V%P;-33rv={3tUh"h3b1 \GP1={3t:Phй"h331 %1={3th3jjh"P1^_[]USWVD$$P$D$x/@th V%QH:1ƀ81Mbi)T3H1ًP1 t H3P RV5H3At\G9uGSVP t5H3Džu*h V%D$P9tƀ8MbE^_[]USWVt$!M1 tFjhRW$,T3t(E1M1 tm`ƋU R^_[]ËD$0ءUSWVX={3th\3jj&h"x${3 1t.VE/tÀxtVh ">߉^_[]USWV|$u h>">W3u`Ɖˋ-@{3UDžuhH"z>-@{3)ً39w؉9vlj<3|$3WS^_[]USWV։ϋ\$ t;=33rVWh#"= -33QPVW{s LK$\={3t%[$tC1K 1 uh="S9^_[]SWVt$f~th"V9~u(~thԽ"Vg9~ th"VS9FN tkQPDžuh "V)99tt79uNH4~^ SW FtPh"V8.>W333F$53^_[ËAP 9ttЋR9uIHËIH hL"Qt8Vt$V莵33^SWV|$t$Åuh-"V,8;^ty^C Fs j/W2GS$3 3W WFV86P1ɅF fN^_[USWVd={3th\3jjhc"w= {3td|$xhV"W!ƅu060 Ph}"h3  Wh~";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6vuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u3$53L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSiG39|͋ 3 $53T$|L$<q$Q AiH{3L{3QA 33QA8{3A$t$ Vjj(QF @t306 Ph"h3 t$xh"8Vh^_[]USWV$={3th\3jjh"e1PPU迏 Džy0Q0 Ph~"h3 Uh"88D$,PWy00h Ph<"h3 UhF"7$jS)ƅu hh"7SVWԎ xD$j(PW y00 PhԻ"h3J Uh"{7W裏${3RrD$l$L{3=H{3,$1Չ1 9$h3jjh"jj5353诖3jP63u h"6PjPhe%HĨ^_[]fP{3D$L$ L{3H{3D$L$ 33={3u t$(6t$pPh"S6D$ L$$ 33L$T$ 3<)3؅~ڋt={3tPWh"h\3 =Ԭ3 33hQV  33^_[]t8{3 PUh"k s- 3hh3U~ 40Ph"h3 jUSWVE{3fP{3t{3 p{3D$?SDžu#Sjj0SDPO/F^_[WV|$ th"WWNƃ= {3uhVDx={3t"W vhN"W Vh3ha"^_WVt$ v vf1t9t1G@t9uuh"Vv vWh"h"hh3]3^_WV|$t$ = {3uWV[x={3t:WVh"h\3$ 0fPWVh"h3^_Vt$~th6"V~ thM"VFσfFVƃ= {3u Vx={3t8Vhm"h\3F #l0PVh"h3!^Vt$~th}"VMFσfFV萿ƃ= {3u Vx={3t8Vh"h\3 #0:PVh"h3^USWVl$|$\$u0= {3uCWSYy50PSWh"uuI= {3uWSZxB1F={3t\2"t;"SWPh"h\36Uh"2$0rPSWh"h31^_[]PD$L$ $QPh3 ={3uh2"=tXh")u2jkWV|$ = {3u1VVhWMx!1F={3t8Whc"h\3* #P0PWh;"h3^_Vt$~thw"V.FσfFVqƃ= {3u VWx={3t8Vh"h\3 #¾0PVh"h3w^WVt$ ;53|$3s(WV=t xt@u;53Ή^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$133|NIL3Ft,h3wǀ3|REMǀ3OVEDƀ3F t,h3vǀ3|TMPǀ3NAMEƀ3Ft,h3vǀ3|EXTǀ3RACTƀ3Ft"h3vǀ3|NEWƀ3Ft$h3gvǀ3|KEEfǀ3PF@t(h3?vǀ3|EXIǀ3STEDƀ33^WVt$ V蜱1t%t 3P 9щrVh"h3` 1^_SWV|$3Wh"S> SՔ3HQP~ Q1 P~ t3HQP~ Q PJ t 3@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#h#W詤t9h^+%W藤t'\$j SWZ $ 9uy6hG"U$~h#WTt@h^+%WBt.\$j SW.Z D$ 9uyvhZ"joD$PhU53B u ^_[2hj"joSWV |$t$ >h#W豣t9h^+%W蟣t'\$j SWY $ 9uy6hG"U$~h#W\t@h^+%WJt.\$j SW6Y D$ 9uyvhZ"jnD$PhU53J u ^_[:hv"jnUSWVhq$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUhW" ^ tjUh" ^ tG99ufD$u\$ tR$,4jVhmg%] EjVh"] 4jVh"] 5\$ D$7f@jh0uht$Vj P53D$^ރ9tD$j@h"Pw ߉tD$PhDaryDpriml$t?tD$PhD andfD D$PjhDgrowfDnt$VLhD defDectsDuV)hjh"PĈ V535 35353h"Et2tR}jh"Vd H}j1h{"V? #}jIh2"V t6Wh]"sSh k$eUփOut$ h".^_[]1h`"j@kUSWV}\$j S53O D$t"NuD$Hj@PjSPh"jj$j$Vjj53rF=tPh"vD$D$ D$$fD$t$j VE 0 9 1L$81qAQQ a A j QV53-D$t$ *jh"E pZ  D$ @L$jhtjPjQ53h"h\3虄D$t$H1D$`D$L'Ƅ$0VhQ`53) $j D$tPS诅 |$'y9D$(ȋL$;w&|"@D$Ph"h\3j &D$$<JD$ D$ L$jhtjPjQ53~e^_[]ÄtH<t<u'53h6" 53hQ"h3 P53hd"h3h"9h)"jhE 0h"`USWV $ ~($ 1j4h"'X ?C9u1CCJt$LUPV蛦 CJjh'UVjS53~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P535 35353h") vL$D$$jh'hVjS53Ffȁw$VhU菃 VhU~ ƅtL$D$jh'h$PjS53]$f1Ɂw$PUhWh"'Wh#)vL$D$jh'h$PjS53$f1Ɂwh"t$ t$ 1؃;D$ D$4ƜF>|$Ń w&hr&h4%_ ~y)L$"  Ȩt&e6&=(3uI&Ph]"sD$P<h\"S譧1T3P3D$L$X3 \3D*h#PJ|E3D3D3)h3PWw G?t C3rx9uC3 D3\$)<+3T$JDHUBRk<P3D$ T3L$D$1ɸE3T$ωD$ \$SMƋD$)D$tGD$ D$H 1ۋL$|$E3VQP: 33E3ۉu\$ 3DQu+<:wS MeKC CCCCuh`"1;D$PsD$\$SL $~&D$KL$  S J#GBD$ @hE3sLH3P3 T3uh"dhX3Ph}"W4`3u1bP'|$t `31jPPLc = 3u'1tu/h",j^bj jhI" MPh"ȵj.KAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQ6v\3X3!уu+D$T$P3T3hc"jNЏPh"h3 jUSWVP=T35P31,9|1C=T35P39}`s &H-~&E9ƉMm|)t6jju uL$L$9ȃ}  $Q 1F,MUۉu1;}E|u E EmubWV"VlWjHWj=Wj2Wj'hhVD' x`j"h"P% hX3衄 jPV% jh$V% E3WHPWVi% V'^_SWV։ϡd3H d3uhhh3l?h3h"h"hS+hV"S-tZÉ A"t_1#hh35`3Ph"S轴Y|@hX3賃 PhH"S葴 yGh"Ph"jE<|.i< _1#t#QPhe"S7 t Sjj!h" Sjjh"VaH3tSPjhE3#Ph5#Ph+#Ph!#Ph#Ph#Ph#h38j١USWVpT$ L$$$3&@ƍ3D$\D$`$3 @3L$XL$H)L$L)L$dtMuI|$ tB1\$L|$H_1#te%L$$ L$D$ \$<$D$Oq%D!F9t$ uȋu] }trOly2|$ w_1#L$L$dL$L$` $D$ D$4%e%w_1# GD$t$ D$LD$D$H$D$Oq% ދ] =Ծ3 y2=ؾ3tD$3$"!y2nD$3D$3$7"ըKwDT%$`&D$#$A"譨GG0O4D$L$$W"$"" ""D$$A"XD$,G@D$$h"=%3_1#D$0pu?t$3<$D$_1#@t$<$D$"?%ىШpu:|$t$34$?|$4$D$"?كှ%] yBD$t$34$?D$4$D$"p?%sBD$t$34$A?D$4$D$#"(?% sBD$t$34$>D$4$D$+">% sBD$t$34$>D$4$D$5">% sBD$t$34$i>D$4$D$="P>% sBD$t$34$!>D$4$D$G">% sBD$t$34$=D$4$D$9"=%sBD$t$34$=D$4$D$K"x=%fyBD$t$34$J=D$4$D$U"1=%sBD$t$34$=D$4$D$r%<%}tQL$ D$h$D$lG#D$ E|$t$34$<|$D$hD$}4$<D$0D$D$3$s"XGHtD$$"AG(D$$".$ B|$,u=Ⱦ3y2t|3uteXu<$L$$T$ 3u t GX@r9=ؾ3uD$3$"訣GXHw $R#$|.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$3$3ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$ 4D$(u;3 3Y=Ծ3LD$3$"荢3D$(M I"$x&|$D$ D$D$$$%_8Ⱦ3ZG4D$hL$$T$ JL$0$RiLưD$81D$D$D$hD$ t$D$0D$D$$$.3"4$yD$8]~8 D$h$h1uG0D$$L"舡D$,-1D$D$D$(D$ t$ht$D$ D$D$$$214$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$J2D$(D$4$D$3D$(1ɉL$L$D$ t$ht$D$ D$D$$$1{4$D$D$$g`1D$D$D$(D$ t$D$ D$D$$$1D$($D$3S1D$D$D$(D$ t$ht$D$ D$D$$$514$D$D$3c[iF D$|$D$ D$D$$D$ D$D$D$3$3V|8 D$($ft31D$D$\$ t$D$ D$D$$$p0&A1Ahy2$D$3D$"[D$ @D$0t$h1AtD$h9k4$uv^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$SeT$<1Ht |$t$ $TT$a΀-% plj\$ Cut$BT$ҋ $)|$4s1ɉQD$PS菣 D$ D$ 938*~s8\$ L$ D$D$W|$hH"SeDhD&Se;h&Sd7h+#Sd3h^"Sd'hc"SdD$t$ |$@r1ɉQD$PSl D$D$ 9؋t$8Wr8|$9r1ɉQD$PSy L$ 99։D$rL$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh34ty2ha#v 1<==о3 ڍt$81 D$ \$phjSh3PVT$R;$1BD$L4JD4`L$p$QRSRPVX%ܾ3 ؾ3u1$P$w ؃&Qh3h# 31<=4 j=VJB9=о3 j=V*BT$81 D$ t$ hjVh3PRW\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP,$$h3hH#D$49t 8Vh#S1JD$ $$Qh5#,=ܾ3D$t$=Ⱦ3$D$D$,D$\$(V (GC@D$p9Vh#n0Pt$h#|$oQhQ#=ܾ3D$WSt$h="VD$ 81ҸD$ |$\$ Cj"$PXÍD$pWVPSt$ $P"\$ E $3jt$tS7 $3jWV# -m0Ph3h+# Bܾ3 ؾ3$Ph3hB&裐D$ $u1@t$2|$ Qh"(11G|$1\$ tpupth{#Qe&D$ t$D$t1@L$ ɉ~%t#"PQ^Q|$t nl8t1j t$ vg4$`St$h"FQt$h"7.ly2my2L$ L$ ف$K{8P|$W2]D$ t@j QS& D$ ;$|$8tQtUL$4 T$hjRh3QWt$ ly2T$ gL$4D$ 31ɍAD$4tT8`T$ Q$QRQPWcܾ3 ؾ3T$J$w؃&Pt$h#t$L$ $d$ r $3 $tu¸+#tc"PQh#|$D$u |$u |$TF1@]~%t#"Pt$h"$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qhj#i0|Pt$h#|$L$lj% L$St$h"{D$$&Si1ɉQD$PS蓛 L$ 9t 9St$h2",D$ D$ D$D$0L$0RPQt$,t$$PtBD$tUtsD$ |$3jVPM D$h|$th811FD$&|$3VVP  D$'$D$8|$3jVP D$p3jVP UD$1=ܾ3D$44$Vt$h" Ph*"=̾3he^_[]4$h"ًt$D$t$$t$S @9s Vt$hq" S @D$t$|Pg1ɉQD$PS T$tD$pD$ 9t8u#g8 St$h"Qh"f1ɉQD$PS; ƋD$ 9t8t}St$hS"St$hj"D$t$։D$fL$8`OGL$0d$ rxL$D$nT$SfL$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h" j0j-wPh3h" h"h#h#h3h"SWVPD$t$|$L$ $QP67Ɔ9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS(1Ht$L$ltT$d;WuT$h;W(u QN ŃtD$ppPU> D$DGXHr P._oXd^_[]USWV$ly2383t 3/3Sh35tW3މ)ˉESQ|$ W= DW3VVfǀ3/SU5u3Uh3,^_[]USWVhT$D$|"&1Ch3iD$ CL$;rjt$V(x ufD$jD$Pjh3Vt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPp;Wt$h\"|$$j@WVPS;Wt$hl"jWVPt$=hy2`Ph"W ̾3t53Ph"5hy2D$$PV5hy2G 3^_V΅tOaHw;s13 3tea0tPh3h"M Atʡ3 3t"a0sPh3hB& u =̾3t^j-|USWV=ܾ3ˋ}ؾ3 3 t u tth\3jVu4}ti=3|}t j eMO؃thD$VuP: t$UtuRh"{5py2Rh4%ǃ bD$VuPA: tMD$PVh"蔃 D$VuP: t+t$ t$ Vh""b]D$ s*P? D$L$ r!QPh]$ rD$rIPha1#QPhX$xt$hg $}u h+"j e^_[]Ph#&USWVP=ܾ3u(ˋl$ D$$|$5ؾ3 3 t u^_[]Åtth\3jt$W,2܅3| t j y$^_[]uCuWt$h ", K4$~DN1ۅtPh" t#=3uPhB"9t3C뿃u,h+"́'t+ORh"賁rt51t ttt ttth"p 9uЋkT ;$tl  1L$D$Sjh"ep {t+1:LtPh"?p G,;{r܃TD$@TL$9uj 7oVG1A ^_[]h3h"+USWV }=̾3t D$ toh"W:>tc>L1ɉt$QVW T$$9t8uL8,Wuh" =̾3jf11CL$ t$PSQVuuetWt =ܾ31=3u?=3u6L$1J1ыT$1 u#MUPj h"1ɅRaMUPjV tK=3u-=3u$1H3$3|$ uMUjj h"MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVhw"ShUh#SW t9VVE4$Euuh_1# Ɖ$t^_[]h"h~"jh"h"USWV\։ύD$ jPj PF 1u0D$F|fD$Y|Uh0"j D$ Pk$L$D$ L$/Ph"j D$ Pvk[ $fL 3/LA .sD$ L<u\$ S臣jPj SjE E9[|$ t D$ P]Vh5"_ld^_[]WVth΋u\~8tU~4~`N4F8 I9rPC1F0F4F8FXHr PCFX^_fUSWV\$33hc#sP\su 3Fh0"P':u 3j*3Jmx &蹶'?c.53芓h0"P9u 3=3n#t#l$PKrt Pu|Qߋ<-t<+u{uNh%SD9tGSM16khs#q3t8u)hz#q3Pqt 3#h#}q3Pqt 3#1=3tjh#~FP7֛j觛N=3u0j_`ujjB=3t!=03u=3ujh# C1FVV7=3uh#5027u\~jh#B jM53f:0BuK@33!Ѓt4l33Bzu=83t0譚|83jS=x3u T3=l4~jh#u j j 6GWVt$ y53533ut[<|=3t=3t|2'V1Wu=WSBV@_WV|$ W@jP8tWP^^_t$t$8tjh#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@93<3U5 4&=(3u 3(3U=v====,=XAf2 3i,30343F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fZ<D$,3D$L$d$ 03 43D$D$fD$ D$5 4 Pj5 4Z6 3,^_[]VPhht@jV) t1h4#ktP&$t$uչD%~83h/#rkt(P# 83 83y2 83 83u.h?#!kt P藳۪#Tƅ~5<3h:#jtPc# <3 <3 <3 <3P^V[tP =h3t1H Vy^PL$$@31Qw$&G#M(uMf@3 xJ#4M#+P#"S#V#Y#\#=YÉ_#/uf@3b#uf@3@3WV׉vu1=h3u WVy^_SWVPhe#iPi1Ʌ y2hT%ui&th3Qhh3vth3x#th3Vy q"l3{#p3~#t3%x3N"|3#|351"y33333333~ 3h3,%3tZ<d#_1#_1#t 3##gtlj=3#O3#>#t 3#!#t 3=43t8=3u/湿#3 &3=3u 313_1#u 3_1#⹋V$3t8u33_1#⹽ &q3=x3tt8u33_1#2#:3t8u33$# 3t 8t1@ 3_1#13_1##$VWWh3h3q,"u5&V5353h3h3H# %V5353h3h3% %V5353h3h3c#;tlj=3#m3%Z#_1#_1#tơ38t,<$1QQPw PWT<$W*@$h#3qb%=y2_1#u_1#u_1#38t2<$ 83IQjPw PW:T<$W@$"S>3# tÉ3#_1#tƹOC"=t3u_1#t‰h_1#Ɖ53>u 3^_[Éy$3z8{lV t<0 1=h3u V)r^USWV׋t$$\$l$;Et*+u( %_1#t D$ L$M^_[]USWVր9tMτtC1302U583Wlp 313U583VOp ;3|ut$3^_[]Ë 383USWVL $։ύl$ D$?h#WpZ)?SWU0 D h VUo $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$ xt$4h VWo L^_[]Ë 383V=83t =3=x3uF 38338t!38t=3u 31B3=|3u 383b=3t 383H 3=$3t!=83|1Fj 2F;583|^Ë 31B^ 31B 31B= 3ug=83t =3uN=3t 383=|3u 383=x3u 383 3Ã=3" 3Ë 31BY 383Ht$j53Mr 1B)=3tË 39t83 =3jË 383 31BV=33t31B53t-F=x33t31BV^Ã=x33t31B^_$3t 31B>3t 31B'3t 31B3t 31B3WVD$ #=$|2 lj Ƌ 3j" 3j 3j=3ttV$ 3j53^_WV|$ 1Ʌ<+u OL$ GW-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$h&1@ÃQ*A wO$8& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$|2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th$V#trL$PQV t4uRL$x# $x2P #T$x #$x #w^1J#^aD$# $|2  39uVD$ T$5$|2! щ щ! ‰ 19^Ã=y2th#Ë 31BSWV@΃=y2tt3tVsk"tx1Cj S*VGVSP_GVhB%P 3=3!Vh#j@W RWZ@^_[ËD$3WV9y2t#֍|$RQjWQ1B$5y2^_Ãw&ÉfUSWVPt$ P!уtRPtt jh#jh#l$$\$|$Q t^tY9uE}14u <Ճt(ˉ $19u tC ;$u~2KՃujh`#t jh/#jhF#D ^_[]1ۅs IQRP踒fVt$t=y2tjht#5y2^áy2xy=3uE 30@#4@u.3jh#?t  4ty2PUy253)3V1N= 3t9t/ 3,@wB$@(@1҉,@Ɖ^USWV=y2 3@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh#1@$qQ5y2 9D$} 3럃^_[]USWV- 31|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5 4( 3@9@S 31JЅt8=$3u/@u1u0@4@ &[WV 31t[@t @4v 34@0@{!уt RPF1G)t  4t^_USWV 3t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH 39t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë 3t$@(@ ,@1HUSWV5 31H(@$@9t#H1ًP1 u,@;Hs D\3%D$z9tG1؋O1 D$ ~9 $tG#G=X3t @ty2x9 @}lh jtH @1HGG7FGF8~FNOG Fx ~,@;GsN+X3~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@!ƒ5 3@@y2tODy2Q@u;G  )RQ@w u& 30@4@D&OD1@l$1tʼn$yjh#1=3u y2x~OUQPA 5 3@@o<$t0@D$4@=$3tU=\3u#L$ Qh k$ \3j2=$3t=3u q= 45 39>tOOHO 35 3wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh# 31H^_[]USWV 3ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1Hy2á 3@u1I4@0@Ë9t1JQQ 9u@o 34@0@1@@(@$@,@PPP@/ !ƒtjh#81PPjt$ !1WV 30@4@!΃t@@9} 0@4@^_SV\$t$ 53({ 3h8@j 3@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV !ƒt 3 3@P53vz 3@u@^[SV5 3@  ˀuH9tPQP PJdž @vv Hu5 3@uE u@+5 3dž@tV1 3P53y^[á 3t@1fWV|$t$ t=(3ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVMtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h_1#j3h #lLh3h3h3h3\$ -uF :tjh #]jNbt'.t53bt0:wtptcu+3F&jSh3 3jSQ ,uF333333333|3333t33x3h #J1tPhz #J1F$|2Vh #Wh,3P(h #dJVh #Wh03P ^_[h #>JPJj3p11B th #Jƅu&h #Iƅuh #Iƅt]h#V+Au6h#VAu$h #VAuh#V@t1B#w1 3TA ruƀ43ƀ43ƀ43@=u=(3D$43SVt$ t3M1ۅuD3;1Cu1񺐇2(u!=,3u2 1ۅÉ^[D$43ËL$=r!=(3tP5,3j h43?'43u 4353u43ESC43Ãw@43uQh #VPt$ u T3ESCuw 43u;Vt V503B$T3xPV@,@43uPh #V5,3j hT3>T3^WVD$L$ =(3=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$؄&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=(3t'~3P19wKS>~-19s2C,9r9v)CK$SU uF8AU" V o ɋl$u9tSv t1|$jjSOF ~.EFE0uE^_[]V3t";T2t1FVh3P/ 3p^USWV\$,=(3tV3tgفuH3J 3319*Qh3~-3531E43J331E3=3u 3 31҅; <2t҉օt1PS;H*$&=3+"3Шu*%=tS 313]^_[]Ét$353 2y33)É 2n1|$ l9} SWh30 uԉn_1#t33VW)=3=35* 38u!e033tP* 3%MD$P1-3E˨ -3E3 3? ǃ3^_[]3] v3e33=3v!x ux ;|3=3w%33< t 38 t33 33B53a338r 33=3wx u 3=3\x tQ 3=3.uD$ L$PjQ课 $T$e^_]Ë 31; 3|3á3t @@@ 11a[1PPUSWV=3׉΋$$L$ D$1AyōD$PU[#D$=xh{"U.USW$ShUh> 0jh| #U, ShU9> D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU8= S1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3o=82u=h2u =3P1TAP苿@PjVPWj|8QZtQL8hV"WM,É4$pu1ND$PVx#D$ =uhVho #a0tPxƅdո(2Ex uָX2Fx uh| #h#S7+ T$Z]VUh #S:S$4$VWǞW;V2Ā^_[]SWVh #/P/tt;^_[&h#V1ۅt+hH"%VtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u% #+ #Qh#P* tWh #v) Y=82t"h #h#v) V(2=h2t%h #h#v) VX2^_[^_[USWVPӋl$D$ $uSPؼSS1tD$ t}t8^_[]StV믉h3jPN SPuSqWV38L$ Ƌ3 <39}I9u3xtWD$3$3V38t,t$<$PD$38uڃ^_SWV 33$ <3+ 3|51ۉ|$8tZO\$<3+3$9|Ӏ8t-t$|$D$|$D$$8u$3)ȣ353^V^_[V533tR3)Ɗ 0@u 253A=33"3=3 1@^À=3t833 25331@á38t AUSWVPQ7$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh #O+h #@+Vh #P@ Åt^_[]jh #Wz@ t Vh #Pe@ Ud uh #*Vh #P:@ ÅuVh #W%@ WV9G t'փtPh #V% G?G uG^_Ð3i ËD$u5Ã<2Ph #USWVD-3ÅE\$9uz$1ۀ|tisljDDs9u>rjjx 33$t,tV#hj:} = 4TeuYÃ= 4e4΃e3~o6/=(3u #=P3 t t =^=(3;P3Ct}.CЃ jS&ed~h83 $3 3=3t 35=3u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=3i3ih>%jjS\Fc`$&=3 %t#-l253=ES[jUY  xS3H݃t =3-3>!(Ƌ 2ķ>tjVUP t j=y2u J[\ 2jry C$<& 53 h #9,393903=(3S(3C1Ƀ X3L3ῃ5(35(33/U]VsWWr!2@*=3%33733h#jjL3P3n=3 5T23 }h #3 _ghu%y1PPv31; 33 $3H$3 3/=3 3%h #1PP9,393903؉ك u. u.S莍iQ35l23%aih %{jVyL3P3 PZw 3 *L3уBЃ@*? !1҃ ƒ!D$Z=(3,9,3t 93h 903W jhZ #j#t$(VOVrlp1BsRtM&=3=3733Щu3Mj5<2ùe= 4Iv_*-t%+q1҃¹) L3P3S\B D$t1< X3D$ D$ PD$PD$ P萪 (3tjD$D$-<{|Q<`ʃ=X3tR D$HL$@븃@L3|$ ^s 8eB3emh #1PPL!ùe9,3e93e903e e 1?PS1FP@/L3Ph_1#5X35(3虤 1;5 3$3|$3 3n蔰VVA 1; 3$3  $3 3|3'M1PP53 =<3 T3 t|7ػT 1; 3$3|$3 3蛻=3 3u' $3|543503P 31QQm1; 3$3 $3 3|3|C=3u543503P1PP53A $3 31҉3P5l31; 3 $3|$3 3l3聺觮5$35 3DT5l3J3NVh #h1PP5 ùe9,3e93e903e e /йSE*re|褹ʭ<3<31<3 ,3 @3,3 3 D33h#Cjjhf #$3݋5 31ɸd9 jh #=3t>t5<3<3@3,3D33j)eD$t Pj{@eJr蘬 L$Qh k$1; 3$3|$3 3)O=3 3u' $3|543503zM 3jjP1; 3$3|$3 3跷ݫjj蟷ūD$<2D$Ph #=3jh #VR $3 3h3 $3 3h3 31ɉ $3|$3 31@Pe(ejh #e1; 3$3|Y 3$3 諶Ѫ=3u543503Ljj- $3 3ʃEݣ3c $3 33H3  H31; 33 $3|$3 3q j5<2? 315H3"5H31; 3 3$3|$3 3 j5<2RCi 31D5H3=3t543503J1=W $3i 3me53V?P/V$ 31ɉ $3|$3 31@PuGjh # 31ɉ $3|$3 31@Pk 2V_e!ֹe5l3RPyJ1A诳է $3 31҉AQPcM<3Nn<33>X`h #r1PP?ùe9,3e93e903e e S賁+̲1PP53n豲צ1PP53jP#' 3$3ؽy蟦=3t543503Gjj5 3d:0ؔ 3$3艽*Pjj5 39; eS贔D$D$PhD #{豱ӡ 31ɉ $3|$3 31@P"etbt3tFu j11A; 3$3s #|_1#L$Qh{ #11% 31ɉ $3|$3 31@P'"e11A; 3$3s #|_1#L$Qh #je53<h#P 531=tjh; #o5l23nvh %1SVUh蠻Ag53rSPx]3 <3݉ 3 $3<39‰} 35$3)‰<33e3 <3 3 $3<33i1$3 315l3QPHFjh #H3D$Ph, #d ։u=83t 3 $383e,5835 3tI~V8Jjh #bUSWVP趮ܢGVD$1Ƀɉlj щ D3@3$3= 4uH9ljD$u21xUUjn6 9- 4u;=@3D3D$t$3 42t8teue^_[]USWVPӉơ3u31 r4$0utV4$#331ESWPO á3 3 H3tu1Fx` sKu j]j%u0SW53 á3 3 H3ujh #t 4$4$^_[]WV=y2u=83t =3u袬׮t 33!ʃt]53QY3u =y2uP5$3=$3$3$3u _BLE5$3=$31jPPB ^_SWVL3߾!&t#3/ V+=P3u V@t h #t u %u%P13PP^_[V蛫ơ3"~S.#V$^%=3Q3VPujhz #  tY>!t \3t P| V!\3=3M\3.hn #qF<+t< t 3t Q/ V菛3/7E=3V蜭ht #Pt% =3V^X 3^(N5 3jF5 3jQP軯^5L3V5X35(3(37333PV3hn #h_1#r^SV 3t s73Zb3sh #i3 sh #Q3 sh #93th ##3 sh # 3fyh #31Ct$‰sSh #jV V3CuϹ"t V% s #Q3^[fD$=(3t@WV|$ Wjeƅ~WhV ^_USWVt$0l$(|$$t U蟖,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD (3H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f `3 d3 h3 l3USWVi $AD$)< u?FP貛^tP贔9~ #ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2h #htjPV jh #h #hItjh! #h #h6jh8 #h. #hItjhI #hA #h6^Vt$ t:j j tL$HΉp `3`3jhO #荞^Vt$ t:j jM tL$HΉp d3d3jho #H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]h # t8tMjQP[ ƅuh #t98t4jh #P/ ǍEjPW W iUUUSWVP1F=3jt$*pP#19jV n1PPPS!ƒJVWSo <$Sp11 ?$:81xM'x+xG1O|E(|n|dȃ|$h3tl3Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW> SXo1N^_[]4$ |t|uVP11xtɉSWVhp3t$b<ƅui\$hx3e5|3PSh3I53P|h3tl3h353p^_[ËT$ `3t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=3ÃB1ۃ=3ÃCɍH9 83~Pj#|k3SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=3ÃB61ۃ=3ÃC%|$mu983~HPj#j3؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P膊V0ʼnPnD$X9vpG$11Ʌu2~>9sWt$V~ t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWЉV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQG?t1=3ƃtEuG%t|Qh#hh%AVh k$6 Eu ?=u Qh]#$ u 覣!ƒtVHQh;#^Ã=3t$3tPP&t53ËD$t53PF$1PUSWVu1953O3t_jP%=3tJtWg%W"=3u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =d3uID$xAPBt4D$8\$Ph/#FًT$WVt$j 1@t=3jWd$53t$V$t$53g$53$h353#3t$ t$ ۨ3=3111 4D$4PD$,$jUuWPW U sڃ,$C^_[]SVt$ h#V艫1Ct'h#Vtth #Vb1ۅÉ^[WV$ VtVWV tWt^_USWV 1=3]=3Pj\h] #1Ƌ|$ 11@L|uM@-u)Fh#W裪)1%tuQ%t s@AAۃ\$WVqWq؃D$jPtWVt$P+W? "S- 1tXt^~u1O\$$D$jPWO uQD$P4D$(0#^jh#4|1 ^_[]ÉOV&;t;V&1|$rɅuŋD$( #1O;PrSj USWV=3t^_[]j荈h%#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh/#U{PljD$UVoWoS\$o,8jUHrS\$SVUPp4$肱 Sy \Wg V% V|V$6#N@ |^WV|$=d3taPW51=d3#D$=Wn*jP`qWPOhP2LPWl5x#D$=@{WnjPqWPh@2VcZ WoƉ|^_V|$PV跗x D$XT$\1jPPVJ|^UWV蒊lj53# QP4t1GL$ T$333 31@ u,L$3 3$33 u!tL$\9|$X}e^_]øb#Vt$Vm9vHx/uAΉ^fVn 31ы531 u^ã33=3t^6~^P~SWV1ۃ=$3t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=3t3USWV-3~ON}=3~Q111SWuljӉ:}qF;53|؃=3' =31=3|=83111;53| V|ljՉ!<$=3FD$1;3á<3D$ l3D$<3D$$<31l3<3PPSUt$ ljՋD$ <3D$l3D$<39pt$j pF1M83H91Z{1@^_[]Vh 2F;53uj{ t j2^USWV\$,=3t3&|$$t$ l$83t  $9~ L3$x 9} H9$!tT=3t 3tC31҃=$3TRQPWV脘WV Ɖ1ND$(D$<$=$3t783H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=$3tzmz1@D$/1@D$=|2uu=y2t h#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 3t)!u =$3u=3u3=3t Xm39l$"83HPj-|1Ot1E1=3~1VV|{~ VVVD5 -$3t <$tw y|2j@ ^_[]USWV=3t341=3u!H3y=$3t 83'|$t$;D$||$$t D$983~ =3É!tF=3t 3t03,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=3táH3y=$3t 83ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åt83HPjytm=$3tPay1u11FUvUVRPVjv!уu 4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 83~&111RP!уtF 839| 1 8319^fVt$tsVGF953u#1=2tu1Ɂ2tщ 3AF=2tH 3v Y vN ^E ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá3USWV\$S@Nj522tv Ww6W菥 |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@3VEES#cËnUc9Ë\$sU SKeFW̤ 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=<3jjPWV^_USWV,T$Dl$@ظBӃ=3t  3t03 @1)ʉ|ЉjSUQP虊كQP4v=@3tK uu|| t u+| t u 4tt 4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t 4ǃ݃ tkwRPW v=t3t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N <3 CfN =<3=t3ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$183l$t$1E1!1M,^_[]Ã=3t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy5y2=y2H~y@wr 1N5y2=y2^_[ÐSWVstjh#c^_[uƉס83HPLi11 u^_[8iWV!Ӌ 83It*QRP4 83HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhL#bKy1V[hVjRPUo=3jusj'hD$ jhD$T$l$ !Ѓtd9}\83H94$SW!уRPvlj9Љ $A83H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$831VVjt$t$PY953^_[]1K16-3-383H $)QUjSWP(1K[6=$3tf"g153SW=g83HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-93#>$4,$tt=t|<93|wC^w \$D$Sh#jWz$4,$e#f93u+93}93t93hu_G t t1"~#ut|\tt t tL@?3~|$j=Wh9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEu #_1#6$4t$ t t_G#_1#$40tUPφtu#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV3^_[]SWV׉Ή5353h#hSе=w )WVRQ賵3S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^333JtGtO GO 33l2 t3u3^_[]ÍZ w6$ &tEGЃTZ$4&btPeu>f3랄tGOm>?"놃>"w>r&h>%YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]33d   >3 3 333Rh#jh3l#3_t>_1#vVh1# 3P+t  30R"hB#蹻3Pt 3S#jVL3jVL353h3h313PҎ $u3^1|$á33S313 3 33 3 3@ 3;3|1ۉ33333333333 331H33h3#h33P $u3[USWV\$0l$,1=T3uSUƉס3 3SU\*@u6 y2y2!ʃt'9݋T$0|y2@9-y2T$0| 3=3tU t33Z3$3<33 39}Q3Ɓ$3 <3ك=T3WV^! tt$j VRP)NVG1 3)~$3r53Ƃ$3 <3Iu܅~+1ɊT 53~=3$3<3A9uס3H 3ƀ$3 <333^_[]Ë 3t 3=T3t13@V53 39}9 3<u"30Ph3 3 3F9|Ӌ535 333^SWVt$\$u$D$0j?oPeF/=(3t&v!Ss1҅ SVqt1҃Pn1҅t$St 3~- 3Vt[u3 3LV3Zt 3t> 3VtV[t'i=(3tVs1҅ƒK1JFVY# 3#3#53#3‰^_[QY# 3#3ʉ# 3#3á 3333á3 333ËL$1wQ5 3t]1SVt$ 1ۃw)V5 3N]uV53;]1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJl#9u!B1@uDA;1A+u%uVt1@^ÃwV5 3[\u߸ع#L$1uj jE1ɉHH' SWV=3 u|$t$\$t-1 |15$35 3tm1@Z ug3t ,3uU=3~+,3 (3\@03335 3=$313=(3 3%=ua03P034319Rh43bmh43m435,35(3,3 (3H 033u"0343x,1WV=(3t 031At^_[ÉШu-%=tS0l3=,35(3뢋,3 (3033USWVӋl$,|$(3=`3H3uBu>%j jzC1҉PPH3333twQPl'UWS H3xt 3Ph3蔅1H33u+3t,3A\$l$͉=(31؋5 333Rk5 3UWS% 65H3胁 H33PV軄3@3VP诅V荄 3AVUUUЍ@@33 <39}oh3藅ơ3 <3Y$gQVlu&3 3PjVPm3$#5339| 3l$ EVjUek L$ )v %uh3蚃5H3B H3 3; 3 53|tq=30jf j39u"_l$\$u4Шx$_l$\$u$53 _ ‰$ u*3t =,3uKuG ڃ^_[](3m_uiud1UWj3+3 t2391J$; 3} qɉы43)t _3\$ PjSi 1EL$3) 3PjS`i ǡ3 3tW4V)3~Z3t\ [5x2)Й)֋$F UWh>% N13E1-3$_PdtUW ](3t6=`3t-QdtQd UWl $UWS t1@1^_[]SWV=03~4։143Pd VW u C;03|103)^_[Ã=3~,3 (331WV=3~,3 (3m3|$t$ =3uu 15$35 3itb=3tY3<393|333 3A<3 3H93}3 j 33jf=33tL3tBx 3 <39}; j,3P 3 <39}3ы 3 <39|L=l3tCp3„u0=`3t't4|$t- 1j1j 1j5 3953 u303^_V=`3uajm5 3QtMȺj9#Fu= 3u"Ⱥjy#Fu^SWV։ˋ= 3G 39=3 u3834D$ 3; 3~~ 3 33 3^_[SWV3 39}1T$53ׁtu Ӊ 3@9|^_[ËD$L$ $3<3VD$ L$=3u=3ttNI1҉ tK1G39~<3$3+53)΋ 3 30 ~^33USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8 4u/3H9| Qu@38GO1H^_[]cS 39t 3Mtۉ>?SUSWV-3\-jSq jSq DžtVtRU53V'W 3UPWW U6x 53(x 53=331t Wx 1Gt Vw ^_[]USWVL$D$ʃQPO1H…t$=33D8OlV tn 4uc~3>-3u@3 (I=39rHŠIJ39s=3)\8OVà uQL$ t 3t=391H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vmv 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15<31K<3|EtESSP t<3@ԋ= 39=3 uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Q2@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=`3u1@$53+53~1; <3^USWV։L$|$0\$,Ѓt3!t6tC؃T$RjQPWSQ=3=31ۀ=3tw4$3 3ىȺVUUUЍ@)I3~4,IŰ31E 8Vt$0j* G;}|Cu4$SG 3tf D3@3!Ƴttt$,9} 5@3=D331ۃtQ3 3T$ 1ۅ~&L$ PjQ\ 3~3\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E3;<3uX3#3uD$,3=3=3~013 8jG;=3|h3t3;3~<$~3 3 3$3~1 ;j_G9u31;<3uD$Ph3t 3 39~~51ɋ34*1 3444A; 3|١ 3) $ 3 3 3; <3~(3 j3H3;<3؉^_[]WV|$t$ =`3u1WVP PV WVt1@1^_ÐT3H ȁ3r13T3T3X343\3 `3 \3d3h3l3p3x3t3USWVL$0D$,l$$\3$\3\3t-9Br }$r1z3|$( H\3u$$rT3t :=T3X3X3<$:rBJ jl$(jW\3tC:\3t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?\3t_ )ϋ,$]}\3t\3tV+BJ NF=X3uW-\3MEu$9ˉ|-X3],$ϋ=\3t sKӋ$JHJ^_[]USWV1=T3tD|$(T$$!t3|0\3\3=\3t'9PH }=\3u11CŋE1ЋM 1 u ]u,333EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR} 4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[ 4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSt3 11؉^_[]Ã=3xÃ=T3u 31T3Phy#4V3xNH 3d|@3* 3539|jh#z53^USWV|$ l$1Ƀ\3\3tKC9\3t31 x31 5`3v vB1IʅI~nVv 4$9ʼn1I1PPt$R9 4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R 4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=83~%GW8É!Ѓu O;=83|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh#2P31111ۉu WVSU1PPWV+ 4u Ɖ!ЃuP3^_[]WVT$D$ =3t 531)|щƉ^_fUSWV t$ >-uF(s7h %+V+h?"+艣D$1S6]+S)S\^SSjy Whb#À8t>tkV聪tmSʼnD$i%$U]% $ȃ$jP'袷t$PSh{%t$Ut$f  Sa'Ņu>tVh#1"F'UUf jWW1FVJ]V'D$$t*P*h#y*/j ))33t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjh#.1N\$hV"SW4h %Q)SH)h?";)3(1S|&S[jj g1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSȒjh#1KtL tGf;t=ËFHN~ ;F~à tQu VShVm1Vj 0f1GWZWg%e1=3VZ^_[]fSWV131K4t 5u'#ar'G__ _Gt Pc GF6u^_[ËL$ 1ɅV-$t:3'W.t7^uM3313333 l33133 33t P` 3Fu,~1S薺PW豺Fvq` ^F~ ^v;3t PNu VSWh ^_[ËL$t@;3tjh#x)1HËA QUSWVD$T$1ɾ3=39~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J93u 33uUSWV\$SκƋ3t@PPV+Vu33@_ Dž3W-_ u^_[]USWV=3|$,t$0h#W謉 l$33!ʃtWj UQP"3u3 h#VyUt3VU3Ph#W7u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=839Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P]  $FQF^_[]V=3tjh8#&dt$D$tt/uKV3;m?u7=y2xCjhn#뵃=y2x%3Qh#l&^jhZ#jh#{Vơ3t P\ VޣP3V\ 53蛙 ^33VD$$L$ t tC8.@L$$Vh&Q 2>jh#2xxPh#j VV2||P|0tB D$0Ph#;D$$Vh&P >t.jh#1l3L$Qh#$^ãl32V2x$ 831Vh@BVPRQ_l3^VD$$L$ t tC8.@L$$Vh#Q 2>jh#2xxPh#j VV||P|0tB D$0Phf#;D$$Vh#P >t.jh4#13L$QhJ##^ã32V2x$ <31Vh@BVPRQ&3^V|$u%t$jVt0Ph#N#^V|$u%t$jV؇t0Ph##^SWVD$L$tP3p=3tjh#"VP>PR Zt V踘)X!ЃtV谕5l3SW? ^_[VD$L$tt\uoPe02_Pơ02t=(2t PX VӟP02VX 02Qh#!^V|$uJt$ =3tV3-3h V%_V_h@^^WVD$t t0t$x4l7=tDMtGhuXF 2P(3x4Qh k$5!Emtwt su!FF2F4F|4F$27W V^_D$u5\36Ã|$"7VD$Hs^\jh#7<2V)hs$&Ph#h#V;2xu'h>#hx#h#h#h#hB#hw#j^^WVD$t$ʃc"y$&m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=3utjh#$FVPMy0Ph#^_ÉPh#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;3~ 3A9s } uE9u9t},u E&| t23+3x2 ^_[]WVD$Pt t*$TV%PVLD$ps D$ stopD$Tab =t2|i1Gt$rVfD,V4 3ha1#P G;=t2|VD andD theDen t$V|5x2h#P 0Ph k$D^_à D$t t+uyL$tJQtQytWjh*#Mà$2L$%2AAD$PhN#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh<$QVP46h#VIt5>t 3 $383tP93#L$QhX#O ^ËD$Hsjhp#/Åu 3Ã|$u=3D$u =3~GT3ÃD$ u)=3| Ph#3ÃD$ u)=3| Ph#3D$u"=3t=3t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7Qh#V D$,L$(t tC1ɉ 3 38,uT@L$,t$VhcP$Ql >tejh#Ot$5353h$}$jVv0Ph)##t$D$,VhcP$P >tjh#9 ^ã33D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$&d~&s wR$<&s wU$&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G31 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qha#1QZS3^[ÍD$PhF#҃=p3=3=3Ë h31 83+3t$4Ph#h3< 3USWVl$,H 3t&AUjQD$}ol$,7F]$d&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph#h3, 3FVEŅ8D$EH$&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=3nAL$,9 ItIT$uWoD$,73j+o2Ph#3V T$jV%D$,|$?+3t P+K GP 3CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WJ |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh3P 3I3^_[]É|$|$ u D$Ph# D$Ph#͉-3ōD$8Pht#uA0h#j*h3pËI1Ph#j*h3pUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph#=j UQ xt-u)%tt0Ph#1H^_[]SWV9toӉQ?@jP ljtG\$=3t <\u ~t F <$t)\tPSt GFFuD$Qh#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$3Ph#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hM/#3rtP詺~21@USWV\$(|$$1E= 3uh3Ú? 3 49<$l$D$l$ =\3t=P3t=3u2=D3ubPjD$P  D$tD 29PaHD$=$3t=3tft$,SW  3=$3u"t13@3| j=y!*F8F8#1Hpt9= 4tD3[1 3D$ D$D$$PD$Pj 9= 4t  4t, 4 3^_[]øjh3#UVVVe^]USWV\$VE0W SVy,jUVShu"UPg^_[]Vt$V|W uVh]/#hE3 E3^USWV D$0щL$l$ |$$t$4PWUxƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPEÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$Seыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVP 4t 3Z1`3WP(t>1C4$$`3u V WSCu ^_[S=h4th4 \$2=c4r 2H 2d4[V52d3t(d32VP52 9t 3^Vt$52^Ã=h4th4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRV0يg/#O u݃|$0xG-Wt$8Z ^_[]USWV\$8T$0t$,11|$GUSRV0يg/#O u݃|$0xG-Wt$8Y ^_[]SWV|$(L$$\$ 1Ѝt$Fg/#NuxF-VQVY^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$PI ƃ^_[]WV t$RVQ t|$P3GuV^_9Hw @sÃtP=USWVPt$|$l4V<$=3uԇTh=3 #Vt$ P]Eu 348JMp;5<3| 3^_[]VWj .^_[]ËL$T$_1#PPhx/# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuh4^_[]WVt$|$ zt!2Ph/#Ph/#_1#PPhx/# ^_WV|$t$ t%WVra7ft=<3 3 j Qu jF^_fUSWV\$l$=P3u<؉%t1UL1GWP?[PW1WPPUVd[1 jj1=31Ƀ= 4HPVWM Åt!W3 |$t8jh/#'D$ tP9D$ 0y3 D$ 89t Vb3 ^_[]Vt$tPJ96=3 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQo ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u UD$E ʀ[} P3@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø,&fL$tt"u$ 8383HI 83Ip4ʋTUSWVD$T$ 835p4|1Gll\G9uTD^_[]SWVD$L$583p4|F|\\|N B^_[á83~Ph5p4E1 USWV 83; t4p4th!t 1G31K;)1G1I4:tl!GtˉP/  83jQJƣp483t4~PhV0 !t\l^_[]USWVPL$\$As 8311H$(u831@$1p4<#|tZp44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$p41H; t$z|#=83|O1;Ll |C9u^_[]USWV 83~.p411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5p4A1G1֋l9߻rB9u^_[]ËT$83!х1A9Hh&*x4=3(&t&P |4hu&4h&2hX& 2h&$2USWV \$4 44|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$&=T3EQ-s4C$ىË $Fw$H&#Fw}$ &X!уj WRPBBtDt L=T3!153h#P"1sTu~-$PuYQA tLу|=RP螽1 $1= 447f1=<3u ÊCCs|,v, l,uȡ3!ƒtظ:,u53资j W5<3QTу 8353n9|$ V5353蛅PtmƉV:* +1+5Q ic+Ɖ!уRPUV 4=4H8  4H=4wA53kP豄 !уRPaٹ 3 83VQRPbg 353,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/153Mj WP j W1P9?"@|4_1#9 4t 4_1# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5l3Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^52~V5(31=3tȉt 2x40A3^5$2'SWVQNj 4ع 49r Ѝ 4WVS ; 4;^_[VQ!уu$x 83H9}FV!уtt^^Ð1 4 4 4 4WV|$ =3t5 4tZ=3ta=83|<1W!уtRP虆Ws@G83H9|vu 4覍5 4^_USWV y2y2D$L$!ȃy2D$y2D$ 1Hy2y2y2y2=3=3t4$=83|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$83H9|u $u^_[]Ã^_[]鍌^_[]T 4K|$th 4m= 4t1= 4 4j jh/#"V΋At P# FVC^h 4SWVt$>t_w p# Wg# ߅u1F FF1H 4 4 4 4^_[h 4SWVQ1u(\$|$ 4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u- 4Vt;xH|p$x Hȅu^_SWV|$t$u; 4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=3uH y25y2!ȃt3y29y2|$|$ !@tp\$9ϋ\$(|$}^ 4U1tHt$ !t Q9y}1I(t(t$=3tT$$1= 4uȅt^_[]h 4 4=3tUWVjW7!t"j]jRPWV je^_]Ã= 4u P3 4 4d 4Vj5<2t2 4jVx 1F=3u= 4u@11N^USWV(U ]1Nt$ t$tr:tm1 4PSi( 31 3t)1V5 4h 4 33ttxq @3 4 3t =3tj)3u= 4t 49 4J\$tP1ػ&!Ѓ1ojh/#D$Pj@t$>SD$$PL$Qt$Tt$V> 4$u: 4 4!ƒt&9L$L$|D$; 4D$ 4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d 4T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5 45 42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=3u?h 4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ <3L$<3L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$<3}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8<33t$ t$  }tEL$L$H1USWV8= 4 45 4 4D$$8u= 4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$} 4 4ȉT$!Ѓtsu!9t$ƄuY 45 4;t$T$$|@Ut$ 9D$ЉʋD$4$3@Eh 4h 4}!3 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># 4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o= 4 4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$ 4 4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ 4D$ 4D$$ 4D$ 4e^_[]1JЋ4$|$9ωL$}@D$ 3 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd= 4 USWVt$h 4tH>tC\$1EjU1GGGUSxL 4G= 4-5 4t~'V u 43^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5 4jjSt$DPV5 45 4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9 {$D$|$!t4$US tVhU> u?D$< t< ut$:D$D$tD$@t t tD$D$@t$D$8tD$PjD$ P9 |$tyL$Y\$a^u Y\$a8t7لt1ډـ\uB9tz|$T$QT$A"8tuӉ1ۀy$uI11T$ D$ 1ۋL$St$W 42 82H82 4$,V= 4/42D$=3PHv1 4 4 41Chm0#g1P1G&UDtlj<$V貿S觿\$4$薿؃jP 4$t$ Vh|0#P̲D$9t P8 h{"WpW  42=42t 4 41Cwj4&=^_[]ûD$=3tPtUSWV 4tA I tQPU$b1HU1P1P蔒D$1 4!T$RT$RL$ Qt$ V1L$΃ t݉!Ѓ=T3tRVUW腐ڃ|$=`3|$$u|Qt$T$&P&Sj^l$ŸPD$PWt$U&$t$W{ Ul$n L$L$ ӉWeكÅjh_0#1H$D$T$$^_[]VL$~4 4A1t242t5 4 4F1I1^VL$~5 4A1tr42t5 4 4F1I1^á 4á 4á 4t pV41@USWV׉1EUj S{@UPFSPD$F~ |$D$Ft$WA@jP躾FWPF^_[]USWVP$ϋ- 4uVPWVO 1u1$}t  tut$RƏ 4QA 1@^_[]fjZtjP貙yjhm"蟙x 41@SWVP|$jW5 4蛺 t&Ɗ\$y jṵt^_[ÐD$1ɉHHVt$t P 1FF^ËD$@SWV\$|$OG9}7dtƉr1ɾ9rG!GjPƋtwPV 75 7OAG^_[ËT$T$D$D$ s1@ËL$t$t$P 1USWVt$~|$\$1/PS E9u^_[]VL$AtpqD1H^USWVt$D$Fx~1+PVE9u^_[]ËD$WVt$ D$|$tt+19׿r#"tu u x q11@^_USWVPL$$D$(t$ D$D$d$Éljd$ L$(tL$"L$t1@ L$t$0t$0V= 1^_[]SWV4$D$=`4e VjiVj^h 4RtW1FVj?Vj4h0#GY 4@"k2=$ 4TP L@2t%5H4@2PVt Oȅu 40# = 4$8@h{"54$Iƍ|$PhW4 F<$$hD&P0u$$8 E$H $5\2W$$h+B#PA0u$8  $ $9t $9,t $9 t$ $9t $Q$ 45D4PQ$ 4D$V$8tq$ $9t $9,t$ $9t $Q$ 45D4PQ$ 4utD$54h"[ 0#|V|$t 4P |$T9#tXq#QV0#AVT9#1V=841t4WŵPWS. ^_[V1FVt$ Vh 4_P=$ 4t&|$t 4`f=2t h0#fV$d3J d3;t3у  \3Q\3jPh4h1#+ t^h4hhP |4x;hVh)1#* t9h4@h\3Q$|h4h1#525|4V cUSWV$$$ $Fhm2#PW-t܍D$Pt$4$hx2#hVDž"t$ϒhh 4t$ 虑 Ɖt$詒l$ UN9uD$ D$ tȀ uWxkto4$h2#ehi#%$bh"t$7t$+9h3jjh2#!h#Ԡ4$h2#h3 1^_[]ƃ 4 4A 4v9 t@ 4ˡ2$tt$蝑1CS葑t$襔t$yjojVhb#WW}3SUSWV$,D$D$=4V/PVW* 41FVh9"54裎 Vh,454Ϗ D$ VP54* l$jU54裏 D$1Ƀ=4ˆ! uϿ1hd4WVm hT 4Lhl WbD$VeD$ T$Nj 4jU54 =4Ӏ"\$\$4хu$4P(*t tD$HL$ uf=2tGWh`1#\$D$)É;L2JSD$P$80 9th2#Q4D$D$ t$D$)Ƌ$0tVPW 9t h2#GQf=2t!j#+D$ T$RPhd1# h84Vj jh,454肌 t$VW̎^_[]WVjPh4hJ1#% t h, 4h4Hrh2#P}u , 40 40 4PhhP[ x1Ɖ5, 4hR1#hWh^1#VW b50 4h1#^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@4PhT 4:IUSWV T$(\$$t$ 1`2PURSy)ˉ<à uVh k$?t$|$u u)u%u!1ɃtsQl2Ph]2#t DhJ3#N^_[]SWV \$ hSh{1## uPAth2#N ^_[螒xEhSh)1#o# 4$Et t$5j V芋h73#뙿 hl W52t$S jW|$W3H[9uR1Vt$4$踋j^Sh2#MVWV|$ 52j/V{t@jWhb#QV-^_1@4Pj:ÊD$d3J d3;t3~{у ts \3Q\3jPh4h1#" th4h{"Pt:j52P? f=2u54}h\3Qh4h1#USWVt$81GWh9"54 1-4ho S<D$hd4SD$U Wh,454 tLtFPFuf=24tjQPˆ P觔jlt$4l$0j軘D$T$1D$EHM~EHMUڃÃ=4uf=|2u0Iڃ% tM 1f=|2@ ЈD$P D$ƒ t|f=|2Qq f=|2uf=ܣ2tT$j \$Ct,j Cu\$T$f=|2x댉\$ 넻 $f=2tD$ @D$ Ph`1#ڃf=245l2ջjW54 4 4 u61=4#$ |29uj苻5$t h 3#Ijdڀ tf=|2u j ttFPFuj聖ÉU$t$jVf=2t'+\$|$f=|2d1#t1#WSP jh,454 h84jj(^_[]USWVP\$D$jP54 f=21=45l2fjD$P54葅 WH9=4ttػ1FU Ph1#KtMVh( 454- =45l2VD$P54 WԹ9=4u^_[]WVjPh4h1#% t ^_h, 4h4Hrh3#Gы , 4u 0 4Q[h{"PtAf=20 41#t1#PQhW4Wh1#V \Wh1#rLhu j+4USWV$d3J d3;t3у  \3Q\3t$hVh{1# 1GWh9"54J WSWjhd4Sj` Wh,454L 蔊x>jQƉ׉U@~*9u$h\3Q:Eh73#(F11f=2tj)RPh 2# jh,454x 1h84VW WVWj^_[]j54W41SjgSW]VVh1#vSUSWV$d3J d3;t3у  \3Q\3t$hVh{1# 1GWh9"54j WSWjhd4Sj Wh,454l 贈x>jqƉ׉U>~*9u$h\3QZEh73#HD11f=2tj )RPh 2# jh,454 1h84VW WVWj^_[]1W54j54SCWjxWSnVVh1# WUSWVPhD3#_C1GWj1Wj&9YtDƅtZWf=9uhJ3#C1VjVj ^_[]h3Wjh#螻h!2#Z1SjSV-2j/Ut@SQU" h3WVh#Bh2#WWVPjhB $54} f=̣2t%52>t=4V+PVW} 1FVh?"54} |$VW54~ ?nu52h,2#  ^_VPjPVh>2# t=4u.5 2VyVhD2# hL3#AP^Vt$j54~VtVhX2#o hO3#RAEjWV5,2t)>t$=4VPVW| j!bj{VhVhf2# V2t$2jh$54H| ţ2u2$ţ2%2t$2t$2f=̣2t52t$$52f=<2#tF>"Pn2t$2242t$2j2t$$2f=2#tF>"P^WV,|$8V54@hF>"WRt! $#84 $ 84841GVW54B h84Wj28^_WV,t$8W54hF>"V1Ʌ#G OWj548^_V1Vh{t 54 j_Vhzt 54 ^S\$1u̓jP|[ESWV|$\$1FtCWPt1^_[fUSWVl$$1D4044%PhP2h4#t$4U艡1I~1L$$D$=48O>HЃ sX 4HЉ54jhP2h4#t$4U߃ufH1K$X&<D4뷃EF<jh;"Sɐ jh@"S豐 h"SD$QPuV<hª%Sh#Szh"S$_=4<41@D$<$XD$4=04<j/S(04k<$$YxD$ P1PhPjPP5< 4L$ !P5<h,5#Q64`44=<W貚*ShC%h04^; 1@1H1HD$1@$D$~1HD$$3)t5|$L$(4h%Vt544`44A VjVjVjVj454h5#j VhV4$jh\3|N"w&P_ D$tu1=4 1A111ɣ<2 222=4t 2=4t54 uW6uB=4u54 u3^_[]xVh`5#Hh5#Ah5#:h5#j54h5#!h5#h4#h5# h4#h4#j諜h3jj@h5#jh3jhh(6#jfUSWV,|$@h jW^1ۅ4=4h4]2u.j _1=4ȍPUu4j14x3=4u?jP 4teQav4Uh k$4WŅ?1GVj =4t1O,^_[]ÉVQ=4uL$ @Vj54 1Vh t 54 Vj1@4jh4n1fWVP=4t 54t$uh8#蓡ƅh8#|t8/u228# P襯 Vh2P %1&9uQPt$a &uڃ=4u%h4h#t$軼 u 4%h\4h*$t$薼 u \4=`4j:h59#t$ȯ 1Ʌuǡ04u'>/504jVB04D45X44`4=4u 4%\4Y1ɉ `404t=D4uD4t =4lj:h$t$ 1Ʌ 4=4u6D4t=`4tP5042145X4j:h &t$蜮 t 2j:h5&t${ t 2j:h"t$Z t 2j:h{#t$9 t 2j:hk%t$ t ̣2j:h>=#t$ t ܣ2j:hc#t$֭ t 2j:hS#t$赭 t 2j:hWc%t$蔭 t <2j:h"%t$s t <2j:h]"t$R t |2j:h$t$1 t 2j:he#t$ t4j:h##t$ t 2=t4u t42=h4u h42d4tPh/",l4tPhz"x4tPh5&p4tPh+.%h|4hi9#t$ u |4h4h2#t$Ƹ u 4h4h"t$衸 u 4 504544t%j,VZtA1ɉ504 4^_Vh89# VhP9#h8#j處ttu$Vh8#h9#h8# jfSWV t$ |$6G44%444ho9#Pl4VW8=41h 4S 84 4%D4%84%<4fX4 d484fV4P4h84jS h4轪h4谪h4裪hu j:#94t:#Ph k$t4 x |AEjj54(n xPj54n h9#jtu hu9#j葓1h9#VW3 vtHЃ rt+vh9# 4ō HЉ4봡3)ǃG<13DHu0W=r$hh9#`h!2#jSGhWh4 ?t GG?u4454h9#j VA Wj/Wj$WjWjVtuh5#h5#jh\3h9#2t 4 h"=4t5̢2u,u5=45̢2{5̢2h9#j譑Ph9# WVƿ3Phu:#W Vh:#W j=4th4htj jkSWV52t>u+t$p4t P V}ƣp42h"Vcts4h#VGtahh#V3tSh%V!tehª%Vt13VhZ:#W Wn4$11ɺ20 ߈p4Bu^_[ñ1WV,|$8V54xWVNvWVv#NF=4t L$f=2t D$#$d$d$ wfD$ f=<2t $Vj54<8^_h84jj( SVPf=̣2tjPMt$R 20utztD$=4„u20u1f=22몈D$< t< u>jV54z f=2t|$ "t_1#P+`u 2 <2tu 2tt A8u1f=2t 3DAt x3DAD$jV54 f=2D$PG/h 4jj USWVt$D$ $1=4h jD$1CSjh 4SWz Vh k$h4$tWD$ h84jjC t$jEUj:=4uD$ 1;$ȃ^_[]Ët$$4$3H 3~3H 3h3eȋL$ < U;t$ KD$ V1FVj54h")Vh4`#SWVP2\$ x2t%429u Gt+t' u9tpD$jP54 Yـƀ_r4^?t@آ44 44h4h k$PW1^_[P3H 3~3H 3$3t1Ƀ=4!YXD$_r4^?<t@ 44 444SWVT$L$D$=4ut1<141F9uRQPc y8thQ%t^_[hL:#USL$ \$1B1t 9tA8u[VL$4tSA ):#8t6u(^@\VPt4)ƃuf^?݈@4^VD$Ph4:#R=x2x24Ft2_r4^?<t@ 44 44h4h9:#_r4^?<t@ 44 44F t*vPh4h=:#4~ v 7^ÐWV1F,4VW54a VW54c ^_USWVt$jV54b  uD$41؍oD<jV54b D$< t r֍,f=̣2tt4t PS ụ2D$y1D$h)#P{t4tD$ỵ2D$nD$jP54`^_[]1f=22USWV1GWjWjf VWVj4fC4CfC 1l$jjSa ~}D$tvjh,454a ~],4Bt8StGWuG1GW,4U54 ` WUl$549a 1f=22D$hU54` jƉ,<=4  A9rWD$Pjx_ f=̣2t4tyf=2~g|$_r5,2Pt. t4YSQ;Y~ڃ tZG9r QRZl$!y-8u!PWjl$UVfEh@jf=̣2tt4t PjgfSWV2t32^tPόtF tFFu҉5 2h:#hW7h{"WitRVhWd t4=4tWh:#Yj W.tWV%%2^_[USWV|$h^+%W蜹j Wj=W蜙t@C@uSh%WMu S6ÉXj?WMt0tO@t8JS?:?!tOYt@t -tWh:#.~5=2t,2Ft = @t t~vuك=4~h" 4^_[]SWV΋4C!w\C4؋ d3Qd3; t3h\3j q4 \3Q\3 X4#|>W-أ4NI$8&Wh]# 4@4N Q1f~ @4d3H d3t;t3lh\3j!l4v Wh:# `Wh]#4@4N tEPPQ~4V\3H \3!6h k$H4#|4h"^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n:#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh%S躵uW 1@W6ljR1^_[SWV21t8ϻ2WPpt!CtWP[t Cuމ^_[USWV׉A tS^؃H$X&n tWUtjPu U# WqF tQfB t 4th:#&*N 1?!9~ t~ N 9tF N^_[]h ;#fSWV,1f=2t h <#|$#=#&t!ϋ 41Ph=#O &u s40h=#* s40h>#AWh$>#.t%thu>#|$ D 4$ $ 4hW uW$ 4hu"ō$UhP tʼn-4=44hPU|O 4uQ%t#P54h>#h4P蕚u54h>#j4uG= 4ty4L4=L4tVL4h4Q4u7J$ 4z$u+h4Pu,4054h>#:u54h ?# =4uhr?#hI"h0Yhj$$ teN 4u$ th?#h4P舙u$ th?#X#4=tD 4Au$ th?#P=@54N4$ D4454h@#4tpp 0h*@#z 4uG4@#ttz@##4@#@t_1#QPh_@#( 4tPh@#4uu+ 40Au*h@#N 4 @# 4@#"h4u Vh@# # 4=u#54Lu54h A#J54@Mu54h)A#4tPMu54hBA#]j$ th?#lUSWVt[ׅtf΋&t#&tVPht%]uWVh/C#{ j4^_[]hC#hC#hhC#hC#hh1?#藭袲PPPhC#h34t@t h4ЃjD$t@0h{A#1hlA#haA#hh1?#D$t@0hA#1hlA#hA#hh1?#D$t@0hA#o1hlA#hA#hh1?#谬USWVhB#B1r&,&Qh4%h3&t*tu6h3jjhB#h3jjhB#h3jjhB#謅C#tH#FKrh3j ^_[]USWV39u1Ht$Vhht@P肚 V$PPftхu! $hLC#5&tc D$r&&0tBV+kؽ ;$ݸC#D$VPh4%h3D$H#uh3h?"M^_[]fL$t11f3QBuhE#hD#jThD#ܪWVD$ tRt$tX|$t3fPhE#fPhBE#pf1@^_hlA#hE#j` hE#hE#jahD#\USWV @$ @SFX~ _cf ߃| RQhF#%19ս|*Ձ tRQhOF#f 1 @^_[]û l$ WWSUPL9tmv h}F#W$ =Ut%tv hF#>hjU 1$ PPQLÉ11 Զx$" 9/9$ $ =JA|$  D$ |$< |$$u)D$L$T$$RQP|T$ L$D$419ع#PhG#ch Pv tOPSQhF#6$!u$!$!j?PQ t$hF#gQ+PQhDG#$ "u!$ "$ "hPQ th G#$ QRPhoG#]$$j@P$!P貇 Pt$$"P蘇$$ Ѷx"l$$ $8v+)t)+8uHJRQP t hH#Í$  tL$(SUP l$ M1h$ US |4ōPUS賆 < ߁WjP N1\$ PPh t<=NýjPU` 91E F8t<8.8u.N1 T$ PPS 9tǃuz8u~\$Shmdv# th>I#RN1 T$ UUP ljl$Shmdv 9=tWv htI#2v hgI#ghlA#hE#h8BhE#hE#h91hE#hE#h: hE#hE#h;hE#hE#h<hpE#蓤USWV$F~ 1jUWSP0G9u!D$=жxt9wwF̓uv h}F#Q v hI#ST$1uD1Gu<jUPSvF9tu&v hgI#hI#R1^_[]hPv hI#-hlA#hI#h hE#hI#hhE#hI#hhpE#MUSWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P˥ D$VUPl s DD$st$s 8D$ s <D$tf4$l$4UL&t_uhNH#h,%hk$h3 L&h3"h3 uh3j P&D$l$4$sf@8tD4$t$xV@SaPSV6 \$$Vt$SK1D$0D$,D$(D$$d$sD$4j@HPb st$st$hH#Lt$hH#;t$hH#*t$ hH#t$thH#L$9P&t uQhI# L&hI#|$4tD$4PhI#|$ gvVD$PU8 16D$8uT$Bg)QPR thuH#11@^_[]USWVӉ͋t$V舑 1Htkt$t$VSUCtGU>t$t$VWUC9uVSW0 t'W谡 苦 W蚡 1H^_[]W艡 USWV$$$|G8-t 3$D$ 1FD$hJ#WSNo it 1|&29t9At&9IuJuiu3$tHPhH$ AtPqh0J# 늡<A뀃Dtou&t$ mt$d<$W$uQ 1t$hWV葡 jSVw $FWPPT uh%VhiPN u hN#jbW4=T$|&2l$D$G_HrY7SshjD$*PŠ ft$fD$CL$fA37ShjD$&P腠 ft$fD$f\$ $T$0 T$T7hjRN SE]Zft$fD$fD$PSU} $T$l$GD$x|$ hhjD$$Pҟ \$ $ shO#sh)O#s hLO#shiO#shO#shO#~s hO#ns$hO#^s(hP#NsHh(P#>s,hOP#.s0hmP#s4hP#s8hP#sXf|$rL$IQ#fw &L$T$ t$"VRQPhQ# hN#hN#j#^D$f=212hjD$$P蠜 fD$|$<2fD$ $T$2h k$H$h&L$f|$Q#tQ#PED$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPhQ#~|$uj豹jPPCN jt$t$ VUq VhiW u hS#D$(|$ u,$PD$D$,$|$ 1hSW葚 GG?t$>hSD$$Pc G$0hSWF jl$UWp wh R#Fh\3IvWh:it$V uO j.2h\3vj蓝Wh:iV u Cwj8)|$S#S#P$rkLPD$$PQw $<1|$VhR#ct$kL4t4&h[R#=hrR#048~1D=P5G9uh~#4 D$4!4"4#4$4%PSWRQt$hR#蹿4(hR#西444,40k<SWPRQPhR#s4`h-S#_hRS#R4\t haS#9t hfS#'h# 4d6|$1A t$t&u/7t$t nu QhkS#ʾFL9Mt$ $t$qV3P$t$RVa3hO"蟙PhM#h3 jŵUSWV։1hUS jWSkm sUPP(J t'Sh9iP tV2Ĕ^_[]h%hN#j6XUSWV׉1hVU蘖 jSUl }VPPI tAUh:iPc uGPhQ#A1FS@2Đ^_[]h%jWVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1PhQ#߼^WVhR#̼f>r1D~Ph&豼GH9|j]辻^_WVhR#芼f>r91D>Ph"o 9} j:xG9|h~#>^_WV$fGjRWWk WhiV t Đ^_hS#jKVfUSWVu }6h_1#j9 hS#VWa Hw$&t4x4ԃBu|1PP5<@ p4불|4444t44너|44sjh\3g_|4S3=3=4u.1L$A AAAQj jQ/ =x44t444|431O=t4}$3tch#VԈt^=4ukjjV*. ƅD$ PVbyD$(!=<\$yB  3u1PPV- Ɖx\$4j3=t45p4PL$Q,- ƅ~E14VPS+ i)u5p454t$, ƿy54h k$<431O=\$t$9ȉQ-L$5p4u ύD$ PSx5p4r*V 4Vh-T#14p4444V-3h k$;43V,3hT#ˋ$B65p49PhS#h3* 1@4}$;3t=h#Wt1[#=4u{"PWN;? \$3\$=4 1$ӋFHN~ HVƒ =4u u u1G1=t4up=x4u< u7 =4>h_1#hT#h\3 h3@t>$@$Ph T#h\3ڃ h3@ t_  =4d3H d3;t3h\3j$  =4xd3H d3;t3h\3j^读:=|4,d3H d3;t3h\3jMUڃ\3H \3$\3H \3^d3H d3!;t3h\3jI \3H \3I \3H \3Md3H d3%;t3h\3j-蔺ڃu!\3H \3-3DPuWd3H d3;t3~ƒ t\3H \3h\3R!ڃd3H d3";t3h\3j^ڃuv\3H \3^?tЃ@Ӌ d3Qd3; t3~ ȃ t \3Q\3Vh\3Pr=F @t54h k$74f h3@ui3\$t VŊ(3%3Wh k$641;`h\3脊u4e^_[]h 9"j2Mh}$fUSWV$$0h_1#j 11E1D$D$D$D$$׉jh 2hFT#$VLQ~Hw@$&ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j<$ىY1ɉPXuG 3$T:-u"j9uzuI 3 u 3)t u <$u|$uM1ۋD$Ã<$D$ tD$ $4u9>WFuTWhT#D$u5t뢍D$PWz u!WhT#MhWT#jJ$1 |$ $jSV]  u h:%P1u&8V1CHHf wy$T&|$uhUÅu뼋ss < PVhu" |$u.jSU ss  PVhu" 1F $tCPpQ|$t KP;AmPsT$Z|$Osh k$J31F7hO%jI變PPhT#h3ݱjӦfUSWV$$6q1h_1#U譝 -4-4-4-41Ch%U#VWT e'H wu$&4-4-4Ńo'fil4뙃prv4oa444%4-4-474-4-44 4444444u 3)ǃ=44u-tX1Ƀ=4=4tL$H=4=4=4=4tʉT$4Y4jY4PuYt$lVUhH2ID 9rUhU#\hH2BH2 @2QT$/u>t$|9A@2A @2I2vy/th2U#hgU#jFt$ D2Dh j)=4u$PhH2$PhH27 u@躈8uT\=4u=4t@4 4t3D$ P6q1#$=@txUhH2D$ P6u6h k$jE#D$=@u4 41ۉ  t1ۀ|$/uhH2hU#.t9U&Ar|/u (IHr IH9/touɉt$Po4USWVT$juQ P D$1t$CHfw?$&ss 艙 PVt$ hu"6 PshU#$>|$(5D2C,H2)=|5TShH2hU# t$VK 1Ga{DuO|$u C(D$?Cj/D$ Pwt L$)@L$D$h#QLxT$CS(L$)ʀ</t ~/t/FD$щT$H2)rPhH2hV#t$PV- L$@2@2=I2vx/u H@2=4tD$PhH2$D$PhH2T$KP3Qt$31 u@T$(3Qt$$3q u.shH2h3V# CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH2hYV# 1Gt$#KPqt$1BD$ $&=4L$ QP T$ 4 4sHtbffM +4Q+4T$ 4t$/D$ !=@8fushV#$jSt$ V 1G)=4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=4t$tjQ\+4H +4<4tICPphH24shV#+D$ PhH21u=4thH2sh]"# VJ Åc1G1蟂8uVe^_[]7h k$hO%j2@h W#hW#h6!\hH2h%W#hW#h?hV#{fWVt$$D$(H0JH(x,z H4x8J z@ \$PD$D$T1l$P\$X1\$|$(9rD$)D$VPt$3 9n)|$(=4tkt$H|$Ll$H W&D$X|$D$ fD$&l$&\$4l$D$44Pt$t$WVhH2t$8hQX#h3蚥$AD$wh k$&]=48hH2h=W#h3J 3H 33H 38=4<u0H2V#GPhVy ƃhH2h k$_XO\D$ظVʋE@D$ T$\$\$@T$T$Dl$@\$(hh+4t$ Å11Sh+4t$` H29߃=4tk|$8t$1hH2hs$#4$hH2h k$#|$t$ D$L$PQy#EHQh k$#1@D$|$t$ =4t#Vt$$7thH2hLW#n#4$|$tV1C؍e^_[]Ã=4tVW1ۅÃ=4t@1ۃ} t8G t2G;4u'D$`PV^t_hH2h k$"1CVthH2h k$"1C=4bWhH2`IGG;D$|u4#G%PVwUSWV\$|$OǴ OOtQPS& uG1CQPhH2L t9{18thH2hW#!1F#GGtPSG1PhH2thH2hW#!1Ft\=4uSolzt US UhH2Iu%\z8-ulthH2hW#R!1FuWhH2t1F^_[]WV$ hWv t,$t'hH2|thH2hW#"vhrW#hH2WtWhW# 1@^_Ã=4tjvP(1V|$ thH2t hH2hW#"t$vhH2!thH2hW#; 1@^Ã=4t jV1V|$ thH2藽t hH2hW#(t$v$v vhH2JthH2hW#1@^Ã=4t jVF1 wPPhW#h3OjEUSWV|$j/Sit@Ë$h7&S0juGh_1#WVmA X3)ƃHt4%j1hxX#WV$A e~!r8$&+5˃K~3LtgP+5믃st\vtcw+5듃FuX+5+5+5+5m+5+5Z+5N+5B+56uX3)ފ +54 -+5+5u=+5u+5u+5+5,ttu'MUj Me%jPrt=+5u4PVu$#D$=upvYj1PVHuB#D$=@tM19t<1jA ŋ9uUߐVh k$j3tPPhX#h3輛j貐USWV׉΀=+5tj}$hVSi0 =w6S@t)$ PQh?%WSv9du?A =+5u L$QVЃu#D$=@`!uVh k$ 1C؍e^_[]Í\$SWeu#D$=@=+5u"SWu#D$=@=+5+5>/uD$PVuX#X$hSW&/ W+=t?$ VPh?%hW;D$PWX#t VQ(D$PWzÅ+5WVe/PVet@\$L$/PWdt@L$ Q\$Seu)D$ )=|\$=+5u=+5h\3KWhX#h3 3H 3~3H 3h3:oÉ؃t9 t43H 3~3H 3h3nƒ߃Y=+5u#D$=@uWCW"u8=+5u WV +5 PWQVQJ tW#1ۀ=+5$+5VPWhX#zh3jj hX#E9D$t$QVPK Ƅ fDŽ$.$$PQ\$4$9|$ t#t$WP{K$ D$Ƅ fDŽ$.$PQI$3$$3$ $3$$3$  WVhX# fD$L$TTPQbËD$L$TTPQbUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQPPb^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPa^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQPa^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQPa^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP`^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQPR`^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP`^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP_^_[]USWV |$87Bh_1#j jOt7D$Phht@jU uD$tL2,5 ,5,5<u ,5t$41۽hY#WVf6 HσG$$&,51,51,5<,5@,5 ,51,5,5,5 ,50,5낃wP,5T,5^\,5Od,5@4,51,5"t,5x,5@1,5<,5@,5(,5,,5D,54,58,5 ,5=$,5t $,5,5P,5T,51VH,5GL,5P,51C+,51,5,5 ,5 ,5$,5,51,5,51@X,5,51,5,5 ,5 ,5`,5h,5,51Ml,5p,5r,5c,,5(,5J1,5<,5@,54 ,51,5,5,5 ,53D$= ,5u= ,5u =,5th?#j.tP-L2=$,5u $,5H,5 ,5L$$ ȉD$p,5 0,5h,5 ,5L$D$ ыD,5 T$ L$u1 T$ =x,5t ŋ$u|$u|$ t+uhL,5jt L,5 L,5=l,5,5tL$t*t,uw kL$t;t=u^ RI K =,,5u==(,5 t/` (0 !. =,,5u=(,5b t |,5)θ =,5u/@ = ,5u! =,5u=,5$ t ,5t1AT2U4,5 ^_[]fPhY#h3 jUSWV΋\$=8,5 t1PSR ~jPW1ɉ=D,5tW  L݉t$=4,5D$W,ÉL$ CHHf$D&ks y PUhu"i ,5{Dt{T.u =,5tw=\,5uL=,5u%shZ#c1TShU#L|$|shZ#7,5VWFʼnى=4,5ut jSW W)Åf0Wwf0pf8u ^_[]jhO%j$WVD$ qH1ftYT$zHftIf t$f tf9t=D,5uyDt,RQ|,51f Duf u RQ^_fu1@fu1HUSWVL$p~H,5D$ ,5u =p,5D$D$\T$8D$,D$D$L1D$<D$0D$(D$ D$dD$@1D$D1D$H1D$D$D$D$ FHf tfuPߍ^Tv t$l$ՉBw PShu"l$ t$ 1@F F,5|$pt~T.u-=,5t"fu=D,5uFF ~,D$9wǀ|$T$Pl$\$|$`FPPdD$$x`\$9l$ЉT$X|$|߉|$lT$D$$P h\$H9Ӌ|$rډT$H|$$GD$9ȋD$l$wL$W\X9D$ ЉT$|$4|T$ L$4T$ |$T\$h|$$G@ %=`G 9|$\$L$  ȋL$D9ȉD$D1@D$@D$ L$(l$0oD$D$4D$ T$T$lT$T$\$hl$4\$(\$T\$ \$\$<\$\$0\$X\$,\$\$l$|$D$ L$(l$0\$|$<l$XL$TÃ=,5\$|$t-=X,5t1D$$ph#&j $U舄l$ &D$,D$HjD$(pTrD$ t=X,5t D$$ph#&j $U5jD$(psŅtt$ PT$,D$(9щL$l$,U/ʼnD$L9L$L=`,5t3h#D$(pl` D$\PT$P9щL$P1|$(P%L hà t$ P/{ Ct$,P{=`,5t +Cl$\UPzUM\ ^|$`\$L$D$ l$4T$D$dl$D$ D$lD$\$\$hՋD$TD$(D$D$ D$D$Z#S~ sv$h>Z#@~ =`,5tsv ho#$~ E@ %=`u6E %  1QRv d3J d3;t3~у t \3Q\3Guh\3Qf=t,5tXD>d3J d3;t3~!у t \3Q\3Gu7h\3QL$D$ ρÃ,5T$9,5}`;L$}XD>d3J d3;t3~!у t \3Q\3Guh\3Qod3H d3;t3h\3j D\3H \3 1D>d3J d3;t3~!у t \3Q\3Guh\3Q~d3H d3;t3h\3j ~\3H \3 e^_[]SWV΃=d,5t voh V%`1TVL^_[SWV΃=d,5t vh V%1TV^_[Ã=d,5tATPqh?%x ÃTQh k$wÍ` f w5$`&d3H d3;t3h\3j@I/d3H d3;t3h\3j*d3H d3;t3h\3j=kd3H d3;t3h\3j%Dd3H d3w;t3oh\3j|!d3H d3g;t3_h\3j/|1@á\3H \3@\3H \3=֡\3H \3%á\3H \3|밡\3H \3/1á\3H \3*USWVl$(}=H,5tE(G=p,5t=P,5t0DG0,51 h,5Í4g69L2} ^_[]E;\2~*P5,5G tM \2,5,54FMt%$Q  Qt $ B$Iu$ L2șƉșD$$t$D$ D$|$1ۋt$=P,5t0 ,5 U(tt$ ;4$}Z;D$}El$)šd3H d3;t3h\3j z\3H \3 MuC;\$rd3H d3~\3H \3 h\3j ]zD$@D$;D$ ^_[]jLUSWVt$~=H,5tF(G=p,5t=P,5t0G0,51 h,5Í,L L2-9} ^_[]dGșljș|$$.1E  E;|$|6d3H d3~\3H \3 h\3j Py1V(=P,5t04:;$}D$)ád3H d3;t3h\3j x\3H \3 KuGm=d3H d3~\3H \3 h\3j x^_[]USWV|$=H,5t_(C1ۃ=p,5t=P,5t0C=0,571F  Fd3H d3;t3h\3j, x\3H \3, +N,d3Pd3; L2} 0;t3(h\3j w;~&\3H \3 "\3H \3 h\3j ~w1W(=P,5t04hŋvd3H d3~\3H \3 h\3j w^_[]SWV|$@,5Wt pSP&8 t81PWV Vh k$pVsH ^_[hZ#WhU#j USWV$Ub4(F$$1 |$1 9$)덄$PSUD$PlZ tXǃt-tat$\ ?tL$T$d$.?T$O$E1 $ ;,3r9vL$?T$$$^_[]SWV ΉRQSZ 1t4u t|uHth\3PjS t V\ lj ^_[fUSWV$$3M1h_1#W] Wt%$ D$D$ h%SV mu05<tChP襨$WfF 뼃pu D$ 뭃u 3,uk5<hT#j#D$=@u.$VtPK 9r*thZ#j|WP*c ty/t AƄ/@L$M$D$Se|/uH9tx/@tj/S>9ޅt@V,L$rShZ#}1A $'@PVt$ 9 ٍ$Ct1@$Mg4$\bFPPh[#h3Fmj%D$1Pt$\U1Pt$`KWVPSt$D$BPh[#h3k#D$H=u}1PPW  t$HhV \$D$,5,5VCVh[#X1C؍e^_[]ÉVh=W#h3j 3H 3~3H 3h3)AÃtH tC 3I 3~3P3h3@ 3 tuÃ߉1ۃYM@Vh k$'$,5S. ,5t$|$SPt$ Y Å11S5,5t$ 9x߉=,5t{\$(t$,l$( W&$$L$$D$ l$ |$T$ fT$l$\$l$T$,5RQPVSt$(t$(hQX#h3Ui$5,55,5t$  Å6|$W\$St$uVhLW#@SgD$hL$l$JD$pBD$tB D$xBD$|BRWtVh9[#t$\t$\W B8tVhG[##D$HD$Ht$\$ \$D$t$Ph k$V tVh.[#gt$S1VB5,5t$`t$ЋD$HPW,tVh[[# $W*tA8-t$Vhh[# WtV|$WGt Wh.[#H1ۀ=,5DVt$SWVP׉jWP̩ t$t-h[#h[#\wh[#h[#;1@^_[%tPh[#h[#$w jWPY t$th[#h[#%tPh[#1돸[#=,5u[#[#jWVh%Ph1"SzSh k$j?[#jVh%h[#h1"WzWUSWV8`2t Pu`21,5,5,5,5,5 V52it$L$&hjV: `2?Vh=\#0jG`2hhV `2,5hjV `2K?Vhr\#0jͳ,5u21`2,5d21t~,5ttja`2,5l21@5`2,5l21@D>VhW\#0jE`2t,5tj`2 5tQ`2h,5P!xC,5%= ts=`=@5,5h\#j許  >5,5h\#0j膲5`2'`2,51HPhm8@5`2% 1ɅA ,5-0-55,-5,5ˋ 2u,5052v$&=,5=05>1jSS5`2%!ƒu=8f,5-0-55,-5 a1H 22=<-5Gt =}r t~=0505q˃u#=,5tPWUVpd ~jWUVVd tw߿(=05u 05~~=2|218^_[]111RSWV։ωS#2D$t,t\$W3 4$t$ctjt$b#1@jt$e#1PW4$qt$ejSVVx^_[hd# h e#he#jVP=`2x=5 5t}=,5ut=5tDP5HQP~'Q & V51,5,5$Pj c55h\#5P5<` 5P5=,5uKh,55`2u4#,5=u"0-5 ,-5u5,5~,5=2w=t5t2~ jP5`22~jQP/ 5 5t4=,5u+5P5h"55P5`2=,5u ,5tP1,5,5H5t2 5 5t'=5tGP5HQP~Q  V5Pj Hb5H5tZ55h]#*uC5P5 L5H5 u <585jhQP)RPh ]#V[^1V5P55 V5^USWV=2\3t3D$WvO+`-5 d-5 u1@1ɉ$L$=H52\$5L55H5h.e#hSY<$t$W5L55H51($hIF#RPWh9e#hVY$VShc#hW{Y}WPW}tf=p15t]t$5U55U5h.e#hV/Y$Vhp15hc#hWYWFPWj 2u_5 V5<$t$WjVO'$h҈$RPWh9e#hSX$S]Vhc#hPXH5D$=2O V5D$ .e#D$5L55H5VSPQX$5<5585VSP3X<5 85 H5L54$t$VPQ&$hIF#RPVh9e#hSW$S]$QL$Qt$Wt$$hd#hPW$t$VPVjt "$PW55hu"t$@[e^_[]V~=,5u(=|2~h~V5`2Y |2~^VP-51=,5uE1jVV5`2axRP5`2- y4h]#0jd 1N^Ã=,5uh7]#jI&1=,5u55505hi]#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|2=,5t$t$5`2 ƃu*~3,5;505tc505tU,5L~ ,5?5|2x52h]#j, 1352h]#0j^_USWVP5|2|$l$1ۡ`2$WUt$ ƅ~)tދD$9uP-5,5!|2,5Hs-28 uc1h]#Vh5|2:~\%tS1jPP5`2x})RP5`2v+ yPbx28tDn28t:d28t0Ty:T28t J28u |21428Eu |2xt P-51,5=P-5uh^#j腥`tx>H5Ht)t h^#52h]#jL 1%hk^#j152hH^#0j^_[]USWV1N=T-5=|2 2uh^#j٤,5<u,5-,5sg,5<-51jWW5`2cxXͽuWURPX)jWU5`2#yQu t#,5@,5=|2:h_#Ff@Phm5`2 x|2h2_#j1^_[]USWV \$$|$ l$(1uu5|2,51jVV5`2Ix\D$ljT$Ӄ=,5D$0-5,-59L$ujRP5`2x+D$T$EU,=,5u#x/hf_#0j |21N ^_[]USWV~=|2$(~$$~,5t)h_#j蔢I1u)1ɍ|$h~W5`2 0|$fGWhm5`2 fD$D$Whm5`2 \$h~S5`2{ $h~S5`2\ GfD$D$Whm5`2O |2t1<$uzfD$D$Whm5`2 f $ 0511F$$~jQURXы$ʉD$ ʋ$$~) h8`#b1F|?1jPP5`2xg)y11=2|!h_#11Fs1o-hUd#RjRP5`2]1yK,h`#.,h5d#",h_#,h}d# ,hd#0jB 1N5|2~^_[]fD$D$ D$Shm5`2 yj,t$hh`#Z,t$hd#0j٠SWV Vh5jk y,h`#0j袠 jVj? y+h`#0jv 1N=T-5P-5=\-5=5u55h`#趟=,5hl2W{hd2Weo ,5aX`#t@a# 2a#taa#QWPA S8 2a#t?"P55ha#ha#ha#h&b#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5,55,5hvb#sWhWb#T55ha#Aha#4ha#'h&b#<=5thb#j{52hb#55hb#ҝhc#ŝ|$h Wf|$.|$t+D$5..L$f tW= r@hgc# h*c#hFc#Y55hb#Fhc#9sWy\Whc#T-5|255hIb#5 ^_[hb#МX-5t P# WX-5t ,51T-5|2hc#j|52mtt$11Hfhhh-5Cthh-5Th151(hPe#0j臜 1Ht$膿'hme#0jX 1HVt$Veu'Vhe#0j*^\SWV|$$W覧ƃu[g'1~tHNtt 9 tu/>'PW#t#D$=@t '1N|^_[USWV1FH5PH{H5P kjƉ+V5Hw> H5SPhl15Q@ V5$ V5L$QPhl15\hl15Cjuhl15[jhl15^uH=p15/u+-Bu"p15P-Phq15p15PY h\3WVhl15M<h3@ubV5V5 V5 V5QP.t H5P(jh5j谻 xsZ1e^_[]R%he#0jՙ USWV (2x&,2kL29|׋yM1II1$V51PQÅy19}WDu=2hg#j.hh$V5OÅy1ۉ9|(2x(,2kLSh$V52y݅u=2tehg#j迗$V51E$sVh%V5$V5Px )؍$V51Ehh#ji1IkFL2H5Sh$V5#1ɉ^_[]USWV D$H5xGD$#V5$1F1$V5SQ291CH5h$V5hl15P$ H5Qu*D$PUh$V5Q8 $V5tu=2hg#j耖t$h%V5h$V5U $W1CttUtB:x9u=2tFh~g#j,Wh$V5Q19uh5g#j1H ^_[]h[g#thl15Q<t  V51hg#USWV1CH5PHH5P yjƉ׃=5t/52蝼t!hf#0j4 e=h5t Rrx7t$t4H5P(jh5j褷 lzbV1ۉ؍e^_[]Ít$\$D$V5Hw5 H5VPhl15Q@ V5D$ V5L$ hl15kWehl15duy=l5tShp15$t^|5 5tShp15hl15Ujhl15Xt@hl15EmV5V5 V5 V5QP=p15/u+?<u"p15P?Phq15p15Pk 5 5tShp15@ 5tpP5|NPWt$hl15)6Q=|55D$L;U5D$PU5Php1585U5t@t=5u Pl=2t1V5Hr@tZ tUhl15l'9D$X;U5D$\U5?uD$Phl15$Ã|$=5ut$hl15ÅH5VShl15P@ =5uShl15/!؃=5\$C=56D$P5HQPQ 5=5D$L;U5D$PU5V5V5 V5 V5QPDy hl15j=5\$^=5QP5HQPQ D$L;U5D$PU5D$X;U5D$\U5OPj \F5D$uV5D$ V5L$ QPpU5x525P5V5V5 V5 V5QPhl15ji\$=D$L;U5D$PU5Pj E5USWVj/hp15Z 1Uhp154t>5h15hh-5U /tOGhh-5WUhp15hf#jjO1N,K|/t1Nuhp15hf#jj^_[]SWV=H501F H5t9t71he#jێmQHbH5P R=|5t i<H5x t `m#5 5t#55he#5P5@ 5ujhl15^t(V5V5 V5 V5QPu1=|5thl15hxuthl15lyH5P(ljgSW, xa5 5t&=5t5P5h"251G*ƃuejh5j ^_[USWV $H5xu d?*1FH5P,H5@0D$ jD$T$=h5jShl159]jhl15Q$=|5thl15~ghl15+thl152dV5 w's1PP5|I5 $jhl15Pƀ=p15/u+4u"p15PPhq15p15P达 =5t4$hl15Z' 5t:P5|Pt$t$hl15s.Php1505 V5hl15T$t8=5=5P5HQP~dQ cH5L$Qt$l15SPD ƉPS?&=5tc=5tZP5HQP~3Q 2Pj j@5Phl15%dPj C@5D$L$ʃ|QP  V5V5ʃ|QPxnhl15*1C@TPhl15Z%f5|I5hf#0jhl158chl15)t H5P4 jh5jN =x5tn)11Fe^_[]þl15PV$Vb뙉Phl15$뇃=|5t cxIxH5PHx11@USWV $$h 55S = u$ /,4ŏ4/t EƄ4/FED$P55#D$=@`1Gxv%xmlxd=h5t exRhl15!(ttjh5jժ Gm'155hf#j 1GĐ ^_[]U55h#f#0j҈55hJf#뻸 )D$ )D$$hl15 X|5 5tV1=p15/p15t$PU ;D$vhp15hlf#jN _D$PSEl15WT&W^jhl15Kt'hl15K`hl15&'VShl15NR xơ5 5tD$Php15|I=5t5P5hp15+5 V5=p5tEhl15C=|55D$D;U5D$HU5hl15{V5Ht 1PP5|I5褩 $jhl15#Pt$hl15 Whl15D$P;U5D$TU57wD$ Phl15;5tk=5tbD$D;U5D$HU5Nhl15hl15^^D$D;U5D$HU5D$P;U5D$TU55|I5hf#0j蕅Pl15WWWhl15!Phl15=5e=5XP5HQP~ Q Pj 95 D$D;U5D$HU5Uf(5(Z5,5u H5@,5=~| h~PhHh#thPhyh#j蜃1Hã0525,5y x1<585 (5,5ʉ@5 D5(5(Z5=2u=,5t4=~| h~Phh#thPhh#j1H5,5 y x(505@5D51L5H5(5(Z5~205USWV=T5thi#j艂1I^_[]Ã=,5052u,51IxՋ=@5+=D5|$\$52UVSW6)9|11UV$)݃(5|JD5 2@5~H505PD5D5;@5r֋ (5 2@5D51)ȉQPx[(5Ɖ5D5 2ȣ@5)=H5L5 051<58521h7i#jWV1N=2=2uhii#jy1L5H5525(5Z12~9} G{u'Phi#j~ xI1=L5=H5525(5~ (5 D5H5L5 @51^_ËD$L$D5)ʉD5QPRa USWVu ]1D$ D$ D$@5 D5)ȉ9؉| D5)։ 05QPVS4)ЍT$RPQ 1ID$L$ )H5 L5|~ @5D5)ЅqxUtX @5D5D$9ؿ|‰D5)ظ|D$L$ 1H1@D$D$e^_[]V1=P5525(5~# (5 D5H5 @5L5V1xC=H5t/x&5L55H5525(5~P51 T51H^VD5;(5v*5@5)QjP 5D552^USWVt$\5 X5ƒ|]; 85<5}O1hj#W}=<5=85$-(52 ( @59)1 -(51ۡ21PUK;2tS1<585S(5 2@59)QP륉85 <5Nj-(5S5@5U +D52)US85<5(5 )VQS D5H5HttT51O1^_[]É-D5USWVP\$1~cl$@5$5D5<$)"523x3ǡ@5$5D59|WUVH 5D5)11H^_[]USWVPD$~Z\$ @5 $5D5ŋ<$)Dž~9@5$5D59|WVS 5D5)D$^_[]ËD$)USWV\$ l$؃|~@5D$=D5t$)#524x\ơ@5D$=D519|VQWD$  =D5)Éظ|$1H$$^_[]USWV$  $x$|$D$|=5t7P$ty#$ h\#0j.{$|r D51N@5)ȅ52  D59غ|PQ$^ ~|)à D5 D5ظ| uXP$$3D$8$3L$4 $ hi#jUy hx$ hi#j5y L$ hi#0j z'q$ h\#0jy111o^_[]USWV$$x$|$$D$x-D$PQt"4$h"j#0jny L$|L$1$p0L$1@5 D5)ȅ\$^ D59|4$ST$ RT$RPQ$P~R|$ =5 D5tP;CJ D5)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=5t% u!$9$t4$hJj#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=5$4t1PWy#h\#0jQw1HD$sD$$P$<R4$tVh"j#0jw $l$ l$\$ 525(5Wl lj\$11ËD$ 9D$D$D$(5}$4$t$ L$ QL$,QWP$PWP$@ ى9u1525(5$< ljޅz11 ͉$03x$3|$ uRD$$P$8%$3D$\$3L$X $0<$\$t*Whj#<$Whj#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]$0hj#0j8u1K<$<$W$4htj#0j uUSWV|$7t6|>/u/1N=`5MWh+k#js `5.|$tjh Wv V $=d5d5_Shk#VP!$DƅE<$8$S x<Shk#P$!$7Dywk0=5t5P5$hk#Vjs15d5$F $Qhk#0js1N^_[ÉUSWV|$?/tGj/PƳUW#u/Fj/VƅuhW=5t$$W jW'y3UW~u%D$ PW)jUPWV/Fj/V1ۅA4t*PW}t1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pەyu~Whk#0j r$tDPByZ$hk#0jq$U 1$d5^_USWVD$Et$$^߅tP:yWhk#0jpq=5t<$8$W 1 5tt)$($u7=p5ujPl5PBp5l5!UW2 2t%1PPL$H$X$T$W$tJSW賕y!SWhk#0jpW@$ 1$d5^_[]WVD1uA|$ t$t$W t(5P5 WhWm#0jp1N^_Vt$#D$ PVÕt%5P5IVhum#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=2t =2D$PVE{tVhm#0jKo_=2u&D$DL$HL$$Mbl$L‰T$=2u'D$PL$TL$D$ Mbl$X‰T$WV=t6A8Nu} u&WVu"Vh,m#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVzt%#D$=@uVhk#jm 1HjW |^_[USWV׉L$]D$PSyt6St$Jth0wwS tՃ} tL1@_1=l5uTG3D$ 3L$ uKG3D$O 3L$ u9t$h/n#jUl 1St$h^n#Vj6m1He^_[]ø#D$=@u%he%SltS0S<} DBShMn#0jl댋D$$u1@Ë $jPUWV}wPVUx1@xN=l5t1A$$3L$ $3$ u*0$3L$,$3T$ uVh-l#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $&55hRp#uu=5tlD$PUWwuZD$ !=uHhWU ƄD$PWwuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$V 4$U L$ t uu$UFD$y)Q8=5us<$8$U xZL$ A$t$Uh\l#0j3j1H=5t2<$8$U Uhk#Wji1ɡ5tt1Ƀ$ !($t($t$$55h]#jUxN1=5=2=2Uhl#Uhl#j7h 1OD$PUtx=1$ ?#D$ PU1@=5u;L$ ($/Ct$hl#0jh$ PU1@Pt$6UK21 2t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PWt1x1K=l5t މ|^_[]ø#D$=@u5he%WW1EtXWyĉl#$t W7y5P5k#WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5(5$5 55L$T$tI AQP DUVP 9t_L$ xZjPUQ|ҋT$0y@oEP Džt<$\$MQVP觬 D$8+$T$0)+|$$>hm#jJe*t$8hm#t$8hm#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjhh5S( y%m#m#\$,SV0je^_[Vt$ xFPE=x5t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(袇 ~H111Ã1T |A9uV$P$(m ǀ$1111틴$(3x$3|$ uUP$(xLX$3D$8T$3L$4 uF1VVV$(7xE$($\hm#h\#.hm#j%c #$(hn#0jc1N|(^_[]V=5tt5=5tt5=5t@t5=x5uh |5t01x&=x5tDyhxn#jhb1N^WV5tPt1551Nx5t 5tqA5uj13H 3~3H 3h3tN;42u1tB |59G= |+5xx|5 PW1t-|58j5t5h|5j 5&1^_SWV|$tR?tMj H tSƋ\$WۦH~ </u>ۉ^F=x5t%5p!hn#j`1Hhn#5x5551^_[á5t@=t5t5=5u0=d5t'D$$u5tjP55 WV=x5tB5x5t;11G~u)uhn#jA`6h#h3h vu^_USWV =5u%51N5u5}$ $ $L$Pr5t#HHf w=$&phlo##"pho#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$pe U 5qho#0 ph4o#p j_e=x5t\@PL$QL$ Qpp p09Bx85jjt$t$t$t$phPo#p j[_ 51N1 $&LJ$Ƅ  LJ$LJ$=x5twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 5 VqP蒤  5VqPq 55h]#1u5@e^_[]fUSWVT\$tl$h=5P($^T$L$X$1V8$V<$t_1#_1#t4$tVjQjRD$Pho#S $u2@$%  RPho#Uh#^|$x$ho#STEPD$Phn%S=$Hs Uho#u# Uh]"S SX^_[]Sj n USWV@L$E\$CD$PS{3j9p#| p#L$QPj@t$VƼue^_[]SWVT|$dT$t$X$hS($耍WVSho#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPSR[VS舂Gu܃^_[Ã^_[lUSWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V5~1F1u5ho#j9W^ÐSWVL$D$t$|$<5t5tt\^_[}\1KZ5teSPKti:tdx:39}j <@3sPVWC hV5:-u/5È5n55`S6h p#3=S6h7p#h3p?^_[f1Ã=5u1áH50hq#jV 5t"H 5p0h r#h355hRp# u_sUSWVd|$|j/7K5t@l$x5hRp#P5Rp#1CL55D$ D$1D$$jh2hs#WUHЃJw$&;t$$@$(&<,5묡2t 2t52r2t c2P=2t#\$l5! <k,5 ,5,5q#,5"P%255<R2t 22\$5t,52eL55L,5ذ2=5.h5 Pt$5 * NL$ < 5$LF,5İ2,5ΰ2,52,525<5,5UR$5q5<[Z 2@K 28<8-u x,5D$ =05u 5522,5p#5255<WO d55s5d2U505?,51@D$ )2 L$ ƒ ʺ3t\3 3P5ƒu 9u , l$D$kL2H55 51"1$jh82hr#WUÚ/~HЃJS$&42ƍHw$&5뫅!<,525|,5UR$m|5@Xp5ˀC`51,5p#"h5 <@Ƀl~mtKotRpd5SatDeJ1A 5 5 2 2 2"25 2@{pe<,5SH53 < \5X51ɉ5<"]55<L$h jLjh2QH5bl 5<Vh"{VM245 5@5< i@5\-5d5,5"P%55<9i <E ,5N545 $! < }t555< =l5@x5 2%=2P5\3 0akG1A11|$<$t5D$tGNutNj]]hnt#S1t[ht#SuE55j55S^ 1AL$y#$]15<$D$h#Szl$\$th{"SDžu 31 ðt5ht#S)u35SC I 1urL$tP؅uAJjht#S蒄 uP5D$t t P CP跅ىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P| h#SAt W4=45<$l$S|$;5,21ɺ G1Fmفt#u41A 02<1A 02!521ɺ.1!# $ 4u H5ܬ2=rnFr0s9-3D5PM39}j4NxP3@3239 1VV4b x3@39| Qh^r#j?H 1FPhs#V(H VZ5<hHr#hcs#jHj45<hr#hhr#5<htr#jG 3Vhr#o3%52WV 5ܬ2WV Vh$so5<hHr#0hr#jjG!jmh't#jCGt$h(s#jjP$t,(XN8@tUjP$yFD$8Uhnt#W%1D$h.D$1$h#Uth{"U0Džu J3tkðtAht#Stjht#SK tj1ujSðuh#ULt W?=45Uht#l$}$l$ht#W ]tjWB\$rt D$W2|$ td^_[]á,5t8uhB",5t8u,5B"Uhqt#j E USWV|$ V%UW(UVNJ00ht$跩tAtZ/UV'UW衊488ht$vut$hq#0jxE1H1^_[]á5t H 5h3hw#6lj|WV31FWVhht#衣WVhh^u#荣WVhh5v#yWVhh/w#eVUSWVPˉjPQʸ փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q!~$1>tj,V"Åtj=Vtmj 船 tdAE0H@5=5t ,5s,5uhOs#j6B1O^_[]hcs#hs#hcs#j B4$ ɋD$L$01FWV55hs#h3  t(οs#Phb$h3 !uء3H 3~3H 3 h3j )^_SWVPωPQ*t4Ƌ$| tC$SA t'ǍCPVW胧 DG 45 451^_[USWV$t%t_݊M\tS8uEEh}x#j@Ej詷 UEƃjSV t3l$hUVP踥WUhx#j\@S $EE<\t:uCCUr{ $AStRC1fGt,PtStgtstp1B ы$J@u $A=85tZ<5HVV4$ Whx#ji? 1H^_[]VV hx# 85 <51V4$ Why#USWV\$tK;tFj tLNjl$1pS胄G woD$G95@5t%D5x!h3y#j>1NhHy#=@5=D5^_[]WV5@5t;11GFu)uhuy#j^>6h#h3 vu^_USWV@51 l$$=t5Kt(=d5t!9t)@tB9uKKt8<@5CSC Dž$hy#j=z$uEPxt?NjCt /C;W C |/uHC C$#hy#j2=Ct/C1N^_[]USWV|$LJ$@5tOwCu kPUC |/uPV3v t2[u1=`5O=t5=`5 2$=`5tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=d5tGtlD$@1G8D$@1D$\1GEt$ hD{#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh^{#j59tNjE|$tDD$@t:$t$PVh{#h3Vh{#h3 $t+Et$h PV{ 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh*{#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7P53WVVjfuD$L$ L$$Vj0VjeuD$L$ L$$VjVjeuD$L$ L$$VjޏVjeuD$L$ L$$Vj赏h|#蘃51555P 5t$,NFF FF |$WVj y|$ujWjֽ WVj½ y|$ujWj誽 WVj薽 y|$ujWj~ WVjj y|$ujWjR TWVj> y|$ujWj& (D$,WVj   WVj 0=2t"VvÃt C|/tS X5t}ǃtCPVW+ \5D/h`-5^dh) j?2HwN$&ʚth|#0jq1 T5e^_[]h{#jY0躼h{#覕-=,5u4!=2u2ҦtT5h{#j#zVt$1@55;|#t`|#QP/d5t P1=x5tVT jfUSWVt$=5t38$/>3i=)‹1@?9 tR=5t3<$/>3i=)‹1@9 tR 51QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=5ujh=蠮 5#t\u#uGW蚢 tjxGj jW ) />3i=)Ë 5,t 98t#@u $ja t!8h $1(Wh|#j9- h|#h||#j!-^_[]USWVP|$1N=5ujh=裭 5#t\u#uGWz tjxGj jW 賜 />3i=)Ë 5,t 98t#@u $jd t!8h $1(Wh%}#j<, hM}#h|#j$,^_[]USWVt$totij/V訩1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhq}#j+1H^_[]1j聢 ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj^S CS>tKt^?tYڃCKt6C;C C})VWh/~#j*S h}#C=5t$5X Vh}#jW* 4Vh}#551Wh~#j** S話 hR~#}VQh}#j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$QÅt>VRo,FN4A1R113Wo1J 4$$&G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACS蜙V!1҃ډЃ^_[]fV1=5u*jh 5uh~#j1(1N^USWV 51Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj肞 Ël$EPb $$$KCs{ D$C $C1^_[]Ët$ h 3P5n  1$$CHC1FwCE3X SO SD h~#j&1NwUSWV5t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j芗 tx@ LHDh#jY 1^_[]USWV5CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjx J1ɉHT$, $$$P HN HF F t$1 H;@u 5-555-5Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@5=5l$T$s}ډD$0! umщjt[5=5 tIje t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  h΀#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=5u*jh=l 5uh#j1N^WV5t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j( t^t$$XtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W h:#jj ^_[]USWV 51Kt$/>3i=)‹/uPVDžj$u tWWVtN$$QVQ4y8~V Q(y,~VIlNF 5F5 53Wh#!Wh#j V| Vhn#j ^_WV5 5t~1F 5=5u~ t v6蚫2 2tWWvvvv 6踫=2t v6ά6 V 5 5u^_jhÀ=5u1WVL$T$t$ 511H<>u5Guu%P=5t511@^_V|$ |et$>t\jhPp#PS t 2=2t#hՁ#j|j 21H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh #Su3h!t#Wu!2u95Džu91FWSh#Voh!t#h #hD#V WShr#jL1N^_[USWV\$hSb1N|$1h$UW踠 O$LJ4$<rD Sh 5h5   Ph(5h$5  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ] 7X 1D$ereRPQ\ ^_[USWV $ $Hw.$,& e| Rh"#{=5x1ۃd|Rh@#Q1l$ hVU՝ $ jdPU$,8\ $$$Hrjtr$@ L$ D /f@ 0 wh#h#h#h#$F1 $F2 jdPV[ fF0 $j j0P 5 5t5T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0Uk $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U茛 $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R螚 t$ h^#$%$ $LJ$m9rD$ )yQj0U? 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U诙 $ t%h{#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjhPp#WiJ t1H^_jh#WOJ u(=5u,5u,5h#jjUSWVl$hUh1N\$1h$WSy K$ǃ4$Yt"Yh PQV Ǎ A/G<rH )Uh 5h5o   Ph(5h$5G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPįyEtQQP  ƅ(8$VP螭yElQQP˳ 1D$@$$$$$ȃJ-σwY$P&<2ǃ$)$QgtxuH%-u~t6h{"VȳDžu'z0ӟ PVhn#jH31FUWt5Ë$rt$Vh#j$_Ft1N13t W^_[]fVjhm"C$xKhV"P_85t)h{"VH<51u;585荇V$=h5thm"h=#j 1H1^WVPD$$|$t T5t$5 5t"=5th3j z5355h"Wױ 4$VW: Wj ? ^_P85t$L$T$ $RQP  585.dXSWV|$1N|5<5t,\$OPWS t;j S]1t^_[SWVPD$ $|$t T5|$t$5 5t"=5th\3j y5355h"Sְ 4$WS9 ~VL PhLQ$h3詰 h3j  ^_[fUSWV} u74h_1#jq \$1hg$WVS LtPt߃953D$h#Nƀ8/hY#V6ush{#V$ua$PV tKD$Phe% t4$3D$ $3L$ u$3D$$3L$ t1PP3ƅu j02Vh\3ah3@uj;h 9"jGPh]#h3 jUSWV$$6h_1#j 1Ɉ @5 D51Chn#VU0R e~%q~3كrtރvt_x@5ŃV.PtrكRtwftAiL5P5뒃Wt6duqH5zT5lL5P5WX5ID5;u39|=L5u 1Ĉ^_[] D$h8 j-$D$,$SA I9v9/u؃@]9v8/@tj/Sxt@À;.uCt<.u{t0\$u h#蕽C\$`5EHu]j$8u `5Pji\5a$8tӋD$t$ VWr X5tRtD$W=L5uɆ8ts迆8?ti赆8t_Wh k$-Htj PWhu"証 +D$@uDH5u;Wh#{`5;;=T5uWڀ=L5utV/tD$%=@t/==D5u uWoW4W L5 P5х ˉ4=X5u Ő=@5t@jPt$ u hx#7P uM8V NjGHHf wO$&=L5WOwP"{jWV GG \=L5uWOwP:GHftIfgft9G =L5u Pږ PW}G  GwUL5?8=L5uG ?tow [ PUhu"  c=D5uO1zuSwht)L5t 賃8t1詃8?t'蟃8ut/wh k$*`5V Dž6=T5u =d5td5ww4hO%j@ww x PVhu"j@蒁Ph#h3¨ j踝d5USWV΀=P5uLVh#h3菨 h3"[3H 33H 301C=\5l$$#E=jR脫D8D$Pu>(=D5uvVh#71Zh3F~Ɖt9 t43H 3~3H 3h3~ƒ1ۃYÉ؃^_[]ÍD$x _1#t>%1Pu}1PuݒVPWSD$Ph͆#h32USWVAӉ΅:#K1jhV| $ǍD$PWc.D$3CL$3 D$(3CL$$3K #D$ =TD$Wj1PPPWh D$$h PQ| KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW D$L$D$)T$T$ 9D$t;$SVg`5Vh k$&)`5Vh k$&W1@e^_[]<WVu1PPPWg uh h$P{ KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW D$L$D$)T$T$ 9D$t1W1PPPW:g h j$Pz KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PWN D$L$D$)T$ T$9D$tWj1PPPWf Th j$PJz CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW ;D$t$$P$!P L$)L$L$L$ |$D$ hW|1PPPWe fCXK\D$L$ȃ|or \$9ËD$| S$PW 9D$)؋L$D$ظL$|DW1USWV\$l$UEtMƊAuA)k')<5j)UXGG SEGh5tVG t|$u G?<5wu wu Wu  <5u=@5t^_WVt$ <51G&uGP5WVP`P 58^|~u$PPh#~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ55^_ÊVF|uܹո ѹ Ǹ É)B$:@B&uVPQhv#NfUSWV|$,t$(S=5jLVFt:xIuxNt@jLPj VF1tE@j PF)=55 555"1,=5uƉSϱ^_[]ù#V=5)u ^5 5Qh#nWV_1#|$ |$wL2 P2 P5>t'F P5QP5N@>vuڋ7 P5QP5t躲 @뭅訲+L2@Pů55VrƉRPhk$Z# 1 ^_USWV8׉ˋ 55D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhL"jVojVt$ % USWV Ջ\$$St$$tƉ׃=5%up1҉  ډD$$=5&uU1ۉ D$5 5ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$P&  u !ڃ SQWVu99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWV,aƉ׉^_[߹\#m#P#wSWVP=5 55Q(Ɖ=5=ޱ2ttxt>u6&=p1ۉSPVX Ɖ#p9u$8t*p8u+$t@& t$@u^_[ùz#%USWVPՋ\$St$gƉ׃=5uKh$5 5MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա5HwSjP ljա5uND$5 5N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH5 5N"ىWP1Eكra$"ى=5#É5݅~h5 52É׃'1H5 5NLىWP1 15 5NىWPÉ5L5 5NىWPe$É׍Eكw5|$4t;~l-5b1A1Ǎt$WShL"jV軎jV550't1I1@1l$QPhL"jU腎jU6 ؉^_[]ù##T#J>#@USWV֋] $t$ơ5 5L$ D$T$uPV֋=5Ww,&8&}uPW ֋=5ȃ}tً$VPt$ ֍Gw&;E Qȉe^_[]fUSWVf2$1h#B=etujX50\$h$5VSS7$U,$@PJá$5)QPSD $5)١X5pQnV#PS$>jh #a#ƅu)h# >-u~u5(5u5$5$>e%t<.u 1.D8t/ua$Phe%)tGPVt6$3D$$3 $ u$$3L$3D$ 1e^]Shg$軺t/hg$診uX58LtjX58j75$5uj=$5522f`5$52HQPP2Q 522@u1[h#]c0=v Ph=#Ch#9SWVW!WP;u2\$V迠c8"u6WWP tV螟$5V胠^_[ÅuNc0u Phs#j$5tjPh#l hH#fUSWVD$ 2fa1Ƀ|$‰tpыLh#ST$th"STu 1t$.4NJ]taM\uNEU\rw$&\0u!11ЃwxAunjt$>2HQPP 2Q t$.PN    ȉš2HQPP 2Q<$t*2HQPP[ 2Q 52 2Hu 1^_[]ÁfHh#jf45u]L$ 85jP,V=<5t @5K15@50ppp VPj 95P5t =2ujV]V^^jpPT$=5u 5D$ $1APV@5<5t1It$aLVPL$T$ D$$PD$5jWVP|$t$D$$_4$ WWV׉Ρ\2t P29ty u hP2C =P55u)^Ph"hd2P =T5t5T5h"hd2/ t*t$ Whd26 x4hI3%hd2xVq Ph k$hd2 2HQPP 2Q hd2o ^_SWV|$t$\$^SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$c^4$w^WVt$ |$C^WY^_PT$D$ $1IP>XËT$1It$)Vf&T$ L$9upu'0fuQh&j hD5D5@^1X5`5d5h5WV|$ |t|$wL2 P2 P5>t'F P5QP5薜N@>vuڋ7 P5QP5t j @p515J+L2@Pgơl5PV p5^_USWV\$0t$,|$W55jVi j膶=<2thƉ؃$1t7=2u.D$0t f $uQVi=X5u"Wj"=<2u11EiW賙u p5D$0u^_[]jUSWVL$,|$(206̓V$$&Uw1ۀ=2_=X5Mjw1ۀ=21=X5$=p5jwH1ۀ=2=X5=p5uQ=5tjw1ۀ=2=X5=p5t  u8V胘1tu p51l=5t\UW_j\$0SWh a=5t0WD$,E=5tt$,WK_=5tt$,WE\$,SW=5tUW=5tUWyPh# hP2Ek=5tswww. p5@jw1=p5p5 jwa=p5t p51VVŖL$,=05t =v2t p5tu u^_[]PjUSWV@|$T545D$$w=.2tttn555P$Pqh#dGtj P52 Kȅuh>#452l$jUth545585j<$t&4$hE#52|$p5\$X<5-45j w7D$ <5u=@5tSw<5545jB <5u=@5t]<$t&4$'hO#52@^_[]j545HUSWV\$;s3=.2{555POPh#stj V52 vh#tu h)#b2HQPPZ2Q 52l$<5ttu .|tF1ۃjU|Sl$SPi~ tuQV/|p5Ju <5u=@5tjs:UsVp5 <5u=@5ttJ=.2tA{t;555PP(h-#52^_[]SWV|$d5jw1=2t d55p5^_[Ë\$1X5u/? p5ut΅tSw5p5X5t"u8\5H \5KX5jw=2tru+\5H \5X51 1@65p5+USWV1=2t5p5|$0D$P`m[thUS- =X5tiD$d5,$\$4>G5=.2 5PQ Pghz"Zw O2HQPPG2Q=u2HQPP2Q 52juw I Sw5p5=2uZX5t"u*\5H \59X5m"u\5H \5 X5 d55p5D$P ^_[]USWV|$0t$V袏@O 5jPw+ _1=X51{t'G5$pWXWuuޡX5[tZtT1=X5uI=2u@l$41; u{C5Us t=X5u =2tʋ-p5-p5V ^_[]USWV\$K1t@ <5PSwƋk1OuD$}t 1{PuV_y uR <5u=@5t~ jW1|$x4$jt$jux W<$t$mE{t Vv1 V{p5 <5u=@5tA^_[]Åx Wk#P0|b PhW#USWV$$D$1t$ 5D$$T5D$DX5D$Ht$05x5$P5|5E5L$XIEtH1F\$Xljtw蔹uG5hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG5w.tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P8$D$XtH$r4$ ȅu$1ɉL$@=2t=h5u|$ ~ $@D$@D$ )$=.2555PP$l$41dz=u)2HQPP2Q9}j=W Ɖt>u2HQPP2QFPpU 1Ո`1t$XtOË$t)2HQPPO2Qv É΅u$u t(PV52 مt ȋN΅uء2HQPP2Q 52W|$ +t$4~jhl&WA u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$7 fD$D$# f=5t*fsD$=T t= u ft$}u$D$@f%u D$<5jUqD$,ED$D$tD$L$` =~2u f|$t$Ut$4$s t@p5|$D$D$`t$dD$,F L$<5=@5tYD$t;=x5u<5=@5t.t$`ajt$hyL$D$Hs*|$# toD$ t$,;up5.u D$ 1@t$,o<5=@5  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]5D$(5x5<NjD$ 45 D$(5=x5x5Y1PPW' O1ɅȉD$PPVd5\$pfh5D$ Hd5$l51p5<5 5L$( T5L$L5D$D$hPZ <5u=@5t$jV045D$ 545|$t&D$1f|$tH T5X5$T5h t$8nh5H h5=t$L$QPy h5<5t$9D$(5D$DT5D$HX5D$LT5hd5膚d5t$pD$ 45|$Pt j <5u=@5t=X5u 1X5\5D$@z$jW菙45D$ =45h!t$8H5x5t$Ut$8>oWt$Ut$8pD$ffD$0fD$8D$L$D$u#|22x22@L$D$5D$pSD$l45D$ 1D$T$PW艘t+85D$|$D$5=45D$$ 59t;D$=X* t=7 u)5D$(15D$TL$$PQ t$u |$ uD$0ufD$D$451f|$ˆQPW$5$X5|51@<3D$l52f`4$t$T$$L$tp5D$ 45w2P22d2|$Tt!D$(55D$tD$p5D$D$tFD$t D$f|$t$lQ<5=@5t|$# t j|D$u2F x2)N2|$@tht$Dh!& $P^_[]hl#5p5t$1=x5ȍPu =x5u"D$4thB p;ȅu~5x5t$ t$,Pt$=85uS'h#hd5d5t$p|$Pt jNt$hLD$(5D$DT5D$HX5D$LT5D$ 45jPe0B0 <5u=@5tVrT Ph}#x85ux5j@p5t51@WVt$tr|$w$H&j Wv M $@Fvu;Ftj WP( $jpV ыF @v 빃^_V t$t8>u3Ft,p蓨tF 5QjRp ^SWVQt1OS jjP t6 >F1"jjP tv^^_[USWV|$41GGG =2l$0\$S}<5AjUfjUPh uA<5=@5t 4$A1CSt$WSU\$t$$w <5u=@5tS=}^_[]hl#VPt5u1PPVPjh2,tF$P`{t5t.1QQVPjh2tt5@=PATH5t5@: t5 2 2^á|5SVh_1#ޔX58uj1^[1ۈ22蠎55thB v65X5A 5SSQPVh5áX5ËD$ X5\5PËD$@\5 X51X5\5Vt$ |$|v܉Ph#1@ d59~1Ҁ8cBX5 \51^WV15p5VȓX590t\W'{X50PjPH555`5h5@`5jw5`5JW {p5^_USWV$5$j/W]t@D$PW+D$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UV׼uD$ %=`uVyjWS ƅuWh>i%Wh# Wh#L$`5x `5V|$|D$ p p5`55h5uu~9} ~ X5\5^11@1USWV4h_1#|$$W膔T$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h֋#52](14^_[]UWV׉΋ 5uj'k< 511D$ T$l$ W&D$ $,$<$\$ D$#D$]?6u0uFjhEP$W %W/|80uHx.t x0@te^_]fUSWV|$7j/V u#$jVP uaK$$WV4c: Pu; 1@Ɖ$m=5ud$$UVuG98t898t.98 uPV跹t 9Vvju$P OfSƒrtt~ 57PSCPVhu"jSWVt$|$t$VW! 9t 9^_[Ã|$u0xjWC6u`55V!jUSWVPD$tnt$ t%1;t <:t9tGt$,89-P2}v,; L2t,WSQL$ NL$ |9/u 1xAA/D$PL$QQ5E9u,;E-5L$Et <:tEL$<:t1ED$(Q% $+ L2AQ:t^_[]USWV$1C1D$ 1D$D$D$\$h#nHw5$t&\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ X59AX593t$$1CjWtV@wM$&|$t&|$ t4t=02x'@ |$uX5H X58u5PVD$ PW9D$ft $|$t $|$tftjWt jP:4뇉4|$ÿ5/tPEȃw?$&|$u/|$ u&u |$tf<u t$Um묃5r52,2$@th#]1@$$$$^_[]SWVt$<55t5Hftfu9502| PF0 9p}Ëu̓5r <5t^_[Ã=@5t^_[USWV$G$$&o5EjWS PqM䃼$$twh.#VhX#GPh k$`<5wPQ_ <5u=@5t hb#yD$Plhh#_/thF#LhO#?GPh k$ t*2HQPP2Q*2HQPPV2Q ^_[]ÃPWhl#SWV|$tWȊ Bu%iC)ʾ!)!53tFWP$tc6|$tT<5WPnƉf@@ WPJL <5u=@5t u15^_[<55Qg-  <5u =@56USWV$$$j/$turfEE^59tth#VSt $j$q1Ʌt@@t`tm$umtisD$ P$exfE$KY18K18=1$ u=02x $u  \u =02y& u $MƋ$1Mtfyu02YL$$j$P 1OD$VmG5tAPh#{t$t-'55h#{t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=5$Nu$/8t/8t /D$}o$E$\$|$$t$t'52jS\P$hB&VfEo$T$pƋ$$<5|$ÍD$ uj$HfxT$ ufBuω7 <5u=@5t ׅt"G GfEG EG fEGE fEEĜ^_[]<5T$ Éuj$fxE$ufBj <5tbiV`C+L2PujVtij$t3fxu*SVm$=@5V$h#SWVP&1t8|$$&L$8u%tWPgL$ t us^_[SWVP,&1t3|$4&L$8uWPL$ t us^_[V,&t%4&jPf@NHu^V5 02trft fuxB =5r^USWVP\$=51N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#wt1<:CG럡02y x5021Ʌx $y $Q502^_[]SWV<55>t+fuwW& ߉?u׃5r <5t^_[Ã=@5t^_[WV|$D$ <5jP+@ft*fu vfFGF GF GF <5t^_Ã=@5t^_WV t$D$L$ <5fO 2fOPGWVU <5t ^_Ã=@5t ^_jt$itfxup%1USWV t$811G$1D$h#<ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPX5:KBX5*#$1\$ D$4$߅u U@=(&t,],&(&8uUPujU*ƃ<$t0vh#4$X5H X5(t|h#j v8tuh,#vh#*X584$t2HQPP2Q l4$t%Uh#Ph<#+h # ,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$&D$j/U'jU4Q~'0>: Ph":uhh#:Yuh^#Bu ht#7t.Uh#+5 t$|$tJHh#t$X5H X5(ouhc]$V돡5D$ FjUD$PK P.dN<$u_1#|$tI#PhB#Sh#t$ct$1 ^_[]hÌ##ct_1#RVh#Vh#1PPt$  5L2@PbUSWV|$D$\$=2t5H 5 L2 5 P2 P51ɉ 5 05H 5SpP5tH P5~55dH 55+L2Pb8545u%Vjap 8585s45UVW85-85545x=tE450va585΅u!Id5P52V'8545t O85G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t`5t D$2 d5D$5+L2D$?~uЃtRWT$4$ D$1@D$ wy< P5H P5f5e$!PVVoT$0/>u!y@u=D$ D$5$P5H P5R5Q=5un5+ L2;L$~[xuUH5QP5H P55P5H P55$ |$D$5ЉD$$ P5H P55aT$,H 5>~=u|$ D$ RV"T$4| u5P5H P5~#5%`T$,H 5 X~`T$,H 5$9Ut$ -T$45+L2jPHPT$8 !`T$,H 5>P5H P5~5 _T$,H 58 5_T$,H 55_T$,H 5$^_T$,H 5D$$ 4|$tu^_[]USWVt$,\$(=05t`5t$D$ 2&j8\XNFd5D$ 51oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=85<5<5u(Q9PY<5NQPS5<5 <5 <5u=@5tP859t31Ʌt AuQP "u=857vA 856^_Vt$t"850v585΅u^V5 5t1<56P 5 5 <5uۃ=@5t莻105 5^USWVt$(PY5+L2PXL2Gtr}t  KvC#:t /tQ t7=2tAL$,u8 P5QP5*[O@랃tPgY^_[]Ã=P5u ZP5L28t!P tx P!Yu$h #ljPXGËD$,tÊ&$< t< s4< w*P5H P5~5RZH 5P5H P5~5(ZH 5Gw/u}/uE P USWV,D$DD$L$@9A|$$D$t1&‰T$D$D%D$ j=L$QkD$pD$$L$(<$ L$ u:|$L$D$ PQV1ڋ\$L$ 5T$)11G5+L2D$D$<$u \$H l%t$l$UPRT$LQT$L$ t,1t}y;@ڋL$ u55+L2=ޱ2\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =d5t1C L$@11ۃ9|$t$ |$Wt$T$RV; WqL$(/<$ }D$1|@uD$P5H P5~ 5ՍQ5BW5MP5EK1ۋl$$]|$ D$EÊ&$< u.P5H P5~5 VT$H 5P5H P5~5 VT$H 5]EuKl$ u% 5L2)5 P5\$\$L$ D$E< w.P5H P5~5 VT$H 5P5H P5~5 UT$H 5]Eu1L$ }D$n $Ip$4&|$tP5H P5~T5R1G>L$u0L$ QV1>t55U75ۋ\$uh$U\$H 5=5+=L2t$ t$(St$ WVdu5=L25)=P5S1G5+L2t$PS  <$t[1@Ftuրut܋ 5 5̀tuŠQ1ۀ؉Hu,^_[]ÉRPh֍#d{)Ѓ55h#F׊t!#u(HL$IQWP55h #D$ƃHQWP55h,#USWV55+L2D$<5 5D$ $5D$$(5D$(,5D$,05D$5-T2T2|$0WhQ+L2PjPD$ P$WWpQD$,,5D$((5D$ L$$ $5 5D$055-T2D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 <5u=@5tJhWt$W y+8t<5HD$EEt< uD$C낉$L$}1A9P5} nRL$ƅ~N$ P5 FK1:P5H P5Q FK1Ƀ=P5 R1ɉƋ$|$t&$< t$< s< w P5F$ P5F<5D$ x PnD$t P: D$tPi=|5$u+L2jPt$$ 55 <5u=@5t˰^_[]USWV D$4L$@-55L2l$)hP#D$P5H P5~5PH 5=L2UEWD$ PN5+L2PM55W=ljӍD$ PNL2 55) P5 P5 iP5SWhL"jP5xt$GF9Iu|$"tjVU0 5A 5P5)P5D$ ^_[]SWVt$|$\$05t#9Xu 9p ux2j0L 05 50505Xxp ^_[WV=05t$ 95(5~?= 5<5?P = 5 <5u׃=@5t赮 505t?9p|<58P 058 <5u=@5tn 05u9q~)q$95$5~ 0505 55(5^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`P5H P5~5WBH 5`52p55515^_[ÃЃ wj PV裪 8ű$<=tuw~;5d5l5bd5D$5l5ØD$D$‰؃AD$$Z|$ T$L$T$|$,&$< u*P5H P5~5AH 5P5H P5~$H $ 5Q5 @5 $Q$ P5$eØt25 $Q$ P5$eØt2H 5P5H P5~$H $ 5Q5 1>5 $Q$ P5$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-GP5PP5=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9r<59tH9u V%8/t Fe%QD$;5<5tF/}tEEGXـxs@<$uokt$蹳tdǀx .u.uN jWt$G t8tG@u@/UPWV5<5=@5tt$赐tWE/Q <5߀xruX@8tB@9tD$P5<5 |x5<5,Ą^_[]ËD$1Ʌt AuQPFWV|$ W蒴@P7WPj7p 8585^_USWV\$D$|nOʼnmIWP)|$SUÉpsx 7u߅u҉3D$^_[]SWVt$(\$$W7C 5L25P2P505jsP5H P5~5k9H 55+L2P{6jVP W7^_[USWVt$FPha1#2HQPP謥2|$Q1ۃ|11E4ӲE9uSh#衩2HQPPR2Q|=1C4轤2HQPP2QC9u1^_[]hQ#rhQ#h|5H |5~5H 5#=~u|5H |5USWVP82H |5t+u y|5H |5~xhP2Ӥhd2Ƥ 5182~PX5hSp' {e8t_82xL8#>WjW訏 !Pjj臏  h#n82p582@1ҋ5  5@@P t 1+5|582{tXAˋ-5M 5~ @لt5أ|5=2t$55D$訢52JD$5H 50~^_[]ø|5515|5hs#USWV=82w <5^t)kU良~D(< t< u <2Hc F5F|5F 5G $9t V  <5t^_[]Ã=@5t^_[]V |51~^Ë82r t ~6u1@1z|5 5SWV\$t$|$<5 82y tje1 82I  82A$A 5H |5H 5H XtK =55|5 <5t^_[Ã=@5t^_[WV$<5jWEƍD$PV}uT#D$ =uD1PPPV  u2jPV蹋 u <$ELF1PPPV uZVI9t:$Ph <5u=@5tCĀ^_Wh#蟓Veh׎#茓VRWh#xV>Wh#dVt$<5hn V?jjV譋 |$ t82H~Q=82pxuh/ 82A1|5542 <5t^Ã=@5t^Z82tL$T$9PuHuá|5 82A 5A5A42Aj8/ 82@1ɉH H$H82WVt$|$ <5|$t=5W|55542 <5t^_Ã=@5t^_锑V582<5Fx PFtP ~ u82Vf 82H |5H 5H 5@42 <5t^Ã=@5t^ 82Vt$ 829t@5tPu^h#B=82@5t-Ã|$t=82@5uH5~P#82@fWV|$ 9=5=P5@2t Pډjhm"蚈@2MP@2hr Pu5@25B苋9t jj1VjƕVj軕Vj谕S L59tQjQ1L5P5@2$s0 h 59tQj5P5@2ˑ5@2襈@21VjVjVjܔ=5@1V4tV'@2Fuh##肛2^_0 hPhu#u0 h_0 hPhQ#蹎@2;D$u D$@2h_1# EX5SWV=5jQEƋPh k$|-1GPhi $؞G;|ۡ2HQPPz2Q 臝5@2tJ<5V[V <5u=@5t/^_[h#菍h#腍 0e hPhu#fVt$ h_1#C^USWVh_1#C=5X51FjPlj+5i5rO@QPhϏ#艝 |,Phi $cE;|ۡ2HQPP2Q WX58tH X5@(1^_[]h#;h#1USWV\$n;%u(sV8V08HА#KSw8А#dS8 5M55At#~i9:0#I {5А#4$D$D$=5C1tQ~H$8?uEt$P uUt$ 7t А#tlА#K\$ueZ*t%tS-tU+E#D2x+;5}#55it #\$1|$ t5^_[]áD2t 5i#뚽#SU2USWV5)i5rO=D29u=D2)5~9ut Ku ]t]tu`ǁTtCiu3itit0 5D2^_[]SWVt$<5~X1tttG9uމjQ虶u|19}q~5@tu ƆH <5t^_[Ã=@5t^_[+55i5rO@Ph׏#g+55i5rO@Ph#LP2 Ph#8WV11Fh9#>kt!Zu忀ރlt puԉпɁuX5tg8tbPh k$Em=2u =2u@X5tA52jPvW:X5H X5@ujDW52 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh\"W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$thS"jD$P ] 5)i5rOC-D2+9tti-;)t RPh͑#jl$ U蝖\$D$P苟$t+,D$0h֑#jShS\$ZŋCt:tBuM ,%Phۑ#jQD,ingD,Runn}=tQ( l$ ,j SP0 D$xxl$ ?S轞l$ ō,@)QPh#0 h`%jQ芕 ݍ,PxWD$P赐݃FD$ ݋\$GHO WH EuݍCWPj$u/1M|t؁Phi $Wx N1MM|FGHO WzH GHOl$  WVH|1GHO W2H ~T$KW衐D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =2$tCt>5@2袅9t%5@2PV"$=5~y\$t$1=5tEt*t t.<$u u/S0=5u WE;-5| $^_[]09 hjPhu#:USWVD$4\$,tl$0|$WUS ƃu8=05t<555D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o5D$ 5$iD$ 9T$tcu tQ=P5t 1=2uL$,uP9tPtu 2P <5u=@5t^_[]Vt$<59tPx džƆ1z <5t^Ã=@5t^#WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h=#W5t$ntpu5D$D$D$t X58D$t(1PPS IjS!A=5u|$ 15-X5~6@ 5D$u}t!AH Et1jPƅt=u ED$u >u G t$EuX5t Dt111D$uD$5L$L$t$D$\$l$|$ 5@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$5C$jU9 L$tc|$tNuJD$1rȋi4ha1#jD$(Pl$D$D$L$D$u UD$\$l$t0~Ot)D$5y\$l$D$tUD$tMjPSx ?jVDžtjuSW =2u V| hŃ퀉0^_[]hA#A{Sh^#6{Sht#+{USWVP1$1C11h#~1it"gu$ڃjt puЉ̉( X5t yjPƅt,1t5)i5rO@Phʐ#4H$t#tH~1i0 tPh\"11G^_[]Ã~1i4h5#蹊2HQP~G ;| Z %PRG ;| 2Z;|lh#yh#yV1=5ujt$ Ot1+^V1=5t. 5~$A51F:uI}^V=2tO=P5tFD$t+ 5i5rOA1ɋ2u0VQh #R.^USWV=5u655~%=5Ft WN5l$5~"55HI}<5tfiPƋ-5=5iPUV覲 ~ ;uKuU l$hnƋ=555i 1҉AJw)׉=5 <5u=@5tw<5fdž=2151B|iP <5u=@5tv^_[]SWV\$|$uƅtt.VSt$W\$<$D$ #^_[G0 Ph#vUSWV|$ P5tW`W4~*15P5455V:V~55l$t$t%t =2ttttk0hWjWjt uumul1VnVhH"%mtOhH"%h#u諅VjuV5@2wtTWj{Wj{t*=2t!WjzWjzWjzu5^_[]0& h|Phu#'uUSWVt$ l$|$1ۃ=P5t/t*=2t!ttSVu5<2tEL$ji4DDt QP ^_[]WVD$t$ N 5=2u=22t=5jP=5~5>f@..@.^_WVt$ 8o<5NJujVj 瀾tW5@2v<u%+5i5rO9D2t ijVt=tu  ρπtt=ttu j/u VG <5u=@5tr^_0 hPhu#rSVD$L$ =2t1ۅ SPj; ^[Ët$1҅tހu1=5u25u) 5~5:tzt Iuh(#~51@SWVt$$1@=5|$(1@$"$&Wh#bjvu ho#h>%tjjvjv 1~ h*#21@^tjs%;thM#hs$jvh%1Wvh@#1WvhE#WvhQ#jvu ho#xh#kjvm~ t+u ho#GhU#:jv <u ho#h\#`#Rjvu ho#hh#7hz"v hv1#jvhg#jvu ho#hT$%;hm#kFp]hv1#P~tF1SwJh#.Sw 1> s#tx#P uh}#h$vh#v#'1#1###1#N9tQha1#jWWSxuF x%Pha1#jVVjv S h#51^_[hJ#hJ#jvUSWV fD$ 5 5l$ 1D$U$u1!" $&]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻?&!$}D$#‘#} uʑ#$%)4$<$zT$tvӃuxu%h>%jVvu^_USWV$t 5 =5D$P 5t x55 $=5z1jh0&S$ `P>;Hx@u8/UD$PVKx D$pL$t 1D$tD$p1ɋ5955tH1 8t:tGt89=P2Z 9=P2~55L2WPV >?#<=P5 VB: fiDle cDhangD ged߉Vv2HQPPv2Q D$pL$t 55E;-51-5D$PĔ^_[]fUSWV<1Uj{D$hhh UPjl` t}9u 苬9È5j Ua 5j,_5h_1#U h#2,$Uh5t$T|$P455xL5P5t.fD$PVWVW(=5 Àu@{=2n$h #85ttQu 5 p5<$B=25=P5(ȃu6xL5P5\5$85uk=85u72HQPPBt2Q hd2tD$P<5=@5tg$$=5u>h #~0&t1Ph-#QPP[V$=2u2 5t N=5uEt$(Vh7# t8t$PBTPV$5=2t =\5tj&luD$P\5u/jM=2tFh?"rhd2Ss*1ɀ=2ˆQPi=2u=\5t4255p5_p$$#uSWVD$8t^<5jP]ƅx jVK <5u=@5t&ex"1=2t=.2t.21G ^_[11=2t 21jLV3V:=2tt.2u2^_[ USWV|$(V11C=05tCn1=2u4t0j52qjhd2q2P =<2t.te=2u\1Ƀ=5 5jPi1;tW1R=2uIu=2t7=2t.h;#pEVu%$uDV#^_[]Vt$<5jV[x1jP| <5u=@5tWcj^Vh#ct1Ã|$|D$pPmmft$虮 thX#act$t$f thX#BcWV|$ W}@PR tWPh^_hX# cSWV|$P29~b9<5؃P tr H2 L2P2H2 <5u=@5t 'bP2<55L2>L2)P2 <5u=@5ta^_[hX#ObD$t L2) P2L2j he#jX 9D$ H2 L2H P2H P5H T5HT5ËD$<5H T5P <5u =@5FaVt$<5H2;t H2P< FL2FP2F P5 <5t^Ã=@5t^`USWVP2<k<5-L25H2T5t|F9uuH2PV(  H2H2+ P2 P5L2=P2T5tG90uC H2 L2H+HH x@WSUP 5L2=P2 <5t^_[]Ã=@5t^_[]`hX#i`D$<5L2)P2 <5u =@5_V5P2T2x'|V5L2Po N5P55L2P2P55L2^V5P2+5P5sP2)P55L2^ËD$ L2) P2 P2L2+D$ȣP5USWV(L$@D$D$@t-΍i11P5ywDGÉ,$Eu1ۋD$"S t Ѓ s^_[S&1ɅfVt$ |$FX5(2Ɓ62u2jX5 \5u 2 =2=2u't#jGtj9t22<u=2u 2=2u2`5=2ut 8-u2(62u 726272uހ=2\5u:u65X5H X5`5jP#`55\5 X5t/t_9tZAX5\5Qt X5`5ȣl5i58t d5Ax@uX5 d5^{h #QUSWVt$\5H X5-t+C11C<-t1Eu{-1Eb USWV1\$@<uPƋtPEu1ۉ]hd5h5=d55l5p5^_[]SWVP\$t$t2uh!%V1C$"hh#^ZI3%(02u*62F#42RQPh#^H#uȡ2HQPPtZ2Q (02t"62#tF>"QPh#h^ u.$(02tPV tuF#VPh#rM<$u#52t(852uƁ62u숟62h#1 _2t$]2t(852uƆ62u ^2@uă^_[V(D$ T$429tuF#RPh#FLt#52t(852uƆ62u숁62^WVt$ ~t)~tP袧 uv莧 ^_USWV jA X5t_y 8-uUD$$X51|5P  X5y8-@P1F Pơd5)<5d5=l5~-h5Ft7ɦ h51Nl51ɋup5 <5=@5[J1F5d5P)ƅd599St<5 d5l5lj4$މt$\$)1*C/5l59rL$ 9v!\$ۋ4$ P; l5w4$ 9vQ9wp5 <5u=@5t[IWv1 ^_[]hە#Ihʕ#Ihv#Ih#ISWVT$ |5tstm8u'1z:trrD8uAÀ~:u"9u X5QX5 tf 51ɉ |5D5X5>1t6?-u1t+O^X5-uta5X51^_[PhM#HPh`#H|$u1PjPPge<5jwX58t PI <5u=@5tG1ËD$Ѓ w#j jPP up5i5ËL$~ND$tH  l5=i5u p5t5i5ht5hp5Qpph#GUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh_1#h#Y J|$:uUD$8@?jPh#Y ^jUh#Y 1|$D$0)@<Ph#hd2V jh#f1?\$D$01@11T$4*l$Pha1#j UVhUhF#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph/#K1L$0L$4@Uj EfVD$ <21qqA1Ʌ 50PQ<2p ]t u 1%<2<2@j* <2 u^qqh<#EPD$5/$aQXUSWV'ơ<2@tu'tƃ <2 x,$@D$t.$xRY$18uWPtG,&uD$tKjD$p*t6NjpV^WPV4 E$ht<2@^_[]USWV<2@|$u <2A1p811+ǃu<Hs C)uj X@Åt"j jtMHXE pXƉōGs1Gt,u|$uq<2@@|$Fu6|$uD<2@ <2Ap8 u踭|$u<2@^_[]jjX <2ASWVƻt u j cpxʡ<2@^_[USWV<2kE1͋ <2x t*5,PqN<2@ C1Ƀ8Qs s j@<2HOH O oKy K9t?U1CSp< &Sh&P= <2HO@ G e<2!^_[]WV@t$P <2A uyW[ wWh>#4&hq#j"Q WhV#j"PQWZuL$Lx4&h#Vh#jPQWUSWV<2@1u 1=2tMtݡ<2@xuUj Y@j@ÉGpj,aC+t<2@tj(pƉ^_[]hn#<2t$p0h#?USWV<2@$ u<2@$EŃCߡ<2@$P&$ <2APUj 6á<21Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjBljF j0G5jGt<2xJjG B u0<2x,u%@&t@/@&uh#jÀ=2tjjj` <2H0+H8O U <2p0j*@ <2QPI H pGu5<2~ hAg%vZm|$F<2xujD$ <2Hu <2H L$ qx0j\@<2HKH K {@;u.<2x }<2x|$ T@0GjG <2@t(HS u <2@<2x\$\$jy <2HK @0Cku<2x ux,uhAg%p贍j@@21ɉH H <2Q0PCAHrAAtejC9t jW\G @:<2@ u<2@$EŃ!ߡ<2@E<$t!t;tj <XÉ{؃^_[]/ uS\$|$<2X0jx@ <2QPI H X t\$|$D$C <2APsVL <2jj 5jj,jj#jj jjhAg%jjjjWV<2x$G Hs<2jpW$ uq<2p(x,u~ <2At8 u @A8 @tHA~րxru\tuՀh֗#<2p0+p8j@ <2QPI H pG .P"t<2@F <2t1^_jjVt$&9u^jVVL$1&tA1B1t A&u^uVt$j@ <2QPI H p^USWV |$$tD$ D$$D$l$E1$<2xc <2x0$t $j(ƃF <2QVI N ~ut. <2I&tAt=t A&u1c<2H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc42 <2A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j<2 $+H8N~L$NL$$N @0FEPqj/vUhuG42 <2+A8FF<2@4 ^_[]jjjjh#L$1&tAt=t A&u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;5}X; 5~P 5I;-u{tBuG<2x0+x8j@ <2QPI H xF^_[F hȗ#lUSWV|$42D$̛=u ?vl$$5L2P2P5G$|$ t u 菛 t19uDp $ tC9u?,$ u42<2HH }AMt9t u>u:<$ t=uY$)jWPX |$l$$uS\uNP5H P5\FÚ u%P5H P5 F42#áP5H P5ƈF tq=v42W=t hh& u42<2HH P5H P5>=L2)FV<2x42+D$^_[]USWV$$1҉T$ T$$D$(542<2r0=&t1$|$ fw|$1/fFn D$j8fNL2 P2 P5=&u ƒ=P5‹nD>  $&=&u f|>z P542Bס<2=&Xf|>LCD>fT$ 豘T!uhЃo茘0N,s05,/L>=&fu P5Bn׍MN|$ @01fD T.fTT.fTT.fTD&fD1AL$!(ljƒ(M P5FD P5BvNO|$?@81ɃfD T7fTD&DfDfD>  = P5\G'T$ t$>Hff P5T$ Bf|>D>u6t${ nMn P5}f|>  P5BFfL D$$D$f|>tD>t P5Bf|>u D>v P5BW P5B*Ã{t & P5}E+=L2 P5E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $* nMnD.=&u P5 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD&fD P5T$ B1AL$ I) NjFfL P5B) 42<2@8xt 5 5$8W Nf|F\=`4" $"}f|  P5T$ BFu6$p Ft$HFu蘖D$$D$ Poſ1۹$&D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD&fDu6t $] FHF P5B}= t]\t 'u t =u 42<21Ƀxɉ 5$6 P5T$ 'uF|& P5F$Ҕ&$< u P5T$ BT$ P5 c蒔,t$@  42<2xD5?&L$ 3DAD$D$ |$}~&f|t P5 P5B\& u P5BNf|t P5B1@D$ P5 P5B݉ý {"XŃ', D$0$ nt$T$ Mn P5B1@D$t$C5$4#U 蔏` Ń< ?\uj\ 0 \$1 HЃ w&Hw ÃHÃéOu M P5vNO|$}@81BfD T7fTT7fTT7fTD&fD荑L$ uk%=I =P5 D$ wF P5P?ˀ P5@ww P5 x?ɀtw P5@ P5W?ˀul P5GXT$ W P5x ?ʀtw P5E P5O?ʀ P5Gw7 P5x?ʀtw P5E P5O ?ʀtw P5G P5A?ʀtw P5A P5H?ˀ)*55D$D$$5 1z&t.P5H P5LjGq &u\KЃ w4P5H P5}LjG; ÃЃ D$ u t P5׃Z P5H P5)=Gt/ up}tkP5J P5#@ǽh#tE%t@Ń:bD$D$$&]¸U1#,W9u袍1|$Nf|uf|t Ms@ L29T$ vNK؃|$ؾ@11fT T3fTT3|3|t3ft1BfTft|&fq fq ƋT$ |5H |5~5H 5 袉ËFD\$D$$&R\Q1&)G P5x?ʀtw P5E P5O?ʀtw P5G P5A ?ʀtw P5A P5H?ʀtw P5@ P5A?ˀa2 P5AD$ ??P5H P5~2G:P5H P5~$_1cݿ:B ˿ˆB1=&nD=&G=&tf|cf|.3P5H P5Z5L2Gf|uNT$ ؃t 4$t$:ŀ>ts4$flT$ )B<2L$H,L$H $衾<2pM tΉ$z Nu<2xĨ^_[]1HE;5} ; 5~ 5>uxkjy1$&tu>tyu6EBE9E0E"EEEA }<2h$ Ή$Zy Nu=tuS$#$ #42 <2A0$2#u$#b$`#V$E#J$#>$-#2V <2xt@@ ^Ãx t#5$@)<2@ @8 42H0|5H |5~5H 50sƃ~0:=F $l& t=uG럃F~t\u^׃ 42@42 <2A0yt5 K5$S(*;|u0d|<2@=t*蒆4$D$D$&Kuۡ<2@1v u42<2HH @1@Q&<2@-<2@<2@&tQ;ub<2@ 軅<2@蠅<2@<2@ o<2@u\u? u642<2@81Ƀxɉ 5P& jjh@" 颁Vȋ <2y8~0 P5QP5謹@ <2Q8rq8^USWV\ӉΡ<2@D$ 1,$45D$&+L2D$$UP<5$~Sʼn$S5L2PS l$|$tD$$45 <5u=@5tw42D$-L2P2P5<2x t*5PL%<2@ hǃ[~!\u9Wǃ[C tJ$Q u"42<2HH s`un=ub\tX`tS42 <2QQ NDt""u$P5H P5~E\E \@ŋ P5AP5ȷ@P5H P5襷EL2@|$t~P贴t$jPU D$pŋȅut$ j艴E<2xtH@1D$42D$jNǡ42D$Kt5 <2At$ D$AEx<2@t$ Ex P29ًl$脵 P29~=L2P5t1SUW:Q )P5<5UPr $ <5t\$=@5\$t  <2T$ Q45Nf|u%Du P5QP5@Vt$+t$ P5QP5ܵ@~.FP5BP5ȅ踵AJ։ȃՃ\^_[]á<2L$H0h|#WF<$t 4$Qq /<2@D$45jP=jj#jjVtQ q N^V <2_1#ytA55t7t u(55542P55#^USWVt$,|$0l$UDz5P2̱1BW;L2u(V.G59w&5WVSO U覲^_[]Áw: t9v$P55hj tã5$5랾ј#뤾ߘ#USWVT$L$ -45蚂Ɗ.2P5D$1|$0<2D$|$ljWLtJD$<2.2VQ-45D$P585_1#jUK\$t$l$=451F5P5D$0<2$V\$S zVh&P <2A |$t|$t=2u #@݅u:T$1rIJ$JB .2VVRM -L2=<2D$.2t$OD$45D$P5؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV 51t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 5tu(Mxju PQ.Ex P U|m uF^_[]USWVl$ t$\$|$t|h@VSE VSEDžt9u 9t SA 9u95H2}5H2^_[]Åyq05 PVSh#9W WVSh.##USWVt$ |$\$l$j茭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!j8@ 5$5M|$];5}; 5~ 5Eu9] u5tX9X55t-pt 9^t6SLF9t S 51tF9Yt? 5tHt 9Y jjSE PkD$($@t 9XjS1x<55  b5 59|AQjS ǃt;=H2~=H2x jjW j詫$JBXxp <5|$u=@5tu5t$(WUN mCSo1O ntuK55jS DžDo8t o8ujjS Džn0D PSh\#I\$t 2x2|$t 2x2^_[]j  PShY#n0 51tT$9Qt uÉVt$55j V9 u 5|Qj V u8FPj V u$j j V ujj V t;H2~H2^hc#V WV|$ t;G;5|.GPSƋG9tVPWww^_WV L2 A L21F |71FPWWO y w;H2~H2Pgfff  5^_USWV$$$~<5 8k$&n  5t9i V 5tQt 9j b Y<(O8=2tNnjUƍD$PVN#D$ =nhh]n$SUHoƅtjV!SjV $/nhh nhh U ƅV;5H2~5H2|'u" 29uu-jjW3 9t1jPWV <5uQ=@5tH A1jPWUy v j0P} PWVPW" <5t Ā^_[]Ã=@5tĀ^_[] hh j | PWUh# j0| PWh֙# f1F55`jV0S PUhn# Dj8V|4j85#jj0 PUh# USWVP=xa|$\$;H2~H2oU#= VUS 1jSS t!t$$^_[]hl#4$1EUjfUjfUUfUjfSj yfVwt$ g SgVD$55<5PV]5V%d  <5t^Ã=@5t^1=5SWV55t4|$t^tCx PjV6u^_[SWV|$ H29|ȋt$|9}9| H29tVjjVW 9u^_[ChW{Sz PVhJ#WV5 |;5| p5t$ Pj V y2g8t g8u>5 jjV ;H2~=H29t V^_Vj 苣tL$ T$5505PH^á5tT$59Pt uP^b yUSWV$|$<\$81D$ $D$1F5<53h#WS>0 !1tbhG$WrQh#W\Quo1<5tE<545_Z 5t jV <5u=@5tF@u5>h#WPth<"WPt D$1p@|MD$K}h%WPt8D$D$h# j521CKD$D$u}h # v11 t=t8<5u.u h#v VaPh3%  GF@uh?"A F@uu=5tk1uu莩ND$E11P@É|$t<5tW45h#Ah#<5t45 h#{SfPh%@# Eluh#52 Cu|$tE1F-<5D$t P贘1<5D$t45~W D$5t jS< <5u=@5t2Et h?"11<5t:58u.u h#aVLPh3%   GF@uh?"/F@ut h?"1<5t?58t3h#45VPh%@#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=5t61B=P5tbu^1Ƀ~7t@tuH1=24 5t1Ҁ9ƒ (u1=2B1ɉσu1B51t)9t`tbփub1^։PjS5Y $u=2d1@ָ PS Wt^u5u jS誵1D$ D$D$$K?r Y 1@ jPj ^_[À=2u=\5u =2=21@V<55>t8t61T 5r5 <5t^Ã=@5t^SWVt$u 51ۃÿ5t658t+<5SP <5u=@5t5=5ru^_[,^_[V1=5u#51A:t2>u 5r^WV|$ X05u"t$=<5tg=,5u^@5WuS =5tӃ<5t>58t2t-0505=2tu=<5uW0^_WV|$t$ 5uWVj5<rjVTuƆ5^_á85=5t1Åt8uUSWV,51G05<05u@@uu05=5u΋45tã45ST-p5VjPVQ !t<$tS--p5m ,5^_[]ù@rA<,5tøWVt$ 9585t)1Wj;Wj0Wj%585^_ËD$<5@5USWVhD$=<5u@5)=,5t45t D$D$p5@5p5=05tt$,jV舨u 545et$,jVju4545=5u%=5t?t15PWt<5jV!u545Bjc|$wfs 5@5S1ۍD$X XXPj\%SWR\$\$ \$\$O?r T1@ DD$jPj VP/uf52t$WVt$|$ ?t*FHN V>Qu952u V^_52t$WVt$ NfuD5FNtF t0fu^~<5 ?NQPޏF N)N<5v衏F FF <5u=@5t V N^_Vt$F t-)t'VfxQPR yNFN F^52t$USWVP|$t$j'V!%t~th#Vy <k>t!hh&V|1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=2uUWMGHO W]H"WVGHO W3H"^_[]WVhh&Qj'V##t)19<>^_hP2ohd2bUSWVD$~@|$l$1SWU t P8tF r)~1H^_[]ËD$)D$<5\2tP{K 1\2T2 <5u =@5>PD$L$ T$$RQP XVPt$t$V誩 tt$ P4$ K ^h#QPD$L$ $QP52 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+5+T5Pqq h4#jh5)q5SWVP\5&C PVw u,$$wCGσCGCuh5VhU#8 u*$ 5555^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')<$5t>7t9^ uSUvr t61^_[]ËD$t8SV foƋ5`u5$H 5`#tY#$#tT%5㟉5t$D$$.# ^[WV<5451$|$PW=t $D$PL$LT$H=45PQR 545$<^_USWVL$T$tHtA|$9t91&Írjt/9t+1&tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UVcƋ $A$~ C@ $Q$f=t @UPeWVp ^_[]SVhg#WV<545P5$|$jWўu"D$LL$H=45P5PQ545$P5<^_USWVD$ èu|$=^2uÍD$PQW Ƌ@<5Nt$݁ uF @SPуF`u vAF F~tuF1Ɏ! s%t É^~5tp5u5t jK~ <5uk=@5tb[r2jXxL$H @ $  $#`uWnE `u W^E fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=d5u0@=\5tc@=5tf@=2ti@=2tl@=5tp@=2ts@jPh#,WVt$|$ <5tw蝅VP? <5t^_Ã=@5t^_CWVt$ t|$Wv 6u^_USWVP\$<5jƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR賄SP}j=SzS苄UPu< ؉G@582582hX2P" ~ F1gjt$5uQG L$<=u5X5HT52UjS $81F FFT55~555 <5u=@5tw^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ 5t8Q12<08uF=u =ut j=RF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWV$51tr:1҃Љu5r׍P节ƻ$5Nj+t7Mȃu%EttUЃuEmŃ5r^_[]SWV$5>tLGu% uw@ Gu#W@ @tw詁Gg;u5r^_[2SWV|$tfh#WWo9uWh k$V't*tUj'Wt8)WPh# h# Gh#Wh<%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhN$tUhN$>=uD2HQP~ j( P 2j)n~=uGuth#EU2HQPP2Q ^_[]USWVP5u5 h5T$ t$\$$51<$?tIOt !T$ ttуt݋ 59|QPYT$(5%5)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP}I1>?f u%PVo1u%#L$1PVʻ1t1Ʌȃ|^_1@Ow$h&1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$O\ t$D19{USWVӉϋu5fx@$&$PWO1ۅD$PV7r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW耹1ۅD$PVh$L$$t$<|$@11$;D$D9t$ aZ$PW 1ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVW*1ۅTVW*1ۅfVW*VWq*1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]F4Q9-u1tQyt8ytBÄth#Qy)&t1h* jjh&Qh* jjh&h* jj h&R#SËD$L$  )VL$D$ 2)u AJ)^USWVP6j PV>i lj68t"6ځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]VhΞ#Vh#USWV׉Wt 9Fup  ^^9uM1PP~ōP rPU~ LH;NuS 1 #~^_[]ÐUSWVt$(h_1#jG D$,^H $x?-Ok-u)sstdluu~xwGWWÅu"3DHt'1Ʌ S膐كh#h3DH\ƃ~ƀtV tV[Vhߞ#jރ $h6&ST&1Ʌt:SUu+$891V52V|-$K$8ʉT$h%W%1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWDu.%|" $4Phn% 1@D$l$t jWK3j D$PU ljӋD$9t-ف8ur1u 38tQ"x_1#UPh?# 1@D$\$ $4h#1@D$F \$ t$|Ph#jg5PPPPhx#522jDWVPΉj WQ 9u=у|=}^_Vh)#jhQhV#j52jWV@5\5X55;=>t)j=WthW>uPPha1#j@VSjVhN# Vh2hb" .#VWhF# R#tT%VQh.# j,hS#h[#q VWh#bL^_L=85t 1|55?<25155595tj=5u2P22d22tP+ 2Vjҵ15p5><25595X2t`2@8@u jR<5jD,5uƀ,5@u <5u=@5t^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$&$&Vw vVw d_ t"Vst Vw?wLN@F1Vw q#w %N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u&E$&Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t' Ã|$' USWVPu }552f`|j%v|h O1@ 0D$,5|$@t$(q%v>%L$ h#V貂<*u C h4#S葂1N .u{*u{ 1HD$Ch4#S]1HD$  t$CD$'C`L$&~QF0 $& D$׋L$ jjU D$tfL$tjWt$QPh 5TFu$&5l$@؉L$ <'t<"u31BU T$4D$0l$0]D$Wt$Ph 5*5L$ Q0&|$5H 5T$ e l$=5uM|$L$ jLl D$tbL$l$tf|$ L$D$$ 5gd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$ 5L$\$L$$X8G505 ƋL$ cjlm |$D$VPt$w55551q  5 5Wt$*|$$ 5 \$$L55t P# VP5 5҉D$xF\$wZ$@&a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~VL55T$t P" T$55t P|" T$15555Љ\$H\tF55X])P0tXM\$u/^t-u#F55벸^tic\$>T$ j55F55{ 31:DYt 7GuF55\$DF55ȋ\$+1L$ jlTD$t1L$t5WQgL5L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h 5 PRQt$QP  5FP+ 5 VjxP! 7s5T$t t$L$ t PVRQh5SMT$L$ t1PRQh54.VWh 51PQ*t$P PQh5 t55T$z \trB<]*<0tu$& ?$\&."'#Eu uSh#5 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hˠ#q5\),ҋ4$u|$ uWh#A5 ^_[]SWVP50t?5= 1ɉQSVP NjrVhd#1^_[SVˡ5H 5 u:2Prp~r0 P2Q 밅u5)2HQPPx2Q^[USWVP50t#5<'t<"u1B^_[]11$71ɉQUV ljӋUڃ^_[]SWVӉQ?ǃArVh/#5GPVh 5F D$ 5 5Ƈ 5^_[USWVP׉1PPPŁ ,>U@PUQ詁 xt-9t)VhG#,1@Vh k$׿1H5$^_[]V΀:t 9t-VhG#+8"u3j"l0 PVhu"ʿ Rh|#躿5^fUSWV\$$8l$}hE j jh&U9ƅu!hE j jh&Uu9ƅH h] xXh!#jhnt jxh*#jhot jxh4#jiWV|$D$ 0G@&Phl&luTG8&Ph&Pu8GD&Ph\&4uG<&Ph&t G,1@^_1USWVP։ϋl$\$t PWt9 u-uG1ۅtJL$PWtu*C#EE CF|$-u#E EE1C؃^_[]USWV$$UVU 9uVh#7PVh#7 ƃrk$$$@PQh #f7 tUh!#P7Džۋ$tSh.#57$t j 86] =P5tj "6P5T5:#w %uA#YwxI#=w %u O#w؃uW#D$w؃t]#D$ud#؃L$u k#D$us#@D$u{#a D$u#B D$u #"D$u#D$u#D$u#D$u#D$u# D$u Ĥ#i]=P5tj 3P5T5ͤ# D$uԤ# w %uܤ#@D$u#D$u#w %u # D$u #w %u #`w % u #?؃L$u #&w؃u#D$u#D$u%#D$u-#]=P5tj +2P5؃T55#wu <#jw؃uC#LD$uJ#-w؃uQ#D$uY#`#u=P5tj d1P5T5h#w %u o# $& v#u D$u ~#Uw %@u#4fD$u# D$u #D$u#D$u#D$u#P5tj 0P5T5#&tX&|$FTPSh#jdWG/,^ u΃=P5tj /P5T5tj |/P5T5&1& tN$L :Ntl Pǥ#PSQ.Ph #h3- j"fUSWV$$3udh_1#j ^`51ɀxo d5$1E1D$ D$D$D$D$D$jh2h8#SV Q~e~/ftOhtdvl$ǃK!tTHu]1,$뱃Rt&l$dt`LtPuV$1댉l$놉l$ $rl$i<D$[u3)t u |$ul$ u1Ƀ|$!<$t|$g41Hh5l5|$uσ=d5u0uˍD$PW4WhT#j:S5u&j.SVt"hh5Su @ t(<#thh5SuٺQ$h5=d5t D$4h5D$8l5jWV袂 u h:%YP $uf804$% $HHIf $P&ujPV |$u^V袋u랋xp ^ PWhu"; xp D$8 PWhu":D$ 1G<$`ǡh5|$t*tOP9Aul5OPt9Qu A e5l5PwӃ t"|$uwh k$f1G<$0|$%w^hO%jhA#j`5=d5"t#PQPh#h3)jVt)<#tV# t@ "l5^SWVP׉>#uFj PV{3 8u$8u؃^_[Vh k$jWVhv#jUSWV f`6p5. X6ƒ X6t5 X6€ш X6x5 \6|55hB=#'t hҧ#t8ƿ,&#PVtG uVh#j $$1ɉh#SU P6$&5kj j5< 2 ƃu 8"5p55v <fx5Wj j5<1 ƃ _%5j j5<o1 ƃup8"G5t55551A5<5<h"Vtch=#VK55B55/x5#8"tD5|5  9u|5rCjh#5<hr##Vh/#5<hY# 5<h@#jνu h# 5t 1ҁ‰5X6փ95x5u<9t5u2`69p5u#\69 2t 255=5u\1ɅQ$hߧ# 3=5t)ͅt=5ut 1jhh5P4 $yh5h k$j莼=5u1D$(Pt$gu#D$0=u 551N1$`& $$hּ">"t$hDZ#Qh?%hV9 VBthV"P$Ph k$5@5 $=@5=5p5B=h{"t#t1@$$Phmdt$ hh#h|tWAWh%# $=85u 85 =<5u <5 4$h5 T5 $$1 uWhPh5p 15555tjVh5 h5\ $RhSD5h5VW0 55VWF5 Wl$t$D$ 1ɉHHD$UD$ Pj  1Džy#8#Bjwx߉DžVPx9ujUj赑 1|$nh{"$P!<hjh5p ^ Wt $hԱ#]h\3`3H 3~3H 38h3ljt9 t43H 3~3H 3h3ƒ߃NyjUj衐 h"d15\3h5VW4. 55VWj3 h5dtd($Ph k$$P>1@PjUj 'P! Phz##tǍ$PWhn%VSD$uh E"Z$P>$jPhb#QQFƃu W VWVθJ#D&PVt uVh1#j苶G x5t5Gp5G|5O1H6t^_^_WV΃=H6 L6t>5t49t0=#=#9t"9t"QPh#. 55H6L6^_SWV# &&VSh#h3?"ujVPjj"P th#.1Q1&$ =uh4} jj"t$ /1$4QF"u4$ 1@^WVκ u1H3 r1P^_V΀=5u6=x5tǁ t41t)Ph50h5hedAV xk^Ã=x5uǁ Jt=5t75t.h5hedAVp th5hrdAVY t=@5ujVh1#j:hB#jUSWVPύAPjh#h\3"Gw4|&h##Ph*#h\3 \3w(h6#V w,h=#V w0hD#V w8hK#V w4hR#V W4O<W8#9tQh#hY#h\3s_1#OHtQPhb#h\3N_1#OJtQPhl#h\3,_1#OLtQPhv#h\3 _1#ONtQPh#h\3_1#OPtQPh#h\3_1#OTtQPh#h\3<$f$1۽a\3Pjjh#wVh#\3PLwVh#\3P5GtmÈJ9|6{u;[tVPWh"#:(D$(ffL$(D$ 1ۉa)D$u!)tPt$hf#'L$4 <)ǘ΋I<9vt$h#'$N<.”T$9vt$h#'$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#+' D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( 85<5t$(L$QhV&  D$ 1h#V tG<$h+B#VG4(1>tYj:WRD$AL$\$h+B#SF,1tD$h&WtkhF $WhQ#W\D$Phs#W D$q;|5ef65ujh&l$!U3 l$|&1tUPh QF&r܉1hD$ Pj <$Wh#3%D$ D$t$ <$}trÉD$h"U t:h"U t/h"U t$UWh;#$ F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh[#G$D$ D$5FʼnD$uf55l$u D$l$l$hR$Wh?%Wh#Wh#W~hβ#Wh h߲#WRh0}"W<Th#W&h#Wh #WUh"Wkh#Wh#Wh%#Wh0#W<w ~W|$WhD#" T1<$5jD$<$rt$Wh#]" D$f5@<$Wh#@"|5f65jUh5jUh5蔾 <$t$ht$0V+" J21jD$ Pj< D$5뜉1jD$ Pj D$5q1jD$ Pj uuD$5J1jD$ Pj uND$5#1jD$ Pj u'D$51jD$ Pj^ tt$W|$Wh# D$51hD$ Pj uD$f51hD$ Pj uD$f5a1hD$ Pj ^D$f511hD$ Pj .D$f51jD$ Pjc D$51jD$ Pj8 D$5; |5sr"jW|$Wh#W|$Wh_#΍L$$ t$@5|$T6L$$ L$D5t$T6rh+B#V?l$}}&1ۋ>t.W Lt t uPUWS  Á4&r D$3MDHu D$"91hD$ Pj t4$h#}D$ \$"r)Ut$h#^ h#QD$1ۋD$L5ND$L5WH4(t$|t%h+B#V> L$1Ҁ<tʉT$D$< w'<$$&L$ L$H5<$tL$$L$ L$H5|$T6cL$$t D$|$T6L$H516FL$<$C fF|$T6L$! L$H5|$T6t8L$$ D$|$T6tL$H511A<$D$ h51D$ ȁ(^_[]4$h#D$ WVPθWEV505f45h5 f45=5u=5u#$}h5hgdV 1h5hfdV y8t 8uv$=5u(PhmdVn xX52h}  1=5u$h5hgdV2 y #1G^_ù#h# 뙃=2tt$ t$ t$ j !1HVD$ t$=5thPh5 ^D$L$01Vt,uVh­#-t"uVho#Vh k$詋Vh(#Vh#^hP6hmd52& USWV8 $RPh hD5Q蟀D6 5v|Pt$h#5 lj D$T$1D$ XƉ 11 ‹l$5 D6D59D5hWD$Py $;D$_1#=@5t =}t=}uЉD$$#=5tȋ 5=WEVuT$tf9|5rD$Pftt=5%4$t$Uh# D$t=VEW=5$t=VEW4$t$UVh#=5|4$t$UVh!#=@5$D$PSt$Ut$VhL#=5u $h5S\3V 55SVI SGSt$VhVWͻ @5D$ L$D$11t4$h`#谈8^_[]USWV T$ $11F1Ń=5|Uhʯ# QPWD$Pt$}9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=5tUPh$# Ɖ ^_[]Ã=5tUh#脇=5tUh#~ċL$T$tPh511@Phl#舤t"j QP u 8"t1Ht51Yh|#j誝Ph#?t"j QP u8"t1Hp51Yh#jaSWV։ϋ\$+5tItEu51tGtBD55D69w1D5 1tth5QA1@^_[VhD#j薜L$1=x5T$ PG1ɅɉWVD6~( WRPhD5Qz D69u ^_hu#uQVh#jLPQVhư#j USWVPӉ΋l$|$uj WVM EuK"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h+B#Vc<t#ƍFh+B#Pg41|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Wh#1۹T6؃^_[]ËL$9/up5D$\$A/jPU u$D$ 5D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#T6!Wh#T61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#D6D$$Th#Sut]"&WPWSJ '> uۀ$U-$T14t&D$XP tpC"uD$TPh,#$T$끹#t&j" $eFMu SQЃ {Shȵ#h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h-#}/$PQhF#R~$ $u ~ˍ|$@WV9t"b&J~PH k$4&1OJH w@$\& W&B(D$ D$$l$ CtGtngtbcB8D$D$l$cW&ɋB(D$(D$,l$(BW&ɋB(D$8D$<l$8W&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=h6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph#uh)#h~USWV|$t$t$hZ"V Gw4,&h]"Pha"V GPShl"VwGPShx"VdVjjh &蒞GXtVjj h"yGXtVjjh"`GXtVjjh"GVj |w(h"V w,h"V w0hÅ"V w8h؅"V w4h"V wu 1<1A71Au01<  $jj@PD$PT7D$ Ph k$bC9u<$u4d3H d3~\3H \3 h\3j 1^_[]h׼#jffUSWV $ $ D$-@1l6p6l6t6x6t6$|66|6t$ h#US{ c~!P$ & 6˃PtdT]=<?1AJ5<56뒹 .<|6h_1#n 6b 6D$6T$:@=l6l<D$ Tnt uBxou D$ 1Ɉ 6h%Vtl6h_1#`ء<$j:WC-t6tWuϲtmt6S c$ \W6t6t 639$ 1ɉL$tVh$Pϔ tj/U|u Uh"h4%h$ UV/lDžuV`kDž7h$P_ Ƌohj#W豱t(h]"W蟱th#W荱pV 1QQ$ 4PU7L$9C9$ $ 9tUjlj?,$u1QhD$PQV h6hzd@P9 tq$ PhedAW W W|$ WxD8$9",&uWVD6,$h h3 56P Ġ ^_[]h#j{$Ph k$j{Vh#j{hL;"h9"ʍD$ Ph# D$ Ph#j{D$ PhϽ#롍D$ Ph#땍L$ Q4&h#USWV։ϋl$j, V衘 U薘 CCCOK G^_[]h&PhN#h3,j"USWVP׉΋tAS}vWrv4$4(VS/ Wh)$Vt$ P W É^_[]USWV|$1_hj#S軮t$h]"S詮th#S藮u\l6toU3{t[u=6t .=6t%|6toU3Dt [u^_[]USWV$D$|$t6_1#tW3t CÅush%$t$ ٭uD$^.%D$ 6t L$ mt L$ ^$D$ D$h $$ t$ht*%hVv$0|$D$4$L$h%Q1G@΍K9|,SP. Ŋt><-u(GD$tj=V t>FD$ GD#th%D$Pu|$1F1B,$֋$$$,$D6tP_1#tX"P$h'# xF1Ë$4h3%C9uj 3t2ƅ|$t t$! 4$ tA710h7#`|$t t$ 4$ ^_[]ÍD$jPV" x!L$ȃtuuh[#`묁tlP PUhu"g 끉 6utD$P$buW$P$u_jҶSVhx#&_ j輶D$L$ d6h6ád6ál6VPD$ L$ $3QPV Vj jUSWVt$谷8h6ut5d6h"h6l$\$=p6t!u5d6hn#p6US|yW PhLQ$h6ttj h6tu^_[]Ë5d6肵PVh|#F jPD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj j<USWVul6$Ph V%.6$|hWV M t Ƅ|D$PV51ۋD$ !=`= بtLVa0h$P% Džu6ht6h k$1 Vh$P裦 DžD$PWK5Vh#Wh#ue^_[]Ë$3D$($3L$$ ul6Vhht6 t9Ǎ$PW4x#$= uVh#{Vh˾#pWh#eUEM JR\tHPQh # t$t$h/#hht6Jt6]á6tjЃj ײWV 01Gj0h&WI =6jj,0^_SWV01GW?"tH#Pv vvh#h36 Z$SWV։ϋY Wss ss҃ 6t~j d(Wss ssԅuA 6^_[ÐWV1t$|$ ɉ @4uAȉXȉX\ȉ\ȉMA-A A PQ40@40<8@<8D@@D@LHy@LHTPY@TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40?40<8?<8D@?D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7?Vw w>V Fww>VFww>VF^_USWV\$l$EffEffCEffCEffCu ux>S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu=SCuu=SCu$u =S$C EDȉCDu,u(i=S,C(E@ȉC@u4u0M=S4C0EHȉCHudh#VŋFNX6tbSQP X6x 6~,=6tffOfGG@ Չn,~$N()ǃ~$N(=69<$D$hP-6>N,ș)N,)n$F(teh#V$FNX6tbSQP X6HT$<L=6tAf=6t4f.<$ ^_[]p66F,)F$N($fOt@ p6븋D$L$t$ QPQPUSWV$$$ $$$(hN$SV\1j ˾D$SVWUhP@؃r_6956rPSV Pt7=6tf%ټ"=@to-#WQh.8%d Whp#T^_[]USWVP|$\$s s@=6tf9uR6t=6t=6tj:D$1PPPs sQs s6O63C 63K u 2&=6tf%ټ"=@to-#Qh#胣s s/)SUh# 6u =6t:yj h#6th #=6uh#u=66t7t;f5p6D$6jhy#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=6tf=6tGfټ"@to-#Ph#/SVz.=6t)1=6L L h7#h#{$p$l tRQf@ 66 1VW 2L$@D$DD$ t$|$ 6pt956tʋ 656T$Htt tɉL$LL$QPh#=6uh#515IJ2PPPj66  52RPjjt:6=6h,#&D$L$ 6656=6 tYjj=6H6tt,fI=6tftfI=6tfIfHVW516696t-j 覹 66 djjQP 66 AQP=6tf%=@56568,$t$R=66 t# Fjj WS:69ݹÉrFND$P9|$P$d닔$hjj RS5 )ˀ0^N9wh #訞h>#Jtf56615IJ2WWWj66 CRP52jj_h#hI#1p61P^_[]Ë$d#6 6$tҍt$PtV$lSUQP4$SU fH1G@u5656h#SUu.$l#$pth#5656SUq5656H=66fA=6fh#p6hj#h?"jj5656D$DD$cL t$\$ VS@@PD$PQVSf@5656tfA=6tfA$l$p!fHG5656mf@5656SU5SUh# t$p$ph#觶 =6j 谵USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ`6@4 1WjPQWWRS 9=6f2 6ff2=6twf2 6ff2=6tjf22f 2=6t2ȃ=6t]D$ Yf2 6f2f2 6f2f22f 2=6t27D$ G UV=6l$$tApQt=6tRP&A(=6t1ҋ `6I4-X6teQRP X6xtt$V/11jWp7 =6=6tf=6f̲2`6;x4})}jhȲ2W7 =6E `6A49rE =6t<$fGj \$l$u6_=6tf1UVufXUVW! t$$\$$SP8tt$$S>8UVW! UVo#L$$HXH XQSߊUVUV8u8|$$$X=6tfUVfXW|$$Wf@t$$W=6H6tt,fA=6tftfA=6tfAfH ^_[]UUSWV$$1Q 669;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=6pt$ =6t ɋ=66L$xtt tɋ=6561L$|1ɅDT t$t RP#56UVRPY~ tE{[|$t}SW"ljUVSW~)SW"lj_{[ |$t]SW"ljUVSW})SWu"lj?UVSW})Ӌ$xX#UVSW})Ӌ$xX D$4PS $$W$VWVhPWV 61ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =6t SW! `6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p8/  D$HL$D$ =6<$\$T$|$(t$,DpLtL|Dx=6RS TtDp`6D$0X0vv RPq VFvv]  RSL VFt|tx|$82 D$T$Rl$$D(D,=6tFB\pTt`6B0FN FNDxD$L|׉L$L$؉D(MU =6t]RQ `6I0VPU EMhɡ`6@0 ȃ=6t3ȃ=6EhD,t($`6@0MU EhEhD,=6L$ tL$D$D$=`6,$\$ 1QOP\$  t19}#8@#pLp0l$$ X6ɋD$taVt$P9 X6x4ƍ$56pSc `6@0fPt$t$ X6x56SpAc 6=6tf؋6f̲2`6B09}+^jhȲ2S/ 6`6B0N9rF =6tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL X6taPt$t$$ X6x=6t$,|$(DxL|DpLt1҉TxT|FN=`6<$096QP)RPVF^vv )RPL$(D,D(D,EM =6\$QP `6I0)RPU EEhhȋ5`6N0 )ȃ=6t^ȋ5`6T)FN^FV )S\$L$4$*5`6V0)EM Ehh )ЋL$Ev8QS p61Ą^_[]ÉjhȲ2pN- $Ph#k=6thF#h#ۻF & `6@0 1RRPQ$$t$Xt$XE D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lF6pt =6tɡ6=6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwM>t~1F=6tf)9F=6\$tAf)=6t4f=6t'fL$=6fVT$Rt)f~T$JR>>fD>=6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=6=6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=6t Vt$t$Ut$h#21Ƀȃ^_[]1A=6t1=6<$\$ HfUSWV $8$4}tE1ɉM4M019 6‹DT 9 6tRP=M$U(E$f M$E$U( u ^_[]%=uLI`6(9‰|ǃ=|6t<|u=6tFNFh1 t6tD$hVPZ |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =6t RP? `6I0VQRP։D$D$ ЉT$t `6=6Q8k=6L$$tL$D$ =6t QP `6#8t@DQL!!IT u‹$8U t#DT tE=6t!RPZD t(=6t1҉EU}@U=}@|$p6EM QPQPh$3WWhR#聇hv##uQ{u u `6y0ƃ=66t:tMPW?UUlCD$T$NQt PWO~V ~V hJ#6\6@ 뛋5`6F8E -6T$$tT$D$ =6t RPv0 I)؉$ʉT$t*DT tZ=6t RP$8D t6=6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wp6E$8I QPQPh$3UUhR#薅hv#8$<t7`6Ht)$|$-6Cq qƃ=6t0FV=6|$$tJRPe)RPW4FV =6|$$t&RP5)RP')FV )FV hJ#b6\6@ USWV|$ \$t696a$6 6 ‹-`6t9ˉrux9ˉ\$؉jL$QWP*ց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס\6t`v0WUH \6`6pxjV|$(WSj)Љ 6$6=6jVPSj \6A^_[]WSh"#\6@ USWV$׉ν# y@tnVՃ2v vv $<D$$8D$`6p0vv[ $G `6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP"19rÃ=6$t$ \$ti=6t,ۉ~A1_t4T\$F9uۉ~1O ɋW @9uG W56茲t$ D$xG, `6;Xt|$#=6t JًL B tmt$v vh)#hWwWVt=6t$$B1ɉL p6t$ $$Bt$ B C`6;Xt`R56贱T$\$1ۃ=6t%JًT tN=6t#RP Bt/=6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbp6L$AI QPQPh$7WYWhR#hv#xT$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=6t+FV=6tGRP +D$RP 1FV =6t*RPw +D$RPg +D$ډFV +D$ډFV hJ#6\6@ 1@$5USWV\$41F~3|$0l$,|!6 69|)S9у} ȃ^_[]Éދ`6K89}=6tOI.A!1‰9)=6l$,|$0t!t$4PWUh#ޘ`6PVWUeNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=6!$l$|$ T|$0tN# $ND$T$RPWUh#— `6<$\Ttq!qIVPt$ Sh#q$@l$19=6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh#`6t$Sh#1Al$,|$0USWVD$,\$( 4606փσ506=4611 J <69866 D6@6(69H6@D$ H6=`6\$jD$ PL$QT$R{ց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =L6P6tX68T6T$t\6‹D$ȉ@6D6`6WUS5`656谬=6l$$-@6+l$(=6|$`5`61VV=6tf%=tjvdv`HVdF`vlvh4VlFht4TCut4TCuG9a=|6t< `6(1`6SS=6tf%=u1=6u(x$CS =6t RPa9Ƹs& ɉ @u ɉ @uG9wt$t$t$5`656衬`61Ƀ=6 (6^_[]PShB#awUSWVl$|$`6jVUW_ 1ƒ 86<6$6 6=06-46=@6-D6H69`68#{H1ۃ=6(=X6-\61L6T6ډP6t@L6 -T6=P6Wha `6t^_[]UWhe#Tvh#Jv`6t Pi `6USWV l$ =61ɅDT =6t RPe `6Y0މD$ʃQSRV^ wÉD$4t,PX 1ơ|6$6QPt$0t$08^$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ 6; 6u3P56b =6t-66d 66Q64 ^_[]h#\tSWV|$t$|66QPWV\tH 1P1 t^_[WVh# tV|6tR 6~%646{g ;56s|6Pbg 56Tg 16|6^SWV\$t$s sǃuG=6tfL$%ټ"=@to-#RQhn%t s s=6tfhi#66{@t1H1PPQQsHsDs sq SW=6t6hh6WEE -h#荠u7=6{놹 (6s s\6H p6^_[WV|$t$ WVh#C C69560WVh# =6t7=6pt=6tPS t 0hN$'=6pt=6tPhv&蚍=6tfPh#y=6tqPh"]1Ƀ=6DT =6t RPRPh#' =6tF(F=6tjP|tPh#^_SWVD$H8=6t3P PP0p4u'11C9}QBRQp<:C P0p4^_[USWV|$_8+t]Cw=6RMT$=6HRP?9L$0ơ`6@0 T$D$=6D$0T$T$4=6t$$t RPMt$t$$=6tȋMD(`6@0T$,‹t$(΃=66t+tMVRxuVFt$t$ _7KVRIMQ AD$:MQqD$T$AQ!EL$DT=6t1ҋ `6q0RP| ƋL$ jWSQcHӃ=6D$ t7~SPt$t$$?HNjT=6t RP|$)~SPt$t$$H=6tȋ|$1҉\$$ t/f `6q0RPُ xËD$L$ L$0|á`6@0 T$ʋL$ȃ=6L$0T$D$t!D$4=6t)PQD$ T$8=6t@ɉL$ D$ =6t h#X=6t h#Xh3#X/=6u hW#WX=6u hu#W3=6u h#W6=6u h#W<=6t=6u h#WT `6|$Y8֋T$  SP56565656h#Wd,$kdы`6@DWSQP>D$T$iщډWSURq>jj RPvRPt$t$t$t$t$VD$Ph#"q$=6 `6+6 66 66 6 tQPhM#p =6-`6KC)s, 6-6Ջs4HS8\$ ډD$$+6$T$6 $ $ډ Љ 66tRQha# p =p6t8hv#o5p6tvvh#o 6j n=x6t8h#o5x6tvvh#o 6j n15x65p65t6956tmj@ `64056h QVY 5l6Vƍ=6t6PPҞ56z6=6t p6j `6y,t+61TtRyF 6 `6F;q,r6PXF 6=6t =6th#SX61=6=6u h#S=6t h/#SGRtgD$Ph V%u1D$t)L$ jQPh V%h^.%1t-=6u hO#S  ^_[]1USWVh6D$45`6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B 6l$9؉|5`6|$0G;~,$LHN4H~KT$މ)1@ 69׋T$9|5`61҉t$L1FG, 66669S,SދD$4HxL$HD$81ۋjV `6ׁ\Tډ\$tQ!QЃQ SPh6A`65,6|$#cL$<VQjƃ(S$QP =64$t 1FFFh`6\$ T$ D$(x+9‹T$ʋT$ r=|6D$Xt1NPSWU7/ʼnFظ|߃\$ <$w4F6<$t LX FuWBsT$ 66$@=6tfL$fAf|$l$$j ( hX x6x6T$ =6t| $=6t RPRPh#l=6gq$ʋT=6t RPkWURPVh#`($DX=6tPh#`p6h#Eh#brT$ '|$@@u' T$t$SUt$A  6t$D$, F=6=6$@=6tffu$@=6tfft}SU{$@=6t?f=6t/ȃ=6 $ApfAAt$f=6t $ApfAA $AtfA1ɉ 6 6 6 6l$T\$X6pt4$9 6t ʡ6 6$tt4$tʡ6 61ɉ$dtX$t $D$LPt$衹=6=6t=6u,$$@\=6tȅSUh#C h#(p~SUؾ19 6t1ɉH\H`HdHhHl$f!B=6,$(E\=6tȅƄ$E\=6tȋ `6I0H111҉,$L$ D$t ߋ `6Y8Om\=6t͋ `6#8߉@DYL!!ÊIT u,$\$lD`Td t<=6t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9`6H4 D$|$׉D$|$=6t݋AQ=6t-RP!Eh=6tȋt$|$1҉11 ˉl$$WVRPSUhD#uA=6th#h2#m|$t;SU蕼ƃ=6D$|t1$=6t RPSFVp6=6tȉFhܽ$|$jj$$$$SU z $A`Id=6tEQP $plph1$D=6tWUPVhe#  $AhQl D\$C5`6;^,T$$L$ 66׃ƃ=656 `69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-6t$| ؋T$(tu3D$1 Kl$@؃,Ut$H#, ƋD$9\$(s+l$ Uh1#>jPSWUt$@hU#h*#m=jWsUSWV |$ ow@u Xw VUp D$t|VUh#w w6 6ʃǃ6=6|$ |:w wh#= =6h#mjG $D$|$tjVU¾ 6<)1CVUh#D$,p p*6 6ʃǃ6=6 j  hp t6tHt6 p69tDy1Y1 t 9u,66$|$ ,t6p6Q1I1 ы|$ tt6$G0W4L$Aڃ]D$ p ph#J< =6t)h#ҍ1C+p6h#;h#h1Ct ؃ ^_[]p6jpjMfUSWVP$T$1B@BY0 p66`6x,11=$6t>Q:`6x,$kd1PWSQh#h3~X$6`61ۃVU聶tzljl$ t$6pt=6tʡ6 61ɉT$HtttȉD$LVUz8tD$PWbu(C`6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$6ŅtTM1ًU1 u3VSh#w w6HPUMpX6 t69tmu1 t6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $&h#F9h>#eh#ejj聴=66f@=6fh#8h@#aeU1hPVPVҜ1Bh#8h>##et21VWhVWVW莜1 tah#+7p6h#du<tf@=6tf @f=6tjjxfh: j5656T$1B@B: -66  $$6$Wt>E6+56=6kdPWVQhP#h3mT$6uF$hs#vv 躑 6A1ڍF$h#cvv 6ǃ=6F$ 6&jP1 6I F NQPQPhSt=6F$ 6t%QjPSh#h#>6#p6QjPSh#h#36=6th #軇=61F$6 I1)щN$uh#b-vv *ǃ=6F$ 6$Wt jP1҉GW1҉GW }hjD$\P) =66D$tt7fD$T@jv$-fD$T@jv$mfD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=6$tD$\=6tL$Lu$D$PD$PD$XPy$6;,$/p6$W=6v656;4$]|$T{$AhjW& -6=6tt0fD$T@js$n&tPfD$T@js$TFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=6$|$TtD$\=6tD$L$|$TtD$\D$PD$PW٧;4$=6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h#ss QPTh#$^t~s sqf@fNCKK CQPh#ss oOCK =6th#ss QPCKh#QPss fN p6;<$=664~^1ۋ/uu p]]8u9rۋ=6/CK tS  StQP HKX9rjj轄`^_[]p6j"ejoBPh4#/L$D$@, +A,USWV $0 n8$=6ui=6t`E=6tȅtNE=6t$;66s&E=6tjPo@E$F0N4 utEhe%P)$0 F=6tȍL$A=6AAhhe%QD 6 6tD$D$L$L$D$h#v v薉 E=6tfM9v%}EPh+#.R#h#0[4/E=6f)=6f=6fEtf=6t΋$0 AI 1 h#QP辈 h#Z$0 F=6tȉE$#PlZEL$fAWQU $)fEPUVd =6tfD$fXWPUD $0 G0W4w wmfH$Xp6$0 =6t>}t8h#v v贇 h#Yu EBp6F0N411G9 v vGD$@=6tȍL$A=6AAhh#Q 6 6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=6t2f)=6t%ffD$=6ff6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=6tfPjU D$fEutEh#Pl$L$Aq $0 JR ωtljh{#RQUW݅l$EMك9v%}EPh#*#h#mWD$$0 T$ 3F0V4=6h#.|ڃD$=6t΋D$p@ =6X}$0 ~hc#v vڄ Eh#VJp6B#$0 1GPVtXD$T$ F0V4=6h#`{ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU  E$t'$0 G0W4jPAifH1G9$0 .1L$AA EL$fARQU $EtMw\}.uVV4~0|Juh# } .u8h#v v% Eh#U4$F0V4=6tȋ 696s5h#juv v݂h#T4$=6E=6tȃu}uE=6tȃtb}u\FN U=6tʋ4$h#jRQPX=6t}Eh#T1 6EtjP|gC$0 A4y0#$0 t=6"#=6JR u=6tPjVRQ菁h#_SƋE=6tjP1Ƀ=6t f61ہ@€@t f 6fGp64$Crv $0 A4y0AI U=6tʋ4$h#jRQP褀h#tRp6zE=6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=6l$\$tȋM=6t1퍜$UQUPhScShB#$"Ph8# %9-6th#vl$\$ h#vQƃl$\$$0 A4y0| AI KC=6taEO9tU$0 AI U=6thj#jRQP%GEh#Pu $ p6fO4$E  ^_[]ËM PShy#"ȃ=6tUSWVT 66,=$6t>)"=6kdPWVQh#h3@$6}ww cO W $T$ WGO ƀÄ:1=6t4=6t+=6t"uGO 1F9ƺw1 tbQPc8uS= 6xJ1v6KNj@ $GD$wOG tQPb8u E;- 6|E;- 6=4$h#b"h#ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$D6pt =6t ɡ6-6L$Ltt tȉ݉D$PD$PRmu h#!D$TPv6t$t$~tyD$ o v6ΜL$QPt4t$t$af@jw wt$t$~t 661JQPBafp69)T^_[]fUSWVT1ۍT$1BcL `6x,@=$6t;`6p,kd1PVSQh #h3=$6`6 6<\$11ۃVU衛VUi`$t$l$ 6pt<=6tϋ 661҉|$Ltt<8tϋ 661҉|$PdtX 8Džtɋ$L$HQ$&xtCVUztV=6VUhH#^1=6L L tOjh#sx6tuQ1y1 t6 u_VUUdtl=6tHVUhr#97jh#$PxyQ x6PD jhy#D$P C6L$;JWD$ P#D=6y1ɋD$@Bȋ@4ư#sLV5h6 5D$ h66h 5`656谵 5l656Q=6t6PP$b56+>66tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$566`6h#h# ud`6ǀh P56薑 5l656,=6t6PP >566`6@=6uh#u_h 5`656謊 5l656&=6t6PP 756'6 6`6D@RL҉111C QPh?#^ `6HLщ@D=6th#==6uh#h 5`656ʼn 5l656-%=6t6PP9656@6 6*HHPLщ8<҉@D1ۉ6 66`61Ƀ,=6hd#4L$ `6L9| 9Ph_#`6=6th#g<=6uh#Hh 5`656_ 5l656#=6t6PP4566 6@h#L$A6`6ǀ,04ǀ(<HHPLщ8<҉@Dh P56蔇 5l656"=6t6PP4566 6 66G?`6L-=6th#=h#:6`6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P56: 5l656!=6t6PP2566 6= 6t}=6uth 5`656Ʌ 5l6561!=6t6PP=2`6ph5656聅 h656=`6VhLLVjP G011D$)9|ËLG8 $HLOd t1SRPV565t0|$u)h#h#r1AL$=6tLSVV66 `6A8$HLId t1SRPV56T=6t SVV5 =`6G0ŋ $A96 6ʃƃVh6VjPz jw,6y9 6669؃s6É66C 6UPƣ6US|6 Vhh6E`6 $6=t6 61Ƹ1ҽhWV5P656|5<6=@6D65P6=LBALtl=|6HhC#[h#11IPPQQPV7P6f@5P6.6 P6fAT6FȃtvFjPhb# =6th#5=6uh2#mt1FP6f@5P65 P6fAT6Ff=rmh#=6th # 5=6uh#t0fFP6f@5P6/5 P6fAT6Fffuzh# =6th#4=6uh#st=11IPPQQPV6P6f@5P64 P6fAT61Ff9D> <:# <$(&6QP,&VMh T$RP5656u-6tu $Q##<$=6tW=6=6x6=t=uh#h# uh#=6t h#=6t6PP'h 565`6az =6t5`656& `6\=8 u6ǁ\TT1=T 6U-`6Eh= | #1^_[]ÉD$<$ 6D$ t$΋E4Md1C6QPVt$666 =6hl65`6=6u=6u =6t_h 5`656y 5l656=6t6PP%566 66M,I\Ttu!MȃMt$VPh6* 1=6=6t6PP$`6ph565d67x =6t5d656$d6\8 u ǀ\T565d65`6o=6tVh#+`6{hr;ߋ-d6ދM9t+`6QPRh$#c9rҋ $S#1Chg#h#j[D$ 6 6t(\TtTu 88 \=6t(\8 t 8uTT\ËD$L$=6P;QP ;Q P;QP;QP,;Q,P0;Q0P4;Q4P8;Q8PH;QHu|PL;QLutPP;QPulPT;QTudP`;Q`u\Pd;QduTPh;QhuLPt;QtuDPx;Qxu<;u.;u ;u\1;\1@À L~.PQWV|$t$ FGF G FXGXFP^_[]USWVTt$xl$tL$p|$lȃ u D$|uWh V%mUQ=d6uR<sJd61\$|11 ʍT$ ٰBPVQ^ D>/|)Ot$L$6d62d6$!D$h8Jd6$ D$tB?JL$h)PRQ]SWVD$t$ 6956r==6 `6jSPVV)޹294v t^_[PVh#GWV|$ wu$0&1XD$@uPw w Ph k$.=6th#h#t ^_Ph#躽$6USWV$\TM@$ 5uh`th`VPA\ =6t h#=61ۃL뀃=6t\,L$UPQZ DPP~$\, 6L$L$UPQ( |$u $PPD1LDffLD@9u=6t8PP\6L$UQPΎ t"PP\L$UQP討  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h#,USWV\$t$=6!ߋ,t9Xt6@u|$t&jt1ɉH HHXh1^_[]h?#ĺVD$ L$56#p9tыR9u @^USWVt$|$VW/`6!t7^Fu+11 33 1u{ 6tqt$0|$,\$(l$$T$h6t9PtjRQ h6(Xxp L$ l6t9HtjQ56 l6(Xxp ^_[]WV `61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$&$1Aȋ$sY9U&<&Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$@&4  <Qh*#h#船D$P`wZL$ D$$P&1B(ɀ!1Rh6#h#SD$H`wPD$T$ $`&1C%   [QhF#h#襸SD$H`wND$T$ $p&1C%  [QhS#h#:USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tW%kƅuWh՗"jj$$<$4D$Phd@U蔛 tg1OVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh4$t$8 1 ShE"U| CPhV"U C Phb"U CPht"U CPh"U $@D$t P 1-Uhzd@$<W t1 VhedAWѓ hjU踧 D$ P$4T+D$, 9L$| L$9u0$S11:8tx$0h" Rb$11҉ $ƅ*ŰP! j PUUe ^_[]$0h"j2hUSWV01ۍD$,ShPSu- 1NtAljSPSWuWgB uMU D$t$$$Q1e^_[]fUSWV]D$D$ PS?*$1NHD$ D$(%=@= j/Sǚxr)ك$0PSQh`#hRQD$jPJǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS(1@$D$hh S@ ƅ%D$ PV<D$3D$ 3|$$  D$uH$0PS$8$P$TRPV V\@ D$4@D$1$Vhv#jSVjS>? ƅxc1GD$ PhFV  貧8u;V? Whv#jSjjS> Gy xD$t P聢<$t t$1Ox V? e^_[]D$(%= tn=@u$0Shh#hPSƉ\$1@$D$:\$ D$ PS&B$D$jS= }tSzUtN$PhF|@V讎 x4D$t PvU$$JhF Vh$USWVP1hUU= ƉRP*9-6t1@fC}+PUUS'G `6;A0u $ytWVD^_[]Ë\$-656SUqRPX$@ ``6ؔؐh P56K 5l6567=6t6PPC56J6[USWVt$(~Ohol6tUQ9Չ 1=6L$$t| tWV9Ɖt$$H$á`6@056QPWVsUC cMhml=6tUQ89Ջt$( }`6@0ˉ9Éʉ\$4$rQPUt$DLPDTGlOh|$ wL$,=6tȋ|$`61ɉSh#(=6th,#h#t$" `6QP%$T$1RQQD$PaAá`6;X0t$~~1Ƀ=6T$DT =6|$t RP4L$ pL$QSRPV?ǍPp6$|$1D$D$t1)ÉعF@jP茓D`r9w<$r$l$T1C @<$9uG<$;|$}`6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡ`6@0)ȃ`T$1ۡp6ـ#h#蒦=6th#h# ع`֋,$L$t1ɉȉD$ օt$ tH `6i0T$,RQUt$> `6;A0l$,} $L$l$l$,`6@0D$Mt$ |1TT1PD$T$ ʃ=6t RP1L$(ωQM D$H 9tet$C9\$t$$h#D p64$F4$;t$SD$`1p60^_[]ËL$ ʋ `6f9u Sh#ԤD$`,t$$h#蜤jʶ `6Ph0#sUSWVT$L$D$0(D$ X=6tSU0ʼnӉ OD$$`6@09ʼn} t$t$5D$PSUt$< `6;A0 t$~QPSUY~t$4SUWt$T$LtL$A L$ Q56t9RPt$ƉT$ /t$1ӋT$1 t<$G RQ/D11 u5\$$9t ;D$t`GPD$ GPWTt RPv/$<$G L$;L$t9ta щʼn$;D$t`1h#^_[]USWV 6$`6x0UWt$0t$09Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PRe9 p6T$4$1B srl$,$ ȈU1wX=6t 6!9GX=6tȋL$,1Ph#ʡ p6L$ $  h#詡=6th#1h#t$D$OPWTP1GTGP^_[]p61USWV|$,x#t}#61@$`6sll$6t6 L$ =ƍD$1PQQV{9 `6;A0-T$zu D$`1]l$z$Ń1EGpD$hb D$ Pt$ u&xMt(T$hb D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh#=6th#h=#qt3s ss3st$Vn[E;,$up6Q$t"Ph#`j莱USWV0\$T|$HOX=6t1D$,D$(D$$D$ D$D$PL$Qs tPs+t$OG6҉L$D$td$PQ,+É׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u$3D$<3L$8 OE81H"h#Ph#輭O4$VIVh#h"#h h#蝃h#h#h h|#hk#h|WVt$ F,t@u6th#+F,P1~,>d9~8uv0΄^_h#h#h h#D$x,u@Pt P蘄鐄h#h#h h#ڂWV΋I01t*N8~2IN8tPQP PEN0G;~4vɃ~8u^_h#h#h h#xh#h#h USWVEH1BT$x,1hPs1MA04$4tOF~|$ D$ڍD$P|$Weu$v vu WS}u 6Mu1NjM4$F;q4vS^e^_[]h#h#h$ h#蛁USWVP΋I1H$ЅD$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hG#h#h3 h#苀USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h#h-#h> hC#h-#h? h#USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h#hY#hO hC#hY#hQ h#USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hG#h4#hf h#o~fUSWV\$$|$ l$t$u6t56SWUh#USWV5671^_[]USWV\$$|$ l$t$u6t56SWUh#ЧUSWV56C1^_[]V=6th2#2j5x6Gtahg#赌h#WtSx6xL~61 t6 s"@Pt4h#< t6x6F;pL|^5x6vjx6t'x,tPx6Px6áx6t x,tt$t$t$t$P1WVt$|$ VWJ=6dtX=6ts,`6`uau33 u1@1^_WV 6t1 t6 `61!`u/aʀs2hlpx1Ph#Ph#h#蓷Jh#`6 ǀdƀah P56( 5l656=6t6PP566`6!1111QWRPjhx6hh#h#赶lh# `6 ǀdh P56' 5l656=6t6PP 56'6 `6dPs+aʀu Ph#Ph@#)h#˵h(#!`6ǀdƀah P56& 5l656-=6t6PP956@6^_jUSWV1L$ AL$HAL$@AL$<L$ T 'L$A P 'AL 'AH '}u ]h#WVH k~lt$tu4D$PS-buD$HPSg# D$ PS %t9PD$DPD$DPD$,PS(uh$2jƉe^_[]953ujhH 'D$Px u1PPD$Pjd953t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQRPt$8t$@t$8t$@W1u2h#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQt ]Sirt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ St$\D$Pha1#hVr^D$@w ww7VPh{#S 1h#+hV#WfUSWV1L$(AL$$t$@L$ D$ }] h#WSD aLuKVbtit'cD$ Pu D$(Pu= D$$Pu udt AuZD$ 93u~]#D1غ$Phzd@b tN|$$tOh<2jet$ ut$@u1Oe^_[]h<2j111J$THPT$,L$(HL$x1VVVVV]PoT$4 @T$ƋD$(D$8D$,D$4D$$D$ puSWuOt1A1@D$ 뼃Ptf1@$1@D$띋t$u D$9-3WʼnT$jW.t<$@jW|.tat$Vt$UW!ƒt=Wt/|$uWt1hT2j[1K؃^_[]É4$1VjVVWK. jVVWt~1hQPp fdžUt$ t$ UP61@PVj1QPQ1PW% PW4$h#WhE# h[#hp#W 9fUSWVP$|$ t$l$1hG;#WV< fttruG$953u4jU-jU,jU, uh#"hl2j " Àuh#U 1O^_[]Åt&$jv 5o VUكtt$ <u&$jw o WUtJ 1u$jq n VUTbh #Lh#Bh#8SWVL$t%T$1H1<213&F9u1^_[USWVT$D$\$1f$\$SSjPjt$ t$jjW  X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQP(DE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q 6 H @AQ@A$Q @QHALh#SWh#h#USWVP\$|$tus$W" $"$jPtQ1@PVSjPt$8t$8W E1u>4$h)#W V6WSh#W4$h #W 1H^_[]UWV} uOʃ<|RQPh#VJPR%x& $T$W1ٹ|$5<h # 5<h "VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhH 'V 1OujV5<>uW?,VQ>~Ih0#Q1$VQ7 t1PhB#Qx 1O^_SWVP|$1N?u;j S5<[ 8u1u5<h "t$ ^_[WV|$1N?t5< 1t^_h#t$USWV 1O1;B։ˍD$ j P5< уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5<>#x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,IjhH 't$|$ tjVt$g|$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh[#VIz1t^_[]1;BB  FjhH 'P{ 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hk#W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Phu#Q 1HUSWVt$|$ t)l$\$$jWUS~ tWUSh#1h#V*l$(\$$jWUS} tWUSh#V1H^_[]Ã|jWUS611USWV\$1s3h%5<, t^1Wd& GtuWh#t$ 1Nl&h& Ch%j Džu^_[]WV|$ p&d&Wh;#xu^_USWV t$@\$D$ $t|$$L$|$t$,t$4RQ\L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh#P%1D$Bh# D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$Hh#u1fUSWVPM(,|$8O] D$1h;#uS sujsWVVuutqD$931t$ t h#DhW#D 1A AAt$Qha1#hVVh#h#h#DĔh#rD|$uhusuqVh$ohk#JDuuulh##t_1#PRh,%DĜ;8jmWj$VnVha1#hWWh#CĐ^_[]USWV΋\$$|$ ʉl$͍L$jj h_1#UPjQ蠑 yD$SWVhY$gC|$tUhLQ$RCj hB ^_[]USWVDt$`l$\\$XT$1 T 'G P 'GL 'GH 'B0$h$VU Tt$t7ltytdPD$PS uNtWSu1HVt2jhH 'WC t9-3uWh8CD$PS ht2j˽hr&1D^_[]ËD$L$Q P QPIHÐUSWV(]1L$L$AL$A} uhE$SW a~bt)iuRt7D$PV"uUt$D$PVtD$PV^uh2je^_[]Ãluhr&:1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AX^_[]USWV|$(l$$}L$ \$ t$ T$D$PRVSD$PQD$!PD$$PD$&PD$(PD$(Ph$UA4 u/D$1NUX ' tLu;1ɉL$ L$L$ $1111ۉfwfWGO D$ G D$fG1^_[]ËT 'D$ P 'D$L 'D$H '$D$fGD$fGD$GD$ G L$ G A똋$t$T$L$ fUSWVTt$hL 'D$N 'D$ P 'D$Q 'D$R '$S 'T 'U 'V 'W 'PQRVUt$t$t$$t$,t$4H 'h[$j@\$HS0<8\ 'X 'Sփ UT^_[]WV|$ \ 'X 'WhM$C=u^_USWVL$ l$t$T$<'__^_f^1ۊD CutRQU4'\ ^_[]USWV|$$t  h@h$誰 ƻSUVM   9)uVH T$@fT$D$,$L$\$ $? 04€S؉΃9Ӻiɀ8F8@,$fL$fT$1t$ 1ۉt$t$(.fNfVF^ D$ F D$fF1Ch$W0h$h$WSPh$WV, 1H^_[]fUSWVL|$`tv\$hl$d1ҍt$1 F0t$D$`lj$T$h$SU tFUtPVW# ufD$P5<"T$uHh2jTI9-3u/Sh+KVW u(|$t)ShKVW(h2j˵L^_[]1Vt$|$u>L$ At$H 6H 6@6 6h 6196F6F6F 6F^Vt$|$uD$ h60(6FD$6F@ 6F<6F8^USWV$ $$#h"WVX ou-<953g 1O$ Qh$D$P $fƋFHt$ $X 'f ^ hSh%PD$ |þ1${kf Wh&$PE Ph"V CPh$V CPh $V xCPh-$V ]CPh&V BCPh<$Vd 'CPhE$VI  CPhP$V. CPh]$V C Phk$V C Phz$V CPh$V <$uL $oVt$7 ZGU $ɿt$ D$tQh$P D$PhW#t$ ut~ yd wh$P jG8Pha1#h$SSh$V 5GP[Ph#VB Vh$G D$c D$$$Fm~ 1B$c KƋ $Qh&$V} "Wha1#h$SSh&V Wha1#h$SSh$V wwh`-%V wwh$V w$w h"V g(jmD$Pj$Wc|$tD$Ph$V[ 0Vt$6 $B$$L$ AA H9t$h$t$b t$h$t$E t$ v5t$=p t$F h#UhV"U6PV\3tlS^ ahȴ2j$ V,F h$$71OSt$F 1Ot$E 6h\3V苫V 1*Uh#$ ä V t$E ^_[]ÅtVE h$hj$h h$h$hh$h$hh$fUSWV]} #D$D$ h $SW iu5<tFumD$ D$9=3uUj]$,(nǃD$T$ЃD$,jSit%D$t6h $h2jxjS5 D$ tjStD$t h#w@h#VO#$tQ+q "h$P#d )j$PY h$Vc h$D$ Pc jhPRZ D$0Ph#t$ D$0$L$ 11t$ L$ D$Ph$t$ bD$\Pt$ tpt$h$S< 1O1PLVC 0h.$hO$SVB hq$St$B ֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$Phz$S $Ph$Sx t$(E Åt$(E $fǀU1PPPE!ƒ[u$t$ ;$4t$8莇 D$t$D fËt$01 |$lD$Ph&Sx D$lPt${D$Ph$SD D$|Pt$G$Ph`-%S `$Ph$S B$Ph"Sa $D$Ph$S tj$$Pt$ ۔ D$DPh&$S D$D9M$ $ȃhL$pQP t$C Åt$C U$61QQP!ƒ~t$ M$$VP! 9U]$|$$D$jRPo!ƒ=M$$VPȚ 9E$1SP|$W GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$$$jU ~11ɋ\$luAu꺀UtPBD$ 1ۉs KuT$ )ڃt rKu\$t| It11ҋ\$Rh"M"#F$;td~jW Ƅ$;t$1QQh$KQPW$Wthh_1#W WhH$#jvhO$h$LUUh$S#D$tPh$=#jL ZjNh jl$ U jvU F QPD$0Po Uhji W tpD$4 D$,L$0 L$( $;j肦ljh$"T$0L$4 tH)Љ|M1K 8/$;81$;tyh$jh$."Phי%"h$"L$(D$, t )|1h$!Whי%!$;|$tv vSj 6D$1P7g@ ^_[]h3$h%$ h$h%jͻ USWV $Sh 'U Ǿ '󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAH2qL1ATAPAXkiA\$A`i Ad$Ah!i Al $ApeQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph"Vw |$V V J(C 1ЉًJ(L$I$1 sD$P_D$D$ t2t$ ^ {uWv1u{u C $ $P|$PRVW蚇P4S> $PQV聇VWhD $rh$jF USWVQ u'|$\$l$j蟡EU3^_[]h $jϷ USWV$$j-It[ō\$h jSN jvS` |$v ShIi U# t!$#D$$^_[]h $h $h $jn fhܵ2=USWV$(x ōD$P\jt$UN |$ZÍ$l$ D$wU!%G x1Ҁ=$6=$6T$R1RRhVQPthh_1#V茳 VhU $ou1۸w) 4PjQ VUD$Ps T$ʅҍ$t(» t)1M։9$uSh"M"G\$t@GS1RRhVQPthh_1#V農 VhH$Pl$ yT_31w) 4PjQ VSD$P D$Ph^ $$\$Gt@GS1RRhVQP#thh_1#V Vhk $jwhy $h\$ SSh$\$tw wjLj ?D$1P_^_[]hK $h%$h$j膴 USWVD$X$\$l$@EM}M UMUMT$ U M$U(M,T$0U0M4}8E<@E@MD1҉UHULUPUTEXi@E\ $E`iEd $Eh!iEl $UpQRPL 1USVP^_[]ËL$1B L$SWV։ωhjS jwS G PKSHK@ CjDt%Sh'iP t#t$Đ^_[h $h $h $j fUSWV l$4UttQ"DGU@Ë|$\$uoh0 $D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hL $ MHtU4uL9rRQPk t$|$t%u@uhV tIU81tSul|$tDEM9rQWP u@u`V[ u@yu@u`VE teEptUt$8ЃtEu8uXV t, ^_[]h $h $Ah $h%$5h $h $)u\u\hb $udSh $j wlh k$j7 fUSWVt$wD 1tvt$E t[S4/ tCPP Vt$&H tPUWGI uW& S1/ 1S$/ W;D ^_[]USWVu]Ph $S t$f1j?1Nt}ǍD$ PhRY$S% td\$ t\hjD$P jS\$S ShiW t$E L$Uf jQh $Pb je^_[]PPhRY$t$ u1$YVPt$ t$t$V tPhRY$Vd u1$^USWVt$t$E t Nj\$ PM` 9v? t1N*Ƌl$WM` VPUB )SjU ^_[]USWVt$t$E t?Nj\$ P_ 9s9Ƌl$W_ VPU )SjU&  ?1N^_[]UPh%u t$1H]USWV@uPhi $V ] h $VBD tP5_ |$ P\$$ShiV\@ |$ jS{] Ph $u (F V# ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP"] t!Ph $SE Vr# 1He^_[]h+.%h $hhr $WV|$$h $WBC t;P^ u1V%^ jPV VhiWQ? t^_h $h $jVhr $th $j訪 VD6h2V V L6hsuV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh) $hV>tVh_ $VmFߋD$t$j7QPh) $hV>tVht $QV(F߁^UVuPh|$V t3$L$ AQhiV= u h$蛒1e^]h+.%hw$hh $UVuPh$V t3$L$ AQhiVe= u h$*1e^]h+.%h$hh $vUWV}W#ƉPh[$W tZt4$P<tW@PV Z tGPhF$u B t>V1e^_]h+.%h$hh $h/$h$h$ h$h$j hb$t$@ tPhF$t$=B Hh%hA$hh $lWVPt$|$D$PVW t2D$t u Wh$jʞ PD$L$AËD$L$AËD$L$AËD$L$AËD$ 221ËD$ 221ËD$ $2$21ËD$ ,2,21ËD$H@42 421SV\$ Sh82EuCЃ r"CrCr 01H^[h825H?r  ؈821ыL$t $61ÍAЃ r)Aw AwÉ1HUSWV1t$ D$hVP 02x$6t8u^$6ǁ$6$6$6$6$6$6$6$6$6$6$6$6$6@whl2R&uh1$0h29&uhT$h2 &u hl$jD $52tvh$2%61$6$6$6D2t2$h82$Ua ƃV B~>CN$6F v/FwD$$ '$6Au"h $$ '$6xu>Wu4D$P1VhVVj V5< $69t$:*ƀ$6l `C Lvms2D2u2$6$6r$6$6D$P1VhVVj V5<̿ $69t$taY$6>$6O$6CatTl52+wtzD29tl2x2$ÿ`2؉$D23 $6$u =$6uB=$6=$6=$6u|t =$6u =$6uftu^$6uS$ttH)ŋ$L$ T$ RQL$QWPU%u, u&hI"h $,5<h%j辘 t$PD$P & u h $D$t,DtVPyDžuhI"h $JW WtS)uhI"h $WuhI"h%$02t H9t@hI"h $$@ uhS$hI"h*h $VWЃ WjUSWV4+ uh|$h $j诗 Ƹ82jmP_1#_1#t*$jL82Pͫt0$USWh$h3o(2t VSm#*$u_1#WWWWWQWh6$h3)$V0 jV 021tT$q9t Iu^WVΉhjWG D$Ph$V tZh$V. tQPI L$PyRPQ觲 WhiV* u h$Ĕ^_h%h$hh $WV h$QO. t;PI  u1W2I j PW$ Whui V^* t ^_h$h$hih $~h$j貕 h^$821ÃD$ 1ɉJJJ JJ BRhiP) t1h$jY $1ɉJJRhiP) u 1Đh$j Qh82_USWV΅t R@* V( O( 0($D$P2:!\$D$1t$$tsVsD$tVPVhRY$W trC=$6D$uCt\=$6uCuM=$6uCt>=$6uLhj$V VhiWn( t!$uۋt$$4u=$6t ~ j uh\3seqWt& 02ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPh$h$VVUhv$ jl$U$Vw Vhit$E t$,$t!Ph$DVh${,$jt$V" Vh~it$ t$tPh$j ꍄ$P$$ j:QPh$h$P$t'$Uh;$vUME}uj:$$h$h$P芲$t'$UhM$UE}u- 24$tVWUmuj|$W$Vԭ $$ DŽ$@Vhit$V舻 u$ hZ$1@Pl$U%jWl$0Uo 1@D$81D$%t$D$;D$t(hs$Lh>%t$ ej)Qj G\$#|$h$1A0'9xu H uh&t$(hjV Vhi$ St$<\$8h$$'Qt8u 9A uVh$K Vh%$1#X4h_1#h4% j 2jmtz D$ ~[11ۋ!9uIuUPhR$hh$hq$4j D$ 1AC9|M rV>ļ^_[]P]#h)$$h$h $h E"h9$ h$h$j虆 Vjmu$6hVV2^h|$j` h3jjHh$蝛UVuU OPh$V贻 t!#$6 $ $61e^]h+.%h$hh$USWV(ӉQtoh $U t$6H1 Rh8i(U u 8uIjh $S踸 t)D$$6t(^_[]h)$VhG$j h4$h$h9$j0 SWVt$T$;h$VC t\Ƌ$6P.8 V7 PWut+Ɖ߁PWAt2 É$611H^_[hTr%hY$hh$Whb$WV֋|$ Q;VWPhj$j9 WVPt$T$th$V| tkPm7 V27 PWtt>ƉPV5$6 ǣ$6V]1u $6$h#Z1H^_hTr%h$hh$聿WVPt$T$h$V tbP6 V6 PW ttIƉPV5$6H ǣ$6V1u! $6$h#v1H^_USWVt$T$1h$V9 thƋ-$6P$6 V5 PWst6ƉPWǓt>V ݉-$611H^_[]hTr%h$h2h$Ah%#fSWV|$ t1H>t$|$\$jS> PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V3 tE$$PwCt/$F ~G F1  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r =8"t$8t+1H^_[];sC| C 9s} "WVR t/t$ L$Ps(,tD$$F ^C F1 USWVuD$ tV} ]CtP7l tEC tP7V u/D$ Ph%7螵 u$D$1$61Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vpt|$,$h%W D$6&tD$1{tj/t$̲tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$D$4D$4D$ PD$8Pt$ t$ +ÅuD$ x1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr 1X \$TfD$t7|$0j WPg t9t1ۉD$=r迿"11HD$$Pº|$1OL$L$D$L$T$PQRh$Vʻ 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P^NjD$fVSP蓘 sD$ t P~4$W- W蔹<4$uM S]s {te|$t^t$Vt$t_@PW- W$tNVsE0" ߉Vu ۉt3EF ^C F1Vt$h-$h$h-$h$ h-$h$jU{ WVt$tVvrx1H^_Vf t3t$L$|$ Pwt΋D$F ~G F1' USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>.1-t P 1GG GG豻1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUsڬt>Vsʬt)uȺ 軺1H^_[]Ís s(CtP7 uCtP7m t1@뿋C$1$'4v6 !6^ P4  v64 tMtk $t$ 4$UQ$t^hQ $D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh$ja 1Hx^_[]h5 $h" $jsa WV0t$<|$jWh$V萴t8W芸 t7HfJBRhiV t!10^_h$h$Wh$j` h$j#a SWV,%6hT2VS4%6h(2W@VgW^<%6hPV3D%6hWL%6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW芞 Whi$ U $!h $m$HQPۍ\$4|$fGWhiU t$ $f|$*u $=$6t P fD$(WhiU t$ $f|$*u $=$6t P|$fG WhiU t2D$*=) Ph $=$6t h ${fD$(IWhiU> t2D$*=) Ph $F=$6t h $.1Shi8U |$Dh $1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQh@ $2] uVh!$`11t j,nDLxPtT h@ $*v<u h# j "$PhiU tDh!$$t$h!$ h#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR) Ph.!$;$=tPh8!$j 4$=tPh$!$^_[]Ph $j \ h3jhhA!$sqÃD$1ɉJJ JJ fBRhiPm t1h$j[ 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h$j[ USWV,$@$PhiV tr$A jjj"L xgljj2 xi$-hSWq4 xB$/uE$0uf$Ciu.h$/D1H h<$DhV$DW55 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h$hT%h$h$hr$h$h$QL$4Qh$胿(D$f($-D$](E!L$:!PS E P$ $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q T%6t T%6EU%6tIAtcAtCAtPA tSA@tBAyAAT$hT%6UWt$PVt$D$VPRRh$,l$ }"E!Ê<)\<$'=$6`Cs|$[VPWl$Ph$h7$褽#<*<0<2=$6<$$<t$sQh k$W#1L;_1#y$QRPh~""G%9u<]K%C=Ph#$h k$ܼ=$6S<$CPh[$躼KPh`$褼K s k t?L$D$Fg$PWh4%j Nu%܋L$D$(Mu} L$D$D$Fl$PtPtPu$}$ $"QPh4%ۻ Nu%D$ŋL$D$(ȉ</=$6%<C<$L'@$=$6CPh$=$6CKSRQPh$h@$1C~@sFNuQPhT$ IRQPhJ$Muj>l$ L=$6?CPh$詺(sh2$h k$莺=$6<$CPh[$lKPh`$VCk tAt$D$xg$\PVh4%" Ou%܋D$t$)E}twt$D$pl$ttu$}$ $"QPh4%覹 Nu%D$<t$)ƃl$ rPhq$hj>~<$€$$8''$rQ=PuJC<u;h($h k$=$6yCKQPh$޸ ]=$6Pȹ-$6<"<$0$ 5$K$U$]$e$m$w$|$$$$h($h k$=$6<$CPh$1D3 _1#t$T3 ׃l3 URWPQ'h$起uj>öl$ <$$CPCHÃ)gj ~EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h$hp$jP WVD$(1www ww7fWfGfGwWhiQ6 uhe$91N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQVM ;l$D$tD...PK^_[]Wh6Q$Q'M 1<$tɍGrD$X1.Ph"S> E;,$sGwUSWV։ϋ\$Qh k$iW@K)Ǎ 9~)j^_[]ø w'ø"øSw'ø"VPt$ D$Ph$V߁ tD$P^h+.%h$hh$舊VPt$ D$Ph $V蒁 tD$P^h+.%h$$hh$;WVt$(|$WhiV tND$PhE$V* tCD$D$WhiV 1uhO$h71H^_h0$jN h+.%h@$hh$觉fUSWV8h` y h!$7h6%2 y h"$6jh8"$ t\A.L$jQP# D$tPh!$$6jh8"$赸 21 VPh  VPUSWQRPh`$1EVRQUhBVWh. 1H\$(C CCVWPPUPP P P PPPPS8VSj$ |$www wwVWjc VWjW V& S& Ww& D$ @ )T$VVQRWPB1I9u 8tމ5t%6 2tщ1@8^_[]h8$$4j yjjPa h$$ca u8$$jV϶t$$jhR$h$$Vh#1"h$ j j USWV`~ZD$=t%6tIt@ƍD$H@ L$1jQRRjPAut$Vh#$< 1t$HFFF FF1G>\$SVjՋ l$ UVWƋ .+ƅZ21OjUj t:9uB$=h"#$jV#  K8uh 29tttn1VSj' VD$$Pj 2vh"$@jjje 1VSj VU6h"$1=2u$=|$ u'1VSj諊 VWj蟊 `^_[]Ét҃t̓ u1Ht$8F FFV! Ph<#$u1+"$WVst8"$D$8x xx8WPVT! "1"{jhE"$h#% $SWF Wh"$j.VuSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP{ $H $u˃^_[áx%6H x%6t$Vt$V趜Ph"$ijVɈ2VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjn ?XWV1N=t%6tED$@ L$1҉RRQWjP>t4$ hj#$^_VQ" jh' jV tP%Ut^Vh#$>j覇Vh#$)j葇PD$L$ $QPj茛 ]XPD$L$ $QPjm >jXÐUSWV$$D$D$D$,p1H$11D$hN$$WSQ f~/P w`1A$'5< D$u[FtR=5<D$,D$낃g<8#u(@j L$ QP/ $D$8L<Pj@$)<8#u)@j L$ QPU/ D$D$8<L$QP j D$ P5</ D$D$8c1Fj D$ P5<. $D$85<hm$$83<=|%6u-%6~q5|%61ۋtVPkxuJVh k$ɩFtPh(&$賩FtPh<&$蝩j 賨-%6C 9|?,u)É\$(k <D$jU D$PU Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0*1ɉQD$ P4 D4D$8u 8tz`Xt$7|%6u |%6-%6CPVvt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UPX jS |$tt$ VUWU  UW ʃ8C|$$8D$@PWtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWt!t$ VUWU #|$$tS9u$UW RW $D$utSPW uWh%$*1ļ^_[]Ë 3DQu1Gt@Gj,Px>'hm&&`h E"QWUg1^_fWVt$ |$7 WVUSWV$$l$WVSU$$hhU3WhM1"v= uWVh"jp) D$@t.D$t$QPh#'hV7WVjDUSWV$$$1hWSg 8D$$81G=<=3D$ C|D$D$1D$he*$UV14 T~H wV$!' $׃Gt!M5<L$ 뱀L$5<-$Ax|$뎃UL$5<($At|$_ $V $M5<L$|$0P$h$"'5<<&P< $3)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PV*t\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]h·"j& Vh$YgPh*$h3艎 jfWVPt$jWV 9u9t x^_Vt$h"j& Vt$VKt@^h"V^Vt$VPt@^hQ$V|^WVPt$jWV 9t9u x^_Vh"j|% WVt$|$ VW諀 t$?/tWhÈ"Vh܈"֝^_Wh"jc% fWVt$ |$7 WVSWV$D$\$VPWS$,$,njS7Vh^.%8 u$4gtu!D$"t$"jށه"g0[yPVt$ h/"jv$ USWV\$ l$|$t$1E1@<3h"WV/ ou%jSh$'5<g9tEP9ǃuA3)ރu4t$$V4Nut$(t;^_[]h·"j# dPh"h3 jfWVt$|$ VW~ t$?/tWhÈ"Vh܈"^_Wh"j# fWVt$ |$7K WVUSWV $$l$WVSU$ $ hU3Wh%%7 uWVh"j# D$@tY$$QPhd''hVPV$$$$$h+$SjUSWVMu1} ]hD$ PV` D$ FxD$D$D$D$D$h+$WS- L~)Hw;$%'5<Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5<L$1@D$kjuh$&'5<6PW6=N|45<1@D$5<Fp1@D$5<L$ 1@D$3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W WB@$N|dže^_[]h·"j t$h$`PhN+$h3 j|WVPt$jWV  9u9t x^_Vt$h"ja Vt$VEt@^h"V^Vt$VJt@^hQ$V|^WVPt$jWVa  9t9u x^_Vh"j WVt$|$ VW z t$?/tWhÈ"DVh܈"6^_Wh"j fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh]$G2 uI`8KD$  =&6%D$ Vt$S jHSt$D$@D$ $p QPhL+'hVKD$tS\$O$oj j ShWt$ PRtPbPh,$t$ SWh,$t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h,$81p^_[]WVh"j" j+zSWV\$D$@u+t$4t;SP t7VDZ1 `&6C`&6C^_[hm&&j jyUSWVPL$$T$ l$\$1$1<2֍zh+$US' @~7M$''OӃ23=&6&6먀'룋 <DF@N@늋 <IF(NnOe <R2KF ?20O' <aF8N &6O <g\P;D$ p4t$ N @OPt$(h('5<0Ƌ$t &6t'tOt@tO t=&6&6 s=&6&6g@tOy 2sg st1A T$ J sh"V-&6$fyh7P%V-L$ A$I$sh+$V-L$ A I$sh+$V-L$ A$I$sh+$Va-L$ A LABLGˉ_ ffGGVt$P uu12wȉfOe^_[]ËL$”19v f39rËL$D$”19v f39rfUSWVT$l$hD$0'6?hZ1$PVcuCt hY1$P3uO'6='6D$1$tD$^1$1MD$,D$(D$$1D$D$<$\$t$SW P4E1A$-'=<h"W2h=#Wn2<$t=<W(@,<1<8$PPhPPV'6Yjj5< D$,9<18$PPhPj'6 ='6=<jh'6h2WP. <1b8$PPhPj'6<1%8$PPhPho'6r<'6a1@D$(S<14$PPhPj%'6(<1A9$PPjcPP2=<hQ$W0h"W0 '6'6='6'6='6=<yW!@<19$PPhPj?'6B<12$PPhPj21Gh3Wj>h1$='6<$=<h$W/u'6G=<1'#PPjPP21@D$$<1"PPjPPj'6m<17$PPhPh<'6P9<142$PPhPj'6 =<='6j:WAj/W.?y'6<-4$l$0UU݋\$UW|$Pv '6'6s3DH,WUD$h $W-h&W-'6W '6N18$PPhPj 2,'6 3DHWD$<$'6h2$3=2_='6tVh2$z5<h2$j5<h1$Zh2$Ph·"j Wh~2$9Whx:$.D$ ='6u1='6@'6$1󫍄$,B'6Al$$+D$ -'6t1$ 1D$$$MljL$$ PW?t$hc3$'6l$Ul$RQP7( $׉ȉ '6='61| h4$$t/$$T$9‰sQt$t$WPh>4$tFtA '6WPU$0 u5'65'6t$h4$|$(F=$PU`w uRt$h4$ A#$=`h'6h3$1='6 $VhJu Vh4$al$VjD$P2 '6-'6-'6݃='6~VUWt$h4$Y|>9|Pt$t$ )̓ }4$0\$l$ '6'6ɋ|$  '6='6 '65'6σ|,@σ|1ҿ9  '69|щ '6|$ D='6Ejjh'6d .h'6h3$'6='6t'6'6t&hQh!5$j '6'6t=|hPhb5$j ='6u1='61@'6='6u '6'6=2,='6t#jh5$h5$h5$-j'6='6u=2'6'6t$t$ t$4Ut$$Vt$t 9t V t U ='69$Pt~EtƃhZ1$Dj 'NPh5$jd$8P=U jn jd jZ h V% +6$'6'6ApQt'6@jxQP$PhZ1$} g20MVh5$jd$8PT$T $|$8jDU$Pr $,PSJ$u/jZ$P$\P u$4mfsjWV苚 9uD$8%PKDP$Ph5$h5$|$D$D$4jPw $u/h'6h3$$Ph'$jXJ h[#j > /dev3'6 '6/ D$ '6tD$ '6<$~~l$4 $jWh" u ƃrl$Wl$$U"MGWU":l$ ʼn\$4Ë$H$|$'6\$L$ u D'6$T$dž,<tx(='6dž dž,dž(Ɔ 22u(jh:$`N='6-5+6u"jh;$4N='6,5+6 '6N0'6F4Qt$QhM;$M='6w,5+6F4Ht$Phv;$M='6S,5+6F4 '69}"QPh;$M ='6+,5+6F0=)hPh;$qM ='6+5+6F0=|)hPh;$AM ='6+5+6F0N49}QPh&<$M ='6+'6+6;'6|QUUUU)ʹ3333!!сis{09\~\{0\\5'6sXș9}%CX='6~Qha<$aL+6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hy<$vK='6**+6{4$='611F9tA uPh>$j[ $Kd='65'6 u։<8=2[ WVh<$J ='6)+6<$C4$8='6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPNjs8ƒPVRW&N)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh<$H='6''6tm +6yxH1҉$q1ҋ8$$)$<$$1C$I8$ '6=+6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$Wu1C1 t׉Ë$$QPV$$V9s($$$VÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPlƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQPCË$Ë$ʃQPRSH)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQj$P$$ @$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh=$A ='6 +6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=2$_|HL!ʉG41SSjhjPS% ,6N +6I4QSP +6H ,6 ,6 ,6P44Q5,6щ ,6`@#HL 9| Hh 2H< '6HX '6H\ '6PTXH fǀ$(d%=+6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=25O _(HLJ$'6$$$t!LJ^F='6$$߬$$ڌ$W&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$7=$< +6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$r=$<=+6O0 9| IУ ,6$,6='6u\Tu))У$,61VVjhjPV(,6u ,69$,6$,65$,6jPe ='6G'6 '61ظ|(RQh=$N; ='6'6 '65(,65'6~ ș)dہ|4 0'GuȹC='6tL1$PP$$5'6V1='6VhZN '61u;1$VhjVu  =(,65+6h`VW ='6tWV5+6x\(,6hhP 1@$='6h?$p='6|o5+6N,I\Tt~!NȃN׊Nd1 t1WPh]$RR7$j39u1H$Whht@P PPftu!ѡ'6t $ Q$='6u$|&+6H,$$DŽ$%$ +6I,$1$ DŽ$1h\3e+6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hP?$n='6Y +6j5,6 5,6FU $F +$^+6$~J`^p=2uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S='6uFh$ NlK`ڍOȃ$ډFd;v&h2?$Kl='6+65,6F $11ہ~U uv`щSA+6$~!ـ1@ ,6Il +65,6F=2Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5,6N uҋ+6B8H!tk)D4+6B8)Nj5,6$9sE)ȉـ1B~U uv`5,6F$CHu͋+6B8$؋N9ȉ$J`~U uv`щS+6$~!ـ1@ ,6Il +65,6F=2Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45,6;Vs2р1@~U uv`5,6F$Bɋ+6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$,6H ,6V$P V PV~x; ,6up='6t,6s4PP +6,6@,6Kd15,6s4,6,6 +6q4jPt +65,6{0 9 (,6PVQ ='6t(,65+6P5,6g +6y0(,6$ryxtG$\4T%TuCl$AP$ +6Ou$ց\TtQ!QЃyId t15(,65 ,63 5+6\TG~8^xN`1?9'$,6+$~0lj$Ɖ$)ى$=(,6$!S%Gl(,6$,69wߋ$9w$+6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9='6} $H$$$~A='62$=|j.+扄$_1#t>% +6ׁ\TtQ!QЃYId t1RP$Vh=$,$$;$$|W='69+6H,t ='6 $$ DŽ$j *DŽ$C+6;X,/$~ j *='6 $hjP9 2 '6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A)$h $l2fDŽ$2t2$_ lj$DŽ$+6H4$ $ H5+6D@VL!! $`Nd8^(W fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$2@ lj$DŽ$ +6H4$ $l$h  5+6D@~L!! $߉$Nd t1$Sv4$j2+6@0p9w Au1H$$DŽ$1$$t& ǡ'6+6@05'6V$SQP$h$l '6ɉ$$$t RP蚙$CPKT$l$hߍ$󥃼$$tA$ȃ='6CX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$~$pthj$P +6\T$$i$$ $$$$DŽ$H0$$_$ +6@$D$@L!! $`$$h $l$  +6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h +6@$D$ @L!! $$"$ $$h$l+6Hd t1$S6j$$V +6$ȔȐG$11F$t ='6$$=+640=20w4w+_1(,6$`SWP& $PjS] ='6t$W\='6t(,6ǀ\8 +6=(,6x\hhP '6QPWV='6t ,6 +6q4PP׸ 5+6HLNd t15 ,6v4t5,695,6vG='6t+6p4VVx 5,6,6@,6=+6Od1Vw45$,65(,6~+6@4P5 ,6~e^_[]ÿWjV 1='6VW\h#!Bh>$Xj&,j%%j(+6j jj'jh=$Lh=$Bjjjjjjjjjjj USWV='6ua΋\$='6t'6+6St$P 4׋ '6UPSt$$5,6萙 9u^_[]O0PWVh>$ j$USWV"='6΅ ,,6u+6H4H ,6 ,,6 ='6;'6'6+6;}FWh 00'1I!;HtG#P;Pt;H uV9R_1ڍ_5(,6P='6Wh De^_[]USWV΋L$l$='6t='6teUjQp׋ '6SPUt$$5,6 9t?0 PWVh>$j"K'6+6UPQ ^_[]SI`wD$$/'1C:Qh=$h3  .  [SWV1ۃ='6։ SjQ =2@fF F)f ^_[USWV Ӊϋ5+6F Nd t15,6G='6t,65+6PP跳 ,6yU +y/\$|$y1U =+61=U L$D$uq`|$ G`Ӊ $u щw*l$$/'р4l$skPh>$h37 =+6,6D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah?$ h?$h?$ S11҉ ^_[]ÉՁ|$U u L$I` L$w$ 0'ʉـ1@BPh8>$h3= 8ʍ 6ʍ   1$5+6$~3%)1@ ,6Il 5+6,6K= ,6Od$sC=2CNdЋT$ t1҉t$VQPR{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRL$|$ щT$ՉD$ȋL$D$VW|$RPыt$ʋL$Vt$QRP$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45+6;F8|$}X1Bσ) ,6yU uI`1@5+6;F8|$|='6t,6VPP 5+6F Nd t15,6USWV$΋=+6G Od t15,6='6t,65+6PP胮 ,6xU t)h?$&O='6(,6xU ‹l$(H $t@\$='6t,65+6PP =+6G Od t15,6w+6 ,6HC, $9r%UQhV>$] ='6V+6 $\D$jT$RPQyD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5(,6W+6\Tud(,6jpxt$0t$  $<='6WV1L(ɉL(@ u1LXɉLX@ul$(,6jpxt$0t$ $,;='6trUV胪1tttp,TtDpC u1Cu) :% $D l$hVU o:% $D9Pl$+6T$5(,6p0^_[]jg j ` WV։σ=2ȃ@PQRY ='6t'ȉGffF=2u GffF^_fUSWV$8tW5 ƅuWh՗"j菮 $$<$4D$Phd@U tg1OVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh4$t$HF 1 ShE"U CPhV"U* C Phb"U CPht"U CPh"U $@D$t P% 1-Uhzd@$<W t1 VhedAW hjU D$ P$4doD$, 9L$L$9u0$S11:8tx$0h"b$11҉ $ƅ*ŰP1j PUe ^_[]$0h"jB USWV01ۍD$,ShPSu=1NtAljSPSWuWw uMU D$t$$$Q1e^_[]fWVt$|$ VW t$?/tWhÈ"#Vh܈"#^_Wh"j{ fUSWV|$$\$(SWt$(t$( )jj`SWI~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP/E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV> 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^4$qt$Vj $u Vh4$ D,6T,6%P,6ʼn߃=<,6~VWUt$h4$|>9|Pt$t$y )σ}4$1 4,6-0,6uU-4,6uY5T,6=P,6D,6@19lj| 19ǃ| 4,6u 0,6͋5T,6=P,6D,6ˉjURP=L,6l$ H,6uA@19lj$ $t$u hX,6h3$jPVWv|$wext23$2fs3$ Wh"hX,6h0'VhX,6h3$} 19ǃ} h5$ L,6t$VUt$  Uy t 9t Vy j&USWVӉ $E|$j W\$ S~ Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph "1L$8ɉ׉u L$8t 1@׉׉|$l$ h8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h0"3QPWUt$t$hQ" QPWUt$t$h" t$t$h"jg WV`3Pht@$V 1GVWjh"軲Vh1'{WdUSWVu} D$8jPc=X065\0654,6%UUUU)3333!!щ%i0,6BD,69922T$u tv|$΍Qx06|065d66 h66VT$ p66t66ډl66P…Ƅ!) x661f1ҁ‰t$$r=T,6P,6\$9D$ 66T$t061t$$ËT$ u׍؉)9H1D$ 1L,6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣL,65d06`062t$ƺQ=|66D$66D$ 66h06D$06061 06506D$8060606S060606N506060606[06Zf06O f0606 2f06\$H$SWq 93rWh06:n 58,6|$t"V賔YjVh06 106`46,16(1606D$06 d06+ t06 1҃r1I1506~σRVPWz5d66H19w+566|$OL$)9r΅u 06f5.1654,6566V66YVjP GD$AD$ 11L$\$06t06tn06tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 66@06t .16 66@ 661H66L2 66D1\$;|$t06)á66f\0 66D1 06u\$fT1 66T1fD1L$ G;|$tD$ 06|$11t$l06p06=<,6~i 4,6 i{50,6Q5T,65P,6PRuhgB$ 06 4,6506PQWhB$66@d66661QQjhjPQX66I 566jP =@,6ukT,6 P,61! V5D,6 1N1Ƀ *p&Fu  1@D$$=<,6|>hE$ 2=<,6|(L$ 06 t061PQh]$PPD$$j39u1H|$LWhht@P覿 PPftu!ыt$<,6tL$QT$=@,6uL$L$D$ 1D$L$ 11T$h\3R=06t$tX06tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f506061t06 566D$ hh`06P0 5d66|66P566Vt$ =06=t06 x6615D,6ǡ66)؉1t$ P =d66Wjh66  |66H9|$u_d06506 t06)ʍZ9s1Gр66B9r)66VhP t$ 1Ƀr!11ƃ66Cω 9rωp 9ǿs"ˀ66CI 9rޡ66L$  x661Ҹ66Pt$ 506Vj66P 66 d66L$)QhP u166@ u桐66L$ D x661Ҿ66Vt$# 5d66jVs =66tb1=66t 1276F;566r⡐66L$ D x661h665d66 G;=66r=<,6t$|\tX=06te06t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=@,6|$T$T$|ʉj.t$몸_1#|$|$t>% 06 t06jQt$,Ph=$(T$;D$_=<,6* |66t=@,6u&D$ D$D$j 1h#~ j =@,6d=06106$hjVU fF쀁fFD$8FFFq fF5d66 ׉؉t$ ֍$fBt 06$,F܉VDF81 L$ F4D$4z x661CL$ =d66WD$(\WλD$S566tPjt$0H .16 9`L$97|$0Nt06L$,ʋL$(T$|661GL$ T$D$ 06D$06D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP" L$ D$1t$V x661CL$ \$.16 66=d66t$,9sD$()QjP t$L$ D$41ҋt$(VW'V\$Yj=06t06t +232$2@1=d66à r t$hhjV  fFA>fFd66ÉFD$8FFF x66fFfFV d66AFmlj\$r*D$p1ۋ d661zC9uߊ x661h665d665d66f582|$D$1ۉt$ :2x1ɉt$)r򍀝66RQP Wh4266V衧 4266D$ f66 x661Vt$ \9\$t5d6682D$ CiL$T 1VhVD$pPy 9506t06t22#2fD$TAfD$V 2ƉD$XD$8D$\D$`D$dY fD$lfD$n x661@D$pAD$| x661h665d66iL$Tj f061ۃ=t06 566<hh`06W3 5d66|66P566V 5t06 x6615D,6ơ66)؉1WP566566Ke^_[]hC$hD$ FC$h?C$Ph=$PhC$hD$Vh@$Rh@$PRh@$hVhA$hVhFA$RVhpA$WhA$VPhE$hE$vjVWt$hA$ghB$`hEB$Yh>$Rh-B$KRQhB$BC$1pC$'hC$hC$"hC$h$D$hC$hTD$ hC$hC$jE USWV66=06tr06tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(66Ѓ06t .16 66Ѓ^_[]SWV=@,6u0׉΋ D,6\$QPSt$ 5\06f 9u^_[WVhE$hE$j莇 USWV=@,6΁ 67u=t061 d66 67D,611;P,6-T,6ǡ4,6t069v@1Sh3'8!;HtH#P;Pt1A xVWh77hP$D hP$%Xh3x881B 89888@88x8888|8888888888 88 uCء88HA8|88DA8 x88 @A888 8888 ؉+x88|88D$HT$Ll$H88+88D$8D$85X&v?|$ D$ fD$l$\$4l$ D$4Ӊ 8888\X&wh67 hB8lB8 8888pB888ʚ; 88886eĉ8811ۋlB8hB8D$T$ ؋pB8|88D$x88D$88D$588L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05X&\X&t$v 8888588=pB8|$(t$(|$D$ fD$ l$ \$,l$|$,=88ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă588 88=8867t 1A67y787 879}(dB8i-@=B'd87@9udB8e^_[]hIP$h~H$j,k USWVh88j 67X&\$Du{'-8888D$hD$h5X&\$Dݜ$݄$hx88jr u{(-x8888D$dD$d5X&݄$\$D88;67D$D88 88 t]+ x88|88$$߬$88+88D$\D$\5X&dX&s=88uZ67tQ88 88 t5+ x88|88L$xD$|l$x88+88D$XD$X5X&wD$DD$D8867 X&w١|88 x88 t>+ 8888$$߬$88+88D$`D$`5X&D$Dw\$867$fDŽ$jhT88jA D$8 X&|$&D$& fD$Bl$B\$Tl$&t$Tj$PA SD$lD$lPD$,Pj5875875677A <hx88jΫ 87D$8<BC97)؉D$D$8 T$4'\$A9 88I؉L$A 88Iff9u888898|88 98x889898 98u88 98|8898x88988867 1D$1 8 8l1A hdI$Oh3A67<1A t$, PVhI$ ΍T$(jt$>PhlO$D$ 67t$؉T$΍T$(jt$F$5'hL$΍T$(jt$JhM$2΍T$(jt$bF$4'hM$΍T$(jt$$Fft$NfQPhVN$ ΍T$(jt$؉t$hqN$΍T$(jt$^؉t$hN$v΍T$(jt$z0FT_hN$G΍T$(jt$9FPhN$΍T$(jt$ ؉t$hO$΍T$(jt$؉t$h O$΍T$(jt$d؉t$h0O$΍T$(jt$9؉t$hT%T΍T$(jt$X؉t$hDO$)΍T$(jt$-؉t$hYO$hN$PhN$L$lL$AQ D$iPh*N$hhM$ hM$hN$KNhLA8hAN$1t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظJ$L$dT$C;88u#Ph88QD$XL$$ D$L88PQh88} T$ҸJ$u1GJ$T$P2L$r |$ rId3H d3~\3H \3 h\3j (  }T$A{^N2D$ˀ) hJ$yuPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhJ$ hJ$9 |$ sSd3H d3~\3H \3 h\3j   }KF߉Ήs(T$hJ$WL$T$؅t%d3H d3~\3H \3 1I h\3j h\3 zء88;67*؅tء67!^L$AQ T$Q= 98 98 t+)|$L$p|$tl$p98)ЉD$PD$P5X&(98(98098098H2vH288v88\$CfK%898f!t8A8 88T$ .KfKf898D$ P88@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$JP88@)t2(uK RQPh]J$87;87}0u h$Phs#Cы\$1B\$D$\$D$T$jhmI$jZ 1AhE"WV&888~b8888 d3Qd3; t3h\3j.788 \3Q\3.H 88by`)8888 d3Qd3; t3h\3j88 \3Q\3H 88|tN=88t4d3H d3~\3H \3 h\3j i8888h\3ksh3^sx8888|88888888Ț8^_jj1A1=88PkUSWV׉E\$1AM67]E uWVhJ$踽t hJ$觽ShJ$虽67t5@D$ X&\$D$$J$]67fyuh3j0e^_[]UVh1AtD$77$K$ 88D$$ K$88D$$9K$߼8A8tD$$OK$Ƽ88t9+ 88} $`K$!L$LD$L W&D$Ht$H\$$K$脼$ 蘻 8867 8A8L$DD$D=(98@|-098 X& H2 88\$,D$(\$ D$\$D$\$D$$K$û67 98 98 t5+ 9898L$XD$\l$X98+ 98D$@D$@5X&88 88 t7+ @A8DA8L$PD$Tl$P88+HA8D$L> QPhO$l67tkD>L> QPhO$F|>uGD>67ufPhO$p"L> ffPQhO$L ^_[WV67u8jjV t'86讴 PWhO$hhLA8襶"6艴 Ph k$hhLA8聶^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ hR$j $t$t$ t$SPhP$Y UPhP$? t$t$t$ h(P$&t$誳 Ph:P$ t$ 萳 PhM$r0G9s'GPh"̶| KG9r߃$^_[]fUSWVԑƀ8-uFh"V!u tB8h"V1u xB8T$,11CD$D$hOR$Rt$0\ Hw؉$H5'\$̃duE뻁뱀=tB8t\랉\$떁댁낃u1 31;L$(uj|1L$ 1ɉT$Љ $PPKL$Au $AP|D$t2ڋL$ PW6 WKf uމ$DuY|$ujD3 Džu` Pz$t8=tB8uIj Vh" WhXR$T1FV薣Ph k$VN SU* h"=xB8Mj Vh"茣 WheR$V腣 \$_1#I"R$VWS+ jjVWS\$uH& 1GWW΍WjÍWj踍Wj譍WV融Wj 蓍VW' u hR$jN jj' u/R$8jz u% jg j j' t)qtOQ@ j jt' uŏR$8t1Aj jh"C ukWhR$jhR$t$U@) R$Q6j0WW' S$t_1#V詡PSh4%WL SWhwR$jˡAVe6&=tB8u_1#蚍VPhS$h3ɴj迩fD$tPhS$ah7'PhS$h3茴j肩USWVPu } h7'WVW cR~5StET B8͍Hw4$5'B8벃LB8B8둃ftTdL B8tB8eB8VB8GB88B8) 3 =B8=B8tjjhH"%$ B8ND$ jjj"< B8jL$$Qh@hPR~ u hq%P4B8i )ލ<S H $5'=B8t1Aj D$<1CPS-D$D$ PSD$D$$PSD$D$(PSD$ D$,PSрD$D$0PS躀D$D$4PS裀D$8|$ |$z |$o |$ d |$Y |$N F B8D$8gtj5B8% rD$ D$_1#D$D$_1#_;-B8S t.H$1ۃ=B8uWhqY$hUY$hT%p >h6&S0}g =B8uh@Y$h(Y$hT%3 1CB8FLCSS H3 VT$W$5' \$@1ɍP$6'B81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12B8#B8L$L$# 1AD$ PD$@PD$ D$<+B8R D$ Pj$B82B82B82 B8B8׋t$#D$ PjB8d$zT$ ED$ L$TL$@JL$CB8"2-L$#d$d$d$L$׋t$B8:C8@.C8"B8C8 C8\$ (C8B8B8 t B8t B81SSP螷 L$Y\=B8j$)/jD$D$ D$_1#D$_1#B8L$9a|$u qB8 B8ta|$  ‰4 D$=B8T$tD$1@D$ 踆1ۉD$0訆hxSh0C8ւ atgcuL$3C8 8C82C8E8@E8DC8B8 Sh#hY$ hY$hY$j$> WVT2t#|$ T2WPirtFuT2F^_USWV,׉1l$u5B8V5B8u D$ VPUhB8WSS|$G"ww Gw\$VVSVjW4D$t2Pgj1PPSVjWb4l$=B8t'hZ$ =B8tt$ hV$Ԣ1|$94D$=B8tCхL$% D$@B8t Ky9=B8Cx$CD$CPS5B8 u~87t 9D$=B8u{=B8t i5B8jt$ PNW$Pޡ$tH@$5B8P|PNW$P襡hU$% 9V?yE~t7tuY$X$Y$ PLPhW$1G,^_[]Ph%W$hV$ h E"hV$jl; USWV0=B8AuF8,r!47'h"PhXW$辠aPhW$諠PhW$蚠F<5$6'vvvhX$mF|$(QPhF8'RWh\3PW\hX$/F( 8'QPSPW`h\3PW!hX$F QPSPW*h\3PWV xdvvhW$讟 V!9't8'~ h9'tF\$(RPQhSgh\3SV e^_[]FPhW$>FfhX$F h_1#PhW$ F|$(QPh8'hW6gh\3WVƘFPhW$踞FHfw6$<7'hW$chU$荞Ph[$zPh[$g6hW$'hW$ hW$h"ChW$/1H9vh [$ -NT$(PQRT FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPhX$距D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$Xh3X$PSVhZ$Ch\3FH^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV>$+D$  P Z1PPWSjV$|$dt$ \$h[$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy92tE2P{y$L$t hH[$hmT$QQh%PPh2[$Б C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPh[$  d3H d3~\3H \3 h\3j ܖT$h9t$h h[$ L^_[]hV$ jh[$j+ D$t'T$tt hH[$hmT$QQh%PPh2[$T ËD$t%ug[$%tuW[$Phq[$N[$a[$PhZ#USWV|$<\$8D$4t$0~u/jUH u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWh="dPh k$TPWho#C ^_[]USWV|$4t$0=E8uME8hhE8t E8'j.hE8=t@hPhE86& t"^tCt0Wv`rhh!%hF8% ^_[]1w)ȉPjQEg SVUD fEu jU"G WUu&VhG8Sh[$hhF8谌F8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhG8Sh[$hhF8@F8[SWV$L$4D$1GD:'t$"tZ@:t9rD$Ph[$S,^_[SWV|$t^D$uFD$jjP t1Nj0j.V;t@hE8P[u7ut${ !%hVhF8/$ F8^_[VD$L$ 1Ҁ0QRRhhF8VP[ thhG%hF8; F8^Au yuyt$Qtu ȃP#} Q{ APh[$hhF8辊F8SWVD$G8Q4[$RG84[$RG8ƄRG8.r|I]$G>1AFL$ tWWVWh;' u;D$ D$ PFWWVD$Ph;'P tt$}VĨ ^_[]h>%t$ $ tԉ1|$l$Vh$PVSFHt$t$Wh|dD$P8C \$tN1D$;D$ 2i9t$sVt$LPt!ʼnD$t$Wh|dt$B ul$$WhedAPB f$a$>ukSt$h"h%h$W?|Ƅ$tH85]$ ]$tX$QPWX} $Kà9Éu|$$P 1h>%j Å~A1ۉhFj"P}KujVh"h4%h$Wi{Ƅ$|$tH8\]$ ]$tW$QPW| C;\$ mU"T|$l$|$$PUSWV v ujsD$$D$<$sh]$VJth&%VJ3hU, Ƅ$h&%sGJut s h&%VBztt s h]$V"zt P# H8D$ h]$VytHáH8th#PI(j,S)tZ S,PD$PUxD$!=`ÉUh k$p S?Dž?tG<$tSWUh]$h{%h$VyV tEUh^$Zh]$ ?Uh^$hn%h$Px15H8ta$|$SWQPV?D$D$ SWPV;?t$$Pt$h`$ ra<$ |$<t$T$7jj h_1#QPjR 9\$؋|$ T$2jj h_1#PQjR蹿 )t$ \$Ojj h_1#VPjS腿 SD$6PD$?Ph`$2D$L$,PQ D$$d#D$<T$T$SRQP>D$D$L$ St$ PQ=+|$t$$ St$ VW=L$$QPQt$ Qt$0ha$pt$ $ t$,t$ \$WSPQ=D$D$t$ WSPQb= $)T$T$D$( WSRQ>=$L$$߬$ $$L$$߬$ W&$L$,L$ L$dL$L$LL$L$@L$\$D$D$Xa$$^a$o$D$ PWG1Ge^_[]hZ#j h E"h_$USWV $ $ h{a$VW* fu I8t R1ы 39<$$\$PhV  &$UV6d tJD$PUDt>D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$ha$h$Sl\$ =I8uD$G$D$ P$P褄 lJ8\$t$Pha$aI8PU uUh k$:1@$~#Qh~a$%1@$\$$$Ĕ ^_[]$Ph k$j SHPha$h3o jydUSWV L$I8$T$t-I8*jhI8: I8šI8$T$1i E$48t!u6$t$P ;T$ uF$t$P:T$ tEM<ǃ h3$1 ^_[]ËD$ t 0I8$4$݋D$ t 0I8$$ؾ I8Phh I8 uh I8h k$j* fVD$t.})zhJ9ha$5%p%;'PQh4%5"Ã|$t!hc$hc$hpc$5"WDth#WDt1H71@1L$t&"WQhc$R4X^_hc$hԹ8t$t$\$8Ã|$t=l8t5"uhkt$~hF>"WCt(h#WCt1WXm88F>"ȝ1Hk8#Ph d$5"VAt\h#VAu$l8#Wv~l8vHM8hVW] =4q8l8l8=4q8t?F>"?t5 @#t5l8RPhd$QUl8#5"W@tOh#W@tBWPy7vhd$5" щ Hq8PVhe$55%VJ G9$uVh k$Zu jT9^_[]ËD$t8uD$L$hg$PQܸ tD$L$QPhg$ 赌$8ËD$thuD$L$h%#PQ茸 tHD$:D$L$hb$PQh t$|$D$pphg$Y Ãt5$8VD$t$5l8l8u hg$wY%$8D$ phg$PY5l8^VD$Hr辋$8>5l8l8uhg$YD$ phg$X5l8^VD$t$5l8l8u hg$X%@$8D$ phh$X5l8^Ã|$u|$t$8Ã=q8t 1PP)jφ=q8t 1PP j.9|$u|$t謊$8Ã=q8th h$XV1VVcV8VPD$ D$t}uD$p*K$8"t#D$ phF>"V+t.h#V+t"#/1l8l8##1@l8l8F>"F>"PQhh$5l8$8^ËD$L$l8th$Rhm8QP$8m8ËD$L$l8th$Rhm8QP$8 m8SWVt$|$l8th$Phm8WVs$81ۉm8l8th$Phm8WVH$8 m8^_[hi$h8t$t$$8hi$h8t$t$$8USWVl$|$$9~1H^_[]Ët$ ~h^+%W)t.h_%W)th;%W)u1C$1|,vxǃuv $o1FVjuD$VjftR|=m8$m8|$$t =l8t/"5m8QRhi$P<tR|= m8$m8|$$t =l8t/"5m8QRhZi$P.<t$j訟Vj蝟1jt$ t$ M $8Ã|$thhi$Ou5=$8u)=l8t5%S UVS SC $8S= V4 n|$8^_[]USWVPD$uD$L$hb$PQ/ h#f$[tǀ8u0"WÃP\|@CSWP= =88$-8l81l8888L$Pjhb$qVhc$h=8-8$8l8V* d{$8^_[]SWV|$uvt$>hJk$W t+hd%W t hQk$W u: 1Cv]tu&6hYk$5hlo$P(t$Dhvo$$t$踙 $t|$@t$t$@ЃD$;l8t|$tt$UD$L$d-$`-$*.$t.|$Htt$H D$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=l8t;P D$HL$H+l8tD$Ej/t$L^ t@Pt$Dho$t$HD$t$象l8L$D|$D$818888$$9l8t1$Pt$yu$\$` 88|$py8p$h{"t$L薸D$|$t$E$QPu5$8$<$$$\$` 888 8t+t$j5858PY=l8tPt$Hh$p$5 t!b$. h]u$}'6u$ uu$u$$X$V52'j $Pt$01# 88<$8D$D$\D$ D$X$ًT$ D$t$|$hIF#>|$/D$(8*T$ @ً\$ 1T$(1 $RVיDŽ$8$P$$t$(賑NjD$D$\D$ D$XًT$ D$t$u$wD$`]j $QP! хƉ$$$8-@D$(j $QP! Ӊ9$$$$$D$(8/t$HL$(x*\$u4$j $PQ)! ƉӅ~$$D$(8$$8 8\$|$\T$X$$$$JNjD$PtPD$PWD$PD$D$\D$ D$XًT$ D$t$\$߉$(Ɖ$ ˋD$X$D$\$$X$$P52$$$$($$$ $$$g$$D$8$D$4$ D$0$D$,$(1@$΋$  \$ۋ|$$7 ;. N8H N8 h7v$ \$D$ D$8L$4D$ D$0D$D$,T$1@t$|$$L$<$$D$,$D$0$D$4$D$8$t$t Wst Vfߋ$$$$$$$t,% t$ht$hhr$ " $$ˋ$$Hl8;D$M|$@h jt$hjt$dq8? ;N8v+ N8tQwdq8N8PN81l8l85m8$t$jktDŽ$j&lމ|$`$t$5N85N8T $jD$,P5N8芒 \$(;N8W8"NF؊ u@;ut tH@D$(h#P.-$$u 1É.1ˉ$$8$4=m8t/j$Pզm8։щ ыN8uN81ى߉$$|$`t<$;$$|$$$$$$5ʋ$$4$8;$$Ɖ$|$$t$Pj5N8$L$T$Pl8l8$)$$N8T$@R1Ot1$VSW`~ $u*j#tu'VSW6~ t߉$ȉ)u$$P9=8=l8$T$Ll8$9=l8}#Ή5ډ׋$$|$N8‹$4$8$ m8ˉƉ$D$@1S$P輣$+$$$$+$ى|g@By)Q9j$PW$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5N85N8W h#5N8M|$`=$@$Dt$hgI#~|h#t$KD$8|jj n$D$@hV"P0O D$@|$@DŽ$H8 8 m!ڃt9}M#$H588$$!;$$=l8t5l$,|$ $tc?tTj/Wt L$9uut$@jh V%VӖ @L$ǃuC=l8taD$t$uI$t>thMw$V:1Ʌ $t}thMw$U1ɉL$<=Dq8=q8t 1PP=Dq8|$DhPW |$L$D$L$D$ tD$ D$$=l8l8L$QPq=l8q8t=ut$8t$8t$ s t D$,t>D$Pj.3D$T$"tQPhTw$ "D$Pjؓ<$l$,|$u'j/VQtG1|$t>tFhh &l$LUɔ l$t$1l$ -9D$Pj9-9*x1l$,1Kd}Z<$t3$DSVWX Sh V%W SUW <$hh_%t$LV t$l$D$ D$<4uT5l8l8=l8=n$t)c$hP|$LWΓ |$D$Pj@5l8l8uj/U t@ʼnD$ D$$=l8tAD$PjN?>uP=$8uDh3jhhw$薫)1D$Pj腡8$81ۃcÍL$%L$0d؁D^_[]1Ehw$=Phw$h{w$j蓕 USWV օ\$ |$$jh7o$Q l$t=jhGo$U˔ t;jh?o$U跔 t9T$(.C fCPC fC C 1}Gt$j/UE$t9lj)CSyS\$$UP͑ { uG<$WxC Uxj@V|$$tZ{ u Dq8w@P|xƋ_j:S跨t@P[xG_Ot[uUnj]Ux$tYÊ@t<:uL)SUV| Vȉ,$}:1j:V&tEt$t$Vhfr$1ۋ\$ t3tHj PU }t $9ut=s fCt$t$Uhr$ CC tWt_ukl8KUVhVr$  t$t$Vhr$~ \$ n1HJ3l8(u_1#UvC{u{ !V%t V%PvC1 ^_[]h/r$jv WV։2vvvGvvGF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=8q8t|jj KMD$~h{"W- D$|$nl8D$ D$3l8u NjhHU8j t$jLD$=hq8l8xP[ l8|$tt$ D$j$8l8=l8jLh{"V"D$|$t~D$ ] D$fxtD$xD$(PW^ux.#D$0=u$$ 88u hgy$5|$ tD$ t$ЃD$t$1t$Vl8=l8 Pj#I%hy$hy$h+hy$XSWV |$$D$hc$W褮t D$c$=8b$tb$D$l9ƅu=(9=,9 4F95p9t jVuh{$j$=q895p9t jVth@Q8h~$t$ jhQ8 jhHU8 hjEQ8hc$W萭 lq8|t1@v5Ɖ=l8~&t =q8u%h|9h#5a uR8tH8#thn}$uh}$K P8t$4\$8VS5l8hB ǃu+8t 8#uoVS5l8=B t׉5l8B =l8t$jWA ut:|$9uD$0jPjjW芚 V5l8Eh}$P5l8A l81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ Åy:8t08#t )͋u|$Htal8 l8; $D$|? 88 )$fz$R|$0|$8 81PPPt$  K8=8|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q P螛 t u\$,ى;=88|1jPPt$ w \$0D$HQPD$~ Q P! " t ]Pj til8 l8;L$D$|TP VWJ8P,P J8VPSP VUJ8PP 4$Vj=P8tP8jփ^_[]l8j&=8q8t#"t 0q8h$~V hln$PtFhc%VtJhrZ$VtU th,#P輂131N9tQs8q85FA\t"uAt""tFAQt FAAtF58 ع8;$8 ع81tu 888^_[]WVt$ t82t2VPLtuVh$j< G^_hÂ$f=2u  2|U$1ۉ___ __$PWj| 1@G ____SW|$ S\$M =l8fDŽ$ 8t$Ph k$hQ蟞1F8 8ƒ\$x|$|l$xDX&ݜ$݄$ W&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh$QP89|ӡ8tPL$ 5L$ )΅~DQ4))h_1#Sh<='Rh $QPvƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4$>'QPh$SWL$(+ 9T$, 9\$0+ 9x@BD$ډL$hT$ll$h|$@l8 l81G؃D$@5W&vqL$`\$dl$`DX&ݜ$ܼ$X&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4$>'RSt$Dh $QP 88ȃl8l8D$u݄$|9s0;T$ D$r$|$\$|?؍<)hB$؍<)h5$QP N+8 8T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$%QP7 4ų <)Rh="QPùų i)ƍiɉk<)ι)VRhO$QP虙ߋuu <)h?"QPo ǡjhq8 VD$ B J1rrJVRVG $^Ã0D$4L$8T$ 1ɉJJJ JJQRP|u x$1H0Vcv0jRv0^USWVh=l8u=l8u }t$XjV3+ 9~= 9N+ 9y@BD$HT$Ll$HL$$D$$5W&l8 l8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и_1#t#|$d58PRQh]$hW5|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ_1#r#+|$QRhp$Pt$詖$ų i)s<$*<$Hrr޸t1@D$))kd΍ 'VSRh$PQR4$}l8 l8ЃD$Pv?8x6ϋ 88\$|$׉ʉ<$=89߉}kg+|$Љ|$0D$4l$0D$D$($D$,l$(|$ D$ fD$l$\$l$ |$ų i) $4d)h$QPE s $(d)Sh="QP Nj$ik<)'/tу&h 9Pat8h 9h؆$螥 둋th}$PXat2 9H؁tȍL$QPQx D$ ?x:$8!h 9$ 9H؁tȍL$QP~Qx D$ ?)$8h 9Q$=lq8 9APQ~ PQj 9 t tʃ  q8t= 9CAPQ~ PQj 3DA@uCr 9븿|9 uJq8t~8 9CH 9|9ush 93E1Kt 9APQ~ PQwi 9 tu7H 9| 9| 9 9APQ~ PQ+i 9< uq8;H 9t{t C9uKBq8L 9$1K $9$$r(!Il8tOh)m8hυ$E;t%5 9g1$5 9HQP~ Q PgʍHr̃t"1 9HQP~ Q PAg\t"u5 9HQP~ QPg 9Gdu 91G 9HQP~ Q Pf[~#\uE 9HQP~%Q'H wr? t:,u3Pjft% 9Gdzh$( 1N 9= 9i!%X>'h 9P[tu :v2USWVՉh 9Q{tDj.V;1ۅt6UP{u&)Wh 9V& u1ۀ 91C^_[]SWVD$=q8t5$9h $5 Ɔy8 y8?)PRQh35 x?t$|$ ̹81; ,q8 ^_PhY$ ^h{$t$h;$5h$h9 r1ɀ9.)h9Ph$5h9h>$53;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh6&PO ƅu 4$O 1$^USWVHuI\$ $Cj j ShWuu > t "hVW j VSs xq8]t/M I9Nt vuvvS2 jjSK ƃPjS1 \$fD$=Tq8~%|$@jWTq8O$Cuu S VjP 1D$ PWh0" D$ PWhJ$hX$ J81\$@jPPhSvv== thh"S6 nJ8ShE$q -D$ PWh$DJ8$\$=Tq8~N1PD$P T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,I8tI8#tj}udI8AuZku<FD$ t:D$L$ PQhhu: t\$ ۋEu Y AID$ PWhpp$? 1He^_[]\ t$a+ WV|$h.#W:t.h6&W:t!t$?tt$ h$ 1F1^_r th$jc Vt$ Vt$ s t^Vh.$j= USWVHE ML$8t$QPV DUt$F|$USWVPt$$\$ l$|$WSU tUn| u2HDeO,1t$t$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV @h1"Ps3t+h1"Va3th1"VO3uT%9P%9u }h$VWv Hσ s У2߃c u1T%9σdt ltntFP%9뵈X%9P%9맃t Vu% 39u=P%9D4$9-u yt$$PQv1ۅtz<$uaP%9tXh@8uNWƃP*MVWP* 3.gz$PS߉ޅu4$hm$^$%=t0=@Vh|$=P%9G5`%9=P%9jV DžND$PW:"$$P Vh$D$Vh$!t$$t SM:NvB11BW%jVe $=T%9$uXh$Vh4%PW`9r DŽ$.gz=T%9uhh W ) $D$D$P D$ T$4$ =T%9u@D$ #D$Vh"$Vh" t$N u h$RV蓂D$ !=t D$D$pD$5`%9hVWx W|<ǍWh$/tI=T%9uCX%9u:Vh$H$Wh$h388jD$P|$WO t $Vh׏$b1PPPW\%=T%9$uL=X%9uLhh W+ ƒu 1@P D$ 1@P T$=X%9u:4$T$WjVVh$F$P t$ $T$ V1PPPGD$T$4$p t h$uD$ tPM t h$RL$#L$T%9tGujjW9 tV$PQL$mtNWhK$4$:u W6Vh$aWh"jWh&$ $l$pT$ 3T$ϋD$1 u V4$u $Qt$Pt$hp$4$G $Wh E" $1B1P 5\%9Uh>'h#h3` jUV3h>'h#Vi` !9PhƐ$VU` jKUUWVD$Pjx2=X%9t0#D$1=uT$l1h$jKh}"<|$VWj/ tt)u1)tu4h$6e^_]ÍD$t$1B1h$PjVh $PD$L$ $QPG =\%9u \%9XUSWV׉ˀ=d%9u h$豓 t$d%9jjjS!!ƒt7jPSR tuh*$ql$h*$11PUVWhD$R\؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ PhS$jV]ZL0L0D0.VhZ$h\3 ^ Wh%@#[^_[]PD$L$ $QPp =\%9u \%9XUSWVpT$hL$lh}"}hf"D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$>'1@ɽ9jD$0PbtŃ|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0'Uhx$T$+\$ |$_ $ ?'Cىt KDP@uD$ 3|$1 ,,C t ^DH@ujGt-Ê 3DA@CCu 1OD$" 83L$C CDP@uʃ;K}/ K>C<\W O Cj$jfGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E79ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$SD$p/9$$ D$ PhW&  hG1$C<\  Cٍ$ j  H$$ j  Êt3DH@tKCu$ D$VVD$PV6z Ǎ$$ D$ VVD$PVy6T 94$ =,31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$p/9L$ QhP p/911 |$ 1 $RO5t1BuڋD$8L$ Qj P!5 Ǎ$Pj t$5 ^ŃuuD$ L$ }D$HPQ4xWt$ P` $(4$hUt$P> L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[E%j $( PSU %%8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =79 hh V EKCDH@uٺ$yG=79 GKoCDH@uٺ$KfCDH@uٺ$ GQC t _DH@u?%ƋD$pW(@1҉ϊ@usFCDH@u\.tDH@*Bhxjh$(Pv 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,p-9t!9}uEpV*mj p-9xt$p@ p-9>GWVZt$F1Ejhhl%92 Å1|$څ,579579hJ$|$t579579h-$h%9 h%911579579h5$(579579hn$Q579579h$579579h$579579h$jj 579579hؒ$579579h-$579579h[$579579h$n579579h!$X579579hÒ$B579579hב$,$P579579h$Sh k$9579579h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u@9_NSFJ1s9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ SK. uC9,@9s,@9؃^_[]Ë579=79SP PWVh$jx USWVP׉΋$1m~ w]$t*j @x 22>u)jH1҉P52 25ojnH@28 2>u j5h%9h\3 u 79P/h 9"j PPh͗$h3:j/USWV\$|$t$ 791EtB579WVJ 7979579x17979Ht8h{"p:79 79I 79Kph,#jh796rf79"79 ...797979@79 79 =79u798#uxnu 79  79W1 t,E-79@J}7979R)ʉ1ɉ799‹\$k791m1 79Q79u>#u~nu 79t791B C1ɾ8f 79@791ɋ\$u79\$t1A ^_[]ÉQh k$j9 USWV|79uN 7919u:=x79u793379}$79\379 9"791NHQPP179=3P =79tC79SPVS579 th79579* o79=;9tM79t=\3tPI V79579h;9Ԫ ;979=79t7979 79@7979=x79QP?rf|$x798t0W57979VZ W5x79V =<W579$V( W579$U V 螿UF PWVh$Wh;929h;9T79޻t=\3t P hV"h;9679rH9tt$t$P說 79H9tȋL$!QP褪 79;9=|79u797979\379 9"h{"Py579579h k$) 7979$@1Q579Pi 579h79h79 ƅttb79|0 uNt$@ $@ $QV579P791@|^_[]579h k$j 579hU#h$h$579h$j hw$hw$ =;9uh$ h;9Rj(hS$벡79@ u:HQP~ QP t579PRh 1=x79t |79t SWV79X1t^h{"33t&Nj@HOWp uW[뾋HWPg W1F^_[Vt$Vt^VhW$j Vt$ D$tVPEuVhc$jk V^WV|$t$ WVt^_WVhp$j7 SWVP\$|$?9t PyD$jPSW+ PL?9VPSW ?9^_[USWV79jh?991FD$?9h%9 @9JBtOz T$R uW|$+;A ?9?94@9ыR L$y th|$ 79)щ;HT$7D$t{T$A ?9?9+4@9. 79;H@ ?9?9|$to4@9u1ۉ791;A791;AT$t1~T$ 4@9=0@91ۉ__ WjWSQP.B|$t4JT$B8 79;H` @9T$4@950@91~>~ VjVWQPA1FT$14@9=0@91ۉ__ WjWSQPXAT$t tCsBtt$u 79;Hr @9xt$t791BtȉÅQJA7$A'=?95?9$=?9FPj W @) ?9QPW h%9Ҿ5=(@9 (@9R҉Y = 579h5"579- u 1Pjh?"?9S1P5@95@9)1Pjh?"@9S1P5?95?9S%1Pjh?"?9S1PS =?9 T$?9=?9GPj Si ƅ ?9D$4)أ?9?9 5@9@99a@9j5@95@9h?9j5?95?9h@9 4 579r%  T$?9?9D$<=79\3=211 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;52r579jjh<%579j$'> 579j > 1-RL$ tKQD$ ;2r579jjh<%1579WjS}t$ tsQQtejPhB'r tQF;2r579jjh<%(1B')˜$Ph$579* Z;2r579jjh<%1t$ D$13Phʘ$579p* F9ut$ t$L$)42F9r579jjh<%n579j$< 579j < 79@ @9  ֡79 ?9u55795?9j5?9=?9t579j 6< n jh?9Y ?95 =?9( 5795?9j5?9=?9t579j ; 볋5@9@99@9+?9T$JQ4@9T$ut Q;P ?9T$I4@9D=?9yBu%hh r> F 5?95?9P虘 ;?9 jh?"ry  _ T$=@9ujjh_1#h@9 ?9D$0?9D$,?9D$(?9?9?9?9@9?9L$(t$, @95@9L$0 @9@9$@9 @9=?9_ ?9QZ=,39?9 @ ?9 ?99r @9֍@9@PQ@95@9 F@+6vFt P uF6^_ËFp vh k$jf USWV ՉL$<@98@9щT$Љ$ 30@9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B L@99r7 L@9P5H@9H@98@9<@9$0@90D$SPt$VB it}ŋ4$L$]\4$L$t&uE\L@99r+L@9P5H@9ƣH@98@95<@9F1C4$<@9<@9\$D$ L@99ȋ$r+ L@9Q5H@9;H@98@9<@9 ^_[]USWV`}$111D$hИ$u W uu5<>ut0Gtg<;u<$8u 3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h%SM# t+8ttDGhט$jb 1E L$3j the%( u3h k$jR tD$PW uh$ۃ|$ tt$Č uh$뼅tt$x uhHF$렋Cu/hb#舷 $tjh$VV VeSP)- QVh$ qPh7$h3 j UVQ t@t $e^]Vh$$j WVP։y1ɉQPW苋 V?t$8tQ1H^_=8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pV7 Cf{~a11C403t?L$qPdt+{|7u!47_3L$1qP D7EC9|^_[]Vt$FtKPF tvPv zF vvyF^USWVP1k<2~42$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùm mUSWVPk<22$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)oh3jjCh~$Wj V1=h@9XJPt*8jjj  V V6|5(Z<l@95(Z<p@9j5(Z<`@t@9jPx@9t#1ɺ2A<.uh@91 1@^USWV D$0f 9t@9Z x@9,I fEE!f ufE(Mt!U1f~ t @9ufE,$St4E,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? 3DAh3j" W@$C'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$,C'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEu#L6N=m$ 5$Z<v5$Z<v1QQPSȮvt$V5$Z<趴5(Z<\1U)19}1ۋ$p$)ŊEt9}1< ˊEE5(Z<Yh$1VV5(Z<"~UVj5(Z<~Vj5(Z<_  5(Z<衶5(Z<+= |3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h3j bxu+=l@9 l@9σqt$V`[VgVNo5(Z< Ih3j ,$,$fUuE 9|)BfUh3ju ,$T$4xut EfEuGza|1x(| E9}ED ufMh3j !}Eu)u:E t uP'uLf;}]D; jtKD; tt$4UЃF4; ~ttt$4WZuE tuP花u mE u蝴umEx@9,Et)u=E t uP*uOEtP|EEf~3M1tRRMEGЃ9|׋E4t t$4UЃulEE tPlE ^_[]It$5p@9t$t$h`$h3 ZwI$@ t$St$t$ t$UPh$'QI $A It$U5l@9t$SQPh$h3% $j USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$pxtS;tNt$Cj S覴)؃ QSVWD$pxt G}uo $ $l$Atl$|$qeKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCA G΋<$9Ƌt$ufthҜ$VSw]w|$Gu1PPw|$ GL$G)VQw wȯ ^_[]D$L$x@9 fAËL$1x9 t@9~x@9USWVl$0.t@99}=x@9DP5x@9Ǎ PjQ< =x@9ۉt@9t @tFj%PRQV|$ Ft$uMh}>%v辳;FVx$9tكaw~ ـb(Qh$P聳 t^WPS\$UF8tt$SVЃ F9u vi^_[]fUSWV|$5|@9ti=|@9WpWpG-@99v1Wuá@9t PK@9=@9@9@9^_[]SWVt$2t5@9P>21SSV.V 1NtjSSP@91ASSWQQPS0?2WV =2t@h%Wit5@9Wv>2W~1 @91^_[WVt$ w?=2t-t)95@9r!P=1 t;@9slj42^_5|@9@9@95|@9tg5|@9gVt$5|@9Q@9@9VLPh k$^PT$D$ $1APYXWVPt$|$5|@9@9@9D$$WVP1A4$^_USWVt$R5@95@9 >-@9E3\Jك@to@uwt uDZ@t< ty< =@9u =@9tI5|@9lmtj 5|@9=@9uj 5|@9@9@9@9@9?=@9u"5|@9mtj 5|@9@j 5|@901@9@9@9@9@9 @9f)@91ۈD$u@9C5|@9lt$L$4 5|@9l9Ƌt$|25|@9lVUUU9}j 5|@9||$uCj 5|@9bKVW5|@9|T E߃ @ Ȣ@9@9=@9uW5|@9kt7j 5|@9%5@95|@9O@9@9@9@95|@9裉 ^_[]t$Ph k$VPt$D$ L$ $PVP1A4$^h_1#t$t$t$t$USWVP|$ \$$l$(t$5|@9|@9@9D$,$VpUP 1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWڣj5|@9޴1ɉV,$E|$@t[D$@8tRD$u:hV%5|@90Nt$@5|@9Nh#5|@9 NWt$Dt$xs hI3%5|@9M4$q5|@9ziD$ 5|@9xi5|@9i‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5|@9M5|@9ithu%US5|@9N/)PS5|@9f 5|@9訆5|@9Ã~0L$ZD$  腏 L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP\ QtRD$(υ~] $9I\$)RPQ\ KOuLuH|$@tAt$t$D|$Wp W"oh3j D$z19Dzf tN;L$$} 3DXuh3j  $9A)RPQ[ $8GED$t+)j Pt$5|@9( L$@9@9D$t8ʋL$ u|$@t$;D$@u  $L$t$t$Po 4$0^_[]h_1#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5|@9e5|@9e$tKۋ|$,;Sm|$0L$Dȃ19AD$LD$Ut$HPo1t$PQQ Źt3;|$,t.D$DE9}SmŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PctC@j PMuL$$)݃} 9WUQS5|@9;~ƅ|$ EVvƅtV5$Z<x4$5|@9PW5|@9=DPWc@1PPWf W轁D$E|$ GWUPS5|@9}Pŋ=|@9VPW=|@9VCPW?5|@9@9@9#WUt$ Sh'%5|@9膥1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV=4$tWV,~VC:WJUP(:W:^_[]h_1#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP^1B4$SWV]^_[]h_1#t$t$t$t$USWVP|$ \$$l$(t$5|@9M@9@9D$,$VAUP14$SWt$(^_[]h_1#t$VPt$D$ L$ $PVP1ɉ4$ ^V5|@9`5|@9a^fUSWV $$$ 0915x9599%%59W;9WVPѫ 0D'Ft(=9tvvP/j vh9B>vuɸ9Й9t999hT%s $|$ h%SU>x e~o~1pMrtoCIDԚ9붃fi5<h{"V PhW \$h+B#W D jPh#茈 t \$Sh|$W u4 %0D'W_gPWV t }u몋}tED$th+B#S <=u̍4@h+B#Pf Fh%V5g 0t$VWch F49h9h9h%5<ҩ `ST$$$ Dm<$.61Wh% -u#D$=uD$h|$d}Yh%+I t41W:d t@ < uFrWA WA jh.#hʁ$Ϥ ZB5(Z<]ǃ5(Z<]1FVVPWrܛ9tq5959K5ܛ9h  Vj5Vj*h3j5(Z< zhhh9+D$D$@VBljD$ V3D$1Åj9P^Z $t|$ o u*t$ e%n ut$ %n j|rjU`tc1L$ <:B @9u1PPPPPjPPj jUVP4t(j t$WJW^11V败|$ t$~14蛥4营C9uW肥VyjtPjjVh #a Z09j9j"ؚ9蜿uٸ=49t j jjp.@91 ^_[]Ét$ hh1GQWP Ph#h3Q V蕤W? =h3jj,hY%g|j h3Vjh%F|V V1Fh3VhEh%$|V UWVV8P h #Km P| 6|[=9t>V葙Phc%W| 5959耣9=9t>VIPhu%W4 59ƀ5989=@9uh3jjh%/{e^_]Ã=9tá|9tt$Pu j j h #7P貘tn,$n ;nu:FUW%t^FPv tFljFn ~D$PYU4$KUUV S] ŅS; ^_[]ËD$L$I41@fUSWV1t$49j9V“t$t$ t$t$4$j~VP;=49P覝t$Vj >hj]jYj߄{jVfʁV2Vjj^4?1549x#t9VPX~Bjhy9jPWyjhx=Ԛ9V/Vbu%9ǀ$jhxup˨vs9Ph k$jX jtO9)tTPCu2PKu#PuajhxP迚^_[]Ë$l$ D$jPtщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uV譝fV蟝fSWV1t$t$t$ t$t$4$549jV$jr4PVf8 9$*tKuKt!Pуt9$P9L$$Q4 tXD$t$VSVx)VOu%u%t*VC^_[À)ujhasu Vt5$Z<ap1WW5(Z< 5(Z<豥5(Z<3pSj 聲9;xhj_jZjC]jVkJ%%!}E'USWVο$WQS*[ Wh%S[ WSU[ Wh?%U[ S1tGUt0VVVVVVVVVVVhܰ"h41PP/t US^_[]SWV$SQV|Z Sh%V[ SVW`Z Sh?%W[ Wit VW^_[WV1t$t$t$ t$t$4$549jVtkjo4PV[5xG9*tD$$tL$PQ_t$ViLtV諕^_ÉWj M?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QfWD$l$1@$4V7W9D$pPt$VK Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PWK L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04hV Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWuB 59t@WPhc%V 59us599sh)#h % 9t*W蛋Ph%V 59s.5ܛ9蘚0tPh#h4%j[1e^_]Ph2%h3, j" UWVVA =9t>V1Phu%V݄ 59~r5959whV"h%& 9t81h%W莄V蚊Ph%Wv 59r$蝙0Ph%h4%j[$1e^_]V1hhPh0PjjPj jjh2h4xjPѪV^h3jjh%%l9tPjjh% lj SWVD$x1|$9t9P1; PqPVhu"W?^_[USWV$$$L$$QPhV1 $h{"VU $D$W辂1K4$ o 1G9r6|$  WUYŋ$(\5F4$n ÃugD$ PVuH|$dh{"Vý $t:|$G=9tVhn%hW%P 1KS1D5$$t 4$| 4$u9tVhn%hv%P 1ۉ؁Ĉ^_[]U$$$1K? USWVu ED$l|$(PVW,  ED$8D$1ۉΊ<'t  j Fj'V_hu VOljt$ t$PS請 D$ t$ )VPh "L$Q h%V t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/WΆ tW1 É@/ W1 É|$PD$NSL ND$+D$D$ .t Vt$WB tSfL Džu]D$T$L$;ȉD$Pt$ SSD$L$Wt$t$ h%P 뒋D$L$T$;t R褏SN) |$\$$h>%S G|$\$1\$L$9}T7D$hPy"7?\|$u9Mx{;5(Z<tV>jP|$ۋ|$t h?""h+P"x\3H 3~3#h3t9Nj|$tE\j~ ;5(Z<t V|$ t E%u15(Z<虑5(Z<j5(Z< N[t$(ׇtwPŇuW資D$td$8u-e^_[]D$t$ h%jJ Vh%P! 1S$ 1FV}$ SjhH"%# VS_ t$R$ $ D$pL$|PSt$( t$ W9t*t$hO%P葱 59裆99t*t$h#P^ 59p9h &D$ 0S}u.h^%D$ p;}ut$vm t$e s h9REtt8tjP~& u%t$V6 6hs%1 j肉3L$1Pha%1 USWV։5(Z<T1@P5(Z<K5(Z<TYh41PSU0  3hP-4hPS1CS }3Wh k$|3h$FPUb~ Y5(Z<:@)VUPRQ5(Z<UtcjPb|Jt05(Z<PV5(Z<#PVI1PPV\ VX^_[]h3Sj+h%W\S fUSWV-1@=@9$h %Pjq hsD$1D$ $ $?$VB9$VW-B PWt$ O VWB G|$>!%F'3D$WAPWt$ 5 uD$L$DAu >uD$ |$O 4$ ))ht$PB FD$ |$$ ))Ƅt$$т8 }? jS{ ƃ $NfF 6Ju1ҹhtRRRRQRRQjSD$DPju4D$D$D$ D$ jtgD$ Pt$袘D$ p @9 )) hPh@9A 14F'jVh@9L4 t1GuD$(Vh"%j@$Sv 1PPD$0PD$XPS?" t|$Lub4F'h@9h4%h,jSj"D$L1QD$PPQQS! Sh)"%s1=@9su=@9lu3 @9DH$D$$Ph V% u5$nfsu( $D$1@D$ |$$tD$$D$$i jv~h1Wt$TVZ j!W|$0WJ iW&]hh"%QChH9PPj}=H9 hJ9PPhh)#h#%ɪ Ph"%j+o h#%Woh"%Woh#%Woh#%WnhH9h#%Wn =J9t!hJ9h*#%Wn $9h5#%WnhE#%WnhS#%WnW~h%jtnh@9hV#%h DŽ$hE9VVj~/j h%V E9defa1ȋ E9ult1 j h#%hE9趧 E9manu1ȋ E9ual1 E91 E9none1 E9 tlf=E9 tb=E9t`hE9h@9h#%jtCh@9h#%Sj~$${}E9A9hh#%HOh!Ifh@9h#%h#%hL [ 8 A9h%D$ Pj3 ~ht$ hA9q< t$|j hA9Sth(%D$ Pj ~ht$ h9!< t$r|j h9VSt=9t A9h%D$ Pj ~ht$ hB9; t$|=B9u:h2%D$ Pj@ ~ht$ hB9~; t${j hB9Rt=B9t A9hhC90u=C9t A9D$1@$" hH9S$W: VC9PPjxVB9PPjw SWqt%A9|$$|$ t |$ujD9PPjyy|$t jD9PPjz^hD9 =D9u=%=r!ƒ%t%=ujQhD9: jD9PPj{hA9PPj}A9u4D$D$Pj訐|$uh9PPj|=9x$x$t9=E9%tE9=D9tD9|$ti=D9x$x$tD9=D9x$tD9=A9tA9SVWQRh@9PhC9hB9h"h,$L=D9x$x$tD9=A9tA9WVQRh@9PhC9hB9h"h(jjjX- xP F9%Ph k$hv ha}<h@9hk#%hS芟 S"jrjQ$H1WWV$Ph]!% t( ;$P$Tsho!%jPbt^DŽ$ 1WWV$Ph!% ? ;$0$4&h!%jPh`uq591H t$1t$w1t$t$kwh%j<$t$jT@91@$F=9hV"h %6 h%jft$(V# VlPhW%h:%Wtf=B9thB9ht%WXf =9th9h%W%W衩 D$Lt$t$L8th>%W ut$LD$LPVG =C9tC9V@3PV |$ u/=A9t&h%V"hA9h5%V |$ t1A&hLhS%h1Ʌ @9jQ@9e^_[]hD9h@9h%jt9tPjj"h!%KL1Fh3Vjh&!%3LV 59thȺVP| h豺h3Pa j觓 USWVL$,!ij u!D$@tP蘘 jPhD9X3 L$,%ij u!D$@tP` jPhD9 3 jPP' ƍ\$1 jh@9S2 Sh8i(VV` VK ulD$PDhPhE92 WEt;Ƹq$E9SPU*3 SVU3 WvEƸ%uցļ^_[]VPh@9h."%Pj?"Vt$= Vj2 tfjhR"%V$ u;hZ"%V7 u&hd"%V% ujho"%V$ u"h?"j ƅu4$q^Ét t t@hVhF9p1 SWVt$hV&uT|$tMƄ$j.VHt#GSVhC91 SWhB9 hVhC90 ^_[SWVC9S`/hB9Q/hShH90 =B9tO)~!C9.uC9PhB9t(H9Vhe%W#1 VhB9W1 ^_[ËD$wF'ø_1#USWV$Vh%Tgu $1퍌$Uhs%W :HUUW f@$|$$jhz%P 9tx/uG/$N~/vt$jhz%Pa _1#wF'1҅‰)ˍL$$QSRPh%hUc ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<91ɀ=9/9QPh?%hh9z 1^ËL$1Bhܤ9WVt$=@9u jG7Wj DŽu1@l9t5t9o1ɀ=9/9?%QPVWh9ߔ =1ɀ=9/9QPVWhԙ9跔 1^_Vt$V dЉhX9$^WV D$Ph9賲 u:$nfsu-Vh9h9 - Vh9hԙ9, tWj 轃1F?t[h9hڣ9h%jPu>9%h9VWh9Փ h9VWhԙ9 1 ^_SWV=@9hUA9u(hd%Q\u9hH9h%U=9t h %˵=H9t h#%赵|$h@9h%hW hV"WƅVWPh%j[h#V[=E9thE9h %Vy[ h%jj[A9uGWPh%jK[=E9tDhE9hD9hD9h%V%[=A9tChg %Th@9hs %hD9hD9h %VZh%jZh)#h" %XPh- %jZ #%SWZh"%WZSWZ=B9thB9h"%WcZ hD9h"%WPZ =B9tPhH9hN$W/Z hC9h#WZ WBjh%jZhG %ZuhA9hT %nS=H9th %XSh@9h %FSt VijQG^_[USWV։ϸjPP. tCËl$hjWj ojh@9WP) WVSV S 1H^_[]USWV$΋$Ph%4`u tW_1#V ^l$PSU 9<$u9PVUWh"%hC1Ʌȁ^_[]ÿ|"%fT$L$t$f1"u/ÁtuZ1$Ãt6u8h6h/u uhG%!wG'hhV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjhG'!t{4$W1ۅtjSSWPjhG'!tEh>%V t&|$\$PS׃th>%j| uVg Vg1ۉ؃^_[USWV[$%G'\$|$jSPe ƅt Eu$wS7& wh)#7' G^_[]WVG'|$uG't%|$ jWQ t u1^_ËL$24USWV1td։σS$PSW5 t u6P1PhPPj D$PU D$t΀8uɃ<$uð1^_[]ËL$$2w4USWVl$\$1}$hlW6StOD$SWPHDWWRt.ljFt(V$'Eg$%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQe $V1VPe 9549D$40$X@hK P@tt$45(Z<Z8h3> 5(Z<b9r 49ɉt$ =1MD$Ni8D$$11t=i8,49tǍXUSZN݉|$|$l$$99ƀyH1ۉLPTXVUQ# 9" .hQP" VUh89" ,9L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP9$()1HD,048Ƃ(1 49<59^W9|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً 49ɋD$L$ӾV W_1#QSPSl$GU 9$H@ VW_1#RPQSD$BP[ 9t% 9QUHDRh$%P} =9$0Tơ9$p:L$*QUPVWjj:WD$ D$D$ PjvD$ t.-49L$QP59 u<59h^R$Pdž$l$9()8 9 9V!O9VjP` L$ D$@D$9 49yuƇy$u4P4 44S$똋D$9$H@HD48D$L$$<uujj7mi$t+D$xfDŽ$DŽ$ 6D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4 6El$L$),$|4xfDŽ4DŽ4 6T4E,$DB8t$ 9zt$D$tj$DxYfDŽDŽ 6D4B=QD$BP4D$ .D$D$$|$y+DxWfDŽDŽ 6D4B1ɸhQQQQPQQPjR$Pj蠁4$1K|$$8h k$jh D$Wt$KsD$tvl4u^u3h1QQQQPQQPjt$,$Pj4ÃtCD$WSrD$lxS1H$^_[]1M4$́$<t4u/h転hPh~2 9\21@멃=49yu4949s19dL$w BsÁt1USWVD$$9*t1G.$ )$Ph$%hV ^.%jt(heMVh%%h" j$ f V%W赢9$PhC%hV葁 WVh:%%虥 ]h V%Vjj\Q1PP3Ahjl1q$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S3t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$F'h%%D$P4 %%D$%%X3|$0tPh%%hW Wh%%%D$P׷ ^.%D$4%%zh%%D$P蜷 %%D$%%i3|$0tPhC%%hWY D3t#PhJ%%j\$S< S\$W^ D3t#PhQ%%j\$S S\$W3 L3ۋ"t.#$tWRhX%%D$ P D3@4%%tq%%D$^.%D3|$0tL3tQh~%%hW~ Wh%%D$P聶 /%D$%%Q|3%%t&%PD$PQ &%D$&%!h%%D$P. %%D$%%D3 $t!t$PQhn%h4t)$j4$VtQVd3U$ 7=49t$ $QD3$t<|$t4øSWS$PW[$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRhn*%U EtjP t4$U؁ ^_[]Ê$ h^.%WL$D$jVù D$jQQPSS 9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uh*%SPVUh*%S@$ Pu1Vt$h|*%P4$T$ l$Sha1#U6 hKUWVjPK1PQG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQK^_[9rwًz89y8rw19HUSWV 91G*ZƄ$h!&%輛hV"hS#茞Ph&&%jSC 59t 9QPh?&%V:~ 5hv&%SC9)\$J$WPZx$L$@PQq $d$ PVq D$@Ph&%SB D$0PV]Y"D$0L$8L$D$hFj"PIw\$D$H$194$hFj"W^IFuށǐW$W q S`R;t$$ *ho9tPjjhZ&%*1PP.+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7d#t_1#$&%\$t7ȉL$7 T$wX%%D$ ^.%D$$F'_1#$uht$$P &%Pt$h&%t=uD7L7qQPhB'%u$$d#d#Dd#t $D$ /% $T$h V%RkGT$ D$L$ 1@D$hi'%OT$%%D$L$ h V%RGuD7d#t$$D7_1#@t'%_1#y'%_1#t'%T$(_1#t'%T$ |$$_1#t'%L$,_1#t'%_1#t'% _1#t'%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4hp'%t$D?@غRPh'%t$>ClE;F{Pp\$CPWm S%Ot$0|$4hg赕L$0QjP4. P7WNtVh&%t$v> SN=9u#D$@9@@hPfh'%\$ S->h'%S>h (%S>=9th9h$(%S= $ 1|$@VVPWha*% ;w_1#r#t#QhF(%S= hs(%֕hy(%ɕh(%輕=9t h(%覕h(%處1h%WI=SoMW*e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ G'h(%U Ubuh%%h(%U U;FjV9F1Ktljt$"h(%G$G^.%G w"Gh(%G ${$^.%C(s4C8G'h(%UC<{@^.%CDsP$sTG'Sh(%U UptlSh(%U "U F$F^ FSh(%U FG'U F $F$^(F48ih%%h(%U? Utl%%Wh(%U "U_ F$F~ 2^Wh(%U FG'U* F $F$~(^48+4$iƷm۶|$9Rh9h!&%讙tzhS#肙tiD$hS#Pj裘 SWl$UVt$t$J6JOu4$J9Ph k$h 1PPx#9)t5PhC%hUq 鋔$ 1$ 91APuDFl9Ɖr:9Ph k$hJ 1PP"999ƻsRAklT421GWWjjhUt8RVx L$ $ g|$8jhahX)%hL)%hh)%GL$T$jt$oËL$T$jt$XWV׉κ^.%jujWZh_1#Vhz"蘔 ^_VK91ɾ 9r^^VD$K9tU@8xtlIuAH1FVVjjhhK90QRx tjhK9j tK9^À=K9tjhK9j K9USWV 1WWj &iP_7SPj  t$ á3D$1/dev4$D$iƋ1N/ u1FSt$$Pp/dev uDL$DAt|tER|$$t.jVj t 3L$Nj4$D$/devG4$D$M[1O4$1O1VF ^_[]USWVPD$tPpP11OFtFh V%Pe=t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T~)%w)%Phn"h?%V ^_[]Vt$D$QPbLt(D$t%t!hhPQ3D$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$59.@ujP`>D$1҅D$t 9tL$BuT$ЋT$P]1hPPhhsjjAPjQQh,2w 6i4WP[w DM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hK PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP<D$1҅ӅtwU8:t\P,40Ut5L${|$P=$tL$ST$Dځ8Nut/$E t$BЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W:ŅjW:{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ J,D$$@$;E tL$ A;L$tI1۸hSShk,ShjD$G e^_[]WV|$ tt$F fG ^_R^_SWV|$D$Xh+Ƌ1ɀxQPVhu"S6^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6=^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVh)%h:1^_[USWVu [$%G'jVP uh8j}w= jVw: 2O$2Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$ QVPh)%hS~b Zq@8^c@8PG@$QP"B'$@ffsWBD$Bjh)%_1ۃt$D$ h)%h)%W = Vh)%S< Sh)%Wݗ Su$Ph}Dt$VW.W}[uVۻ$Ph*%$ 2 1ۄ$h*%$ h.*%PL$DQh&P; t$,04t$jj h_1#RPjV- |$DW3r \DZ@uWQVt$h8*%ht$ j` 1C}$5t.1ۿO9PSWv: t$D^^^F~ FFVhQt$ ? t |$\JSjV: $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h_1#RPjV躮 VShO$ht$"_ }G8@É؍e^_[]O9=}t'fy"6O9 7O9NuEt FuXt1€1ɾ9O9( Ӏu A'w'8O9 ' Àu A&r  uȃsƄ\$,04t$jj h_1#RPjV蜭 $PVShF*%ht$yD$L$a!jPD$T$AjP{D$d$jP`t$,04ڍ\$jj h_1#RPjS W$ePSVhR*%ht$ T] -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h'%qe\ Y|$h V%u ),DžtohG'6,tkDŽ$v/rDŽ$/dev,$$VuPV D$/devf@/VuP9 Q踃낋E\tu xt@@AED$59$ttt$PуuN9덬$WPU t$/devfF/9WPVp [S4\as|a9aO$CQPU+ {PWV9$t(tt$Pуt Nj59,$1D$0$h@hK P5tt$G9PU*tTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jWÅT$-t WVS $WD$pV l$ Uh%V( ǰD$h]"W(h#W(tyhj#W(tgh]$W(tUh&%W(tChnf"Wo(t1%D$t*%tD$VPS VWS Uh%j ( DžED$4$v PS} t"vh k$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=09SWt$t$%$1PWt$t$%|$%Wj D$VpWY u\$t&WhI3%V8 WuSW( WN9|D9...Wh k$v.( e^_[]fL$19bUSWVP\$1ɸ H't'H't"H'tэ Q9 H'ƆQ9Bu14Q9B9u4Q9ju8Q9juu1@G9)1s9?%VPWSh9S wsVPWShԙ9S 1^_[USWV |$ faa@D$$1C_1#=9th.%j9VrPWh4%hNvD$PUBD$h959hY0%j訙x9rW!9u9QWh9Vt$D$PWhw0%SR$'D$D$ =mdt2Vh9h9] Vh9hԙ9J 1$hVS* t$t$t$D$ XQ9jVVm ~;Ƹ PV"D$i jQPm e9]D$|$hYWw)o ~#u4hXQ9h9G 21ji p9ލ$hQ9Hf@ 6tJu1SSSSSjSSjjUVjl M4jmoPV>VMktXQ9Ph9F u`~*=9t!h.%jU19Pjn)D$Wj|>\$tt21ۅ1C؁ļ^_[]h0%h0%h'h/%&USWV|1ۀ=9t}h9h0%jŕ ue9q0%?%9h9VWSUCN h9VWShԙ9.N VU#N@1 É؃|^_[]ËD$L$I1@Ã=9th.%j(9Vt$ D$t PnVjH=m5ܛ9^USWVPWj=1F?tih89h9h+%j讔uL99q0%+%h9VWSUh9'M h9VWSUhԙ9M 1^_[]SWVPVj<>u1@;9+%h9VWSh9L h9VWShԙ9L 1^_[ù1@t %Q9It1ùtAQ9t 1ùD$Q9AuQ9ËD$Q9SWVhzlhy1$hWVF& 2WSChWWh9Wj65LQ9WjWPVWI4SP^;VrJİ^_[USWV|$1i/t\1tWQ9tI1r rr2\0u&1q1ur1ۃ0݃]r @뜃|$tB ]BB]^_[]USWV|$D$L$BJ 0uQ=HQ91۾&-@Q9B0t#1urFQ9tuHQ99u'Cϸ@Q99t0Q9 D$44$D$D$ j$SfŅm<$t$ >tV\$S= Vg$|$);\$u ^_[]h.0%h 0%h h/%kSV521/t.T$ 29u9t Q9t q/u^[V1ɍt$QQPVhW,%k y1t1^USWV|$(1$PPWVhW,%( $D$(1PPWVhW,% Z$LF1d$Pj%s4$>$G'h|e$U3eh}Bhh0%eh~(hUeWq5ܛ9SD$h贃jU5ܛ96H :H'PPqhVjU5ܛ90 VWt PVWX 蠃WD$ PuSt$5ܛ9G 5ܛ9d$5ܛ9Sjh2% j D$ PU| Uӹhe%c D$(SSWVhW,%C $j蝜 he%fMuQ1AtCjVBJ u4Vh31%"1ɉtjVJ uVh 2%j) D$(SSWVhW,%衼 u$~hk,%jTȁĐ^_[]1USWVhhq0%蚠9tPjjh,%_1<9894909,9(92/u D$82ڃ9tQ9u@(9Q/uD$/u.89(919hbj 21@|$>ZQ9M ,9L$ 49L$j5$Z<5(Z<(5(Z<=9th.%j聈9<9896P5(9h,%jaa9Wj 0D$ttRN1ҋ0t1t /u oBrgQ9uƃQ9<91Q9uAuVD$u,D$ ,9D$491@Q9<9^/ 49F(989QR5,95<9509Ph,%h` jj/_5ܛ9]1Q9tvh,%hu>h+_t$FVj/~th,%j軆h-%j謆hJ-%j蝆1GQ9Q9thf-%jfh V%_L$QPu{h-%_$QPʜuYD$3$L$3$ t?h-%h-%Mft!h-%jޅh-%h-%a迪1=9th.%j訅9]$1L$VVPQhW,% }t|$ thk,%jTGjS"e^_[]1F]VD$FVjX-F^SWVPD$$h)#h;.%{at@Ƌ|$]1Ph.%S9 4$WV VRh%S^_[USWV-<2ta1F82t&U7Jd1tUh k$h] 111Fo u1tjh1@1^_[]Vh~.%]t$hPVp hhX9V蝱 x(X9ƀX9h.%Q< j/P@.%D9^SWVh.%&]Y9hPV VlZ9K5D9 Z9Z9PVh4%hW; jWh`" hIVj< 1hh.%WWhIjHj j j jVWWM94ƣ2WP+2V':WF jjt$5Z9h.%WV<; h~.% \$WPS S]SV*j jj%1@^_[UWVj WW W |$ hPWb j WtZD9 Z9tV("RWQPh܁%hhe^_]1PPj< USWV=c9uj53q ǣc95c9u3Pƣc9^V=c9~GtOc9Y9W W;Z9t1c9hAY c9A bc9$Y9$V y))L$H 9Jx .@ SPt$ D$PhY9=c9-39|uP5c9K c9QjP P5c9 c9 QjP -3D$%=@t=ut-c9D a1c9D8 bt$h V%t$ =c9-c9Z9Y9P  c9D G=c9V, V苪 $$c9B c9fJhcjQP Ą^_[]VPt$D$ L$ $tt$VP? 9t 4$VP? ^PD$L$ T$$RQP XUSWV$01$D$ h;.%WL$Ph k$Qn h /%WPh k$Qn h!/%WL$ Ph k$Qn t$ IYP踬hb$t$: D$4$YhV"P D$\$t$hSfJ tt1h+B#Sj 4$0P'P$4Vt u <.=tSh k$t$t t$hSI ut$}t$q%t$ t$ t3h/Ut$FVj$~t$t$¬L$ t$Q詬jh1D$t P$t P Wh k$h2dU jjP$T5ܛ91N^_[]t$v t$k V貪Q W1Njh214$Vt$X 4$M t$ A VD$FVj#F^SWVPD$$h)#h9/%Wt@Ƌ|$3T1PhJ/%S 4$WV5 V h%S\^_[hj/%h;.%S/%)1ۅt0"t0" 1ۅÉ[USWVh# P D$1Ʌ$l$h#UP@ ti\$WPS 9s?hh V%SA =w%hVS+ =wjS9 t@h#U? u4$ 1jV9 1Ʌȁ^_[]4$w 1AVt$V1|TsrLc1f ^Vt$h$VtV9t 9ܚ9^WVt$ D$wǃr9t\\%tSPQj* V5(Z<+V5ܛ9*V5(Z<GV5ܛ985(Z<*5ܛ95(Z<~5ܛ9p^_WVt$ V u.>v 0f!PVWh/%h34 /%^_WVt$ 0PpPGt$>FFVj< F^_SWV=2/t/t$2GtPV`t /u?É^_[USWVj$t$ P1ۅtKƉ|$\$FUShSSj WV8 $Vtu;D$ rj$V ƅu1؃^_[]VPT$ D$t$4$oVP ^USWVӉϋl$jUtMƅtPt$V} SFOVUP tP׃SVx^_[]VPT$ D$t$4$ŧVPv ^À=[9ua[90" 9E0%L9O0%$96$H9$@90"P9SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlWq$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPM $LL $UT4L$ L8L$T$T@Lƽ$$hVWUy uD5<w |5L Ku1PPD$P )ƍD$Phd@V |$D$|PhedAV V菟f$1 GaD$P$,h0%t$V胳 1PPV6 $C]su PUhh[9t$t.[9CD001 [91 u=[9tZF9|4$蠞ja$,h`:%$0uѲ EPP jOh[9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$t$$,h`:%uM EVPhO$P7 EtE @E w-G$9@  V觝؁^_[]1D$L$I@PQ9wʀuQ9AuQ9 Q91USWV$$1$hWV E jShWWh9Wh5LQ9Wj jPVWL$4SP)V=%1Ĭ^_[]ËD$1ɋ0t1urQ9A1ËD$1ɋ0t1urQ9A1USWV ։D$ $E1$ A D$$ ,$D$@1%f $FZ1%uv1%D$$O1%i1%u1%F\$$H9< \$\$$&HD$\$$)|$=89=9=H9$ <$D$D$1%<$wq|$4$D$ H9D$?%S |$D$ 89D$9D$1%=@9u$AyD$1Ƀ 3\$2C|$D$$$$D\$$({|$!<$D$H9D$2z=3_1#|$l$ D$D$1%$kljl$4$ K=@9u $exD$|$D$$.$$C\$$'|$u1=ڣ9=9=H9$ <$D$D$1%<$t|$4$D$ H9D$?%艭 |$D$ 9D$ڣ9D$1%$juLl$ t$<$D$f4%i$ \$<$D$4%i$ l$4$1 > ^_[]Á=2ftp]|"%=2PFSWV|$tyZ9GO4VStRV t{S5Z9Z9VhY95Z9h%hS! jSh`" fG2~"P8ptVatV1^_[ËD$ Z9ƁY9 c9fH c9fH1SWVt$Z9Y9V~)S4:Q Fc9Fc9F1^_[ËD$L$01ÐSWV1ۉShPS$ tD$$P t V8Vϖ81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u6C1^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW(3Vy 81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=091SWt$ t$L$ T$D$T$SWt$ t$D$ ׋ؚ9t$ t$(22%L$\PSWt$t$,t$RPPQ $091WSt$t$<D$T$WSVt$%É֋=ؚ9t$Ht$H迍$PWVSt$t$2%PPPQi $VD$`Pjhr1@USWV u C(D$|$8hjW] wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@ǾPH'|$D$u$H'B H'BH'BH'QP׾H'B@ tu ǾH'pЋ$+L$L$8L$9ǾI'HQQQQRPRPjD$ tj31҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ L$ tEH/uj#EH@EH`L1^_[]/EHjSPj EHHLSWV t$ vDh#&WS~ 1WSSPPjjh= SFDNHA`1 ^_[ËL$Ahh1USWVL$AyVbn+~V|$jPWRUvPQd@( m4 +WP59h%3%sT1hh*P5959h%3%sh^_[]Ës=9h*PWUh%3%VҋFHP5Є9UUSWVP $1jlv D$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F59me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|~94$ukGllPwGX FPvt~C $i)ىQRPS 1D7D77pfD7 D7 ~4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPpL$ A$W t׉\$ A fOu\$ c9fA |$tApfAA~ 1AA tAfAA A =AtfAA) 91jEVVhhhrjJVjVQPhd94C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch V%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0&ƋEp&PVjWPUCƃu4UtU&ƃuEtDjUуƃu:C(C,SPs{,1s$C$10s$C$s(JC(1ۅÉ؃^_[]h~2%hi2%hlh"2%USWVt$ kFllPvNj\$FFi )tkllklPRQ草 ,$kl11CPsjNj$ /L$s)RQt$ + 1/D/D/D/ f{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh-- WP1^_USWV9t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$1K&L$t$ 1L$t$ QVM؍e^_[]ËD$@,1@USWV$u}t(M01B1 tǀ9s BltNf~N( $ L$VW_1#V_1#RPPQdM EHemL$ U UWRPVQ4M tD$8h^L$8jPPQL $l$P tR/L$8jPPQ͖ Y0ƋpǸ_1#<$u hL$8T$ RUQPWVSjjA$$jBO$ L$+5ؚ9PWVQ jCL$5ؚ9PWVQ j-tL$5ؚ9PWVQ jDThEV踓Ńw-9W蝓ã9~$Uj-P ň$E Eۉ4$~Sj-PT +@$c9Ph3%jPS -959j.SPWVt$UD$)PD$:PD$KPh3%hhd9 0h$F)^_[]USWVUu @(D$=9uj%9]zklD0 t|8twF9r=D80 $ |$ WPQRLUL$  ;d9D$0BD0 Cfd0 j509t4-LdI9LhD$$r1CExhIPSt$t$h3%WMA9d9D0 tfMCfL0 L$ D$$091RSD$PL$QD$T$t$,|$(1PSVWnD$T$ t!|$ t$jSVWMT$ D$1L$0]D$ uuut$@t$@ij2j3j4CNj $Ut$TBDL|$D$uCD$0 ttt$ Vh2%D$DPu( D$8D$ D$8t$XjVt$(1IQjFj QPg D$89D$ t PDV$P |$YtZV.A MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ09}] aVt$ t$ ؉e^_[]USWV D$ 8t$8L$j QPz $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQP蘻VGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋091щT$1)΋EM M1WRQP˺ljT$1Pt$uu谺)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSpD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h]$jV C `L$rL$DPh2%uL$DPh2%jQL D$D---D$D$sؚ9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVh2%P" SVh2%P" VWS09D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h]$j$P t"?tt$ Wh2%D$LP! D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PW}{{ t|$uuxD$tF ~,1t\tW I' D {u6H L> HL>@D> >jhEV> wE%rhD $uR1jPPPhhPj jjj%VjMo4x!t$PEWYV赾1@^_[]h3%h3%hh"2%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ pI'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; I'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jSc t$]E1fEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t= 9t@u.1}h[ju tEx 5%rt5%t5%M u@=Uu,>t'D$ L$9;\M`|ˀuK(Ѓt tu tPjbjWBƍD$(PV轍$1 $$QPVA $V C9$ul$`=u]tP$PSr $5fǃU'VBWh k$h5% uRe^_[]SWV0\$@1҉1 F FFF =9tjP4D$VjRRS/<^_[USWV9(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h5%jkt1e^]USWV8=9EM 0~klP1`ËE E8؃lklQSP3O ߾J'9$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =L9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPSN F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h:%h:%hehe:%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSW褺 L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$\9u hj\9D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$J'd$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uthzm1Ot1L$D1 L$8ɋT$]t"9tjQP/K T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(\9u h\9D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$J't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nhz11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ9I |$ƄE C ^_[]WVt$ hjPo ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut;%1^_[]Ãt ux(tth}ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVKF >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDK: l$(Ph<%U{7 hV"U [Ɖ$Uh$<%jqu D$Ph3<%V^u wXw\w`hW<%VGuPwdhn<%V)uwTh<%Vu f1ۍ{aE4K'WuWuWh<%Vt E< t<uEMPWQWh<%Vt$<I<%9|?"PVtC9z1h%WltV蒄 D$PD$Pt$\$4Sh<%h<%WS 1(^_[]h;%hs;%hBh;%hs;%h1h;%hs;%h h;%hs;%hh;%hs;%hhe:%}USWVhj>}{1O1ۍD$ShPS$4t9+ōF,PhedAUp l$$4$0$($<$8у|1҉$$(7 F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$ıt98t4 .jPL$QB D 9D$ u D$4$P,$F n$9Љ} 1F$F )ЃF n$,$G9t$-$$h<%jP& r=t31>t9>u 9>t0uk9uV蚁V蒁OV芁U1@19$,|;ЃVMt$d؁^_[]USWV@D$1PuRhj5z;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dJ'u#4 FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h;%h<%jg6h;%h<%jh(h;%h<%jih;%h<%jj h;%h<%jkhe:%R}D$T$ L$DrRQPq> ËD$Djt$ P8V USWVl$j/Ut 1NtbNj\$)CDWPU1 uHD/t(t+t!u GF "u^_[USWVPӉ΃=L9ui"sv|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=\9u U\9~V19|(1@@89|~@w1A^_[USWVP=d9|$(L$111=J'"\$uӀt0t u@tӋ;K'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1hJ't$(t$(t$(PPt$0K' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWV]nhhJ'h܊9jU ܊9j9@11KjeƃwDݰL'DtGCuޅtH=`9Ped9t)1ɀ<t ͬL'AuVv^_[1V `9t(d91t ҡd9 `9F9rd9Pu^fUSWVPt$L1h;4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h4%jQQWRjjh=%T,1^_[]USWVhu}WWPHD$T$9L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv9@u ǀ@>1t$(F F>D$,Vt$}|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP3|$4r!1FD$0P2F;t$4rD$0=0ԷD$p÷D$6起D$v覷D$  _1#1ۺL$#PWVSh0RQ3t$kPW_1#PShPV 9VL$'Qt$t$t$ t$PPhyg$h$9$0$9$pضFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCtffC C CfCC=`9rC fC*C,G1ۍD$(htSSSSSSSjjWPh48Pē@,ot$VW賅WǔFuQ1K59ot Pnt$肔59n1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$fD$L$I1@ËD$@1ËD$@1ËD$@1ËD$@1USWV։ϋQP\Ëo tEjW`t9\$t$t6t/1FfA A ]9s^9։r 11uqfA t$T$d9fA tApfAA A A1AAA tfA*A,m)0|9u >^_[]h>%h=%hyh#=%dUSWV$(E]0ƋEpجljl$E@ t P迬_1#PWVSjh]1U509|$ ww@[43%t$R5ؚ9RPSQV觌 U509w$w [l$45ؚ9RPSPUv G\$skhSjPD PVWed9j!hI>%VD V\#hϫ%L$5ؚ9PRUQ h被$5ؚ9P%PUS‹ hwPSD$Phj>%hhċ9藋 1҃9Qd9A \߉$4-PWha#j$WR hWhċ9$ Nw@EƆd9 Ft3N$t.1@Ƅd9-H9s Nr,d9$EBL$ ;QUċ9Vh|>%W6$ Vhd9W'$ h$Rİ^_[]USWVX] E81h_1#PPPPh>%PPq 9_ vSL$QSWPL t@D$ tWD$8uN Ԍ9uh Ԍ9D$9H*h_1#Vhb#Ep[+D$8u RPt QPVW҃091VSt$t$6XD$$VSt$t$XL$8QRPt$ t$h>%Ep#[D$V9p1h$YQVu WPTtY$UtOwGD$VPv )vVQj P_c W@ )Q$YQP! H LCF;puD$VPh k$EpnZ e^_[]USWVLt$`T$d\$1*kvs0C41GPjh3  9u vEL$QVUPL 1hPPh!hhj6Pjjt$(SP4ōt$ VPwUƆS"a~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 59`|$.9L$`ʉAfAD$ 1Ƀx fJ1O S`1L^_[]USWVpU t$01^F4jjY1AǾL'D$ǃ@$M'SPHD$ $9L1OًP|T$|$`1 |$0jP4D$DD$ 09|$ 9ϋ$|$1HPPVt$t$WRQjD$9P;9~9hČ9P;9~9hȌ9P^;9~9hƞ̌9P6;9~9h螞Ќ9P 99~9x$t911@(4cP 99~9E ;h$r˃ 9$F89~.wy$L'C 99v-v*)NjVl$hURWv4PQd[=9@( I4踝UPWh%3%SO{9-Č9j509vv{9-Ȍ9j509vv L5ؚ9RPU<{9FF NN5̌9j509QPK5ؚ9RPVSh.3%WNDC 9Ќ9~?u 9F u97#VRQh%3%PN^_[]USWV$$x+~8P(TjsNVUl$URWv4QPd@(1ɺRUUQQjj4讥 UWv4PQpu Wv4QPh 1^_[]SWV\$P,ǃjPNƃt Q Iu1PPPh, PhjPj j WVPy4ǃtSWkC=WzVT1H^_[USWV8] C4t VPQRL u s ss3r SCt$t$PQ| $t$+Ks;K C}K s1e^_[]USWV8] C4t VPQRL u s ss sst$t$3'SC 1e^_[]ËD$p 1USWV$@t$ HPQ0ƅtw1@^_[]ËGtL$hpQ3 D$\$1hSSVVjjpw ;tUSP@u54$1hSSVVjjp7 |$u^WVD$ t$tL$ HPQ0vtpvhhyPh k$VHK ^WVPt$$F4t'WPQ u 4$fF<1^_ËD$@<1fUSWV hJ?%1jx$S?%xtD$PV H$^?%KtD$PW 1yoh^?%螙hPWr D$PW 1u!hp?%nPWhd?%jϿ1EWhz?%j.A hW hY?%W͘$hPS D$PS u"h?%W藘PShd?%jY1Eh?%טhPW Wh4%j* 0l$Sh?%h?%j t D$K?%PV$SPWC h?%Vd?%1PWQU豾h?%VЗSPW  h?%V跗PWd?%PUyK?%PV藗Ph?%U[ ah"&%VrPh?%j5 ;h?%讗hPW h?%V0PWhd?%jhJ?%khPW? hK?%V1BP$h?%VΖPh?%j葽 h?% hPW h?%V茖ƻ$3Wh?%hUu 1tVUhd?%juŃ|$tjh*'$Ą ^_[]USWV ։Q 1Ht L$ L$$W $f} r= jh?%U u&USh?%D$P uhm# WU Ņu>L$4t&t u$Ut$ t$ h?%j t$MWv $ ^_[]USWVՉfD$/D$jhe%D$5Ĕt&軔8t豔SPh?%hU9t VSU 991j/URC t5ÍD$9tK9vH8/t@P% CߍD$ PW9 D$%= h$PW FƄ$/u&Г$QPh4%hUQs /h$PU hhe%U e=@uW$ x*|$VW$P 9r>P?P0|$Wg WP01Ĉ^_[]hU*l t}/u }$$tcD$U W Ɓ`|$tVh V%U 9=VWU 9%|$W x(W17O>1F1SO0jh)#j}j SWVύD$ PQ 1xVD$)tOjWx@ljj PW W u $=rɁ uƉĜ^_[USWV hڐljPhW@jD7 \$hjS'K jh?%8D$ƍD$ PhW@V6 t$1hUSJ ,$LM'tWPp@u-،9D$C 6E,$ !u1L$PPPPhpjPPjjj!Qhm4t$t%jit$VW_Wn6V8 ^_[]VD$@t(L$ 4@DM'VhW16 F܌91@^ËD$ ،9fH ܌9tPPQQQh @%j϶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj ^>D$48T$y:D$ػ˺L9$L$~D$<P t3_1#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$_1#t$DRQPhvB%jV0m D$ T$Bj509QP;_1#tu%t$DQRPhvB%jVl D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5ؚ9t$h4%jt$hVD$XP1WWjjj0ߕ,09|$4D$09L$QW<W,D$DPVs~ljӍD$DPV/<|$߉څu D$$H؋Pٸ"D$<h+%t$;|$,] {t+[1h V%S;t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$h4%jt$hVD$XP1PPjjj0k,j D$DPV` D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWQp )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j509PQ |$ RPh]$jWh ;ؚ9CVpSjP jPPhߍ9P VA(^_[WVt$ 5(Z<K5(Z<~$uFjP:F$1O~(1hߍ9QQhhhRjFj WjPv$h9e4F(x;F,VPWv(fv$@F(F$~,v$@F$1^_USWV4ˋA@Pjq$A C{$t%K0 u G fG lJuN'fG G5Gh*G G,,G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPd+{$4^_[]V$j)ÆNv811Fu >tlIut5t.j+j,L$PVhT%jPQf 'u tEj,j+蹅L$jPPQ h?"cj*蒅L$QjPm6 h$<j-kt$R5ؚ9PhO$jFVe j.FhN'PVh}B%hh9fe İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j509RQ{3L$RPhE$jQd G<(\(|(Pu#]j#艄L$>PSWh43%j&Q%j509SW3L$t$>QRPhvB%j&Vd $F|(,u)|$hf)PhB%j(WVd <$1e<(Ou*?D(Ltۍt$hPWhB%t$t(Tt(P/PWhO$j(Vc 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhB%v>5t 4$<|$|$upd^_[]1؍L$>PWhB%j&QXc  $L(4RttD(8tPQ҃lj$uFt(Tt(P6lj$FD(Lt&h谂t$PWhB%j(Vb 4$h节VjP  lj|$D(dphYPVhB%j(Wb *USWV9$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá9H1WjHDWWQZơ9$1$ 9@u <@TX uDHXT=49tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W_1#WRPPQ1ҍD$*W Q_1#QRhQPD$$W Q_1#Q1Qh0QPů&)ߋ90D$pL$$QL$.QL$QPt$SPW0 90NjpL$$QL$.QL$QPWSSj'[0 h$F0W|$pDG$DŽ$$T$0<$tT$@BfBBQ.ffJ B _.BfJBm.B fJ*B,{.=`9r~(uB0fB:B<.@1L$0htWWWWWWWjjPQhZ\4t8P/\@,o$PSNS/]$X(؃u 9TXK$N'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u h V%P*,T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV59)R t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!P L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh V%D$ P3#t5h+%t$ #u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$VfGT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0(9)ދ,9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$K L$T$)D$D$D$( $FȋI0l9Ot$zD$0)D$$)‰T$ 1ۋD$,D$1 $|$HHPP9ϋL$(ы $Ot$ q|8L0t $ |$ ?Ld3|h;y& T$$RD$tQD$PL $T$$W2$RP$D$L$|+T$L$$1HPPt$0t$Qt$0WRjD$dPt$|$C%h-C%h]hB%USWV$L$|$$\$tFD$ pC(P9nu,uCt8tNQP u ~lOuɀ|$(L$ kAllPqŋL$ AAkl.@A1Ct8t .jPQq CD5,$D58D$D54CK JKL5@D5ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ- tt0\$4S tt<1^_[USWVGD$59l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1l99ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX 6AL$D$~@ 1ø11OT$LhtQQQQjj PWWSRh649tBƍ|$WP[(Vo7x#9}09k<4LE1UЍe^_[]USWV1l9T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=$9t*=911M<t9\@u 9DDMHEr= 9tOԽ9D$PP1ipt$1t9 :ut$P9t:,@uލEpr=H9\9J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@9D WVu)y8u.q$t"y8uqxu Hu^h#hzD%hm h#D%D$x8u@h#hzD%hm h#D%]V 9; 9tD9t99t‹9u€92t 9^WV΋$tRttyu)99tЋ9u90u1H|$59,1C1҉T TTCD ~k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D ~$kt$$t$$OƋD$&$4WVPhE%hS M$4jt$t$8u"DH $4jj h_1#QPjS'nSW"?D$5$4whWF%P w01k,Cy uC,1uSPQD$=P賷 Ph>%D$=P蛷 10u?x@t$5w%SZ 1C8Ou111$H4$8 8tsuV4v8)ω$4VRQWhBE%hS M1T$5SPP$@PGG t$5Ph<%hV@ }AI $4jj h_1#QPjSkSVhE%Wuht5$4Whs$S@ WVS5 Wh%S& uD$ L$ $4jj h_1#QPjWk$4WPhE%V$4w$h#&V |$$4wh:WjP| ƋMjs,s(D$AP-V#fuhB:Ph k$V Euh1uhJ:1T$5PWWWT$5j SX-4^_[]ËD$@89USWV09=9tp1NxtZ$tIP$xt.jVVQtPu wƇxu= 900|$1ipԽ9PiԽ9t(hE%jW hV"W t$Wh$<%j= Խ9t(t(l$t( hE%VhE%V 0=Խ9\$t$| |(P$P D tWL$tN1FVVV1Wh$,WQPRx Խ9 T :<$VVt$j1WjQt$RD$ Px $Ph#VZ =Խ9,MQhE%V<0=Խ9\$| |(P$P D tYL$tP1FVVV1Wh$,WQPRx Խ9<T $VVL$j1VjWt$RD$ Px $Ph#V =Խ9,MOl$ t/$t/ t/t/hF%VZhF%VLh%1V:W` V Խ9t(|$Wh4F%h^\$t$uq3 Խ9t)PhIF%hh^uKԽ9t(h^F%hI^ u,Խ9t(hqF%h*^ u Խ9D(Fp=$9119Pt49t(tiD$Pt>Sh#H%h>T$\$ 9$DL$4L$090|]t$VePh?%WS 9( ( PQVhG%WSt$\$ CCa59.> >,>(>$> D$)Pt>ShH%h,S$$(t$,t$(r 9t P 091`9tWWhLE%CEOWhE%h35 9t8WhE%P 91NtjhbE%P ^_[]1N=P9tt$hD%jPMR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ 9V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$D$ytP-ptYWtDžtFE tWPV u WVDjVSe E t VPwVq1HPPS| ƃx090^_[]h#hzD%hm h#D% USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4S'jP8 D$$tI%SX UVSM ,Oudh!!\$UPSt UhI3%S 00~ t ~(tUh>%S UVS ,OuSh k$$p yh"!v$|yh# v gyh$ vRyh% v=yh& v(yh' vyh( v PhD%WN^_[]USWV$t$8$03u*11IhtPPPPjj PQQjh3P403N wT$<+$Q'<91N<9RP/׉Vj 1G$h)j$~,"-. / |$4ha1#PW 1PWWVVjjU( WP xL$<1$^_[]USWV4T$H1z$X11D:tL\$St:PQL t2L$ D$; $…u $;Չډ $ڃ,ut B$Hrt)u.$CM$։$B(r,Jֺs$h9^~x14^_[]ËD$1A1҉PPP PP@ HH $hLRPk USWV l$8fD$-5@9u61ۿS'P0 9މuڃ5@9J\$<|$4$Q'h3p SPVhQ4%Woh4MǸsu8j509  L$RPh]$jQ= 5@9h5oh61PPWVhQ4%U4du31PL$Ph k$jQ 5@9h7t)u D$ ha1#jPo 5@9h8t)u D$$ha1#jP. 5@9h9zt)u D$(ha1#jP 5@9h:<t)u D$,ha1#jP 5@9h;\L$QPVhQ4%W% ^_[]USWV$@1K $ $ R'_ 1hSSVVjjh<\$  /t$l$ WSUՓ Uh%WS S< |/D1l1_9, 1=WV<VH /11 11$> t1$?$J1$@( 1tiu`$A,\$ D$4ha1#US 1USSVVjjt$" SJ xL$1^_[]WV|$ 1uOG P{ t/1; }O"h|9x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h]t$hPV $$$HR'D$@{tUh>%Vt USVi 8Ouڋ$xhKuhLSPhD%V}C(~Pha1#hV }hMHC,~Pha1#hV }hN#C0~PhD%hV] }hOVPhD%W^_[]USWV$T3u*11IhtPPPPjj PQQjh43P4T3Nw'$Q($\R'WP]1N1jWWVVjjhP lR, S0D$4ha1#QPf 1PD$PPVVjjUv D$PlG x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP iQkd)QhD%V ^_USWV$h]|$hPWэ $$$tR'{hU VPhD%{hVvvPhD%WO[hW\1~,t[hX?1~0W[hY"ǃ4V蒋 uh]V0FT~Ph#hW shZ[h]1~`{h[vXPhD%WF\~PhD%hW sh\mFd~Pha1#hW sh^HFh~Pha1#hWp sh_#Fl~Ph#hWK sh`WPhD%V/[ha1~pPPWhD%S^_[]USWV$@1N R$eT$R' 1jWWVVjjhb|Gl=Ol9,1۹cWS<S1,G,10G041jWWVVjjhdI 1`G`fX"g\hd ihD$4ha1#QP 1PD$PPVVjjU D$PB x1pGp1^_[]1wwVt$F~|F P興 t1@1FF^SWVT$1ۉZBr 1Bl@ZpQkd)QhD%V|{ ^_[V=@9=P9 áD9th%(D9Vt$D9uh%~(D99w1 k<L9^Vt$=D9u h%K(1t*uP9 D9tL992tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hH%hH%hh9H% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FDU'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$T9uh)T9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IQ sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW .Qw$$$S'@21^_[Ã!t*Wp1@<QcWPVV} rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZJ%D$ Pb D$F,N0~8V4t( uD$D$PSWRQt$(hFJ%j$uÍD$PWRQShnJ%j |$Ml$vE4tL$PhI%Qa D$D$uPhI%j_t1ۉ؁^_[]E@USWVt$ $=@9$WhpK%jP 1t t^_[]Ë P9 ÍD$TWhK%Pj1~jDj¨tD$$?"Vt$X1ZVj&ZD$(D$`C\$\C D$XD$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h+B#W ƀ8tt1tCuVL$ D$ j jV^ É$qj jV^ t#D$Zj jV^ D$T$C\$ \$D$|$u\$uthh>%SJn hVS;n \$E61ۉSt$,j SVD^ É$ tbD$ ʉ $tQD$ D$tGjh#t$}V tOjh#V tdjh#V te|$ush?"j XD$(krT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j hU'l$}UB hj$tJ@j`PQT$7l T$ $B0Z,D$B8D$B4D$Du0|$\t)Ѓt$XP T$uD$DЋL$Ht D$ D$,D$ T$HD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPvHƧW跧߅uv覧^_[雧hK%hK%hh9H% D$phK%j iSWV=D95L9t^sI3?t#$t$j(PVd 4$_u9hr|$0VPhO$jxW WVV &t Ĩ^_h-%h~H%hh9H% USWVσ=D9u h% 1t0?t+D9t!-L9E WP& tt/|$thh%Sa_ !hvSL_ u4$$$$$St$hJ%j ^_[]SWVD$Qt$RhJ%Pj h?"t$CI$jhU'PP uWh?"jI$tAt$h+B#Wo 8tjt$2h?"jH$ut$1ۉ؃^_[USWVӉ΋|$|$tBhK%S訔 hK%S蒔 h"K%S| h(K%Sf h0K%SP h6K%S: h=K%S$ \$hH#Sj ǀ?t(#XU'WP uE F@j`WVM\ -j(Ws tj)Ps t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVUO |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3ha1#WU WUUjU, H>wѻPD$x0ha1#SUڽ SUUjU H=wˉ9DD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]áX9tp.X9Vt$ X9u V. X919vFt=NL9wu1w 99^ËD$Hs-s Z'.h#hL%hhL%轓 Vt$ =X9u-(t;u2L$ rȃs['$tu91 99^WVP|$t$=X9uH-j PV =v1t-h[t 9t4 9^_Ë $9u։^_-=9t9ù^-D$1ËL$T$t$ h4.WV D$$s1!t$ T$L$7GWh_. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh[-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh?-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh,^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh#,^_USWVP} uD$Phe,D$PhG,1\$}UM;t;Gs} ShC%q} ~Sh"G%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW{ L$D$ T$VQPRt$VhH%h$P $L1QhPjV趁x`WhydP~ D$V-|$t;jWSaP \$;MU}hL%hL%h hL% 1e^_[]RSQP Sh%%RQK ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS/x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVS蒃 )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H 9)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SUcl @$\Cǃ1:k0hWVw D$4WhPW$XwgD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(tÉ|$Ue#D$0jPUQt$(J1 Ⱦu#\$,hPt$ T Wu|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P' PʢD$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjktFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14HrFuU9rt$D$l$x P?tn{ C K$;}sL$4QjSPL t_D$HtW 9)1ɉAw Puu2S"j@jPr fdžUSq1ۉ؁4^_[]h\K%h=O%hhL%o USWV,D$D D$HhjrjƋl$P\$L|$@Y'W$ F|11Kn^؃N$F Fdž?džjh>USf @džPWwt%D$ D$D$D$F11,^_[]h\K%hO%hhL%n USWVhED$$11@D$|$ t&1ɀ8>@,19QzvPWk! D$vP6K! 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[hlO%hPO%hxhL%W USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]fUSWV0$H$D7蹹15:5:5:D$D$ D$1D$hO%WU$& pu <:e~ft$lt*zD$ƒbtCeubD$벡<D$ ChjVV5<hO%::zVhVV5<hXI$D$Vu=39}4D$$D$l$ t%1PPUz D$yUh k$IL$ tHt$(UhO%Vݵ h{"6uRhO%fD$0Pt$O> #D$8=$$ ::jÍt$0ShV裑 u UPVC UjD$0C ::Sxy hO%t$(V1|$P.y hP%; y h P%vuWjt$>.1St$/.4$t$"P%She#PPst1hP%t$t$-4$t$~5$:5 :(:\3|$t3,:j3t3=l$u1HL$(Qhht@P"B PtL$* 0:t$[Duh'P%lʼnP-yhP%T D$ yh=P%@$uBL$$4jP-4$t$V6聓6hRP%jPzh j [V j|$WUt$/ x>tq1.SPt$  yX 19u2 :$:)uX 8t1FVhdP%1FVShrP%VUt$D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u X 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj U URL$ɋD$tPr V@V P h_1#PVhP%h3_} jUr V jVT jR VP^Ð=X3u X3,:@=u1HP,1;X3USWV}uCjhH: H:X:L:\:P:`:8: <: D:@:|$(jW 58:5 :<:$:?X+=X:\:@1;`:)ω|$$\$ D:95@:T$s;D$0`:D$(L$, \:X:@:D$D:D$$D$ =(:EtQ1$w ww7wwVWV& 7www ww$PWjT M$y1~~~ ~~$PVjT 1@F ~~~~WVW[& =(:B5fDŽ$ :t$Ph k$hQ#w 1F: :ƒ\$\$xT$T$|l$xDX&ݜ$݄$ W&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh$QPqv 0:9|ӡ:tPL$ L$)΅~DQ4))h_1#ShT['Rh $QPu Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4<\'QPh$SW{u L$(+ H:T$,L:NjD$0+P:x@B‰L$hT$ll$h\$@$: :1F؃D$@5W&|$vqL$`\$dl$`DX&ݜ$ܼ$X&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4<\'RSt$Dh $QPs  ::ȃ||=$: :݄$|=s4;T$D$r(|$$\$ ؍4)hB$؍4)h5$QPis ƃ}u 4)h?"QPCs ơ,:@=u1H$VQP e^_[]+8: <:T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$%QPr 4ų 4)Rh="QPZr ùų i)Ǎiɉk<)Ϲ)VRhO$QPq 0D$4L$8T$ 1ɉJJJ JJQRPN x$1H0VO 0j}O 0^VD$ B J1rrJVRVR $^ÐUSWVl$tD$ t|$ 9vE4O 71C~7|$1ۋl$tE:ED$4FFPha%jUp C9rED$^_[]USWVP|$D$\$1l$ȃ t :t-u GGuZD$OL$3DBt1DJt*u?t!tjjUW C1Fu ON 1^_[]USWVjt$1Kt.Ƌl$Ut$P2 VG9u M 7߉^_[]WVt$ht$8 t"t$t$P V1H^_Ã|P$ t$L$4T$8P11H|USWV\$ tol$}Wj Q' t A)WjVc' t:)1ɉ}  t uFt t #t;uu111"~ #t\uAu $ u t QA^_[]Á Ph V%t $  fWVt$ Fv Iv NtHN V~tbOtHON t w9GW0GNjOtHON  t wGWF~u^_FUSWV$$$$1ɍt$t1G$)ljƉ>umFOKu$t$1VQ$PpL"u%hQ%SFK 8t0 tb$UtM$dtPj $dPU` t$jW@+ tu)$-j4'WU% 1Hp^_[]Ë$j-UP& D$L$PjD$L$PjSVt$ t P닆t>PD)džW1ۃ1ۋt9PLDdž- t^[VrG V 1uUG 19^SWVlT$|$$VPC1Nt/ǍD$PK PSW t W+l^_[USWVӉjh0jWQ ǃt{jjjVB L$ F#t_1#w#tŃxQ%_1#_1#t pQ%؉_1#te%|$u_1#SQRPhQ%jhVGh ^_[]USWV$=~ F 71Ha~B11ۋ$4V= <(Gs@ ,PVQ C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)mE jj9ƅuƋNtHNO N uFF9sSP:tVF^ St$P ^GNON1wOWhPw [@v?V?1H^_[SWV$uShQ%hDQ%%M $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6C 8 C 89hQ%hQ%gLNF G8~ ~u3FVhjv 3?uhQ%h0Q%Lt6hWv  t%uhQ%KPWVu  s V^_[WVp׉$ftPh`Q%hDQ%K jL$PQWH jjP PjW tnjjW t\PjWr tHD$|PWV t2Phjp =u6h`Q%h0Q%J"h`Q%JWo h`Q%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Seڃs tAt1t% t&%SB su^_[]USWVt$48`ځ% t0ty@ !ȉف tVeBt !ف tV-dt ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jWjW5^_WVPt$4%5@u^t8tW%Vh$%8Vho#j>#45@u`V,<jP,9 u hR%G,ydž,shQ%\Gj>3 t1t3u5h$0iQ$ h$1PhX%F iQ$ h$1PWhX%F^_WVt$ hG"PG4r%t8t7 uhY%W諮㋎8 84^_j+>^_USWVD\$\t$XFpt+NMT$PQhj@Rxuh&R%FD$n D$SPU6rVt)ǍFtۉ,$t1j@SP SUhMR%E SUh;R%E 1KNދl$Xu^1Ct'D@Wt$ P+a ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFD~ uC t<6@u,uVr'F@ ȉC dt7`1Ҿ<1uCD1`1dB9r ~ jr&`ǃdf@K`1ɉHHH HrF>rD&>C5F $P w_ǍCWt$PD ;)QjPr7 hY%Cbu^_[]ËFUSWV |$8t$4l$>Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhY%N> SWVt$~ t^_[ËD$|$F @PWD[( ~ t͉^_[gV6uYhY%Qk~LtV7At(t NHtH<#tvR%PV"^WVt$ >~Hxw16tЄuOF$uItV@u hY%=jjAV? u hY%<^_vF$ljjV? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph\S%;G$C$G>C>>-ك**PWQv WtgAt[ƃx t Ph%S%Z;uSj$( ҋ>$ 1GOtHONG Pt=3uFGGtIO9tA t3@UUD" A3WQjjs.>jV*ta<t$VtSs< t[=VS>= hS%7 ^_[]Vt$N Qt<tNH9HHu^v$QP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/. 7 VhT%hu"7T$1|$`F(f9t(~ tωӍV QPRhT%u6ڋL$tf~(^>8u(F*4$QPωR ~ tcF D$F*|$ <UWSPωT$sP\$ShDT%5 <PUt$WLPShaT%5T$ V>t*4$QVl H^_[]WVt$4rDD$ tN8tCt;D$ jP, u!h~T%hQ%5 j,^_Ã~+ajjjS ̓khT%hT%hT%4 1m9hT%hT%hT%4 <5RhT%4@hT%hT%hT%x4 111dh%hT%hT%Y4 @+X1BWDPU hT%hT%hT%4 11G1=h:h:6u PW+h:zhT%hT%hT%3 t0SvPhT%34WV11PPPVCD@PjVN48@t @ sfyt ‰48WVK^_USWVP$t8D$ \$9}$w ŋD$4VS tE9u݋D$ 9t9 uZ<$hY%WN1PPt$$ UVW WݖW;9t>G 1PPt$$ qWD$$ W4D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1,G@8u^_[]USWV \$@l$8;h4U%W .hEU%W !hUU%W D$$D$heU%W |$t$<t$ ǃt1Fl$<4 GF9uW$t$<l$Ue WUD$P E t=1FߋD$@D$P) Wt$U EE F9t$U%E0V @PVU,MjljŅu <$1EWhnU%/Wq"3|$D$D$D$ D$l$@Wh_'hU%UVjM,4tN6urD$̓o%kt?nu1@D$뵃Nt4Uu@룃pt.xu D$D$넃|1@D$ pe\3$rbD$8@#L$؃ 94$D$t$4t$j%W|$47@D$D$4tۉt$t$@D$ D${ t^$D$9}*s |$ D$@tV t|$/@Gu݋$;D$ut$Sj“ D$t$[uD$L$jPD$@p . D$4ttq$@D$ t$ރ{ tV$D$;D$}*k |$ D$@tU t|$>@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]$ |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tW tFt$9t$VЃ с u VZV[}^USWV$ 1t$t$,$|/xhU%W h4U%W \$0hVS jǃ0U%\31O$(0@4jV9u1 1@PPu1Ajj $$ uL$ D$l$,D$D$D$$hU%tU%Uh_'PSV,?u$hulM44tN6uD$륍HvH w<$|\'<$`$X\'D$T%D$dD$YxPD$T%D$; $hd$ 'd$ 1@D$D$D$$l5<~ $lD$T%D$D$T%1@D$D$ x D$ %D$ D$D$FD$ 93t$ft$ n($lz($t$p3)$$ݍ\$0Sw1VVVSC7$U$ PjSeB\$h$[%x D$ 93$ 4$|$4Wa?31VV4W6I$ $ Pjl$@UAdD$D$h[%Fx 1h[%$hu($huh[% x $dL$ 9 3%$0gV U#|$t_1#w#|$l$0$the%QVhU%j+U)? $hh\'hU%k@ hf[%Nw 1_1#PPPhU%j+l$DU>  $d$h$d 3|$$tD$9tD$Uv <$Z$d$ht@4$  t% Љ$h$d tD$ @P%$d@gl$0$h V%<$uhI"hV%u$e$jj  $Uh4jh\'vVv|$t`U莹HrFPt$hGV%# \$SVaD 8$$zU_ $d$h$d$h3T$QR$4 $ $dhI"h"V%l$0<$sD$t<t,<ulhU[%t |xU uDh7[%t ULN hD[%t Ut D$1D  Vh""4$hI"h1V%|"D$1Cl$0$fu UuhI"hX%?"D$PU'$tCt)QqtrqpQI#$PxDŽ$WUZ:$ t P" $@$1U$s$U# U,C$;\3t P$hP@1uhX% $ht3$\t'L$jQPb uhI"hQ% $d+"$le$V$h ؁^_[]Ë$ r,u'3Qj$4 $ u*$d1PQQ $  $g@u h~V%$ SUQ hV%$dB $h$d$hUhWjj$%t'UhXj$,$hI"hV% hI"hV%VhcV% U$-h#3 8thI"hV%#$d L$ vW 8 h$d$h$hl$0$hhV%B u! 8thV%hI"hW% hhW% u! 8thW%hI"hW%G U tUhI"h"W%Uh]W%1]$dr;$h@ щ$d$hU諴tePhI"hW%KD$$Pjh0j0-~ h"}UPh7W% :$d$h҃ ց uڻ$d$hr>1r3$ L$QPUV [$d$hW%r 3$ _1#_1#tW% tW%VQRhA%pUHt$01D$[hPMu hW%lVhTj$$WuhI"h0Q%7$u($dr$h$h$dL$$PQV!$&$1l$0~O$4P!t x u1X%X%$4PF$$9|t$t׃z  Ru$hh\X%PHD$0P`$fhvX%/h%D$$L$($\P蔪UhSj$h$ uhI"h0Q%gy $hhW%n$hD$$L$($\QUhSj$h$< uhI"h0Q%V$D$xhI"hX%jihV%hI"hW%ChI"htW%4hI"h X%hI"hW%$4P PhW%$di$8l$0t+1 tVV$ uދ$|$WPt$8V WVD$$f@t D$0P&$1t*1G{ tSJu΋[uً$d<$r0$1Ʌt z uRl$0<$l$0<$u@u0$h@hX%PAD$0PY't#%@tD$0Pho#Qj$[WD$4Pq0$01~ tVh9-jj$vS WVjhH"%mt*VPuVh Z%DW hH"%h#'^_Vt$Vˬt$pApdr$PhZ%EjjkVhZSjdjw ^WVPt$D$uPhsZ%hDQ% jP,P tuIhsZ%h8uM, ,-dž,>wt=D$|$ffN(ffOfuj$ ȉG_1_F*N>QPS F>)^_[USWV$lt pvhR_%PWe t=wM$lDW 8thR_%h k$h$u)h_%hR_%hhf_% $$l~>1ɀhL QSP ƍl$hUPt$ UU =wfD @PUhhR_%W8udh_%h_%htI{>tA,$fEC(ffEEK*S>RQP$ C>4() P:1pČ^_[]ÍF Ph_%n tt {>u[[ht h_%? ~>t$fF(ffCCN*V>RQP F>4)mC Ph_% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP# 1HXjzu V >8t~L$ T$pFhf@H X@fPFM1^_[]hX`%h4Q%hGhf`%h4Q%hHh`% D$tFL$tt 9Jt ;  . 1HBH@M1@hX`%h`%hh`%y USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;vb 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jrDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$hX`%h`%h h`%h`%hh`%h`%hh`% L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]hX`%h`%h|h`% D$t L$HH@LhX`%h`%hh`%j D$t@LhX`%h`%hh`%D 11WVD$ t!L$T$t$|$x0p4P8H<1^_hX`%h`%hh`% USWV(l$<\$߾\'1|$ |$|$<$E4t.1FM0 I?r) E4  G9rՉt$@PjA 1Nt91D$ D$D$D$9E4t$1E0jS4 t G;}4r1(^_[]hX`%h5V%hYh`% l:tD$ l:Ql:p:WVjPj1tMƃPjt/1vN F NN F N$(F(N,FH V4^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PNSv@1F@FDFMF t@PtQPV Ps؋PtQPV$ PRF uPtQPV, P*F(uFN^_[jt$USWVu-~L =l:t'l:H l:l:N8tv|x| @t,'\$$3SVU" Uj 0 `3 s SVWV  ^_[]PL$T$ D$$PXUSWV։Z $VhU S PUhu"W" ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXád3ËD$d3 SWVhS$  1OtFƃ ||t +D$HPh3Ph k$Q] h3^_[á`3ËD$`3@P VK hjh`3h355`3 jVP |$t9 V1H1@^Vt$tNVV VLfV0jVVQ6^^SVt$ V(1Kt=jhj t!jhj 1ۃۉ^[ݤ Vt$t'P胍džtPedž^鵆D$t$t$t$7 WV$hjW F jPW膯 Whi t D$F$11HĐ^_SWV$hjW C jPW" Whi 1NtF$$T$ !fD$f9t hWhiE t1Đ^_[ËL$A$u1ðyHutUSWVTt$h^>tv 7 V1H11Ʌt< $BD<IG9uލ|$$ ^ F>L$jPWV) uF>*PWV 1T^_[]VD$0tVjVf"v^USWVD$8t$\$ 1wG oHt/usOWtjURQPwVjS$IOXxuP uf@ wQ|jUPSVt$,Vj\$0S ?O^_[]ËL$1t$ËD$t 0Z VD$0tVV!v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV Fjŋ$@V?T $1WT$ȍD$l$C txuD$ Psqt uCutF L$0QP tًv\$~;1$D$0PtW tF9u19D$$"$8ЃD$P1~11TjT$4R4  t GP9|PX~11\jT$4R4Μ t FX9|XD$ 9D$H$~11LjT$4R4y t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$uVhW*$VTPRt$ $6@utW|t^WZfG@GȉGDWt GLGDw sWkGHGMO9Et$ha%W$AD$l$t$0<4$t t)|$ jVW w_ jVSӥ r 1N^_[]j:S t/@1UQhQQj QP G8mt (G8GjSP] O t 3DPu:pKCu1l$PVhVVj USy G0Et=it.u1@1QVhVVj VPF <$ O4G4USWVP~~!D : : ::hd%F: : $<  O+hQP芠 =v1 LJ\$ I;<j,jxt ǃ| h_d%j,jt ǃ h_d%j,jt ǃ h_d%t$$Whdf'V賟 D$9rh_d%hkd%Y$|$ 7D$PWGD$t$h+B#D$P ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW̖D$u?\$Sd J9t& t uJ؀\tJ\$9u돉닋x$8|1x| $A AAhl$<t$$hV0WrD$t|#t3=w&AL$0h_d%hu" HD$1D$S0Wr 1ɍD$D$$D$ 01D$ύD$PD$$P=D$h+B#D$P ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$hH$U ha%U h/#U $D/'hb%U 1Ʌ<$t$V՚ H9t- t u!H\Ht$9u1@$D$$<PS 1Ʌ $1@D$U$@tXtT$@S $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$ `Dd<t A`Nh_d%<$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щ؁$^_[]USWV։ϻ`l$Ue'> tu;uHUhd%e'D$uuUhߡ#t$$t$$Pe't$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPtt*t$1PPUZ t xTuXTj卆jPW67 X6H(\x|tW,|u싾xWtW,u싾WtW,u싾Wt7hu닾WNtW1,u싾W`V^_[]SWV@t.Ɓu$È@Ƅ1@ ǁt!t !ց u %t utxx^_[USWV |$,t6D$(3|$$t)`#L$# $ 1CƋl$ \$18U%sU%Sh_'Pt$ujt$\L$,1VSWP|Wzjt$\t$ VSWU^W\jt$\t$$VSWU@W>jt$\t$(VSWU|$Xj=|$\W NÊ@tC< t< u CCu1j h%f%We _j h1f%WM jh>f%W5 \jhef%W =jh^f%W %jhTf%W  jhQf%WՃ jhf%W轃 v jhf%W襃  jhf%W荃  j hf%Wu !L$P1T$XPiL$T$t$XV**1K&j/V藧 uD$|$PLjPP= PL$LrL L$LrLL$T$t$XV)1Kj/V uD$|$PDjPH HL$DrD L$DrD |$XD$Pi4$PTt$X)TCD$P@3|$XD$PJ$;\3t P"11j|$\W#ƉD$VljW"t>thH"%V V$ǀlD$P \|$X L$P T$Xj$HD$X|$PjP,"hd%hd%D$Xzt$P jP!]ha%|$X@ D$P$<at$Xq  $<Pv D$PU|$X hE#|$\W0 t$1VWjWWWWP? L$P9>t$Xhe% |$X t$1VWhWWWWt$t L$PA 9>t$Xh1e%M |$X< $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV$$6?mjt$\D$ 0USWVSQQ jt$\t$$USWV5Q3 jt$\t$( D$Pt$P1t$Xq%mdžD$X 8 j/P趢 1|$Pt@j/P蠢 tƍt$X$t/F1V$ |$X t$1VWjWWWWt$t< L$P9>t$XhMe% L$P?)‰T$Ajt$\ hb%|$X7 j,|$\W諡  ƀx 9l$Ps%ƅ@|$1WShSjSSt$tP ,9he%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFup냃|$Xt$1VWjWWWWt$to L$P9>5t$Xhe%/ |$XD$P 4$HLt$XX#L|$X1K|$XGl$PGt< t< tGG1L$1V8"7T@jPXk  XL$TjT UK< t< lGG|$Xt$P\At$X| \hd%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P$Ɛjt$\V3u7D$0Lww 8t$Xhf%11IT$P  8D$P(D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆD$Pf$6l$Ptu|$Xt hDg%D$XHU 2 )@Uh*g%~D$P|$XkD$PD$PD$P|$X0$6t$PhLg%l$Px|l$PŌ*E$ |$X.E$$(1|$Xl$P$Š|$XlD$XhE< < ED$PD$PD$PD$P"oD$P \D$PLD$P <|$Xt$XV聬@ $d |$X|$XG\$PHE  @D$PD$PD$P@D$P|$X$;zl$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV6Hu8jt$\t$ USWVHujt$\t$,USWVHt$Xhd%mD$Pl$Pń$1D$X2u31L$,|$X_D$0K&   CD$XxG< t< tGl$Gl$1USjSSSSt$tVJx 9]Jɋl$t t + OGuhg%D$PD$PD$PD$P |$X2t$PBjt$\)AlD$P\D$PLD$Pƀt$Xhi%|$Xtut$1VWjWWWWt$tv L$P9>t$Xhi%D|$Xt7t$1VWjWWWWt$tv L$P9>vt$Xhi%Qhi% Ct$Xhg%W~ à \$S˯ƅ|$P4Phe%SV  jV@Ht t u@j/t$\ז {AL$t1|$P# D$sN|$XQ1j:W\ l$t2At$1VUhUUUUQDu 9.Rhg% j=W ED$(E@1 t rH@Whje%GD$Pƀ 11 # yD$Pi1t$P XD$X+.U$ D$L$t$XYd$D$ $D$ D$0D$ D$,dtV`͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu Nul$P`BjRQv ƋdHR‰`df||$XD$D$ DD$ DD$ DDl$$j/U) G Vhsg%T$P?@?Uhd%]D$(hd%GC Ɔ h f%" D$Pǀ~hg% 1K$d Vh0i%  hd%dD1DDD DD#.u hd% @ ;1|$1WSjSSSSt$tVq 9t Vhg%_t"Mt t [ME1UD$1\$P@jP^ gQT$ȉ|CD$(1hp$WCjhp%W-1xh+h%Wh&$Wqh="Wlhp%Wfhp%WCh+#Whp%WT h"W{w hp%WeZ hap%WO t$ hhp%W.O hnp%V^ hvp%VR h}p%Vi hp%V h"V hp%V hp%V h$V~ hp%Vh hp%VR hZp%V< hg%V&z hp%Vk hp%V\ h#VM Vhyh%T= 3 t *KC   t KCWhg%Ɔ  Vt$P1$ƀh!hg%ttC< t< Cuh4h%ǃhd%slD$,@ǃ%Ɔ 1YL$PjGt$PAjW @Kh%W3 t-h%W! th%W t hi%W t@hJ&Vӭ thi%V D$P@tsFH t t@@1G t 7H@ttC< t< CuhMh%Ƈh:hLi%sF)< < Fhd%Wd 1$SUje tUhf%1C CC$f8l$1USjxSjSSWk $D9]{$ƃWhf%]ttC< t< BCuhch%Ɔ )L$P1SF@D$PV &ֹ 7"ƇhD$Pǀ1^S#؄  H@เƇh7D$Pǀ$Ft< t< u GGu1L$l$S L$1Wp F <$W[ÍD$PS#CUP#؃8L$QP#t$PWSP T$Xj n11jU\QÉD$=hh%t$PjPj 1Ӄ@ (CjVtl$P@ h;"1F؄t  H@hh%1K؃<^_[]ù@D$Pǀ=ǍhPVj -hli%F -{ < < Chmf%蛿11Kh@߉D@ыD$C*A*B@zhd%$| Cg{< t:< t6CSݠNljjU? C%{< < Cnt$1VWhWh\WWSf L$P9>Shf%2l$1S 1K4$ƍ|$WP FWPw 8UPh D$P4$VP L$PT$XjC"ut$PjPxCt+j/S辆 tIGC1L$Pc 1D$PVSj u7tb\$1SVhVVVVWFe L$P93tQUhf%tGShf%覼1F FFv@dD$PƀMG=6 @/@(!  t$ %|$(t u$Whh%t$ût$1D$( s$t %@uhh%葻?suhh%ptF1tC< t< Cuh$Wt)Wa Åu"1rWhh%-1ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP貫 t(t$Qk,1҉T(T$T T!hd%,S譬VD$0D$ FD$(F^ t8Uj ljD$FWUP= >)QjPt 1FFL$TT$`r|$\s72USWV׉ˋt$$Vj >"u y"uIFA $Vjat*Ń!9 VSa ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P?W T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$PV T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v聮 71M^_[]USWVՉϋRF] j=PQ ,$|$D$ Vbg 1ۉ\$t?t9D$ 1j=S )9uWVS[ D$\EuV4$\ t5ƍEjPt$ 荧 4DL$hi%Uhi%hj% |$$t#4$C\ tzSaD$uv 8Vt h^k%ňjjUdq jWUNq Gt ;D$TG9t ;D$TWU>nWVjukGTL$tIѺ!! t=l%Wjv3u!讝 8t褝 8t hl%(W9߅81SSVp tLWVmWUj9t!O hGk%ҥWSSV;p Džu1VD$PVD$ PD^_[]t$ t$ ËT$11;T$ tэ HUSWVPՉ΋BTx tt /4u$UhtEPXt1^|$)G&tl%lG|E|GT;ETUWyGttEtuGMQPUupG8M8QPAu\Gx;Ex$UVgtb@tt EtGT;ETu8M8QP1WjJ1u肛 8t$hl% 1$Uj1uK 8thl%ϣ1ۀ<$tWVZkW؃^_[]ËGx $;ExtUj0u 8t hl%r$=htl%hml%hhWj%; fD$t%@<t <u ø蔚 /1hm%h m%j;hl% D$t%@<t <u øQ /1hm%h"m%jQhl%貓 D$tBHt*t u#xÃxu x uxux /1hm%h-m%j}hl%R D$t>Ht4t uxjh f'P3 蕙 /1hm%h?m%hhl% D$tEHt;tu&xÃxu x uxux/ /1hm%hMm%hhl%荒 USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^貘 Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=:uD1FFFF FFGF:SVrVW_uH:މ^_[]Åt 1u19[:Rt1hm%h\m%hhhm%h\m%h'hl%2 USWVP|$G<t<$ $ l$W)Ã|WhV茓 t(ٸF|$\$$)؃|PjVW 1=:u+:W9u!: /1N^_[]hm%hm%hnhl%; SWVt$|$~tuV\t1WMu;^G8u-8rt!1ɀu,r)É!rPWV諺 ^_[hm%hm%hhm%hm%hhl%j USWV|$t$)Ã|UhV t(ٸFx)PjVȑ ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQESyKWVPQ ^_[CPh[$WV 1t߉h%hm%h{hm%hm%h|hl%M D$tL$tf Hhm%hm%hh%hm%hhl% VD$t&L$ t/fqPp QPI H^hm%hm%hh%hm%hhl%词 fVH$ f'Phm%v u^USWVD$t$V01Ij0VI1|$/ooo WV5\'t-1C \'I?r 蜓   DE9u֋-\'t/11C \'I?r c   DF9uWt$V8 1ɉt$\T$\RVQ2P_bVt  81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP) tbL$1tHhan%h=n%hM8| /IG?uWG9rD$^_[]hMn%h=n%hhm%@ USWVl$t$|$t1ۅu>t7NHvR%t&H<#tÉS1ۃ1Ct:tVZtXtShun%t؉8txt@HtPt؉CjVmt.V%t!th}n%`t؉Ct:8t1V]t$t8uC^_[]CWV΋:t$ FtPVJ 1H^_SWVD$1tQ|${t 1N4~0jhn%W= uW3WI G9rЉ^_[USWV |$ 7u ;l$$Ujhn%U= \$C UPWhn%OS1t^DžtnjSW  8thp%h[#莗9hn%1HzSlt$hp%hu"S tG11CGt0WH ؃uhn%hn%?Ņu1 ^_[]Ë$t|$u%tPWh5p%hp% =mQ蠠PWh5p%hCp%迖KUSWVӊB D$ L$$t W *QPYNjD$$7@uMh#Qn%tQhn%W < Pho%Wr |$ t$ho%WM }D$D$h(o%$U~ t$ hun%U~ UF |(6h}n%U~ 1>hY%Q~ hH<#$U~~ 5hvR%Uh~ h?Y%UR~  h&U<~ h tr7@MǀD$(he'PSt0ts~ t!V5t&PD$,P9uvho%Nho%A1OĨ^_[]D$D$D$ho%WC t1PPt$0VmZ tc1PPVZZ 9th>%h k$W oET Ph k$W QjUt$0V Z Ņu1UVWU0 hY%$Vx h(o%Vx hY%Vx hH<#Vpx h&VZx hvR%$>x tzh?Y%$&x o%tn|$"D$<u D$xuT|$t Su@|$ "$<u D$ xDu'|$ tjS\uo%#(##D$##to%Uho%W Vho%W SKC%tPho%W[ 3C%t= t1tVC%u vuPho%W ?D$ tho%W|$"D$<uMD$@tBL$q PSh?%W:?%D$S|$ "$<D$ @LL$ qPPSh?%WfwUSWVl$t2E1Ft/׉˃PWh p%StEu11N^_[]fUSWV\$l$|$ttUPWy> 1tk<.tgh@#Wu tUhlo$W}u tCj hNp%W1 t/tj.WqU tUWl3 1t^_[]D=|Vt$ 'Bءd3H d3;t3h\3j O \3H \3 Fut$d3H d3;t3h\3j \3H \3 FshYp% Fshg%ݥ Fsh%$ǥ F sh<"豥 F`p%gp%mp%up%|p% p%@uwxnp%rh"r]p%rR$ rGp%rU%hV%hp%USO 1N@t+9w');@MQP^&At9w :)߉h>U%hV%hp%US ^_[]USWVD$<P. t$ $hH#V ]NjD$@HD$?1jh!j%W2- ujhj%W- u|$D$4Njt$0tNF tA.t;\$SP7q D$P1U1HPUUUUSF0 9l$u9t[,OuD$,Njt$(\$Sv p t-D$P1U1HPUUUUS/ 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ hH#V賭 Dž4$ky14$\y7~ 1H^_[]4$;y~ USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQjV t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I${ V { "1H|$0t1rЃ^_[]{ { 7{ USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DHz \\$ $2f\\ $$[$T$$[$O$sZ/t uPYz tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1y T$$t4<$t s%|$$u1Fy 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMElx 1 ^_[]ÿx 8D$t)ݿ"USWV$$${ t;$tu:{LtDD$@-KMspQhhP~%W3V2 18w 1H(D$ p%tq%L$QSPWV̙ Ą^_[]USWVt$HD$DD$L$UjSj C@G jPSq( fC $4CCD V$4PxG UShipU C O*W>RQPAG UShipwU -m 1N^_[]WVPRQ@ ~u~uF $ L$\$ )͉$}݉ u1O~$\$|$ t1)<$|11IF 1؉F T$$))V(^,ȁ$^_[]ËT$ t$USWVP΋L$9t_Cx9|s)$UtUtt|L$$$)yurQ舄txPQW9 tUjW\ $x1{ujS91N^_[]WVt$xu9r'G r'Gr'Gr'1Wt%xPtjj"KP^_1HUSWVE$hV3 ǃtu1$91ۀ$$ʀtfp$u 19ct$$1ۨ N$PEttD$&$D$$PW $t$uF$uPvHV# D$8Pt 1ɿux|$D$,t xuHL$L$@1ɉ<$t yuAD$ \$H1 jVSK fC$CShi@}E $<QʀrufwwR1] 1K؍e^_[]Àufv$ffuˍ$Pj1ۃ$u|$HMVtq|$I$$<=P$PEtr<$~81AK\ 1ۃ8V$Pju' ty1I|<<ua$@to$t$HQPV5 G(NPVRQPW,11*HL$QP HP |$HWHO@G D$,HP L$T$HL$@D$ WV NJ$<$@tL$PPQu' $<$ $WP* Z 8tZ 81thr%hr%6c$L$ T$t$t$$QRVSjPWg$cZZ 8tPZ 81thr%hr%b$1|$HuL$IufD$J$ D$PuG*SVPg{ tuV 1^_[]fD$fx(t1ËL$ D$fx(uD$uV V1ËL$ D$fx(u D$GV V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWSR |$jj!JYƋ$(h@hs%ljFuJ1ۍl$Shs%j Uw h@UFuCeU 8tǍ\$($PhqB@W= f<$f|$ jUS ShlBWB= txD$PhpBW$= tZ$$VЃuBD$PhfB@v< t(D$FP7?F u+ h's%4]Ft PVO1ĸ^_[]USWVt$fFtV)vv vS AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ - FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP; ^USWV L$@T$*@h t$ Vhw%}k|$`$0P6DL$L$QWhOPt$$@$@$L0" 1I1AT$|x1|$$8L P€rM$0 $4WPVU t.t$PhOSt$$@$@$L0 E,T$;|r1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$Pj9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ Vt t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$1C  $C V1(^_[]ËL$DtD$L$tPVQ D$ƅuB SWVD$ L$tT$$wB .11t$|$X+9sB "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p>v\F\^VF`t# Pk>v`F`^SWVjh0j.L 1NǍ\$PSPhWr2trjSjjW]2t]jSh@hWB2tBD$$1ɉ $L$ L$L$D$fD$DtD$jPWD( t W2^_[USWVt$+VjU@Chu,\t#tVh"Pjq?^  r4%st%PShs%9`PShs%yH 1Bh"^_[]WV΋tF>rD&蓈 GTt tB9tt9BTtI䋆tÀ~>r QVhw%RH ^_ËD$\PKL$1Bh"Y SWVt$tgw]Vh"j>^ w$_PShw%"G GLhQ ^_[USWVhuD$G$D$GH L$t0w9GGGG G _G_1ɉO OuG_T$SPND$@tGHit%_0MwA SPht%F _0G8 9=\$8D$<l$8 X&|$ D$ fD$l$|$Xl$ D$XG8M PQht%,F w$]w(=PSVt$ht%EG0GH>t%Ep w$J]PVt$ hEt%E G0GHbt%z1HG8G4q w$ ]PVt$ hqt%IE K\$0D$4l$0 X&|$D$ fD$l$|$Pl$D$PG8G4tc;G8\$G0D$(D$,l$( W&|$D$ fD$l$|$Hl$D$HG4M PQht%D CG0D$ D$$l$ W&|$ D$ fD$l$|$@l$ D$@G4\$?u8Odt1D$;Au&Ghu Mq P[w0PVh,u%C Ep w$[w0PVh,u%C6u$HujGtGht:?Pu%tPWu%I(o%GHPu诫jR;7@O;Au<t y%?uIu%GH0MttQh"w4V :uh*w8V9uhA+w0V9E w8w4Ph]u%BM 1HG8G4@uYD$uGA _iSPhu%B wwhSE0#MuShu%BMWhD$T$u;wHQj3jt$S2: GdGh]QD6D$Gt@O;AuD$$<]GdPG`tMSh\,jP5uEhu%h0Q%A;t(hQ%Ajhu%Ae^_[]USWV ֋T$ yF BuB |$$t(tCNVًT$ PjW t)<$r#)jVQ8 H N@A6C8FD$ًT$ PjU- t |$r F  ȉFn ىj3Wt$(' tEnىj:Wt$(' tEnىj;Wt$(u' tED$ًT$ Pj6W t|$rFF ^_[]hw%hw%hrhnv%hw%hh v%0 SWVt$^ Shw%?G0+G8PShx%A? VhQjl61GNhFL^_SWV1{\t^_[ÉjhkQS C\t4Wh`jp1uh"|%h0Q%> 6 8u"5l3h|%> Wh"|%hu"b> 1NcD$T$ P2USWVPt$E $u 01E E9t~WSV|5 ur6jSV]5 t jPc= $WEWSV25 u(hnv%hbv%h@ h v%{. PPV 5 tSE EdP $PEt]U$uu h-.CF Phu%<6uu%EHPV褤 Vhu%= ^_[]WV։h,j(t/L$ PǀcSc tfǀ 1 ,^_ËL$h-.VD$tF9tAtIdtI;u D$ thZ%P^USWVt$\$#uk  GiP6V9?tAt;<t5n w$RPUhyv%:; j1VUj2/w -o ow-GOGO oo_Hu1GdGhSV謢#Vjj1^_[]V8=wc-1GG G$^_[]USWVT$ ED$@L$ \$8KL @r@t‰SLih葁 4\$ S=-C t%uzx%|$ tnp'\$ t]z8ZuSQ_= D$ p t%ulx%|$ t`p'D$ tOz8BuE1ɋT$8RTt$PD$Tl$P5 X&T$ L$D$\$$x%81sTQVhox%81D$ jP1G\$t2=[Lh\t$$G\u1\,y% 1Ny%L$ QP8ދ\$|$L$4uAPh,ja$DžT$  D$@dtdрs@G RuMH t$;N(ދ\$u9L$It$cu%uSucu L$AhtL$ A(GA>ɀwȈGGT$ *QRPI T$  t$|$t tAtftaލ|$`Wj0D$1SPW, 9s1Ht%t fG f|$fGD$T$ Ɖىt$FTȉGh D$4D$LJcScN$tG~DcScu>|$ u(T$Rdt$Fh;J11ɉދT$)ƒsny%D$ PR6 f5PT$T$ Pt$~$~DcScuuʉtwL$y<T$ \$tmL$+L$rf@6L$ID$ 6u/Ct)CZu#D$L$)ȃfPL$L$  $ShP ǀ gjW裭Ywb¹ sU@tJL$T$)9?@B+AQWPJ T$ |$Ã\$\$u9D$,t@D$L$)ȃf2AL$D$,tCt1D$L$)ȃny%f3ȉAL$ny%D$L$)ȃif7D$ 1D$$L$(rSX\$0u#1Ct$t>t$<ɋt$<r 1CL$L9Ptt$\$L$(B,;r|$ |$uL$0:u \$t$ʋL$\$$9L$hC\$$\$0L$ t$\$W D$4L$T$)9w; BL$4JQWPP D$4ǃZHT$\$)9v |$QC\$ $ AfAAPWǃ|$|$T$ L$|$,t6t-C^u'D$L$)ȃftAL$L$& ȋT$AtBL$)9?ABAQWPJ |$Ã\$\$ny%C_D$L$)ȃL$f|ȉAy|1ۉ΋ًL$)9gT$JIO4tQ ny% Gt$FFCD$;r|$D$$|D$(D$D$t$ Uy%t$|$1|$t$USWV$\$@|$wK*PQt$C u)C Pt$h{%,' ىt$ t$ X[u^_[]WVt$ Vt>www  W6ttt9uq@苆t'P虶džtP{dž@1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h m ƍG 4$D$,$5 X&D$\$$ w%%WhQEVje^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0j& u&h4j@`GHY%GP_iVjhS聣tSE0賫 LJ  twAQ2 \ BjWh`jPh<|%h0Q%#sY EX>@P UB( A J*R>RQP  ]rts4 t*Mq @T$hRQP3PV]hs|%2C>t2Mq M*T$hRPQPV]h|%P" Pj1wLw ?w wL$u]rruG XixiF SPh|%! D$h$PS6UORh<|%+"@u3EpCP  t: @ NH M plYhL|%!u VhH|%!h|%!3=u1HL$h$QP t=w:F h|%Ph|%d! w 1Ƀ8tmF SPhu"(!1Ƀ W7@uÍT$D$ Pj5SM؃ PG tL$SQP= h|% 1ɉOG @L$jQV.T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSkG@4G cL$Scu%0tGiL$QP6L$ <G cSc{ ni;`CLsu"1C &cMScq s$5PVh }%< M1Ct%j7puHW菂뉋Et xWtstـsSD$tPЃ8u)ʃAr  N@H@$USWV׉΋D$$E t @9u ;M$^ P\1PShu}%  EiP6-$u!}@uHhjjWV3 Džt jW7Vjj|$?$tDZ%EHPV #8#4 u2j1Vh:!jjx؃^_[]ËL$hQSWVP֋T$D$WPt$& 1Ht<$r 1t ɉ^_ËL$hQWVD$ t01r9wu f΅t0^_USWV׋$$D$?pΉD$CTO9u;F>T$ wAOV*PRQ3 t,t$UĤ)Ĝ^_[]~ D$,$\$Lt2P1ۋl!9,tG9r P.PVhy%*DtH1ۋl!9,9rD$Pj5t$h t>|$t7T$ \$uK u)\$@I,z%D1ɋ\$T$ t*u4_z% Vhz%oz%L$C$D$CL1CDpـs%USt$T$ t |$}Cu|$B6@t&Uj6t$^ |$z%t$\$SWVStǍF WPhz% W@|$? 6uhz%VxGiP6͜Vh:!wPj GPuD$߀ Vj4We t|$t$$}, uZtV,j@Uh@h\$ S襉 t$%4$teSPh"Vt$Wh{%t$( "ۋD$t$0$ P$4$L$ t/PUVt$Wh{{%QSPh"t$Wh{{%t$$E $PUt$ Wh{%Q.  hr{% V^_[]USWVPPj8t$ 5 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjjAK AuA jQV t=Ht*ub 4$#PVh{% OVD|$ss OD$L$ q qQPWV  (^_[VD$ Ph{% v 81F FFL^!L$h_USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh|%hDQ% t `jW0  tD$ WV h|% `(^_[]USWV$$($$$$_\ftPh/|%hDQ% cl$h$USr t'sPUVdt3_\t,Ct$?tF Ph/|%hu" V6$^_[]ËL$D$1PlSWV΋1u1PPVI t7O t P SGt-^_[F Phu%% u%GHPV q^_[WVt$ F Ph#}%OhGL^_鱿fD$ȅtȰ (1SWV\$C rk 1H4t${GPhV ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0he'D$(PEdx t]SLXƀH|EdH #HL$|$WVhEd@ D$WPgF9VD$(PyX1VVP VVP ƍF8P+buz3VMhVP& SW>WG| WD$(PWjVP ƅuSD$(P萭C$t{tlSWD$|$WPfFWPfF8MdQPfXMdQPfVD$(P/WS訬1PPD$,PR toVD$(P[~xF| uF|FXMdQP;fVt$|k9tVTVS1PPD$,P ƅuC$t$xhe'D$P1PPV ƍC D$~dVL`Sn8U8`?1PP$_ 9tC9t?UW{c T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$} T PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&U 8E (΋L$T$(t! tE;F unt ;F ʋNHNj4hƉXEFT$(F 1ɉNON1wF ~ u} Ʌt ѹ )QPh@l%jWi D$0L$,t 1ɉNFfL$OыE@rt$4VQD ƃu V2^_[]h9~%VD$t:t0t!PtQPV PV^WV|$ 1u7j>t @1H1N^_USWV $ yrV t$ $ q>Ypi@D$ \$fl$Ӌl$ hq%WU  8th%h%dt$@s"j@T{Dž@738 D> t$t$4t$4* t$t$8t$0 T$$L$ftf D$(L$ P t$XVn S$PV"r VD$1ɨ1QSVg PQFRC F CFKN\$l$ 3 ! F3 ! F D$(t8tjVW uʋEu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF oUSWVD$1tH8tB\$l$G@tjUP u8u@$t .o*Shq'U. Sh q'U kD$ 1L$A AAPj@QW1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU Uz V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS t=m<$Xj.PSj< 1T$ JO9zPW.EPt.tRD$@D$,$KU5E XUPh% 4$ f4$f 1SWVt$\$Gt!PtQPW P41PW tt2jPt4%W1VPj^_[Vt$^USWVPD$0D$ h@$6G@jPU tGT(1D$tJGTt%G OXQt$(PhS%GTGT@t[Ot@HO?D$ @PGP u ^_USWVl$$tEt^_USWVt$Ft-9t'\$l$9GuGxSVPUT?tF^_[]USWV0t$Dl$ UjNF D$D$D$ D$Nj9w!D$Gd@rNGTjPUZ Od)v u"GPt$h% GdD$D$wxF u F4jPUܻ N )v t}NTtYF m%t$NXQRPh% Vjn[u!} 81ts 8t h+%1F$F fTװD$$D$ȋT$ 9rЅtD$L$ 6<$tl?~u $tF$jPU 9Fv $tƋ$C N0QPh;%> NtHN됋<$GTjPU衺 OPD$,_LD$s)\$$h$@sl$ D$<$\$wtuۃr֋\${t$l$ D$tT$l$ D$<$뱃t)+|$,vމD$ 9rÅt߰D$|$ xT$ŋD$蜼 <$D$u.ƇD$@D$t$Dr1Bjt$D!ȋT$ 9rЅtD$L$ $L$ tVhKQjD$t9t$hP%nj6lh}n%V,0^_[]SWVt$Vjjtj11G9quƁjمuިt?j6  sh}n%V\+^_[USWV] D$@Cxt$rj.VL$,Qj |$,wVh{%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h%e^_[]T$rRQPh%ߋL$@T$ru_L$$9ujIu_yjjPL$$ tjt$(VQm t8D$ L$rQPh}% RQh=%g \Rh`%<$EL$t^9HtutL$EۋL$t$$t&9KuC jVP L$  uhj|ËD$CNC KFCF CCj.L$vQPs Cx1ɉKxC|ƃ9KPƊðD$(D$$D$ OL$4QD$Ph%T$ RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$( D$@h0u$@ t|$Gl1fLJƇGpht$#GxtHTGxD$`g >@t $L$$yD$<<t:<ut$hք%<<tj<uŃt$h0%|$$HL$Xpx jP$PQ D$<t$h~%|$rst$hG%$p΁Vt$h%t$ 証$x|$D$ƀt$h\%D1ɀ|$t +L$$t$$4XQjP Vt$D$`P胏 \$Zt$he%t$ $A D$PAD$LIL$HD$D G$?u|$(u&D$xdu|$Ttt$4t$hą%t |$u3D$8$u+D$xdt!t$ut$h%:|$(t$L$U@AH|$u D$D$6D$t0t$}t$<t$0Vj6 t$H\$1ɿSQWWV1QWBh(o%t$D$u%D$6j蒮D$@`L@O|$ut$h0%t$4q t$ h%jsLߋD$,9CPut$,t$V mVNGPD$(t$,谘GLtbt$,Vt$P wPD$$À|$(91D$(h%3|$(>W詨0Mtk,‹t$90t ,IuЅtVt$4p t$ h%U|$u/j |$u$jt$ut$h %詵t$5t$4t$t$ h:%f|$(tL$11BL$jsD$$D$(SWV|$G Ph%ujjƉ6菧F_>tC FPj蜠t.t+@JAH *RWP tF F^_[h"%}^_[USWV׉΋A1PUSFVUSt!NtHNVJFxjt$PK t$PtQP PevLXVO^_[]USWV8|$L_OTȃ GTGPtTk GX$PUhu}%e t#@uUhP%k S0AC $1E9^t 6u(Fxt1ɋPT8t9tʋхut4$h%Uj봋4$VUh~%r Wj Gu! 81t 8t h~%蕲L$o@G WQSRPUptDD$GTՃGTD$ j.PUj t'OQPh@l%j.V h%)hW  WhPjm8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW uFTt|$tF$61^_[]USWV΋yx1t>1COTШu* uG@jPw3 OTt OT tY?uŋFuh}n%Ph}n%Pt-u~`?w#F0hF Phφ%0^_[]jt$_USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Shb%.L$jQ= u h%脯$BHJAWhjj趥G Ph2%跮WhW iSh%Yj-t7UhjP@h%h0Q%ۮ)h%ɮd^_[]USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%hDQ%R jSWU< tD$ SVc h%p^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhŇ%n PU!D$C,9r|$t"w 7hŇ%8 PW!,Nu^_[]WVt$ tqwgVhbjߣ1GGG G XGgt^_$& Vh%hu"Ӭ ^_ËD$@|tHT(tuðUSWVD$1t(x|t!\$l$SUW u?u^_[]USWVD$t81t9\$l$tp|tSUV设 u6u1^_[]1USWV$/GXt$ j.VUj $wVh͇%$$tXjWV& ÅGD$Pjt$L$QNj ulpt$NjSV藛 tL$9uPVW+ t0 D$ PSh%航 ^_[]h%jjt$t$VUt+> t$ u2}E$<ߋl$ D$ PSh%늋l$t"UH4:QuU:QuU:Qu$t9t.tI4tU:QuU:QuU:Qtc΅ M $Uu@4xh@L$ QPUWVRt$Sha%d$ VSh;% G PSh%6 t){4t#D$} t*tu Wh% Wh%jjt$U\$D$D$D$1L$ ‰1Cl$s6jPt$l$Uh!D$ 1Cl$L$tjPt$U"FL$ ,D$;ZE.%fu" PSWh%艨t VW4r't Qf9Au<< <ut$H $8q'jD$$Pt$S) )ȃ&D$>l$^* D$ PD$p Whފ% D$ PD$p Wh%D$8\$ x@tLD$@<8u@ D$ PWhJ%IG L$ QSPh׋%jD$)t$VjRt$t$f|$ ˉكčG DQSjl$ u(Pho%Q](kl$@D$1D$@jjt$UdtjD$$Pt$' s ?4$j%&G L$ QPh-%˥ (SPh% VjSt$t$atHf|$u@0ΉčG DQwVj\$ s,Ph%-s,VPh% l$jD$$Pt$& \$ iۋT$tj݋B< $9J@s#P4$[L$A<4$V\$ SPv D$p@;u D$8u/D$ P( EPSWh%ؤD$H|t9PTtuȃ XL$ QPWhh%`h>% D$ PWhK%A|D$w 1L$ T$t$QPR#SWVPjh0j@ 1NtKljjSj hP荌t $jSjj)Wqt W3^_[WV jh0jΥ ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW\D$jPV t?jWj$j)V赋t"$jWh@hV蓋u%hň%V2 hň%1N ^_SWV\$|$1t=$dq' r]t1ۋhDj2H(H,|މ0fǀ<fǀ?WjhP!jjW t W G Phӈ%eWhWa 1^_[Ët#uujWuW 1NUSWVt$1퀻?~ Wh%P~ k1@CCC,C kVUjt(eVh*j jmWhʐ%hu" ^_[]USWV(u48Ѓ% u 58uu@1ɀusA u$r'D7sl7PuJȀ1C u u$u t8u VLD$1OxhD$ 1dt`1$f;t$ЃIu[1PPSh]jPWh%h0Q%3y$1M 6<$tu $\$ t=F QPh|%9 D$$hPS6%Ch%衞Qh|%3=u1HL$$hQP, 'D$7@\$  $9|$L$Qt$P\% sTVjj< D$!ЃD$L$+D$NT$T$$MVjt$  L$ChUt:+|$t$t$19}$uB PhV|%1FsD|$W]CDtL$$WQPn {H[\$ h-%(ut|1QQPO 4$6I$sD}1CDCH6.u28 8tv. 8tlD$ Ph%hu"補 NE uf։T$,|$t 9t,Nu:t^_[]USWVʋE4L$tPT$E4] w$q'謉 9 ȉt$,u9  D$,1uD$ D$,L$(D$$-D$ $WhPZT$ D$$]D$( |$ l$D$  $D$D$D$1t ߋt$;tS,OuBrD 1FuD$ 8rD$ 8u D$D$E,;,$ut$t)|$ l$T$&1D$1QD$ |$ l$T$11|$(ujt$( T$ ƃuAt΃ D$4upD$D$WjRP葀T$ D$x7?t@11A9r1ËT$u 1Ë}1$1 $q'D$HDH8D$PjWQ$D$Ãu D$hDxHT$B|tIHTu= r x t1:t,@Ptftft x t: u ft볉։D$ dt`1f:ÃIuD$81ɉu(D$6uD$ @t @u$$u D$PDhH1 L$wZ sPD$ uCD$2Pj URt.L$ 6Ƌl$ uD$ Ph %辍1l$ S@pNjD$x4t.X8L$ lt&f|$2uN H NHVP)1N J(H J(H J(H J(T$t,B>r#D&"D$H<D$@ WgGt tY;L$t tv4t8Vu 8fu8FtIыT$tz>rB QPhw%4 D$P4 uPL$pffBfBptYQlR(^ D$p4t$ffBfBtD$WVPR] $L$t6D$fffBt$tVt$Rω] ډ dr1ɋ`ɍ<@L$D=1fÍ4L=L$H1ɉL$LL$PffffJBt$VL$LQP'] t$ ރL$I|/,$YT ry |$?APtftfty t \$; ugf;:ub,$;]uTftNyL|$DyH|$@y@YD\$<|$8|$8\$%ZrRu$WPRVSQt$%D$ D$,|$ t_1#t_1#$BD$ BR|$u|$\$8D$<l$85 X&,ߋ\$0\$ t$T$D$D$LD$L$ D$PD$D$XD$\$$$%$,t$ D$xt&@Vt$SjD$,xVD$*PjD$p8p4f|$*uED$|$dWj&{~t3D$4PVWv 1Ҿ9s+1JUby WD$lF D$dL$hNF1/dljkdk_kd$49ƒrt$ D$ff|$tS|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWPZ uƃ VhT%&V΋Qhjht1ɉHH@@ @ @$t ^ Vh׎%hu"L} ^WV΋Ƈ?DtuU1B:wLoGDOHGLOP1ɉODOHthY%VP6##9F Ph9%|G|t1IHU H$H u1j:u)F Ph%^|1VPjs^_USWVX։ϋtu'C|t@Tu1ɀ@ƃ@L$ tG uVPhT%Qy1l%8WjjrD$$Pjt|$w$q'8uJu%=ǃ8Ϗ%8u+R%8uY%8u |%8{`G D${|tat$ްGTu3N`W u u1!1t9wGXPt$h%z ؋?ut$u {`|$ui s`t$h%z 1CdC`|$t%t$s USWVd|$xwl 1HD$8L$D$ @|tHT@uHTD$,D$`D$ D$D$D$,Bf9A)fftftf  $9v%l t$h%tT$BUD$PD$(PE L$8dt `1f9Zu2;t$ t A9u19uAuD$7@u.j D$\PjD$,PPt$ h%ks T$Qfua1D$(D$$t$$)L$1UVqT$u D$ ƀ>1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pet$|t$,t$,Pt$h%s:fD$D$D$PjUVJD$0T$4)̓w!Hj t$h%rfjPD$DPD D$LȉD$LD$PȋL$LD$P9v)i t$Pt$Pt$h.%rrl$4D$h|tjD$@PUՄ upmjhD$DPt$ъǀ%fD$ $BE0JM,E(EL$E(ETuET$%ETBE<JM8E4L$LM$E T$P9t MTU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%p2h t$hu%p|$ɋD$,u ȃd^_[]USWV|$_T؃ GTGPtG OXQPhu}%Dp wE tu{E|1ۅt5HT(tgGPt ftftGTu tǍF PhS%fot}u^_[]8Vs6&^_[]SWV΋y Whl%Qo 1CCCC CC$it^_[Wh%hu"Qo ^_[Vt$F Ph%So^L$\Vt$?N Qh%Pm ^L$WVt#׉΃|jRP t j6^_USWVPd΋ $1۽`D/fu /u'|/u|/u|/u|/tbfu //hQPVІt:ǀ%L/艈L/f$HC;dT^_[]Vt$VhjpdF PhN%m^PL$Vt$?N Qhܐ%Pnk ^L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%hDQ%l tjS0 tD$ WSV} h%ul`^_[]ËL$LVt$?N Qh%P>j ^L$VL$@h%P1|$L$8jQj*j)5 <=Gu hr%<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5 <qFy h%Q<t+DŽ$j$Pj&j)5 <3FuK1ۃ|$$p3D$,tD$t3S?8<uh%hŕ%ƣ::|$$tF1FFFFF  F)F.N,::9rF t$ƃ|$t.t$]L$Aut$h%+p3D$,|$,tF)F/p3F <@;DŽ$jjjr y h%< <<<<<<<<f<'u<<|$tjt$ j.j)VD=p3ujh<V yPh%UPhp3Pj)VPDuY=p3tjhp3j j)V/Dthb%$Ph<V苩 yh%h#%h@%V D$ t3 | h%و$jPhh5 <Ct$8jVj$j)5 <rCy h%qjVj%j)5 <LCy h%K<H H r8r t30 s~|9~ h%t$jVhh5 <By hɖ%jVhh5 <Bhߖ%d8t3PQh0%t <Ѓ1۹#<PSSQVRh<C#<t"QhK%it <ЃPSSPVPh<Ct"Vt$0tWNuVjM VjM 1<<@<L$?V1Fh3Vhh%# V6k USWVX <T<t91ɉ : :1GH T< <d<f < r+rm ]1sq::Y:: <:<:<:<: :: t1: 4<0<: :f:t3Uf: (<ff :f:=$<u"t$@jV ȣ:Fȣ:t3:<:1L$@A A:Y ::Ph:5 < ƅx9t&y h%VS5<h\%q <uWh3W) P<x<L<t<H<p<\<X< u2ءP<`<L<\<H<X< P؉+H<5L<D$8t$e t$hԘ%-e <1$@$T$P$L$H$DfDŽ$@\$K $XK $HN KN SVЃ#<PWWhVj$XP3t"Vhݘ%{d t$|$\$,=$<u ݄$\$$%Id D$D$(t h%2d D$|1|$ ;|$Dw|$D|$x :8j@9uD$ g Ȉ<|$<t$Ѓ#<P1PPhVjR2t"VWh~O$c t$Ffff9fDfPh+% 1@Ph3P:PhlO$h-% h8% hG% hW%w hn%m he%c hz%Y h%O h%™j.$Wt$|j*uj.h"W Wh%b j.Wt$,juj.h"W Wh%"hǛ%[b hH#Nb Nf|%fw t'P(b <GNju j.$Pt$ jN]h%<hO%a hH#a Nf|%fw t'Pa <F hE%Ffff=fhn%fPh>%FffQPhQ%a sFPhV%` L$$T$ /Ftc|$ umh%h%` Fz$` <F<<|%hۙ%` <tF %s%P_ K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( 3D$0LA ʘ$s2%PQ6^ F9uEPh%^ h% hƚ%hۚ%^ |$ FPh%] 6Ph/%] |$ "hߟ%h% hL$h]L$袔L$$ 'j.$Pt$ jF$Q4pt'h%Th!%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"P $@D$@|$ Ph_1#h4%\ t$ 9|$oh;%h.%\ D$$$T$ $@WjWhMQ$<&PK\ Ft hI%8\ d3H d3~\3H \3 h\3j a )L$|$$t1 q΃j.PL$Qjuj.h"$P $Ph3%{[ |$u"tVh&%a[  h%R[ d3H d3~\3H \3 h\3j a t$GNjL$+{h%ih$Z <t$Nhs$Z Ntu|%<&PZ 1L$1΄u j,Y D$H%x%%sVQWZ D$9D$t$uKj,_Y h%2Z D$4L$:D$tHj,6Y D$4WPhę%Z $D$4D$ uj,Y h%Y d3H d3;t3h\3j)_ n\3H \3)h;%h$Y <؋ d3Qd3~ \3Q\3 h\3j 1_ <z|$h ot$dc~)/F1#ty1hM%n2td3hm%X ^ F N t$~WRQPh%X \$Sƅx*Vh%X 'h]%~X N h&%dX D$@Ph9%NX ~`1St$t:j.$WPj蒚uj.h"Wn WShQ%W ShB%W C9u\$,t$ |$d|$h19wƉ΅h\3 (M|<T$p1Ʌu9QN V&jV31 [ VPjN 5<hr%7W 5T<h%$W 5|<h%W <tPh%V T<tI |<9~h`K$V 0D$D$L$d$ W& \$$K$V d3H d3~\3H \3 h\3j d\ |<$<tz<$$<|-<x3h<$\$\$\$ \$$ӗ%U $h\3 h\3 USWV $$919gՉ $t$ $;8t$hhe%$, =&GШu+$ ؃?9?)9K9si 3LA ʘ$s2%PQhVS =hV$, =GC~ 9r9$$ul&hhe%$,V =wDG$8:$ t-؍L$VSthV$,a 1 ^_[]USWVP։1|$4$u9|.HPh%T %wS$`t'W )1@1sC9uÅu.Ph"&S t$߉E1 `^_[]USWV4)ȃ'hf%kS :։ϋ ˉ h$%2ˉ $Wf_oUSRQt$Ph%S Gl$j.UPj^uj.h"U: Uh)%R Gj.UPj+uj.h"U _U苉()|c؉<+<'uehj%0<9#<,uthw%`R '<+ugh}% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5'<t$PV;hD$$HL$L$ 1x1PPPW jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$'<D$PVPB L$@D$D$ 1 G|$<$D$=3$TD$j=h &|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h &S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=h &P Ņt$,]>' 04$Q",' 0D$$t'߈FHGNm&Þw$t':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4 "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H  dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f='<u t11jNt'<1'<'<t PW1@h{"h>%+E '<1USWV1='<MT$ l$(L$DžD$5'<hh'<T  |$t$8"j h'<} D$'<h8"VM'<tUP, uTWV~M'<WVoMt7j L$QPM x#L$9u'<;D$ D$uL$us '<8 '<APQ~ PQ  '< tuQhh'<S  |$u'<1^_[]'<+<+<1Ҋ+~,u"1t$L$t' t" t΅tAL$=.<u.< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ='<u#'<'<tP_ '<t '<1^'<'<tP+ '<VtJT$1Aj<ƃ='<u#'<'<tP '<t '<1^t '<t D$'<1@1USWV D$,L$(l$$~ )$1H$`t '<1A\$9|ωL$ tgp9tX tt$ P t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$'<'<tP '<D$,L$$ ^_[]f11f11Ã=.<u /t(.<11hh(/<PjNt.<1,3<.<t P S1@h{"hI%s@ .<1USWVT$1=,3<+\$0L$ D$D$|$(D$5.<t$8S)P l$,D$ D$D$t$j S \$1 h8"VHE|$tt$(Pf u~8"WVHEWVHt^j L$QP2I xJL$9uAE;D$ D$<u/h8"VeHtj L$QPH x L$9t[ .<8 .<APQ~ PQ  .< tuQt$8SN E h#VGEth#VGwh#VGah8"VGEHh8"V~GE /h8"VeGE$j:t$ 1@|$ u,3<1^_[]WV=.<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh(/<h.<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=(3<u+,3<.<tPL$ L$.<D$$tˉ01C؃^_[,3<.<tP .<PPhh(/<h.<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=(3<u+,3<.<tPL$! L$.<D$$tˉ01C؃^_[t (3<t D$(3<1@1fUSWV\$l$t$V PVW莫 U PUWz S PSWf t$ V PVWN ^_[]WV t$uRt>DžtA=23<t ^_Épxj Ph E"׭ ؀=03<u1F1=13<t 1맋53o _1#QQh\%PփX USWV1ۀ=@3<t ؁^_[] D$ |$GSSPh43<jW" u 43<苳 D3< H3<r1HL3<_1#1ۃt2u3hWhR% D5<3<~ȍQ2w$t'Q3<PAu P3<?$D$-31 h"L$Qhr%PՃR3<3@S3<3 L3<I9@3 L3<I9@23<03<13<T3<P3<yQ3<pR3<g3 L3<A9~WH3OS3<F3|t%ƍC!t2)É$)t*3<L$ 3<$)PD$p xPh3<=R3<=T3<WjD$hpj Ph E" 53 _1#QQh%53 _1#QQh %Pփn 111{PZDWhV ESWV 1L$ |$ ru\953<s(>tGǀ=R3<u.;=3<rN;=3<rD83< DžtVjWV =13<t^ 1ހ=23<t& ^_[À=03<u1Ffu]pxj Ph E"m 뺋53- _1#QQh%Pփ NUSWV|$4t$0Ë 3<9s&|3<9 8Ս1ʅ/t3<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu953<953<H_ŋ |3<!9r؅ X3<9s9s_H3< 8!9t.M9wI9rEp3<8! 3!9u!=R3<=T3<83<Rf ʼn9rPVU  8!!ōD$p 3<PVL$}D$PVt$83<Pt$jUV thŋ$L$Ai Qh3<=R3<=T3<u=13< 1=23<tM^_[]t$h3<4O=03<1GDu3t몍D$0xhj Ph E"6 53 _1#QQh$%Pփ 9U7)SjZP)MPjS[ :9/ $)QjZP)PjS( tƉ111USWVˡ|3<!9ta)‹ L3<h t u9=,$)<l u=R3<OE$)ÍFu\wl3v'xD$X 3<PWEPWY=R3<N V3<53<w(u' w3v'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ}-E $ut=R3<tGV^_[]ÃWU VjZSN vjZv 9 VjZS( V t$=23<tt ^É01ɉHHj Ph E"i ҋL$SWVȋ|3<!9t+)֋ L3<| u 9t%)D @A Qh3<]@D^_[USWV=S3<t^_[]þ_1#VVVh%3Vh?"h k"hɡ%33#=P3<u)#%=R3<u&O"=Q3<uI&RQPhա%3%=23<u%d"=03<u"%=13<ui $%=T3<uɉ$VRQP33$ 43<|$gfff̉ҍ4މ劄14#GO wһ_1#?"SUWh%T$t$|$f4SUWh%33$ l3<Ggfff̉ҍ<߉劄94#FN wh_1#h?"Vh %T$3$ X3<|$gfff̉ҍ4މ劄14#GO wh_1#h?"Wh%T$3$ x3<|$gfff̉ҍ4މ劄14#GO wҸ_1#PPWh*%T$3$ 3|$gfff̉ҍ4މ劄14#GO wҾ_1#Vh#Wh7%T$VVVh<%3USWV΃=3<tPt |3<3!1P@ǡx3< |3<!)ȉ9r1U@3<9tEuótP-H3<!1PPjhjUP1 t(3<t3<=3<=3<-3<1ۉ^_[]V΃?3< ; 3<v$1u3<Ɖ 3<^USWVPd3<`3<h3< 0trƃhu'PF,=D3<=`3<4$t|n011FEEhu'PـEEC`3<(9r:53 _1#QQhz%Pփ=P3<83<11d3<9s[ $,0EEhu'P!s+`3<Cl3<]ǡd3<`3<(9rh3<9$sj,Ѓ0EEhu'PX3< `3<s d3<)ÉE;ǡd3<`3<h3<(9r$^_[] L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡD3<D$3<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9\3<s$5H3<!։Ņ9t3<v6J Љ  ȉ  F1r{@p9X3<sBJ Љ  ȉ  Fd3<`3< 3u%1I#5p3<!֡`3< 3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=R3<t=T3<uVj1^_[]VhUc USWV5|3<1!-3<t E3<1-3<E@;3<v@uW-3<E@3<tE3t,ÉE uUh3<=R3<t"=T3<t!3<E-3<^_[]VhVjS USWVΊ L3<T$ T$FD$t$V$D$9Btr$u$…3<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~VSSD$x,t @,KZ x3<tjNjD$G G3< 3<)ʉWOT1Nt TtWt$-3<T$ L3<^_[]1USWVȋ5|3<!) L3<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡx3<94$1PPh3<p Åk jS3<WR SWf3<3<;-3<r ;-3<1WWjhj\$SUw t\tV9tRSPv uE j@\$S0( -3J h?"Sh[%PՃ=P3<1lj1x3<4$9v(3< 1QQjPjVQv @wg1=3<j)6ŋ5|3<!Ɖ)tP63<9tut݉<$/3<u1]4$D$x Ph3<EtA<$3<C 9r09$v+jSV SV3<3<uɉD^_[] V43< 83<r!1F<u. 83<43<F9r^USWVP $1N=|3<1!׉) L3<D$)ot +t=Q3<;3<v|u+HL)͉ll+;3<s| ullD +lD;G,$vuWVDGWV;_s_u.G WP=Q3<u.M,t x3<-},^_[]jPR 5x3<^_[]USWV@׉9 3<953<j3;3<u >9uP3;3<FjWV蚱 *1ۡ3<t  3<83<H@; 3<v@j3<H@ 3< 3H x3<HPh3<x3<9rWVOs u=2 j@S0膯 -3 h?"Sh[%PՃ=P3<9=x3<u]3<t  3<63<H@; 3<v@u,3<H@ 3<t=x3<p xPh3<@^_[]93<u)3<3< f3ø3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á,3D$t$P$)WVL$T$ ‹q~y ;q~ t 1~9 QP ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4v'Wb tF u1^_ËD$t w$Ÿv'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ |3DAD$ x3DAWVD$ _1#_1#tƀ>tI3%G 0PWVh?&h3 ^_Ð1|$w L$t9tø3f|$3 #t_1#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fL$Ԣ%9 (vt3fL$%9 W(v3føÃD$L$L$ L$D$Vt$ t$Vh3l h/R"V.t" 0kPhLQ$h3 3Vj 8%VO ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP% tL 0 C 1$^ÐWV|$ W4' tFu1 ^_D$ftL$QŐ'1USWV$п$$ u V  X)jL) ŁTUUrP$@@D$0jPD$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#; ׃4$(}~111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$3<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$@' j F H @(N]_?[\;^r~uFF3<3<C><% ^q{t|~F~F ;^r~uF3<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF3<F^9րրw t$rI{i9s <$=3]D_\,<$t~uF F3<3<Au~uF 3<F>:* +F)@HWPF)P)?#{Ë;NsD9,u=A3IDJt"9~~uF 3<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPF)PPp^XWSF)`P}F)@xWPcF)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF 3<F"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF 3<FЉGL<$USWV t$ ^h.\u/;nr~uFF3<3<EMŁ'$~]$l'|tfύ]Љ8S dBtr@SB*@.[Oω\σ~uF3<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF3<FωωD$$xt~uF 3<.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS F)`P9\9{ ËV9sE9,u>A9s23 DJt" 9~~uF 3<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF AM ^D$D$ F@^ ]$.^t~uF 3<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF3<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP] D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj~F jpf]@T$P F$\$T$  D$^90NL$]H9s-u9]-t{[9 =:uv9r$8u3<^3<]t -$8u3<F3<$8u 3<F ËN98-P9:]:-f-9؋$r;u3<F<]t<-u;u3<F= T$P V9H98=9] f9u$ÉT$P^99]=,30f9Ë $~9u 3<Nff9ۉT$SRC1=,39f9~w;d;TH9s3DJ)Ãr~$u[FPSPD$$P DD$P4' Cu$:u3<D$3<:\$1ɈL$D$L$D$PD$ Pj$~8u 3<F1ۉD$1D$\$D$D$PD$ Pj<\$1D$L$D$D$PD$ PVjÉT$PC=u,'11GPՃtGT$P1Ƀ=,3G9ɋ|$G@jP7 t@OQW fHV9sjH9ы$8:9]9~$F Hl$ 9=3ADWuI$:Hf9݋\$C@jPs tCKf,f|AK$8 T$j-K^9H8] $8L$T$ D8$tF @tL1=,3耉11G1ۉD$L$119 $tOL$G9fl$|$L$=щF X@ $D$ t(|$w71$؃9u F H$8u3<F,^_[]ËD$ |,uD$xuD$xu D$ |<tF +h 0Ur0붋D$ D(D$SWV$΋A @u1 3LAtx x3u|3f9DAuP(^_[Ë>^D$f@]D$F~>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQt F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA 3<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$Ȅ')@xWPF)PA~uFN)! ʉj~uFNT!ڃTjGEUS1CU?Kl$E1=‰$|у $~)ExWUWt$jpF)PR~uFN)# ʉj&~uFN#TTj)~ )EHWUF)PP F3<FUSWV\$1=,39~1@(ϋF,@jPv( t|F(N,QV,fH~<t}|3Dh ,31҃9~1B ,3x3Dh1҃9~)1BuG 3<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF3<3<3<^_Ã~uF3<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF3<F1^_[]É؉D$ %'t$t$Uw u U誂 t/uՃt~uFG롋$USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRq tF^~uF 3<F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]ÐUSWVt$8e x ?E G  $$$T$$ƃt$l=,3|$ r3GtD$WT$ou]t$S萀 |$Qo ]GtD$wt$wt$wSM |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$pt OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVUo Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPU D$<(D$@t|$0 L$4$hUt$HD$DHW_N$;GOXL$LY;GU_$_ŋt$DF81ۋ$;D$09$;Gu G1;G ;G~x t,sO$9u G19U8 LD$@un=$;D$0.@$V1ۋ$;D$0L$I L$|$D$<1ϋ|$L$9D18$ED$89t$DN_u_uuP uC͉$t$ t$ D$@PVt$@L%;D$8Z,%)$'T$L$GL$Tt !1ۃ)uL$ dAL$ L$0)ы4$9G T$RPV t$T$\$@E9uo$L$8uG $T$LBT$AG$l$;t-)ȉt$ Ut$@Pt$@9Ml$D$89I $L$8u9uD$$9'$;\$0t1ۉ؃^_[]ÁGT$$ˉ+O l Lt$ t$ t$@Vt$@كÅuGlT$떁GTT$$ˉ+O l LL t$ t$ t$@Vt$@CكÅDGl T$T.M$t$ t$ UVt$@ÅH!=ET!4*F !فu։$t$ t$ VPt$@É뚉USWV0Չ\$LT$Tـ1@D$\$؃=|D$\$D9t$t$|$ |$‡T$,L$ɉL$(t$ɉL$$D$ F $ĉ'L$P)D)~T$P*D* cL$P )TL$Tс1Ct!1CӍ ;сuD$PL$LT$P*D*V9!ځXT$P JD$=zD$=y|$(~D$Tw|$gqf|$,V`D$=wK;D$ /9|$$~&|$ | f|$f|$F D$1=,3耋T$ 9~OD$1T$T$3D 8\$P+D+)ʊ$u tω\$DzD$Dt$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$D'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4>l L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ ^ ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V8 @wj/VQ 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPh4<4<ø͌%Vt$1Ʌ1t э^fffUSWV$[ØD$D$L$|$֋$)5URt$$T$$2WQPt$(t$$k$RPQt$t$Pl$8L$-tE$^_[]ÐUSWV[D$@$t'rPуT$s1d>1dD$V׃1diՉƃut" $4,rƃu$UVjj9 |$09NjL$4sD$D$8T$<UVt$Dt$D L$D|$ t$ 1Ҹ$|$(RPQt$ |$@tjjdUVD$ ƉRPUt$  D$ T$[D$L$ |$֋$)5URt$T$2WQPt$HD$HP腜$RPQt$8Wm^_[]SWV[&$$u^Jw $`hPV85 u=uk+ W5hPV4 `hPQ4 t5hPQ4 _hPQ4 e5hPQt4 hPQ]4 55hPQ94 /`hPQ"4 5hPQ3 ;hPQ3 5hPQ3 (`hPQ3 t.5hPQ3 5hPQu3 P& Ą^_[USWV[øD$$L$ ttD$D$5D$UPlǾUD$PզDžID$8t۱|$;D$ T$$75/`PW.h E5PWh (`PWg 5PWg t5PWg |$D$ tH`PWg 5PWg `PWig i5PWQg t5PW=g |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,1D9r 胼$ t+$ $$ FhPWY- $D$ D$jD$$ xfD$4D$dzFr /$$ AfAfIbQPRhWmt$ VPj $D$ $Pѓ1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ V詃hPW, j:W_C D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPgct Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃKD$ $t1L$ L9s ዄ$ @<CL$|I6t$tjhQPR*D$4 mqPh$P$$9s|$$$9s$$[1 $L9s D$HL$H P 6RQt$ Ph$P$$9sD$4mqPh$P蝏${$_9sD$hI$/9s狄$ @mPQh$P$$9s獃Ct$Ph$P躎$$ o9sD$ tWmQPh$PR$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ %^$$$9sD$dL$HL$P6L$pRt$t$t$$h$PD$L$HL$HL$HL$,HL$(HL$$H @ 6T$0PQt$,t$4t$8  9u8jj$U[ t< P 1 4>b 0ǃ8 $gǃ$ƃ< t b 01^_[ÐUSWV[õo$01< uut!j/V3 uS< tƅu*` ƍ|$8VPQhWz=ria ?h@VǍD$ jPWS )a D$$WZtLD, L$Pjhjjj QD$(PD Ƌ<$t'Vu D$8 t` 8 ` L$^_[]ÐSWV[fn< u[ÐS[Þlt$[ÐUSWV[plu }^ D$<$|^ t$u$$D$Put=k<T$JL$|D$x$L$x$PQ2?$$$Pt$>lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$`1DPu@4 $((9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$[ D$@j PW [ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $S \$ 8u$$>$0։S D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ3|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR{ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6jW8G4jjdv62 jjdRPjWPGLjh'v62 W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[?L$$tEׁ u$C t+t9u11ՉL$!։1^_[]ÐUSWV[{?|$GtB#l$%t$PCt!G t7t9uӾ^_[]ÐUSWV[ ?<tC#l$8 t$PCt!G t7t9uӾ^_[]ÐUSWV[Û>̘tC#l$Ș t$PBt!G t7t9uӾ^_[]ÐUSWV[(>t$0t$,0Ǎ5VP‰t$D$(%D$1퍃 D$ <$l$$tg|$ !RPAtG t@/t;L$uЃt'D$ t$jr…<$uNt$0t><$9tR PUW >&t1<$WM*^_[]fUSWV[<t$D$hEt'1PV@t%D=u1@ u\1VPjMD$@ 8^_[]ÐUSWV[h<|$ D$hEt$1PWy@t%D5u@ ^_[]ËD$@ 40tM'. D$jPt$V ŋD$18t- r"u##@ uCB"tt$@ aC4$WPjуH\1WPjSV[=;t$ vs(v h(V_(^[ÐUSWV[:D$,8tD$,1퐐8@ujHƋ|$(WF$"jU!F D$ D$,F>5D$Pt$o1}nu1ɀ}ouL$D$j=Ud tǃ|$D$,t1PU9>tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8@ t 4$&V&1^_[]Í\1UPjUSWV[E9$4$,W+ 0CjPUf uj:UG CjPU= tKt$}/3t$UhV( jVEPU PPt$UD$P,:|$ x1jjWjjV0 mt$ jjWPjV t$/D$PVǍ2YD$t$jDžjt$W uj$4$4jWtƍD$Phzd@V VD$(Pt$ uDP$0>!$0VPW FD$ GL$ 1jjQPjR tqVUW R) 0l$0X) 0Ck( 8uj/U&Ńt$ $0UW ( 0CQPWh 111( 0l$0P$49 11,$j$4V$4WjU0P~Jt$t8HPQA& ( 0C$0P$4 1,$D$P"U"' 0^_[]ÍD,$UPVWI1' (xWP$8$8~IV賿fffffffS[+5D$D$ $L$T$jjPQjR yD$[fffffS[4D$D$ >$L$T$jjPQjRq yD$[ÐS[k4D$D$ ?$L$T$jjPQjR yD$[ÐS[ 4$L$(DjjPQRyD$[fffffY3T$ulÐS[Î3t$z@SWV[l3|$Wt$t$? 9rq% ?:DWVPj^_[ÐSWV[3|$Wt$t$ 9r!% ?lDWVPj^_[ÐSV[2t$ ƅuDPj^[ÐSV[Í2t$t$ƅuDPj^[ÐSWV[L2|$WƅtuDWPj ^_[ÐUSWV[ 2l$|$UWxƅttuDUWPj^_[]ÐSWV[ü1|$Wt$YƅtuDWPj ^_[ÐUSWV[k1l$|$UWt$} to# 0EUWPj^_[]ÐSWV[1|$t$WsIƅu7EWPj ^_[ÐSVP[0D$L$T$$RQP| ƃuHEPj^[ÐSV[Í0t$t$t$A| ƃuHEPj^[USWVP[J0Pt$0t$0t$0t$0t$0jt$4m Ɖ׋,$t1:" (]Et$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[/Pt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1! (Et$,t$,t$,t$,t$,t$,Pj ^_[]fXO/L$"wÍkffffffUSWVDX/D$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjjkB~D$$<$|$ D$81$|$ <,PL$41GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$$~D$$L$1ɉt!D$,tt$$T$()9sF$$$L$l$$)\$@L$<`L$ڋ\$4Rt$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$Pjj: $~D$$|$ $1\$4WRD$$PjjM: $ˋ\$4VRD$$Pjj$:1Ʌl$<릋\$4WRD$$Pjj9~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$Pjj7D$$u|$0L$$tB;L$s5T$ >#\$4 L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS["jt$t$t$t$t$[fS[!L$T$ Pt$t$t$[ÐUSWV[è!|$$t$|$0t$(aD$ j/U ,$t|UPt$ WVt$8IuU\ 8uFlt$ t$Pt$t$@t$t$$t$$t$$t$$t$$t$$t$$t$$0$[ÐV^L$ʁtPDPt1u6t ʁPH^ÐV^ƞL$ D$ʁtPDPt1u6t ʁPH^ÐUSWV _8T$ сtHDP t16|$t сHHPT$~]P$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jPZ1 ^_[]ÐUSWV _XT$$D$ сtHDP t16|$t сHHPT$~aP$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jPY1 ^_[]ÐWV^}D$ PHсP?tׁ;>u@D ^_ÐS[.t$0[ÐUSWV0[D$Hx'p L$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|w|ut EGDuQDP@I|t+1zxtItPv1^_WV^mD$L$ QHׁ8P?tׁ;>uQDP@I|t/1zxtItPv1^_XƀD ÐSWV[ü|$0 2@ 2 2| 2 N d N$ NTh NX N\ N`h Nl8 Nm Nn822@22|G G$dGTGXhG\G`GlhGm8GnWG1Ƀ2QP讞G GlWW ^_[ÐUSWV[l$uPlŅh4jJ1ƋD$L$dž3Ndž2dž2D 3ƃD fFddž2dž3 h3,V 5VU2@xpu xhdž2jjjjjjV6FjjjjjjVFVZV`jjjjjjVҟF tdjPVWVNV% VlGHt 3t VdV@Z2t Pd2tuc29ʼnu3V1^_[]ÐSWV[ìt$2t P-d2t7uc29lju2VbZ3390uVj^_[fffUSWV[ d t$@+@+@+@+@+@+@++ uǃ >ǃ <ǃ ^ǃ vǃ #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ( |ǃ@ oǃ -ǃ -ǃ, <ǃ0 >ǃ4 *ǃ8 !ǃ< f2Ot^t8tjtfxH ؋tvQjPW[ 1T QTpQTtQTxT|=u^_[]ÐVY.1T T$tpqttqtxqt|1=u^ÐUSWVP[P l$j+GG(ujjQP ukPj|j3 QPej>x j9L$u+0D$PH8@<utCu-/u5tMt$ul1‰jiP0t$UIƉ$L$PIE/t$1jƋL$P1‰PL$Tƃt|y<x -tl|.D$8T$PAB $tJt PrRV U}" E @t9@ 8u/3t$d10+ǀ3e -D$T$D$ D$D$ L$jjr@PQUD$PU%|$u@*2$t u $ L$TATJSV[=0t$t$V< tt$VZ^[ÐSV[t$ t$t$V tt$V^[ÐUSWVL$[ä|$0D$(T$ 2D$ED$4D$D$H f<2tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃH ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4H ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃH D$4Pjjj 4449)4L$ 4QWPt$]4;4}2Dž4t(D$4PVt$ t$ 1|$0fH 4)Ɖ4fǃH ff9t |$ u |$ t)Q)R;* t$VUF @f|$t7&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fH f1jD$` `4rփփ19‰4 4fH fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fH f13FPjj!Qə jS[nt$j[ffS[N0t$ [ÐUSWV$[|$uz2t PO2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(UFP0tjjPl ,GT^FPtjjPl GX!2@@xGX GXO <W$d OT h2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V|| PʭD$$<$$u$P HuǐuU| PQD$$鐐<$$u$}P胔 Huǐul$Ut$VZV\US$|$~"14菸;>|zVq^_[ÐUSWV[fǃ\ h豧u$ DHDHDHDH uǀ2ǃ` ǃd ǃh 1IT<,$T2j T<TV$2@P24tVmu =wlj<$hVt$ Vv VDu 1rNj2Z1퐐T,jj L,LNp9u^_[]ÍFPjQS[N0[ÐUSWV [(|$ EG8$u%O9OuO9Ou9$uxW/t W"`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PxGGMIAG GAE3t4d10lwEǀ3 ^_[]Ë3t*Q33t8tVW^‹D$89L$uG8W<ut#u%'t^1Ƀuk1g RG4$膐=u8 $A @11 $<x D$8 $tQWTL$|$u $E t΃2t2u΅rhƋ $a aU蒸 8uE3 $tԋd10yuL$Eǀ3뤐SV[ 0t$t$V t V^[ÐSV[t$ t$t$V t Vr^[ÐSWVP[Ë$t&T$t$2PWj $^_[ÐUSWVP[(1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[kT$9D$Po 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[Å1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[D$0>ƈ2L$ȉT$ D$D$ D$t$%fG d 9h \ f$t|$u!|$t'QL$ )RWlŃuRG @tGR 8u=D$3t.d109qD$ǀ3G @|$tmG  f` l Hȃ` d \ fftVWa=Vth l Hȃ` d 9` l Hȃ` d f9ufǃ\ f АT$ftiLjfx_ɋ4f>t%fG t~t-` 19h f\ D$DhhAh l Qʃʃ19h ` f\ ^_[]ýG @tB 8u8t$3t)d10nǀ3g 룸FPjj Q蓄 jISWV[<|$WWƃuOG @tD= 8u:3t)d10"nǀ3^_[ÐUSWV[ûtt$339}3AP3!t' 333343;33PQRPV 33t331^_[]ÐUSWV[tt$339}3AP3Qt' 333343;33PQRPV 33t331^_[]ÐSP[$tT$ 2Pjj $[ÐXϼ tT$QT1øUSWV[ÖTAx43fTFT$Pj +f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh\to DHDHDHDH uǀD$ FF^_[]øFPjjF,nFPjjQ8 jFP覾jffffS[κ0[ÐUSWV[èt$$F,NVxF ,|$ |x<$ |<$l13t+PtЁ3QjPL [ÐX3u1Ês3ÐX3u1Êu3ÐX3tD$s31ÐXO3t L$u31ÐXL$31fffffffSWV [D$ D$D$$ t$VWj . XD$D$D$ $jWj- jjC/jVj-,^_[ÐUSWV[H13PtЁ3QPy  u jC ƃ ~:Pjj $; u jPjѕ 1 }t&jEHjjQppǟ@|tDQjP Et"@:t@DQj8 @DUj @UjX pxn jjjpŒǀ3Qt43PjQ ^_[]ÐUSWV[h3 u ZPj葒  ƃ  uR^D$D$D$ D$D$D$ L$PQj ǃ @HtȍL$Qhht@P} tBL$t9D$t0d9 t ǁ39tǀ3d(8$9hu9xt WUPJ 9hu9xt WUPJ Qt43PQv It3PjW  6$0c^_[]ÐS[~ u ZPj輐  ƃ [ÐS[> u j} ƃ [ÐSV[ @HtȉQhht@PC{ t!$tL$td Hwtǀ3^[t$ЃS[k uO^$D$D$D$ D$D$ PQjE ǃ [ÐS[ ~:Pjj $; u jPj 1 [ÐS[Þ3t[ËPtЁ3QPYt [S[NQt3PjQh [ÐS[Qt43PQs [ÐS[þ^[ffffffSV[Ý@|$t|u7x1t+DQjP 3ph 1^[ÐSWV[,3@t8|t%DQjP 3pth ^_[Ëx1ufffffffUSWV[ëT$2tt6usRRt1u8]RuARt'2DPjR pg ^_[]ÐSV[2tt6uq IIt1҅u8[ Iu? It%2DPjQ% pg ^[fUSWVP[Zt$F8 t V]F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$ @tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$L$9A}1ËI,$ÐUSWVL$xaT$r)~VT$xN9|1~B΋D$x, 9})D$Xh( B9(~(B 9}ԉ1^_[]ÐUSWVL$ $T$r)D$$9|ƅ$Ήt$#;L$}z|$(u-zZ(B,,ME9~u 9}ʉƐj(B,{79|B9}j({ 9|r9}/$$$^_[]ÐUSWVL$xaT$r)~VT$xN9|1~B΋D$x, 9})D$Xh( B9(~(B 9}ԉ1^_[]ÐWVD$ H~+P,2u!9t 11;3}:tt3PS^_[]ÐS[~T$t$t$ [ÐUSWV[H93|$0t$,T$ $uk`MDH@utl$4D$ U'< 鐐t$ D$PL$ QD$ Pdx)t$谒tL$9D$)<9u AT$)RU0t( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[ȏ8D$ $4VjPj~tSʼnt$UAlƅtMD$ $t$UD$PVBtT$t$$V Vn|^_[]ÐUSWV[ |$3t P 3~/11퐐440|0;3|4{ 3ǃ wwLJ3j0jt4tW2Ht<@xX3~3 jP 62@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448z0;3|4z^_[]ÐUSWVXht$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W!6 1Ґ$t$V|$(WD$0PUt$$訍ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj VNx $4D$)Džu |$ $tR1VT$ U 4$)tWj Vx T$L$ (^_[]ÐUSWV`[h14t `΋43t42NzRЃPWVPV8hk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W4 PWVjUt^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P&D$T$3;4}D$PRjQD$PRjQ8Nj$D(PڊD$$L$ ;47&ffffUSWV[k|$$D$hjjU蘊 t)ƃ|$t:L$tVD$ tNt*T$P19tL$  11fVUl$ UR D^_[]USWV[û|$$2t$耉Ƌl$r:D$0誉D$4艉uX9uE$E EEEEE EEEuDE$E EEEEE EED$%EP9tL$ ft M}Wt$UQ 1^_[]ÐWVY]D$T$ t$w4  p@^_fffSWV[t$V_}~tyы9uv0 rv,r9p9p 9pt PqqVq1^_[v4q9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PpffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT$[[ø[ÐS[ނ|$uT$ L$/[ø[ÐS[î|$ uT$[ø[ÐS[~|$uT$ L$[ø[ÐSWV[L|$u<t$D$9% Ɖ-t1^_[øSWV[|$u8t$D$|$% Ɖ1^_[øXt/HX2#H@H@Rz8tT$ щH@1ÐD$t/HX2#H@H@Rz8tT$ щH@1ÐS[T$R[S[ހL$T$ 6[ÐS[þT$[S[ÞL$T$ [ÐSWV[|t$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[t$|$tCGX2@TtgAWW@x8tg@ 1^_[ÐUSWV[Ë΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt V4t"G8tt V 1t$׋NX2#N@N@Rz8t N@^_[]øSWV[}΋AX2@Tt{ @f @tf@t Vwt Vr1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐX|HTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐX{HT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[,yt$8V$ PVW ^_[ÐSWV[xL$|$t$x"1t%<t9u W$ PWVN ^_[ÐSWV[Ìxt$|$W# PWV ^_[ÐSWV[\xL$|$0x1t!<t9u W# PWV ^_[ÐSWV[w0t$t$V t|$W9# PWVn ^_[SWV[ìwt$t$t$V诏 t(L$ |$x#1t&<t9uW" PWV ^_[SWV[st$t$t$t$0[ÐUSWV[s$$$W $GO,D$$|$<1 $$HL$ D$$hUT$1 |$<T$D$D$jD$Pt$t$D$ P$b$)~"D$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZPL$1~t$ ~9J$u9r ^ÐUSWV[ûPD$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77莽1^_[]ÐUSWVP[:Pt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux lQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0X)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p d912u-t@:uP $Pd1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV[ML$(l$$UuX< ;~$|$,M;~ L$ L$(+ut$l$,+o w4$tpL$l$4$l$(9nы$;JT$,,$9U t$t$ $;r|D$(GD$,G W: Wt$ IOD$,G W D$79t,鐐FN Vʼn |$(69ujW1^_[]fffffD$H8T$ ʉP81fffSV[mLT$L$ Aq D$t$jVPt$ ^[ÐUSWV X(LD$1tYՋD$  +T$$QQ\$(Dž )yy A;D$$&ދY 9t$$A9t$(7Y9~ 1 ^_[]ÉL$\$t$,jVt$0Wtɋt$NDHDNHHHh L$ H$pH$h0ȅɋ\$xƒrUǃ߉AA8ATApǁǁǁut<ҍ<1Ґ9u$J +N J(~T1B,,B+FV, HMPUE $pQ8DT$E;z}J(뮉SV[MJT$L$ Aq D$t$jVPt$ ^[ÐSWV[ J|$199Rjw www0$ƅt VW^_[ÐUSWV$[èIt$D1Sl$HGL$0[ÐSWV[Ì>t$19pHt51F:tVtFxvvv vPu-F9u" Q+Vy1҉VI+N y1ɉNA^_[ÐS[=L$1qqq qj [ÐUSWV\X=IX1ۃyL$4D$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV[X6L$8T$4y1ҋt$}t$j J\$L$(xu$0)\$L$(xl$H l$H}D$$ H1D$4Wl$H9} U,4I,U L$D@t!t3t$t4D$84NT$8R,Ju͋l$Dl(ED EH fǃ L$Qu|*ELf MH!L$fl$|$ ~tD$8@,Dtbt$$HL$xo$j" D$@, !D $jjUt$W|$ -\$L$,@@A,D$(@(x ;i|J1D$(@ D$3D$@x9D$||$D$$@u#L$8 I,T$ QT$L$(q  tU1L$ QRLD$0T$,P8t A xtpt$4 PV(iF!;D$eFٍ 4)Nj$y1D$ @@LD$,|$0t$;l$l$M|$HxGu ;W|$ } D$HP(9}eD$$3l$DtJL$4L$4u:D$XfD$\$jjD$`P\$ D$4) U:D$$Hxq2U 2;q<|$@D$(u(Gu"$t$W&\$D$$HL$pjYD$X, t$<;t$ t$u 9uƒt#L$  $jUQVt$L+D$$L$ Hh;l$${"T$$ω;l$GD$(l$u $t$W%\$T$|$,;T$0; )tO; T$JR,t$ R 9ut$9ru r;T$wD$@;D$ T$t<i̋D$@ ))Ƌ$t$,\$T$ 9v(PL$ I ywwy1,L$;i|:A;D$ uL$$ yL$s;D$ A8uKЋT$Pt$  D$$xLL$CD$ @tGt‹$jCD$ @Dj+W 딐$;l$Tt$W#<GŋL$$ yuD$뾋D$$Չ9h֋L$ T$9Ju\ыR9~S9}OPp$jT$ KD$@, $jt$ VUV*(\$D$$p h 9|T$ R ztH{t$L$q9|d@D$\$D$Pjt$4ZT\$ D$|$x D$$xD$8;xj@,L$ 4p F fFV !Z  fN 49D$8;x|T$t$t$ƃ$D$8;h}xD$$p|$OoL$AD$$j\$G, 9;t$u 9l$ut+9L$D $jUt$ t$V$\$T$BL$$ ABAOHL$Nfɺf|#udt$T$։D$,)jVD$PRPfL$<$|$ T$t$WL$΋D$)jPWVW#t$QD$ @f|$(ut$It$t$,QpDQjP-ɋ$CdDPjQQ f~$~gD$@u]D$$t$Fh2u&P9u%$PD$<0N;\$6>v t6>vuD$ @tt$ t$tRFz$j=D$ @$ $DjP\$ ?tdtD$PjQP\$ D$ @txHL$pmGD$$j \$G, 99uT$9T$u $9 $jt$Ut$V!\$E;1f΃9!U,<t$uw\$GEʋL$HAQ,1f1ɋ$u뎐l$;|$ ,0t$l$,L$DT$0;|$  E;l$(ŋt$|$T$0D$D$4l$@sD$D$4@ωD$ D$t$9]D$9D$<D$T$ЋL$9ȉD$D$ AD9   $Pq|r\$$ BfBD$ ALfBt9zAD$Rq|\$uD$<GD$D$4T$D$4x; u D$P1r21 $Ph Va\$ ǀw  $PQR8\$ D$@ L$P D$ T$)ЉD$LD$‹t$)T$4)l$,0|$LD$ xpT$)l$ E@H0T$҉|$t$ xpuDt.t%|$T$t$>t$ ;W|$Hrt$t$ Q}f DUjPG jjjVWKt$ @UjppG jjt$jj @t$QfUjPDG t$ D$4T$L|$)T$t$T$L։t$TI,T$DD$<4|$(|$0D$<|$4D$4D$D<9;t$;t$D$ @,֋T$(;W|$Lt$|$ WQa DUjP C jjjVW|$ @UjppB jjt$$jj@#D$PQlaUjPB |$ F|$GD$0D$D8jjD$0PVQE@tT$t$9rt9؋$PQ`DQjPB jjt$$Vjt$8HL$QP`l$T$ϋl$$DWjPA |$D$l$,t&ŋt$ $@WjqA u|$oL$ɋ|$L$T$ $NDVjP(A |$0)l$l$,|$ $@Vj@ u|$ $jjt$$VRv$Dl$@$Wj@\$ uUjH@ |$t$ |$,t!|$@UjHT@ u@L$ IQjp0^ UjP$@ jjjjt$ $D$VjQ?\$ |$0l$l$,@$Vj?\$ u|L$ɋ|$ t$y8UjLx? D$t!t$,@UjLV? u@L$ IQjp0] UjP&? jjjjt$,@@p1DQjP> L$T$ $jRQjW\$!HD$$jjt$VRS$Dl$t$ @$WjHy>\$ uL$L$ T$9Q|$ D$VjP&>\$ |$0l$l$,@$VjL=\$ uWGPGGPQheR$ USWV XD$\$DT$@|$5 H@ @t)@tDQjP5 H@@t)@tDQjP4 H@t)@@tDQjP4 H@t3Ht$LtDQjPz4 H@^_[]ffffS[î 0[ÐUSWV [È T$ 9t #BH$$BjD1Bt$9J~B,t$pD$F9.u(ftN!; $u~ tN.fFF! $FVr|)tfF;t$r[f~y벸jRqjjV! 1 ^_[]fffSVD$L$ ;u@Q;Pu8Pf3Qu+I P ÅǸ tttu t1^[Ått;uIRDžu ѐS[D$ L$QPQfPQfPPq [ÐUSWV[Ë|$t$O tR1ȋHvDžtYuj tpG@v1ɉDžu1X1tRiQTuG .1t(@yQ$u^_[]SV[ýD$ tpPu^[ÐUSWVP[zD$H~D$@1L$I$9}Z~L$I,$ i19}ƋM tyQDuD$@Ń^_[]ffffffUSWVD$T$t/L$u+1t 1%t 1^_[]ÉӃ1 9t<1lj1D1ǁt%1ƐUSWVL$2T$119:lj1zlj1zlj1zlj1zlj1zlj1zlj1B؉ǁt %1z 5É1_É1_É1GÁt%11^_[]fffSV[D$ L$T$t$\ ` d h 1c1^[ÐSWV[ÜL$ D$T$t$|$\ ` d h 1^_[ÐUSWV $[E\ 79|` \ d 9|$} dANjh ʼnh șd @ 8@D$Dj ~RD$8t/@@tUjP - j @@ltUjP, 릋h ǃd d9|` Hh ` 9|[H` 9h }B\ @8u@xhu ǃ\ $n\ d9` h qNh9}uuJ` Bt>\ PQJ t*NjD$9d t#W购$~ 1ɋ$DPjW+ ` h \ d ^_[]Ë@D$DL$ d;> MIIlttt$ jQH+ j D$uǃd USWV$T$ [dl p d h D$PBpL$ t$tIT$$h\ t)ʋL$ ׉)}=)9hgʉt$T$ 9` 4t2t$ t$ )t)W` D$)1Ѝ /9L$|9l$|Pjt$) ǃh ǃd 11ҋhD$8\ tlj)D$8>$@D$8 $<t$u;` } t$Ћl$)$t$@@9 9<$|PjQ) @xh H$L$T$ t$dՉL$)4/L$T$ 9~L$T$ <$|Pjt$( ǃd D$h ;` ;T$ 9<$l tot j PXx)p @lt|QjP( Fl t3t j PWx)p j |j mh h ǃd 1;` t $|l$*ǃd h ;` h @@ltWjP6' p yAl t`j t$Vxp )ȉp }u D$8o@@lU8 LQj `ud ;\ t |"UjPw& d ;\ ~Up  d @@xuăl tjWVx)p j띍|h ;` ~-h @Uj% p yxD$8\ d )ȃ,$D$t D$4$jPu% d D$(19 ș)Љփ<\ 9D$@ul t!j t$Tx)p j td D$@,h @D`t D$,$.p p d d -;\ !D$P,h t$j<L|$ tvl ufL$L!;H@L$uSDuLf~54td h t L$ fu-@t!,$UjP# p l t0j t$ZSxp )ȉp j ǃp l tD$ d D$h p $^_[])ȃ|,9t$,$,@tUjP" <,$l t!j t$Rx)p j fd ;\ ~nUjP" d ;\ d @@xu̓l t!jt$)Rx)p j룉PS[~D$l t#t PQQx)p P1[fffX/Hy8~DyD~>Hlt htðuu냹tt u1ÐX@ xÐUSWV [ØAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$tDPjR| MAҾt.DPjRU $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";|0 fp"2fr"4t"ǃ ǃ 21ClD$L$ /jt$u\D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[L$9 ft$9|$ 9l2uCUw$-4$t$sk^7w07|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVX2lT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVY|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y^7f>2~w-s q^7f ^_[]ÐUSWV[ L$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW6DQjP 1^_[]ÐSWVZLL$x?9J\~2D$t$|$ Irftf>vf1^_[S[ǃ0ǃ49t% DŽp"DŽt" t 1[ÐUSWV[kT$L$l2uI~w-ss^7w!H7ff fff0f2ǃ4>t* f0p"f0r"DŽ0t" t 1^_[]ÐXh2ÐUSWVP[Zt$ t@@1EHd9l2p"fx fr"yVRt6$DPjR[ 0 $!A@Ep"f@dfx0ɋ2@Ql3DQjP  Er"Zfp"fx fr"yVRt6$DPjR 0 $!A@Ep"f@dfx0ɋ2@Q#3DQjPQ Er"]fx*ҋ2@R42DQjP Efxd#H@ H@^_[]ÐSWV[,l2tu6@t!|$DQjP 0!G@f@d^_[ÐXf@dffSWV[ÜD$ yOQW~ ;O~ t Q WPW^_[ÐSWV[,|$D$OQW~ ;O~ t Q WPhW}^_[ÐSWV[xWt$WA^_[ÐSWV[Ì|$Wt$W^_[fffffffUSWV^KL$xLT$xD6~9|5^9~.nF,9}#,]19CENV1^_[]ÐUSWVL$xHT$x@t$~9|5^9~.nF,9}#,]19CENV1^_[]ÐUSWVD$$pHP 9,$l,$,$m19|$ Í],$]xppt_ÉΉ׋HP {)xs)x݋X9|֋h9~ω\$ Xl$h,,$݉\$;\$|,$\$leh^_[]fS[þt$0[ÐUSWV([Èt$@4D$$0D$ ,D$1Ʌhv~x|$jt$ 0p [ÐS[jt$t$D [ÐS[t$ t$ 0 [ÐUSWV\[èL$t1-1xƅ|$pGP,D$iL$x|$D$t@$L$OGʋL$tiL$pIL$T$L$p|$E  u;yTuA8 u  t t+D$օ_1^D$ D$1oT$$j xË$h0L$ș)T$L$L$ (D$D$ $usx)ʋEAT$$PGxt$EtD$ ~L$p֋QA)Ѓ9~$t$ NT$ T$ AD$t$t|$L$1ҐD$$#D$ 1ҋ|$D$=H7D$ t1sT$|$$|$t$j .xƋh(L$ ș)L$ T$|$$|$$ t$`D$ |$T$1$vx;l$T$|$t)ʉ$ l$T$P{x‹FL$T$L$l$tɋ$ T$t$D$p@,L$ Ql$ tL$(t!|$$y4s |$po(ՋI;)})t$֋O9΋|$T$@ ,L$؍4D$49\$,L$pD$0ADE$Uq|GHEEfEfED$09w|$\$,#FEF E FENME9sًD$ D$ t$|$ptS$G,L$D$(ED$ uLGD$wD$ GD$GWwD$GD$;GTu"Wbx|$T$D$t$|$T$L$pAI(ȃL$(I ;~t"|$tL$ L$ $t$$$Ut$p?1\^_[]ÐSV[M0t$t$VL tjt$Vh ^[ÐSV[t$ t$t$V tjt$V ^[ÐSV[í0t$t$V tt$t$V ^[ÐSV[]t$ t$t$V` tt$t$Vz ^[ffffffUSWV[ l$t^T$r9n t9tB 1ɀx$u B1Ƀxp|$$t1R(Wt$$t$$UP 1^_[]ÐUSWV L$[Ä|$8T$`D$01DFt01ҐЍ GDFu<.u=GLnL$1D$thЃՉ,$D$tGDFu$L$4PL$ 苜T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K7Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K7Й~ ƃQWT$H ^_[]ÐSWV[|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[N  jt$t$t$P1[ÐSV[   jVjt$PJ1^[fSWVP[|$t t9t QD$PBL$QjPW6L$N|$kK)l$kK) \G;\Gi)8PU耸t;y t0q$t~fuUvIu1 q 8^_[]ÐUSWV[D$$L$t@1D$D$>D$PL$QjPW5L$kL|$kC)l$kC) G;Gi? ):PU^t7q tAy$t+nuUw)u A:y^_[]USWV[D$(L$1҄t@1D$D$8>D$D$P}L$QjPV4l$-?L|$ ) i)ʼn) i)kG{Glj*SiŠ)Ǎ ;PD$P$t1D$H;<tzp t:h$D$t}suPuɵD$uދ} مt3l$,t+Et$WPmuV|EЃ^_[]ÐS[Nt$ t$t$ [ÐUSWVH[t$\t|lD$P輭ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$Uz{L$QjPU2L$ȿNt$kK)kK) \G3\Gi)8PU輳$D$$8ED$j=U舓tƉH$$D$<$|$W|zL$QjPW1L$Ƚ-?Lt$) i)) i)KGsGƉ*SiŠ)ƍ ;PW覲D$5tcL$f <$|$WyL$QjPW^0L$ȽkLt$kC)kC) G3Gi? ):PWtD$E;E!D$:Dn $$D$PU蝱4PU腱GPUmr4PUU[PU=tGPU)trGPUteGPUtXDePUu^O1<5.' D$UwNj$tPw 1L$;D$v==wL$L$Qt$óL$uD$ 9D$ tf, UQ,$t'UW|$BU4+1t$ 1L t]|$uf, FM $QPI4$v  $LD=uVQVv $4D$ H^_[]1|$t4$E1USWV[h蛧WT$L$ $L$`1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG7M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$脳_ 1Pʋ$H $$$H $<<$Rt$Wˊ /$//$H $>$D$^_[]ÐUSWV]Ÿ2~:^^t@\|,$n*^ÍxЃs.ÉD$$`D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%`Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[1l$E<%uEpuEπ r?уstlu~;|$~,|$tӵ릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[]L$ T$D$$Pj [ÐUSWVX%$1h ։ͅu4$ u'$h赟 5 @0t$E4}0u"$h}E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP趯 l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,WE,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $NȉىӉl$ |$uGD$1l$뀋$`DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $xO$t"A$|t+H$D+$1$uՋ$1ڃV$P!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,躥RE,}0M4T$$V$0PRQ1$E4$߯1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PgP=D$π$O6\`D$TDl$H$th$V g9r‹E0M4ʃ9‰\$WE,y$H$|T$`t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$d1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$ʫ1L$ ʀŸw Dʀ¿~4r$膫1ۋu0M4A9s E,u,߃$Vu,ڠrE,u0M4tڍqu4 $ 1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,趟tRE,}0M4$V$0Pt$QE4E,M4},$ݩ1^_[]ÐSP[ÍT$ D$$1Pj= [ÐS[^t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[T$ D$$1Pj [ffffXL$8ÐUSWV[ȶ|$(t$ l$uP1mƅ>l$$uj hjL$tfjVP NjD$uj(P/D$@ x |$(uZHVqE\1F4G9Pk1D$tGuP|$(Gx |$(tF|$(mHV|$(LHPhht@U規 t$t$tL$t RB(J8tR@PktjjPO IA(KP`ktjjPN IA1t^_[]ÍGPjPdoHVSVP[|T$L$D$tRQPVƋ$t P.^[fUSWV[+t$|$t$jt0ʼnVU:|$T$VŸHPt$Ǘt~Pt$谗tkHPt$虗t[HPt$肗tKHPt$kt;HPt$TuA1 @VK^_[]ÐUSWV T$L$[Ͳǃ HP|t9j|Vkt.)9uUt$Vc t6u0,1(VR9ſuUt$V+ ^_[]fffUSWV [HD$48H L$@ 1퐐/t <,tEPЃUWPs .,v3l$4uW'EED$\$cD$ ID$|$j|WjtD$4@ T$L$ tk17t<,t\$RT$QD$PڂtDl$VWQr Ut$Pr 1<$W*QNjt$D$Pl$8uQEW|$WVq WD$D$D$ Džt$螒\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0<\$<u3D$u'\$U!\$8C k$K($fC K(K(|$T$ t$4HP9=>p1\$91\$-4$K\$HP<D$PD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Qʏ ^_[]USWV[hD$t uyk I|$ 1퐐/t <,tQL$M$P~t2ƃ$UWPn 4$t$Pm 1^_[]ÐUSWV[ë|$ t$FN,9vtU62uCu;U/~t.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[ |$ l$nPW uLt}D$x@ȃǃtVot$ UĄ)Lstƃntfuă뿐1ɋT$z H膒D$8l$|$ u)1|$ IWuPt$D/WKpr(IWuPt$D1TL$4xT$$s$tntfuσ1} t WPVg l$ E|$f>t WPVg }t0EfEfF}WuVg f},t&E(fE,fF}(Wu Vog f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[ۙ|$ t$FN,9vtU6bu]uUU_vtHnNT$l$f,Ninf|FFWRPwe ~F 1^_[]ÐSWV[,t$FNy9vtW6躀uCu;Wut.~NT$|$f<Ny~TF 1^_[ÐUSWV0[èl$D`EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1EIbGj|Uy{D$tL$j|U!\t L$U8C=rUPt$P 10^_[]ËD$tPCL$ =r\I"D$t+PBL$=ryIQUPt$T^jjP}tt$ $@ 1D5t <,tFPsD$4 VUPc D5$(L$tSD$HtJ11t <,tFPps Vt$Pb D5$h|$t+D$Ht"t$7 $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0v$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p Av$D$t$HjjjPjfWjQIVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[Z|$ $ ftGt D1DWG(f hwU1 =wb,Ž Ƅ |)ƋtVPU1 9vD|ŃƋGtVPU{1 9s D|ŃE$^_[]ÐSV[]t$ tavqvqvyqv nqv$cqv,XqVOq19 uǃ ^[ÐX߃ @ÐY @ukUSWV[Õ$(E$$4D$$0j:WGt!jQP# t0V$0W  NjE;$^_[]Ã\u 1@tMduHt6luPttxXf$O:t @t@uS4$l$w$D$j@UPR/ <:t$EF<:uEl$4$D$D$Otu<PH\PG`ǃ< ` D$O6`$$,PQhW蚕 t" ǃtmsj <<g @X jN `_\0 `! )BPC+BP% IJP7tRJj/Vct|$u`$jPRQVЬ'`T$$jPRWUQV觬_JVPj/SV[t$ j:V&Dt!jQP tt$V1^[ÐVYT$փ1u@t^1\^USWVH[ht$dl$`L$\D$Dȃ=@u\<$ynJL$VPj@Q3T$tLT 9 $ƅtID$\WU\ ~*)NjD$\u $dVUQ ;L$Dt[a1Kt$\\@DŽ\DŽ@tp $;D$Du ЃH^_[]USWVT[~|$pL$ll$hD$P=@u\ $t$ utJL$WPj@Qϑt$t$ T$Ijj lD$Wt$@o $t$j l9<$u-;D$PuyL$T^_[]WQU6 ;L$PtNT\}@nDŽ\DŽ@o;D$Pu T^_[]@USWVD[ø|L$`T$dt$X}|$@uM@u \t9ƀzJRQt$dPj@W艐 tRQt$dVV M;L$@uD^_[]SWV[{|$=uj@u \tVw>`}tL!\@DŽ\DŽ@W^_[ÐUSWVP[X{D$hT$dML$LL$pL$t$lуuc@u \tOz=m8@tW=mS`T$ vPQj@R x. VPR$U bN<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l\< 4()uT$ff׺r$σߺfDfu,$tу$$1kE;D$Lu^P^_[]Ët$d\@DŽ\DŽ@(k,$1,$\S[xD$u&@u \tj-[P[ÐS[~xD$u&@u \tyj-[t$ PM[ÐSV[xt$ j:VF<t!jQP tt$Vj-^[ÐSWV[üw|$t$j:V;t!jQPX tWhV WhV ^_[SP[]wD$ L$ $L$ƒu&@u \tMi-Qt$P [ÐS[vD$u@u \t1[PDK[ÐSV[Ývt$ j:V:t!jQP= tt$Vh-^[ÐUSWV׉[4vR!jj ueD$UWt$@  t$j Le19tG4$\D@5DŽ\DŽ@g^_[]ÐUSWVL[ÆuD$D$H1,<jU\ u} t @u D<@u^\@~DŽ\DŽ@ gD$;D$HL^_[]Íl$ E< us{Uf8|$jW\ u|$ u}Fu\@DŽ\DŽ@Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:@$ D$t$DRL$D@$ A @`? J19<$D$ D$D@ @`ƒ?J91C$ D$D@ @`Ń?+J9B$ D$D@ D$@|$`D$?J;|$  ՋL$A$  <$‹D$DpE$ D$L$ D1 <@4$T$<`Ń?|$_u+J19QL$ T$D $L @`ʃ?|$_uJ19 l$ D$L(D$<_D$$D @`Ń?+J19 ՋL$ T$D |$_$D @`ƒ?J9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0tJJ;D$(Q,^_[]É<$t$D$X$ VRPQT$T$L$ t$ ?3J|$D/? JD/ ?JD/D$J/T$T$L$ t$ ?3JD/? JD/ ?JD/D$JD/D$L$ < JL/ ?JL/ JD/D/ @$ <$<$B USWV[õl$D$$  ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ|$ ǃx$ ǃt$ ǃp$ ǃl$ ǃh$ ǃd$ ǃ`$ @`$ ĉ34t2tkƷ< sԃ1@tt`$ tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ`$ ǃd$ ǃh$ ǃl$ ǃp$ ǃt$ ǃx$ ǃ|$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ʼn|$| t!qtAD>1tBD>׹@`$ ĉD,|t.tkŷ< s݃1@tt`$ tр‍ @ 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ|$ ǃx$ ǃt$ ǃp$ ǃl$ ǃh$ ǃd$ ǃ`$ ʼn|$| t!qtAD>1tBD>׸@`$ ĉD|$t=2t$Fi%I<<fw1@tt`$ tlj瀍 ;@ 1ttD~tg$  fAB; w~4AB; w~4AB; w~4AB; w~4AB; w~4A; wʼn41 @tt`$ tlj瀍 ;@ 1ttD~t$Q;$A`$ ;$B`$ $u1 @tt`$ tlj瀍 ;@ 1ttD~t⍃c$ 0pQPQPQuw$ D$pv$ D$lu$ D$ht$ D$ds$ D$`r$ D$\q$ D$Xp$ D$To$ D$Pn$ D$Lm$ D$Hl$ D$Dk$ D$@j$ D$<i$ D$8h$ D$4g$ D$0f$ D$,e$ D$(d$ D$$c$ D$ b$ D$a$ D$`$ D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فр3ʉрUɀʈǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ΀$ D$$ D$x$ D$t$ D$p$ D$l$  ʋD$h$ ыD$d$ D$`$ D$\$  D$X$ D$T$ D$P$ D$L$  D$H$ D$D$ D$@$ ʋD$<$ D$8$ D$4$  D$0$ D$,$ D$($ ΋D$$$ D$ $ D$$  ω D$$ ɋD$$ ? ? ։? T$ځ@ $T$ 1$ u$ E$ Qu$ ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D u 4$l$T$ L$ Ń4@ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]USWV(]h[D$<X%UUUUʁUUUՍ4P᪪@ D x   x @ D x   x @ D x   x @ D UUUU $؃@ D x   x @ D x   x @ D x   x @ D T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y8 $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3@ 3@ 3@ 3@ 3<$t$3~3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 1#t$t$D$|$811t$3=@ $3=@ $3=@ $3=@ $3=@ t$$3=@ $$1L$t$|$l$3l>l$|$l$ 3@ 3@ D$35@ 35@ 35@ 35@ 3@ 3@ 3@ 3@ D$t$D$D$$7֋T$ Bl$l$l$$xl$ @ D $x   x @ D $x   x @ D $x   x =@ =D $x   x @ D ȃx   x @! D! x ! ! x @" D" x " " x 5@# 5D# x # # D$@P1(^_[]ÐS[ûUD$1ɐȊt tT Tt t t4 uP1[ÐSV[:UD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[0TMD$$D$DD$@D$9\$6D$L$T$@jjPQjRqD$HPj ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWFD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP薐$jP脐D$0Pj5F\$|$ juh$PhD$lPj$Pj$PjWV)4D$ PjEt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]USWVd[Q$|D$<$`$ hjD$@P DŽ$@D$V$@8$u H$@D$`K$@UVqljD$Pt;uHJWPs4JWP[4uD$JWP=4D$UVqljD$OjPW D$,u:|$$@PW#x$@L$,UV/qD$l$05t$\$UVqD$ D$D$ D$$$@&D$ \$UVptt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWoD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V91$xU$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-JPQR3d_h$DUt$@V: j jW  hjU hj$P D$@hjPҾ D$<;$`u`d^_[]D$RWmD$tT$@PQhR_l$ $fffffSV[MKD$ h`rƉP7)Ɖ^[ÐUSWV[Kl$0JjD$PU thh`) $)D$j PUl $l$1}$K1D=t<$t h`tt$,ōK& 4$t$L$QWPjbVt^& L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃 Kt$ Wt$t$Pjbt$(V^& & &  & jQPR ;& & &  & jQP ;& & &  & jQP ;& & &  & jQP ;& & &  & jQP ;& & &  & jQPS ;& & &  & jQP  Ƅ;& jjt$X ^_[]fffffUSWVD[8H|$\w Q:2t$`tD$@jPV$j NjD$@9t8t:D^_[]:8"u tr臂D$yD$ kD$D$[D$<D$8wD$X$2a$KWQjP[0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$DD$ tKWV(tD(1t$t$ U~T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[H#t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[n"jt$t$t$@[ÐS[>"jt$t$t$[ÐS["jt$t$t$[ÐS[!jt$ [ÐS[þ!jt$ h[ÐS[Þ!jt$ H[ÐUSWV[x!t$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Ø t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[øt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXL$Q##wdÍyOÐUSWV [è|$(l$$t$ D$4hD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[D$ hPt$`  [ÐS[ht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[MD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[hD$pML$LjPt$lv D$h|$df$D$VpL$)L$D$PVWD$ |$$v=D$)t$.D$lp8L$ QjjV*V|$)cƃPD$2PL$Q舼 ? $ $$m=|$D$lp,t$ jjt$>VV蕛|$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>VOV&|$)Ƌ $PD$2PL$Q謻 rg $ $,p=D$D$lp0t$ jjt$>VV軚|$)v#Ƌ $PD$2PL$QE sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7ʉL$R)уtuÐWVt$  r!̐cw^_fffffSWV[t$|$G@hjP j@PW袶 g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[å$$N$@r8hUtE\EXETEP$t$tAsE@hjPt Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV h$$V!hVU< hV1;$u Ą^_[]茅USWV [l$(16t$ %T$$NP NT  ()`N`L$$WRP裲 ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPԱ 1 ^_[]ÐUSWV_ǎ$hRP莱 RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P, g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQU $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]sffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[ø|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]Ÿ$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$P4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l${P$FQ? T$‰ً$|$D$G<uD$ $O $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4hL$ |$ )t$)t$$t$,)wD$ L$?? nP T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EءBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍$PFL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N PFL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj O&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B OYt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ȡፅGPGX GTG\GG?$L$u aD?OFQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  7QFL$Q? "QFL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$P$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tQD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$P~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=aP$FL$Q?P$O$NL$Q?D$T$ ߋ t$aP$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $IUSWV[viE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP&v )t]D$)WPu8v }43M(U,E4E09w)RVPu E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[lt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQUt F4n0)Pv8Ut 1tN0^_[]ÐUSWV[kt$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[HL$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RoT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXUD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@D$?? u)D$(PL$(PÉ$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+ T$D$tq01t ^_Átփ*tUSWV _HL$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[(l$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@|$D$ @$;|L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPm )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IvtxzG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[}|$$ $w9>~NQǃ8wH̲l$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw #I o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw G o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw D o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQD F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw C o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQQCL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw B o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw }A o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw @ o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw @ o $ho)o)hu $AA~l$(u ~tvet!@UV|Xxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq > $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq x< $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$Xa$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv * n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ) n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv ~) n on)n)ouGGD$8xt1$^_[]ÐUSWVX]$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu E% } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu $ } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu # } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu 2# } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XT,ÐUSWV^xTL$4t;T$8\$0Ӄs3I͉у1&Ӊi913,ƒT$4zR13,ƒT$4zR13,ƒl$4M1ʉ3,xT$  1ϋL$ 3,Ã1ؐ\=13,\=13,9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3,3,3.,3, $3Q,3,3,3, $3A,3,3,3,D$ $3A ,3,3,3,|$D$ $3A,3,3,Љ3,|$|$ $L$l$11D$D$33,3,3,3,3W13,3,3,3,3G13,3,3,ȋT$3,3W 1‰3,3,3,\$3,3_1ˋT$ )3,3,3,É3,ϐÉ13,W13,W13,W13,W13,W13,W1Љ3,O13,RЃ^_[]ÐS[.Ot$t$t$ [ÐUSWVXN$D$$tz \$׃vND$t$,1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVXN$D$$tz \$׃vND$t$,1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX:M$T$tfǃvEt $,1ف 1υt1Mu밸^_[]ÐUSWVPXL$T$tfǃvEt $,1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[nHt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXFÐUÐXFT$J r ù)ыÐS[NFD$D$ P"[ÐS[Ft$ W3[ffXEL$  $ (, | 0 <8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_kCT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PIL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXH@D$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$,PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$Y.L$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +d)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX*\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[<$t$VGR=yaratV=tcidu3VuVStt$P`F 81^_[ÐSWV[#t$VQ=yaratV=tcidu3V;uVtt$PF1 8^_[ÐSWV[L#t$VWQ=yaratV=tcidu3VtVctt$PpF 81^_[ÐSWV["t$VP=yaratV=tcidu3VKtVtt$PF1 8^_[ÐUSWV[X"t$VcP=yaratV=tcidufVsVoƅtJ|$$l$ 4$VuD$PWUa 1u (V"u (^_[]ÐUSWV[è!t$VO=yaratV=tcidufVsV这ƅtJ|$$l$ 4$VD$PWU 1u](Vru B(^_[]ÐUSWV[ |$Gt,/D(UwU t D$0 1^_[]ÐUSWV[Û |$Gt,/D(U蘚wU誒t D$01y^_[]ÐUSWV[; |$Gt,/D(UHtwUJt D$0 $1^_[]ÐUSWV[|$Gt,/D(UswUt D$01^_[]ÐSWV[yPt$ t$  t6D$t7<$D8W`t$WqtD$ 01KB^_[SWV[Pt$ t$ N t6D$t7<$D8Wrt$WtD$ 01^_[USWV[xt$VL=yaratV=tcidVoV苖ƅtl|$$l$ 4$VD$PWU} t_VL D$t<<$D8Wrt$WtD$(014 8&8V t^_[]ffffSV[}t$t$ePzK=tciduL$1=tcid^[ÐUSWV[+t$t$3eP(K=loobul$V袉Eloob^_[]ÐSVP[D$P趈t&Pt$t$f D$VDD$1^[ÐSVP[|t$t$Vt$t$f D$V^DD$1^[ÐSV[-t$t$t$1dVPP^[ÐSV[t$t$t$dVPQ^[ÐSV[t$t$t$cVPwQ^[ÐSV[Ýt$t$t$cVPQ^[ÐSV[mt$t$t$qcVP7R^[ÐSV[=t$t$t$AcVPGR^[ÐSV[ t$t$t$cVPR^[ÐSV[t$t$t$bVPS^[ÐSV[ít$t$t$bVPgS^[ÐSV[}t$t$t$bVPS^[ÐSV[Mt$t$t$QbVPS^[ÐSV[t$t$t$!bVP'T^[ÐSV[t$t$t$aVPT^[ÐSV[ýt$t$t$aVPT^[ÐSV[Ít$t$t$aVPT^[ÐSV[]t$t$t$aaVPT^[ÐSV[-t$t$t$1aVP'U^[ÐSV[t$t$t$aVPwU^[ÐSV[t$t$t$`VPU^[ÐSV[Ýt$t$t$`VPV^[ÐSVP[lD$QPHt&Pt$t$b D$V<@D$1^[ÐSVP[ D$QPHt&Pt$t$9b D$V?D$1^[ÐSVP[ìD$QP!Ht&Pt$t$a D$V}?D$1^[ÐSVP[LD$QPGt&Pt$t$za D$V?D$1^[ÐSVP[t$t$dGt&Pt$t$a D$V>D$1^[ÐSVP[ÌD$QPGt&Pt$t$` D$V]>D$1^[ÐSVP[,D$QPFt&Pt$t$Y` D$V=D$1^[ÐSVP[D$QP@Ft&Pt$t$_ D$V=D$1^[ÐSVP[lD$QPEt&Pt$t$_ D$V==D$1^[ÐSVP[ t$t$Et&Pt$t$=_ D$V<D$1^[ÐSVP[ìD$jPFt&Pt$t$^ D$V<D$1^[ÐSVP[LD$jPtFt&Pt$t$}^ D$V <D$1^[ÐSVP[jt$Ft&Pt$t$^ D$V;D$1^[ÐSVP[Üjt$Et&Pt$t$] D$Vr;D$1^[ÐSVP[Lt$t$tEt&Pt$t$}] D$V ;D$1^[ÐSVP[jt$Et&Pt$t$] D$V:D$1^[ÐSVP[ÜD$jPDt&Pt$t$\ D$Vp:D$1^[ÐSVP[<D$jPdDt&Pt$t$m\ D$V:D$1^[ÐSVP[jt$Dt&Pt$t$\ D$V9D$1^[ÐSVP[Ìt$t$Ct&Pt$t$[ D$V`9D$1^[ÐSV[-t$t$5YP*?=gntsuV!t L$1^[ÐSVP[t$t&Pt$t$[ D$V8D$1^[ÐSVP[Ìt$t&Pt$t$Z D$Vd8D$1^[ÐSWV[<t$t$DXP9>=atadu,V)st|$L$tVr1^_[ÐSVP[t$t$Tqt&Pt$t$Y D$V7D$1^[ÐSVP[lt$t$tpt&Pt$t$Y D$V@7D$1^[ÐUSWV[ t$t$WP==gntsu?VŃUt$UPV t D$8 W1^_[]ÐSV[Ít$t$VP<=gntsuVzt L$1^[ÐSVP[<t$Xt&Pt$t$qX D$V6D$1^[ÐSVP[ t$(t&Pt$t$!X D$V5D$1^[fUSWV[Û t$t$SP;=loobul$VzEloob^_[]ÐSVP[< D$P&yt&Pt$t$_ D$V5D$1^[ÐSVP[ t$t$Vt$t$ D$V4D$1^[ÐSVP[Ü D$Pxt"Pt$胂D$Vv4D$1^[ÐSVP[L t$t Vt$?D$V24D$1^[ÐSV[ t$t$t$VP@^[ÐSV[ t$t$t$VP@^[ÐSV[í t$t$t$aVPWA^[ÐSV[} t$t$t$1VPA^[ÐSV[M t$t$t$VPB^[ÐSV[ t$t$t$~VP'B^[ÐSV[ t$t$t$~VPB^[ÐSV[ý t$t$t$q~VPB^[ÐSV[Í t$t$t$A~VPGC^[ÐSV[] t$t$t$~VPC^[ÐSV[- t$t$t$}VPC^[ÐSV[ t$t$t$}VPD^[ÐSV[ t$t$t$}VPgD^[ÐSV[Ý t$t$t$Q}VPD^[ÐSV[m t$t$t$!}VPD^[ÐSV[= t$t$t$|VPD^[ÐSV[ t$t$t$|VPE^[ÐSV[t$t$t$|VPWE^[ÐSV[ít$t$t$a|VPE^[ÐSV[}t$t$t$1|VPE^[ÐSVP[LD$QP8t&Pt$t$i| D$V0D$1^[ÐSVP[D$QP`8t"Pt$}D$V/D$1^[ÐSVP[ÌD$QP8t&Pt$t${ D$V\/D$1^[ÐSVP[,D$QP7t"Pt$ }D$V/D$1^[ÐSVP[D$QPA7t&Pt$t$z D$V.D$1^[ÐSVP[lD$QP6t"Pt$N|D$VA.D$1^[SVP[D$QP6t&Pt$t$:z D$V-D$1^[ÐSVP[üD$QP16t"Pt${D$V-D$1^[SVP[lt$t$5t&Pt$t$y D$V@-D$1^[ÐSVP[ t$t$5t"Pt$zD$V,D$1^[ÐSVP[üD$QP15t&Pt$t$x D$V,D$1^[ÐSVP[\D$QP4t"Pt$>zD$V1,D$1^[SVP[ D$QP4t&Pt$t$)x D$V+D$1^[ÐSVP[ìD$QP 4t"Pt$yD$V+D$1^[ÐSVP[LD$QP3t&Pt$t$iw D$V+D$1^[ÐSVP[D$QP`3t"Pt$xD$V*D$1^[ÐSVP[ÌD$QP3t&Pt$t$v D$V]*D$1^[ÐSVP[,D$QP2t"Pt$xD$V*D$1^[SVP[t$t$T2t&Pt$t$u D$V)D$1^[ÐSVP[|t$t$1t"Pt$awD$VT)D$1^[ÐSVP[,D$jPT3t&Pt$t$Mu D$V)D$1^[ÐSVP[D$jP2t"Pt$vD$V(D$1^[ÐSVP[|D$jP2t&Pt$t$t D$VP(D$1^[ÐSVP[D$jPD2t"Pt$vD$V'D$1^[ÐSVP[jt$1t&Pt$t$s D$V'D$1^[ÐSVP[|jt$1t"Pt$cuD$VV'D$1^[ÐSVP[,jt$V1t&Pt$t$Os D$V'D$1^[ÐSVP[jt$1t"Pt$tD$V&D$1^[ÐSVP[Ìt$t$0t&Pt$t$r D$V`&D$1^[ÐSVP[,t$t$T0t"Pt$tD$V&D$1^[ÐSVP[jt$0t&Pt$t$q D$V%D$1^[ÐSVP[Ìjt$/t"Pt$ssD$Vf%D$1^[ÐSVP[<D$jPd/t&Pt$t$]q D$V%D$1^[ÐSVP[D$jP/t"Pt$rD$V$D$1^[ÐSVP[ÌD$jP.t&Pt$t$p D$V`$D$1^[ÐSVP[,D$jPT.t"Pt$rD$V$D$1^[ÐSVP[jt$.t&Pt$t$o D$V#D$1^[ÐSVP[Ìjt$-t"Pt$sqD$Vf#D$1^[ÐSVP[<t$t$d-t&Pt$t$]o D$V#D$1^[ÐSVP[t$t$-t"Pt$pD$V"D$1^[ÐSV[Ít$t$EnP(=gntsuVz t L$1^[ÐSVP[<t$Xt&Pt$t$an D$V"D$1^[ÐSVP[t$t"Pt$oD$V!D$1^[ÐSVP[Üt$t&Pt$t$m D$Vt!D$1^[ÐSVP[Lt$t"Pt$5oD$V(!D$1^[ÐSWV[t$t$lP&=atadu,V[t|$L$tV[1^_[ÐSVP[Ìt$t$Zt&Pt$t$l D$V` D$1^[ÐSVP[,t$t$4Yt&Pt$t$Ml D$V D$1^[ÐSVP[t$t$TYt"Pt$mD$VD$1^[ÐSVP[|t$t$Xt"Pt$amD$VTD$1^[ÐUSWV[+t$t$jP(%=gntsu?VŃUt$UPV9 t D$8 W1^_[]ÐSV[ít$t$ejP$=gntsuVt L$1^[ÐSVP[\t$xt&Pt$t$j D$V4D$1^[ÐSVP[ t$(t"Pt$kD$VD$1^[ÐSVP[üt$t&Pt$t$i D$VD$1^[ÐSVP[lt$t"Pt$UkD$VHD$1^[fffSV[j ƅt%PPV FF F^[ÐUSWV[|$tzj {1tcPPV FF FWŃP7tQPK~n VX1^_[]ÍRQQPQhRSV[ t$ tVdP4^[ÍRORQPQhmRoSV[ít$ tVP^[ÍRORQPQhmRUSWV[HD$tfL$ L$QPjj"1x@ƃ$Pt+ǍD$ D$Pt$ t$W1ɉV.ʼn^_[]ÍV 1^_[ÐSWV[t$NtFt_V9wwu QPtFVL$z~ ^_[1SSHSPQhRQSSHSPQhR2SSHSPQhRSWV[\t$t$|$PWtu^_[ÐSWV[ t$jVt j V~1^_[ÐSWV[Ìt$~ t1j VHtw;~ rjVt j V1^_[ÐSWV[t$|$ʃ>tXVt j V1^_[ÐSV[t$ jV)tj Vt jV 1^[ÐSV[jսƅt5h½tFFF V1^[ÐS[þt$[ÐUSWV[ØD$ t$tPD$D$l$$~1̀ws 琐<L$yO!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸ]$T$J(z 1 7>w􋌋L$qD$ tL$9QWP 78/u%<$D$@$|7>7VL$A$>tGL77t$ wɋH vHN15t$F FFFFU=tP w싔\Nx"u+1Ҁ8t$FHt"tV x>t1^_[]ÍTTHSPQhRUSWV_l$D$P1 D<&t0<<t;\$rJ1ɋB닀ztuTz;uN<szuuuwXtEuW`1^_[]Éw񐐐USWV[D$PZ>L$QPjjj$0PD$PZ$$_HtыxnU襗tUt띐$$QL$ QPƅtׅkUetT$$4$tz1U:$ƅt`L$HtыxnUutUPjQt t뫃tX^_[]ÍUHSPQhR UUHSPQhR)UUHSPQh RUHSPQh;R)UUHSPQhERUUHSPQh RrS[þt$[ÐUSWV[Õ$x4$tT}tNU؀t H|/tv鐐9/ 9sf$.V肀H r/?fD XDXXXXDistX/.plV W$P\ 9ucV^tUj蘖P苖WVat)V^Ut$V/`u-~8u8V^V Z81^_[]É9tE9t qy/t)rVUP 4USWV[j3[jq1 Ɖ|$hj$] tLǍD$PWLt.L$Al$h($#$V9s&W]VW]Vt4$D$ l$t1jjWjjQjE,$EWX]tFjVWa D$D$ u;jjjhj|$WPlEt",$u U1Č^_[]VUD4$ڐSV[mt$ jv6Ra v6DV艿^[ÐS[.D$Pvt[Í UTHSPQhR螽D$t1S[jt$t$ [ÐUSWV[Õ$4$0$,D$PStED$$;t 1^_[]Él$L$QL$QRUWVPu=VU$8P$8PD$ PT$,$0릅4$t$$8$8D$ PRt?t$ $,|$$0D$$1;<$4t $4jj$8W$8Ut$ VJS$,$0PQjjWUЍQU3UHSPQhR葻S[D$P[ÐS[þD$PP[ÐSV[Ýt$ vVʼ^[fffUS[eEM L$$D$e[]ÐUSWV [&@PQa|( W^( l$UV%tPW}^ ^_[]Ét$Wf^j vthʼnPU|$GEOM,$EV#^W|$W襌t(P&V]4$菻p1l,$UW̍9uVMVUUPQh@R谹US[EM L$$D$e[]ÐUS[õEM L$$D$^e[]ÐUS[uEM L$$D$e[]ÐSV[=t$ 1t9u V^[ËD$@$ÐWVYT$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZNL$1t91t^1^ËAQ^ÐVZL$1t91t^1^ËAQ^ÐVZL$1t91t^1^ËAQ^ÐVZŽL$1t91t^1^ËAQ^ÐSVPYLD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY,D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t9u@H@ty1ËT$ BÐSVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY<D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t9u@H@ty1ËT$ BÐSVPYLD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY=D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t9uBJBuy1ËT$JÐSVY=D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY\D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXoT$t9uBJBuy1ËT$JÐS[.D$t9u L$ t9t1[QP*[ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYND$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV[ãuD$D$ D$~6~$,F0tW-uk腲D$jPv T$ D$1ɿ9F8"xxu-D$jVD$jPvU T$ D$1ɿ9rG߱8"u=ձjD$Pv ` T$ D$!Ѓu 話8"t7L$d$D$FyUjPV tu L$e^_[]ÐS[.|( jPN( PQ}1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[ D$0( VPOV31^[ÐUSWV [Ƚt$4L$8AAItVQPRj WyUUVtWVt UVR1 ^_[]ÐWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[@PQpO|( PL[ÐS[þ|( PWL[fSV[Ýj@UƅtCPVjPeMF,F0F4F8F<^[ÐUSWV[)t3Pj蒢tjj@ŘDžuU9Oj@誘1t=PWGjPLo,w0G4G8G<1^_[]ÐL$WUSWV[xt$19nUxLN4 Džtbl$~4<$tC1퐐F,USWVP[z|$1ts9uiw4#(ƍG$PrI4t$1퐐G,4V4.t;o4r4$=I4$0IV1^_[]ÐUSWV[طl$1t.9}u#ED$PH19}tt$H^_[]Ë}4tE,$1)ωr^$tUPt$$dt1Ʌ~ă뽋$tuXXVPQhR賢1[xVXVPQhzR荢USWV [ȶl$ 19EL$$09uVG}4t$tfD$$D$M, $1)ωr6֋$tKՃPt$ @t1Ʌ~1 $tt5t$!G ^_[]ÍxVXVPQhzRuXXVPQhRVUSWV[Øt$$t 9t 1^_[]ËF4;F01F8u$FD$PyFv4t[D$$x,1)Ήr=$Dž,Pt$, 1Ʌ~$j봍\PQaG( UrD( t$(VWrD$PiU@D|$$o4;o0w,PjǍMUVWf D$$x,ljh0V~,$tD$,PD$,DV|$UCV\_ǃ,wj,<j<t$$D$$x,ljH0l$,Ujw,4t2$ƅPt$,萗y&$'L$n@4@<C$ōƃM)WRPK L$$A,T$TT$,T A4A<$D$P!D$mh蚏0QPFt$(P薾t$ ~UFBt$(|$WptmPFUBD$ x|$$t$P蘟$<WVVJ L$$A,T$h t$ VWq9Ƌ|$$UAD$ D$XxVXVPQhzRrXVVPQhRSxVVPQhR4KY5YVPQhR)YYVPQhTRS[>D$t9uL$ t 09t1[Ãt$QP] [ÐUSWV[t$$t 9tFD$ PAF8D$$P4D$$@,D$$׉T$)ω,$D$4FPt$,jt1Ʌ~,$벉t$9vwL$T$ )VQPH D$$@4@<W4$t$ A^_[]ÍxVXVPQhzRaYYVPQhIRBS[ÎD$t9uL$ t 09t[ÃQPc[ÐS[>D$t9u L$ t9t1[QP:[ÐYD$t 09t1ÃÐYϮD$t 09t1ÃÐS[ÞD$t09u L$ t9t1[QP[ÐSWV[\,tIPt#D$PVQ tVQt> 6\1VD1^_[ÐUSWV[l$}t^_[]j@蒊tƋ|$PVjP>F,F0F4F8F<}$t7h.tL$7PUrVPbUSWV ։L$["|$ *jjWg tUjPww Ht(ut$$jD$Pww (u$uyGL$PQht$0WtZD$=stL$$jt$W t4jjW t#\_jt$(P6t$}.t1t$$fU  ^_[]ÍZYVPQhKR莗S[ΫtUPt$ [ÐSWV[ÜltyPtWD$PVQ tEVt8>VtW0G49O,tktklD$jjjWP,tqG,O4QW4DP*D$(Ct(VVVPQhbR藕Q.GP;W1^_[]É.XVVVPQh`RH\VVPQhqR)WVVPQhR S[NL$A4tPQ4I,Dt*P1[ÍLW,WVPQhR譔W,WVPQhR莔USWV$[Ȩl$<|$8uV9}4tMtUD$ PWtj WctD$<9t6$V9$$V9tUPW,^_[]ÉL$jj貎t,]]Hl$WUP@j jzDžt!`PWGwo 1^_[]ÐUSWV[؝l$1`9}EuBM1tDm $t: $UJzt^Ut$D$Pi U-;1$D$jzt"WPT$ED$E E^_[]ÐZL$1t `9tËA ÐZߜL$1t `9tËAÐSV[íT$ t`19 uL$t r ;t$v1^[ËR1ttVRQh ᐐUSWVP[JD$1t `9t ^_[]ËHh t( $tDUxt؉Ut$Ph ątZZXZPQhR|ZZXZPQhR]ZŸL$1t `9tËAÐS[nD$t`9u L$ t9t1[QPj[ÐSV[-L$ t `9t1^[ËT$19Q ut$tRVq讱 ֐USWV [ؚt$(~$t  ^_[]ËFV}jQvPt҃~ t躌D$jPv蕼 ʼn$u 蓌8"tD$NN 9u8"t= [ZXZPQhR܅1jPj N,$Uv7ǍFPD$PU tcD$;$uZjPV& tD|$u W1,$jmvƅt-`PV譱F~n W†t W谆D$$0USWV$[Ey11T$G=w 4⍋,jAPQXe u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5jP"F,F0F4F8F<^_[ÐUSWVP[ؐt3PjAwtrj@tmDžuU}Wj@Ym1tE,$UW蔨/GjPd!$G,w0G4G8G<1^_[]ÐL$GUSWV[|$1tv9uloU !O4ƅtIl$44$t*1G, 6t1V蔦1^_[ÐUSWV[;l$}t^_[]Ët$j@ctdǍVP7t$jPG,G0G4G8G<>}$uL$UxUSWVP $[Ç*ts֋|$jjWƥ tCIV袤tW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%\\4\PQjfRoQfqGP=WQq1^_[]É.\\4\PQjdRo\\4\PQjuRgoS[îD$H4tH4[Í]h]4\PQhR!oUSWV[ht$(l$$~W|~4tHI<$PU胛tj Ut 9t6$W6$W%I^4\PQhR(lQ^>^4\PQhR lSV[Mt$D$ PaVU^[ÐUSWV[ l$}tQ97uGWEtS90uOH<1;M uM;H4w\t @,4MW^_[]Í]h^4\PQhZR5k]]4\PQhBRk^]4\PQhGRjUSWV[;|$wt<9.u2VBGt>9(u:G@D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[øyt$@|$t1 @u~1ɍ( >t 9u#;T$t$bPQj7RNUF(^[ffSV[ht$ u9zbbPQj7RUF$^[ffSL$D$ t9tEA󐐐€tuuuu˃t@Au<€tAt9AtAt9Au΋D$[fS[g+ Pt$t$K [fffffSWV[ügt$T$u#+ c׍bPQj9RSс wdpp.c*?&b"Au-ta lsw--trN-ywNс@txuSsF-- trN-twNсtxuSsF--trN-twNtxuTtF fF ^_[fffffUSWV [Hft$ uqKccPQj>RyRjVD$S#jt$V Ƌ4<$lD$,$ltAL$t$t$$UT u͋D$|=uU|W9,$}d)tuDur;MDMDMD MD9ux"1 ^_[]ffffffUSWV[õd$/L$(nL$,TL$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPj S[ZL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[YL$u"drd7dPQhREt$uHT$D$t$ 9Љ,dWt$Pt$Lt$Lpk11҃^_[]Éȉt$,9ы|$0}dt$49Ƌ|$8}!dWVRPt$Qt$Xt$Xk 맋L$<fffffYVimNA90%ÐXVL$ffffUSWV0XxV$t$Du%$meceePQhRBL$H|$PL$u)${eceePQhRlBL$X1|$L$W2D$ ؉D$ )t$D$HOL$|$ T$/,T$D$H9wԉL$Lt$9s,D$$PVT$XD$x ͉ƋL$L|$$WVT$XD$H\$tt@1ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$  T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$L7D$4D$9ƋT$L߉l$9s.*D$$PUT$XD$x ŋT$L|$tB1ɋt$D 9u)̓|$nЃ|$S1ɐT T TT TT TT TT TT TT T9u|$uO1l$ t$L 9u)\$T$Lt\$|$$Wt$T$Xt31T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$1Ґ  LLLLLLLLLLLLLL9u.$t$ =1$sB0^_[]USWV<[(Pl$X|$T|$\|$T!D$u D$4tǃǃ T$PT$$9L$$kT$,"T$0\$|$ =$D$(\$ ǃ|$ l$XL$1L$u8D$4;L$$fD$T4>-u FD$,t$0fE<+<-n L$ XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő t$+1[fS[Þ>Xt$ t$ PZ [ÐS[n>Xt$t$t$Ph[fUSWV[;>l$|$t$uggPQj4Rd*1UPWV,^_[]ÐSV[=t$ uggPQjAR*jjjV,^[ffffSWV[Ì=|$t$uhgPQj6R)1hPWV@,^_[ffffSV[-=t$ uahYh"hPQj0R^)jjjjV=tt^[ÐS[<t$j t$t$[fffffUSWV[ë<t$|$uhnhPQj/R(jWX~G0t ujW=^_[]fUSWV[+<t$|$ttft7wt9fh L$f@Hx$p,L$ H(L$$HDL$(H -1^_[]ÐUSWV[è;j`1L$,l$(D$$t$ T$wGo Ouu u&t,t+$|ttڍlVPv3alVP^"llVPFlVP.lVPlVPmVP t9uuhl$t!j2pU` xqjQPs`YRKD= 6 / ( !  l$mPQj2UFU<ƋD$XtPUt$\ ;D$4u 8^_[]fffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[Ü0|$t$ummXmPQjYRF)F31uF FF^_[ÐSWV[,0|$t$u qmXmPQjwRQ~uP\$wGN QtmmXmPQhR~~uр~|$^[ÐSV[.t$ t ~t/FmmXmPQhR~uN .wu^[ÐSV[}.t$ u"mmXmPQhR1~t^[ÊV u.wL$~9|ԐSV[ .t$ t~uQ(mnXmPQhR3~u'F u <.wL$9^[Ð|$t1ËD$ÐSWV[l-|$t$u"mnXmPQh.R1u6T$L$9w"QjV FfFF^_[ÐSWV[,t$u"m,nXmPQhMR~u/L$Fy |y|9IL |F1^_[ÐUSWV[h,t$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍNn;nXmPQhhRYn;nXmPQhiRwSV[*t$ t~uF(menXmPQhR#~uNuV9r ^[ÐSV[Í*t$ u"mynXmPQhR1~u(NuV9rT$x 9v ^[ffSV[*t$ ynnnPQjTRG^[ÐUSWV[)t$|$umnnPQjbRl$unnnPQjcRMϸwG)o >1^_[]ÐUSWVP[:)t$u"m onPQhRh|$ |$u"o onPQhR;cUL$$Hn 9uЉ,$)1!)1։t$uFAPjQ D$0D$8t p,$VPQ@ D$0)p)t[uQNr-p $p׍nPQhR)L$JBQjP D$0)r&,o o֍nPQhRU1^_[]ÐUSWV[H'l$$|$u"mPonPQhRr1>0L$(#4W 9u$)1*!)1ׅt"uGFNPjQ D$ NjD$8Ћ $)ȍx)t_uUOr.pL$pՍnPQhRL$JBQjP $D$8)r*,oPo׍nPQhR2L$Q^_[]ÐSWV[ì%t$|$tt1)tWmdonPQhRuύwodonPQhR)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9SWV[Ì$t$|$tu)OσO  9 9tj9tly9y]monPQhWRAiwoonPQhXRB 9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1VL$t"T$ tփuQ^ÐUSWVP[ #|$$"T$(D$,<ȸ9D$ 4t)щʊD$$L$(l$y1oo$nPQhRT$L$8D$4t9|$tl$0|$ thu[r&ooՍnPQhRcGRjP^ D$$L$(l$0O}^_[]ÐSWV[ü!|$L$1uLwt?;t$w6)w*t$uQRjQ ^_[ÐSWV[b1Ƀ8=D$ȃ}D$AD$D$`jjjh|$pWuutG,hPW L$rWPmD$`jjjhWuuutG,hPWl $rWPt$(h- |$ 1(WՂ|$ n$$juD$P D$jPmt$t$X4$PjV )VCPVW՜ V*9h|$(fD$,t$t$0fD$4D$(jjP ~ D$6;8RrP荭kjPW? $l$$|V脿PVW $VfPVW $VHPVWڛ t$XjVW u9|$XBjVW u+jVj蕛 |$X uL$1P觬<$$0輝2rPxt$D$PD$dPV謝 V聝$(D$a<t<jjD$`Pjjt$(D$xPuD$XP!x%=rP:l$<$7jrP:Vl$WݜD$8jPjǚ E;$duch^_[]ÍrPo$묋D$pG0PVQR)l$`S[jt$ t$ t$ t$ t$ t$ [ÐUSWVH[ØD$D|$\|$d'D$l|$hu&ƍpp6pPQhRl$tt$`u"p6pPQhRofƍ/t$$PQj V!%D$D$D$D$D$ l$D$ D$L$PQVt$h6.tz6PPVQ8 hpp6pPQhR|$dvpp6pPQhRl$p $At"- hPV D$\0t$\ $Ut$pt$pt$p4$;D$Du H^_[]2SV[ít$ u"pp6pPQhRjjV> ^[ÐS[^jt$t$ [ÐUSWV[%$E$$u"pp6pPQh R:$|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQ ǸxVtuTfD$D$PW~,$D$f$//,$$ffD$UD$PW; yQ80uN$=uW#,,$(W(,$W֗,$M;$u Ĉ^_[]迫USWV$[( l$@t$8|$DD$ D$D$D$D$D$D$D$ L$PQRV5<$t$L$:$u 2 uL$>͍ >T$1ҍL2 -9si$:uU;L$s>t 9sE.9r9s34$uh9s맋 $L2 9s$ 2 ^_[]fffffUSWV[+t$|$tU載D$D$?D$D$@D$D$AD$ Ÿ4$jjjjUWƍGD$$1VjjjjU~Wƅbt$$Vw$Lu"u8tPQhR|$/WL$ QL$ QL$ QL$ QL$ QL$ QPV$TD$$LD$ AD$AD$AD$AD$AW$L|D$(PdtL$QL$ Qt$($TPt$$l$(L<>4LuŋD$;D$uY^_[]Í~vsvuPQhRZvsvuPQhR$tffffUSWV[(t$0l$,D$tu5#GuvvPQjFRCuj)蟲ƅt]UP1 F LFuF(;D$u^_[]1sUSWV[U$ $$Ph@V^1$|$$ $ u#D$P|$W©P|$`l$d$$ʃ|&jQPt$ 9|=P$Pt$] ƅ~.V$P$PP |) uS84$^A8|$$uj)趰ƅ~$$QP1F LFuF(4$W]|$;$u^_[]1rqS[Njjjjt$t$[ÐUSWVt[$D$p$u"puvvPQhR1U$$U uj)kƅtZD$\UP1L\F LFuF(;D$put^_[]1pffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP訝 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPL ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW肩 ;D$u ^_[]zYfffffL$$Yai qyD$A(tQS[ȺRjj#C [1ÐT$D$ Zbj rz $z(t RPS[xjRjB [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj>B [1ÐT$D$ Zbj rz $RPS[ÞjRjA [Xt@ffffffSP[mD$ L$T$$RQP[[[fffS[>jjt$jTA[fffffffS[jt$t$jz[ÐS[޸ht$t$jz[fffffUSWV [èt$ uqwvPQjw ^ffffSWV[ٱt$(WjV xqN|$,t?r$ԣd$D?r'轣- d$!L$jWVz ^_[fffffffSWVP[+t$סtBC6 PQhR*x>L$ $„6 )QVWR6 PQhR6 > t@> ^_[fffUSWV[{t$uwwwPQjbR謜D$D$I@t NQwى+tՃ-!ȃƉNtu+u0u;t#>!tu:uCtPtЉ#.!tō,#.!u뼉#> t<#> 0# Ѓ'^_[]ÐUSWVX[H|$l? D$DD$@D$D$jPWC NjD$D$ |$ t 8"u$9r6l$4D$4jj P+ š0軚8uQ$)l$4$u&ƍwwwPQhtR賔-@@+x @`0UuP01X^_[]=(3l$l$u"wwwPQhR-qpt+t Xt-u111#Y Y+tXt-uY !!ݐY !!̅t f-xt f+p}fXPmUSWV׉[u"wwwPQhtR9L$D$T$W~>Ǩdt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ffffSWV[ |$t$uq?xxPQj:R6$D$ WVjjjPL1Ƀىȃ^_[fffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[øt$(l$$T$(1aHD$8t8P3y`i0`D$(8rl$ Pt$ŋ$t$xLxPQhRQQxLxPQhR'*0S`D$8t8PN2W4$,t$,覔01UPt$&ŋD$G6,oD$ G > > D$8t8P1G^_[]ËT$((Tn/ijUPQRVtj躒USWV׉L$[¡2jeVej+Vet-1|$WjPjcyFu<$|$1jrVtb $UWdt1j}u%E07|+wq+)01^_[]ÐUSWV׉[נ> tu(+mu?ru<6+FtjPOfv*+u4jj2f&v*tjPf6*^_[]ÐUSWV[8t$0l$$T$081RHD$8t8P/f&D$08rL$ Pt$kŋ$t$xLxPQhRۋ[xLxPQhR豋4t0D$8t8P.Wq4$)t$})501UPt$赈ŋD$G6R)oD$ G > > D$8t8P`.G^_[]Ët$,|$(T$0VWU( j]USWV[ht$u"xxLxPQhR薊H$8t8P-> t9ut@mt9uu+$8t8P-h1VߊEu> $8t8PI-|$jWu % ƃu 規8tU踊tt$^_[]ffUSWVH[HD$`|$\u#ƍxxxPQj>Rst$$UVPWstUVt$&`ǃu.8ujF$~;$} VP_ǍD$9tLVA$jD$Pt&UPt$hWs{D$$oH^_[]USWV4[HD$\l$Hu#d)xPQj8RuD$lt$Xy1y)xPQj9RJL$`uktuut덻tǸtD$T$\dL$00G?L$T|$LtD$HT$Pɉ|$ xGD$Gz9иG|{ϹdkdD$T$D$ HSQ|\ϹЉ)kϜD$D$ T$D$OD$ dD$D$0D$ڸD$ dD$D$D$`L$$׃tkL$VE (T$L9v 4^_[]ÉŋD$\0l$,t)1vwL$$L$$rx|$j|$WQRq|t,jWRP^|tjWRPJ|+щ1ɉ4$tD$LσT$(s1d;21g1di։Ńut% 44rŃu΃T$(19L$$}4$j|$WQRy{щ9} 4$jWQRS{щ9} 4$jWQR-{щ9}O4$jWRP{уjWQPzуjWQPzjWQRzщ9} 4$%jWQRzщ94$D$\|$Љ׋l$ D$D$Nj|$1ʹ9 d$0@0BL$,ȃl$L97gfff4$ֺQ׉Ɖljҍ)|$͖L$ T$ QGy4$Qt$V0WRUt$h$4$jjdQRωjyƉр|$ul$эo |$$t$($P&Dt$tS1ɐftsfTLLTftWfTLNTftMfTLPTftCfTLRut:N,19tDtPvt$FPvF^_[]ÐUSWVYT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWV։[ÄF,F tvzzFUPol$~D$uNtQjPqvD$ L$$t$ F1퐐fy zTyPQhSVnozPQhpVn1 GtfLGtVLGtFLGt6=u $$$VPV$y$B @uD$$PQD$$PQR(u%#D$=@u;$s#E/$B$L$ ;$u Ĉ^_[]USWV׉ $[0$s$$u)zzTyPQhR6m$|$$u"zzTyPQhRl$u"yzTyPQhRlD$fr$9 $9=*uG=*uG=*D$GD$ 9$D$$)9$f:BD$D$ D$ $f9uxyzTyPQhRkkyzTyPQhRkDD$D$ D$f9Hu&yyTyPQhERekL$1AtATAt1TAt!TAt=u1E @uD$$$PQ(D$$$PQU$1ɋ $X#T$,@tsBЋT$$Ut$P$$BT$$UP$ $D$fD$f9u&y-zTyPQh/RjL$ftL$t,=tsAuE @u1$P -$hPQ9* E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtun$0Q׃}1E qjMD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjnl ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ KE;D$f/t$$$P $$$$$U$u"yyTyPQhERf1$ BtILBt9LBt)LBt=uf$@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=pIM lt$10kD$/ Njt$$E @D$uP0PUu Nk8t E u;$uĤ^_[]ÉNjt$iUSWV׉[xu"qTyPQhRel$(9rfu ^_[]1t$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$zf9u;Twˉٍ^L$ |O]u`$$;D$ u)1;T$t\$9vL$\$;\$(f$ω4$ލ^ρ]tN-uf9w f;Fw$~ːf9t4$뱍7zTyPQhRcCzTyPQhRbUSWV[ev$$uzzgzPQj_Rb$$tu8h1D$$tŋD$3l$ yPh@PYD$(D$$D$ ^L$L$\QPJtYD$|$D$0t$\ d$<0fD$PPju\ D$ $D$1j1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tW PWu uhYQD$Rl$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P (jD$PD$0J D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$zjPvo u|$1D$Wt$XƋ$6yd$t$`D$|Ay DAD$$uD$*`ՋD$DJtDHD$D$ $@uP ` DAթD$zjPD$pYkjPD$p; D$ |$t$ztG$`L$tZzjPq@ 9jPD$p /1ҋ$tzjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1LD$ 1H1D$ D$D$8=a< "aY1D$ D$l$t)aD$D$\Pju V |$`8|$ $%|$tKjPu |$t&`D$u|$`8|$ $tt$Dtu V^T`t$jl$ U~\ 1$u UF[;$u!Č^_[]Ë|$|$[|E S[þmjhjt$t$t$)[ÐSWV[Ìm> t-> jhjVPt$$t8> 0jF> > tPI> u^_[ffUSWV[ m|$u{zzPQj jjj襞 > l$> tUQ> x > tb1i > 9> wHt QY > WI> t$UWP > u 1T$ Ɖ^_[]ffSWV[ lTW> u> jP0xƃ> 1> t > 1Wb^_[ÐUSWV[ÛkTW4> u> jP/x5ƃ> > U";D$wUt$%w1Y]0W^_[]ÐS[kt$-ƃ> [fffffffUSWV8[ju }D$D$L$$jjPQjRnrL$0 $$t;L$$L$D$l$tL$(L$D$l$_uVkT{H{{PQjERmVPd{H{{PQjFRFV,D$,D$D$ l$_e^_[]ffUSWV [èio{P! kt\ƀ8tUT$D$j PV tŋT$t|zt)y{VP腑1ɿkkP&wAc@ʹ &*uk@9~ ${jP,${VPՐT$t$$D$ t {> RUPjQ|L$ t>> ^_[]ffSV[-h> u*ǃ> I_OPVl> tt> 7EVP1^[ÐSV[ýgǃ> > tP舒9I_OPV> u7EVP1^[ÐUSWV [Eg$ǃ> ǃ> ǃ> ǃ> ǃ> ǃ> ǃ> > > hhUَD$ 1Ʌ$t$7L$4 $t$ > L$l$<ǃ> > hhUpD$ > t$P7j\WVN t8t剃> 8#tj\WVN t8t뉃> j\WVN t8t뉃> j\WVN 68t牃> ǃ> ǃ> j\WVGN tD8tP> j\WVN t8tP> h> |$$W |$5j\PD$ PM ǀ8tWUu͍UWHthMUWHtTvUWHt@UWHt,UWHtzUWHQ> E5xxMf l$<$j\WVL 8t牃> 8#j\t$VL t8t艃> j\t$VL tOǀ8t扻> zPWG"> PWGtb1`> D$_O|> PQ蛋 > l$tэzQPHGuR> <$j\WVK t8<$tPB> j\WVK X8<$tP> t$t$1ɋ;$u ȁ ^_[]SWV[lbt$u"q|{PQhRNǃ> > t P (I_OPWuz> t,t+V> Eu䍃> 7EWP1^_[ÐSWV[ìat$u"q|{PQhRMǃ> > t PM(I_OPWy> t,t+V> ;Eu䍃> 7EWP?1^_[ÐS[`> tPMǃ> [ffS[þ`L$T$ j@t$[ÐUSWV8[Æ`u#֍zi|4|PQj{RL|$PT$ur|i|4|PQj|RLD$T$L`D$,D$D$(D$ D$$\$$|$ $9 EtL$|AyL$ DAMZu*?$D$t&iPW>t L1t 1t^_[ÐUSWV$[åY$ jj$H$DDžtu!K1Ƀ8-ىL$m|$dW 6D$KWP$H$D5D$&h5|$4$l$t$ D$1t$ D$,8hUPV&l$D, jjV$L$H;D$$~UP@l$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11P$EUE;$ u,D$$^_[]D$ʋ4$t$ l$1USWV$[uW$ jj$H$DDDžtu!aI1Ƀ8-ىL$m|$dW3D$KWP$H$DD$&h3|$4$l$t$ D$1t$ D$,8hUPVl$D, jjV$L$H;D$$~UP=l$|$UPV$LV$HfPt$VW$L$L~9u`|$D$ǃ;|$.$D$?11PBUB;$ u,D$$^_[]D$ʋ4$t$ l$1USWV$[EU$ jj$H$DDžtu!1G1Ƀ8-ىL$m|$dW1D$KWP$H$DD$&he1|$4$l$t$ D$1t$ D$,8hUPVƎl$D, jjV$L$Hb;D$$~UP;l$|$UPV$LV$HPt$VW$L$L.9u`|$D$ǃ;|$.$D$?11P@U@;$ u,D$$^_[]D$ʋ4$t$ l$1USWV[S<|$l$t+PWUD uu^uڸ^_[]ÐUSWV[ûR<|$l$t+PWU uuuڸ^_[]ÐUSWV[[R<|$l$t+PWU uuuڸ^_[]ffffffS[Q0t$t$ [ffffUSWV [Q} F FEFUVzRu)ʃԉF:FJFx9uRu}N ;Nue^_[]USWV [Q} F FEFUVzRu)ʃԉF:FJFx9uFpRuy N ;Nue^_[]ffSVP[lPD$L$T$t$4$VRQPUffSP[=PD$ L$T$$RQPKIfffffSP[ PD$ L$T$$RQP{IfffffYOT$t :tp1ÐUSWV<[èOt$PD$D$8uq||PQjhR;pVPQ_ B hjD$P= B D$ $C D$ t:t|tD$ 9rC yPQt$^p C yPQt$Dp L$ QPt$,p xNt$ PV2t"|PV2u 16  HC V;Sj:Pt$] tHC l$^UPt$u tL$C UPt$Zu t D$ C UPt$7u t D$C UPt$u t D$$C L:D$ PVt$ o t$ u"9z||PQhR9ĖPVYPVyYFPVaY9PVIY,PV1YPVYPVYPVXPVXPVXPVXPVXPVqXPVYXPVAXPV)XuPVXe7tPVWUYPVWEPVW5PVW%PVWPVW`1DQVXUVt$Ur tD$1fB ~vnf^VNF>6.&)fB t$ C7UPt$Rq tD$ C C (C Z9UPt$ q tD$ $C (C ,C UPt$p ftL$f8C $UPt$p ftL$f:C UPt$p 1tL$fC lUPt$Fp tL$@C ;UPt$p tt$DC 3UPt$o tL$|C rUPt$o tt$C fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&C aD$ `|$4&L$ qL$%L$)L$-L$1L$ L$5D$ PWt$ o tD$ UD$,Pt$o tD$FUD$0Pt$n 1ɃtL$Nt+D$PD$4Pt$n t D$1vF UD$(Pt$n tD$ 1L$ F L$ D$ PD$(Pt$xhL$ L$ t$L$ u&9z΍||PQhR31PQRt0Euዃ` 1DJtV赫t$F t$ 3L$ L$ l$|$4=D$ fzC fD$4dxD$6D$50UWt$hm 1tL$LC D$51UWt$?m tL$PC D$52UWt$m tL$TC D$53UWt$l tL$XC D$54UWt$l tt$\C ǃB WEVǃtC WEV4$y2L$D$;D$8u ȃ<^_[]fffffUSWVP[D|$L$W4ك</@t)9v"9vH8/u)t\9v N8/@tvljD 9thUWV~Ƅ+D ^_[]À|$/tÍ,ffffUSWV[Cl$UCtNL(`1DJuK4$5D$j PUh }t֋L$9tJ9tE5^_[]ËLJ wӍ<(H@눉b58"u rL$ <$։q1늾=3ffS[Bj t$ [fUSWVP[úBt$tttnL$VtH|/t|$/u,29r9vzz/u)ρwH hUPV|Ƅ+H ^_[]fffffffUS8[AED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[lAƃtk|$|$u,P1uPTjjP t8jPjWjW|WI^_[j1fS[þ@D$t=u2[t$ PU[SWV[|@|$t$uah(}|PQj1R,WhV ^_[fT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[>|[Ḯ̀rS[>|[ḭ̀rS[ä>|[̀ffff̀ffff/̀ffff^̀rS[T>|[̀rS[4>|[Ḥ̀rS[>|[<̀rS[=|[̀rS[=|[ḇ̀rS[ô=|[̀rS[Ô=|[ḓ̀rS[t=|[̀rS[T=|[`̀rS[4=|[R̀rS[=|[2̀rS[<|[ḩ̀rS[<|[P̀rS[ô<|[ḷ̀rS[Ô<|[Ḷ̀rS[t<|[ḉ̀rS[T<|[̀rS[4<|[Ḛ̀rS[<|[̀rS[;|[Ḩ̀rS[;|[1̀rS[ô;|[Ḍ̀rS[Ô;|[òrS[t;|[ìrS[T;|[l̀rS[4;|[t̀rS[;|[s̀rS[:|[r̀rS[:|[p̀rS[ô:|[j̀rS[Ô:|[m̀rS[t:|[̀rS[T:|[Z̀rS[4:|[ ̀rS[:|[S[9|[ᐐ*̀r׋L$Q1fffffỲrJ!Q+fffffS[Þ9N(SV[}9L tFL PjtsL 4+L 4L L RK ^[ËL HL jjjhjPj趫1tȉL uxj$Pj j)S[þ8D$L );L t P%[à QPʪ[ÐS[~8jP+L uPi[ffffS[>8pPt$t$t$ [ÐUSWV8[8uD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y`DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ PPt$t$ ZD$x$WPt$Wb @D$x$WgPt$W7 )D$x $W<Pt$W D$x$WPt$W uD$x$WPt$W zD$x$WPt$W `D$x$WPt$W` <D$x $WePt$W5 D$x$$W:Pt$W D$x($WPt$W D$x,$WPt$W 1D$D$$T$EHL$D$D$D$ PPt$t$M D$@D$ POPt$t$  D$@D$ PPt$t$  D$@ D$ PPt$t$  D$@D$ PPt$t$ D$@D$ PPt$t$X D$@D$PZPt$t$' 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ J|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ .}D$ 7}|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$&@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$@}|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ VrD$Pt$V@ ID$ VCD$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$pQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$xA(|$€´|EFt PYF tX~tI1퐐t(04F t((%F t( ;~s F @ƋF PF,t PF4tPF8t PV^_[]fffSWV[\ t$|WL PVA]Wؚ^_[ÐSV[ |V趚L Pg\V螚^[ÐSWV[ |WuL L PQ\WT^_[fffffUSWV[Ë t$l$uqPQj1(`DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsUSWV [(l$(t$ D$D$ |$$El$ߐt$,D$PUD$P|u$D$͐׊D$l$EjD$ w"`sD$tmD$t]+t$ [PQhRX[PQhR.-[PQhR ^_[]ÐS[nt$t$jt$ [ÐS[>jt$jt$[ÐS[jt$t$t$[fffffUSWV[@M |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉDM uj()ƉDl$Utwn$Nj 0Q 1XM utjh=ʼn@M 0ƃXM LtMjуDM @1t*n$F)UQj P|$z^_[]ËDM )USWV[kHM |$i)Njtt+~%L$9N$ut1Ƀ|$tΉLM uj(ƉDl$Uȡtwn$Nj 0Q謨 1`M utjhʼnHM 0ƃ`M LġtMjуLM @1t*n$F)UQj Pq|$z^_[]ËLM )USWVP[l$UHNjPM $tOs;1҉v\M ljh=PM $uƃ\M D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0DM tuR:t!jуDM tiE$SDM uj(Jŋ$,tIEj |$WPQ W̡tE@E$L$1E^_[]t$̡t@ϐUSWVP[ l$UXNjTM $tOs;1҉vdM ljh)TM $uƃdM D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$ t0LM tuR:ġt!jуLM tiE$SLM uj(Zŋ$,tIEj |$WPa WСtE@E$L$1E^_[]t$Сt@ϐUSWV[t$|$ ԡtЋ@M t61=tDtPǃ@M D$L$ƃXM PM t?1=tDtPǃPM D$L$ƃ\M ǃDM ԡ̡D$ 1^_[]ÐUSWV[ t$|$ ءtЋHM t61tDtPǃHM D$L$ƃ`M TM t?1tDtPǃTM D$L$ƃdM ǃLM ġءСD$ ȡ1^_[]ffffffUSWV[$tA$1uhƅtcD$E/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[;t$tD$tdPV$xaa1ɐ΍,?UQt&UP#y.w8"tV 1^_[]ffffUSWV[Ût$VlM P6hM ƃpM ` tj~V:u^tVtDi@u\uRDQ@u말:u~u'hM t PǃhM ǃlM 1 ^_[]ÐUSWV[{|$t$L$W91:u?8u(t$Ր}^8uuu@tp:ute:u^d<PQhR"_E<PQhR81~@t^_[]ÐUSWVP[j|$t$u"dQPQhRl$ tt=jUjWV^_[]ÍZQPQhROuÍqQPQhR)럐USWVP[ó$LL$8u"ESPQhR$du"ȆSPQhR$lu)ZSPQh Rx$|$pu)qSPQh RD$ t$ l$4$h\$hM $lu)qkPQhR$|t$tx8t$tD:;|29v&t:t|u싌$lh$ $L$1xjjjUPt$eԆPQh|$XWjjjh@W3jh@uu D$jl$|$(1ɍl$L1$D$D$L$$AD$ ЉL$L9rT19r=|$T$\$hQl$ U9u ƅ,4LT$|$< u|$$tT$ $1s$#gT$$lu-\$qkPQhR$|$tX8t(a:X|O;$v<t:t|u싌$l듋$$$L$$t1<9< t+< t'#<:t <\ut111D$9;|$L$$T$ $)\$PL$QT$+$‰$L$$|$|$t UtD$$t$t|$(G 4$T$\$t$ |$(l$ܡ$ppD$L$,4$|$(D$$l$T$<:u>tuk{D$؊6U8u Xuuu@}=uUt @fƀ:t FuFT$L\$t$$Ut$ t$4 \$,L$Lt&u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:D$\$L$ щD$)9L$ |KT$<,$D$)\$D$PU))\$)D$Ɖ$T$<*)׉ڋ\$QVPz Wt$DUl t$ t$,4/L$,\$t$ l$T$|$t Uq<$ЋL$49T$v)RW uWL$81Ƀ|$D$|$uD04$W20lM Pt$ t:hM PD$lM $D$D$ V4$$lu)qچPQhR$|D$,P赑l$,t$ \$D$0jD$HPUWW t$t&t$D<u/t$,D$Ht$ Ľ\$WW<D$\$V;D$hUt_UVPZ~ WWxz1ɊD$D$4T$D$8(D\$4$ |$\t$oKWWy t$ ;$Lu|ȁP^_[]M0Uǃ|$\$t t$oo4$At$ 믋\$U,|$t\$t$8o\$t$,b.XL$ܡÐSWV[|t$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍdkPQhRE}qkPQhRVSWV[ì|$t$tGtitM tPǃtM ǃxM ƃpM ƃ|M WV^_[ÍdvPQhRuZvPQhRipS[tM tPǃtM ǃxM ƃpM ƃ|M 1[ÐUSWV[å$,E$$$(xM uxM ȋtM u!IQ0tM 7hM t%1pM tM PQ0t $D$uz1tM VVǃtM xM HxM @IQPtM uE<PQhRƿdD$M]h\M:ȉʀ0E€0 ȃE€0 ȃ0^u&M: tz:tuS|$)Fd$PW*у¾2w2$:밃뫃릱뢱 랱 뚱 떱 뒉l$)u! +F$PUtL$($WU ^_[]ÐUSWV[(t$ l$ B|$$d\$~E<:uM8u*t&M8uuu@=uE<@D$\$jd)JƃdNJD$\$E<:u)FdPW?ƹd뽍dPQh"R.EPQh#R|$$oPQh$Rzd<PQhRXE<PQhR1)nu5 Q\$UWt2L$$:\$PQh`R\$W^_[]ÐUSWV[Ël$t$u"dPQhqR|$MtAp:uu8ut݉ː3V8uău뻀@0#uN@0F ] ~(FF8hWvPD>8/>9v$uP FN8D} .~ wF F PKBuWv ^ tŃ~?:}|@uH)ƒVԍiF F BBQWPB uvv A^ ?~?:uF=~t   8u F,;8u e^_[].rS[Þ0t$t$ [ffUSWV [a} F FEFUVzRu)ʃԉF:FJFx9u0Ru ] N ;Nue^_[]CqfUSWV0[óD$(}/PQeM t$M L$ML$f|$ L$T$|$QRj WPW2uOt$ rF|$j WP u0O L$FD$D$ PjL$Qb 79_t$} urQ tgM9uWM % N[QPR}Wu19r"y";L$(M jjP@ PID$t$L$ WIt^fxHuHPQ$3U q 3u uًI3Muˋpjt$Vp uEPVu} ;EsD$t$WHL$%D$"T$ ;UwRPu薜 1ɋt$;D$(u ȍe^_[]nS[N8jP+M h P+>Q [SV[ M hVt$t$t$%t1^[fffSV0[t$DD$@t2D$D$ D$HL$ $@D$1L$"$uD$D$$D$ D$D$0D$~D$HD$WP$LD$D$,8|$L$9s&ȐVPT9rG$) $u0u8L$$QPxA D$D$T$ ^L$$QP? D$8|$b|$0g$D$D$,D$Wظ9D$l$T$jFT$L1 󫋼$$WRl$,UPt$((tl$t%D$ D$$D$l$~UBD$1WP臹4$uD$D$$D$ D$~V螥HWP)y+؇ՍPQhRʢF)׉FL$$QP D$Q T$ t 9l$D$D$,u|$gD$T$ ub|$L$,D$|$$L$ VPr=D$T$ |$ GL$(D$<$EHʀ߀X$uD$VQO $uD$fxWt$,jU[D$eWt$,jUC $u&@u(u-uu||$|$ |$fD$,T$ L$ )L$L$ m|$[|$$|$<VPrL$׋T$ f|$Q||$|$ D$T$ D$D$8G׋T$ fD$9׋T$ L$ ׋T$ @݉T$ @L$؇׍PQhRh؇׍PQhR=D$,N @1|$8 D$,D$D;$u6D$,^_[]Í$9v׍HL$@VP֡QUSWV [l$$T$ 8u}jU輄}0u LJE T$ uGmt-U ~WE EE}0T$ fE ʉ $7tFO9M}f}Y֍#PQj`R肞0%fE EMt\9vX8PuSEElE@9tj< WVL$胙Ɖ|$NjD$PVW} E00L$H_MMt .$ tEt@u%I3oPQjJR苔E@NT$RQjjjuЃ>T$u-ӊƊډPQj[RDT$,$ t|$ tEtHHu0t׍oPQhR|$0EHHPVt$0t$0WRUуt 菙0$^_[]ÐS[NpPt$t$t$t$t$c[ÐUSWVP[ l$t$D$ $ t t@8u'oPQhR@8QUVwЃt ǘ0$^_[]ÐUSWVP[zl$t$p$ t t@8u'oPQhR腒@8QUVwЃt 50$^_[]ffffUSWV[t$l$蓖CPQW躽 t"t$ VW UWjjPjUEPQWz t$nfffffffS[^jt$t$t$p-[fffffUSWV[(l$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]>CUSWV8$[à$L$4u"xl;PQhR輐$PD$u,$Pt"l;PQhR聐t$$Xu"l;PQhRQ$Pt$Pr 9FjP7D$tk|$jWD$(D$ tND$1ɅujWt3L$$\$T@u%t11|$l$r1҉D$L$ |$41 tw|$tE9sP r L$4QPUW蓢x9!xt19)u|$T$$l$);$Pw|$$Xt$,VMD$jPӈtT$1 T$|$$T@uW$L$,Pt$ QW膢t4W$t 8D$1D$(vt$,L$ɸttQȃ1Ƀr8T$1ɐ44t tt tt t 9uӅt!1ɐ449uD$l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@L$1jt$t$t$t$f[ÐS[L$T$ jt$ t$ t$ t$ 4[ÐS[ΙL$T$ t$ t$ t$ t$ t$ [ÐUSWV[ÈL$(T$ 7t$T$L$kD$L$11jUt$,jPxD$Ƌ;D$u ^_[]7USWV[D$(L$,T$$>|$T$L$kl$L$T$ jWPjU1xL$ȋ;L$u^_[]7USWV[Ë|$t$t VC1kL$1jUWPV^_[]ÐUSWV[;|$ t$t VC1kL$T$jUWPVN^_[]ÐUSWV[|$t$t W8C1k1jUt$$PW^_[]ÐS[ÞkL$1jPt$t$t$[ÐS[^kL$T$ jPt$ t$ t$ [ÐS[kL$T$ t$Pt$ t$ t$ ?[ÐSWV[ܖ|$t$W_uGكs^_[!t_t$t%<8F8F ^_[ÐUSWV[[|$ u ^_[]l$ t$W脘t t- t(Wmt|WPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[è|$0t$,Wt$@{D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv(<$|$Dփ 6D$4)D$4@u \҉L$x MV)t^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ͕$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/`DPg%0W$\P$D$4@uW֔u#`DxuGws>4$$^_[]ËD$4  !rfUS [eE$D$D$D$PQD$e[]fffffS[t$ t$ [ÐUSWV[$$%= uRl$%4$rnƅt1~(Pw,to‰4$D$4D$t$@(ueO@4u\D$0D$(D$D$$31fGHrG D$4l$L$ $Љj0 t9D$"D$ <u rG OJrD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDRb)l$ǃt$<)l$ D$8D$D$14$D$Lt$)DžN( u" .uGt<.utʐL$tXw P[ōG UTD$t1 .YMPNQPT$ RK u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HR"f4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$Xl1NPQh1R\fD$u‹.l1F)EHftf },$FtpPfu|$t$u N)$xDuW@8/tOF(uIjh@P tFFU $U<$u~ljF^_[]FUSWV[xt$uŌPQjBR,eH}t v$e>VD }t!v$Cv$8v$eVeW^_[]fS [[xpPQt$ t$ ,$ [ÐS [xt$Pt$ t$ l ,$ [ÐS[wL$T$ pP[ÐUSWV ׉[ôwT$4tb=t= T$4t=uD T$41(L$ L$L$L$ D$l$ L$RPQUWVs=uDi"ك$Tw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[ÞvL$T$ t$[ffffff̀rS[dv|[̀rS[Dv|[ ̀rS[$v|[SWV[ v|$t$u+IPQj*R9b9tt F9u1^_[ffffSWV[ìu|$t$tt1WVY^_[Í~PPQjBRauύ~PPQjCRa뮐SWV[,u|$t$tt1WV*Y^_[Í~PPQjBRGauύ~PPQjCR$afffffffS[îtL$T$ pPt$ [ÐUSWV(T$[rtɉ\$u'cUc\$PQj?R`\$t$@|$ |$<t9D$<|$ "v)Df1t$\$VP-U\$ u+t-t D$ 1D$t$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[4i|[USWVXXi$l$x|$lu"$pPQjwR?UL$ttwF$Z$pPQjxRT$vl$p1 D$͉L$4A$P%ED$(u'$rpPQh"RTT$tЃD$|u,$pPQhoR;T$؃D$ JL$l$ |$lT$tL$l$ щˉL$9D$ ;\$lL$xvߍ4$WVуD$ ~L$tt>1ҋt$D L9u׍*t$t)փ|$r؉΃|$r1Ґ ,, LllLLllLLllL9u4 t$4l$(.Mu$rpPQh#VR{PQhnV$R$3ȉƅu4$L$pPQhoRXRL$ $D$,l$ /؃L$JL$݉D$ \$$!D$T$tl$  *ωL$9w"ސD$ ŋ|$9ߋt$xvD$$WP֋T$\$,D$ ~L$ttE1ҋt$D L9u׍*t$t)փ|$rЉ΃|$q1Ґ ,, LllLLllLLllL9uD$4|$( l$ /L$<|$l$PWփ8t$,ىL$0D$T$tRD$8L$(L$\$|$$D)L$(D$L$T$tD$4L$(t$,t$|$$9.9D$ NjD$84(L$$VW$L$8(L$D$,;|$$rÃ|$ T$tL$(\$t$,D$4;l$ XD$<.+|$lσ|$8D$tt71ҐEL5MD59u.)֋L$(|$re *փ|$rW1ҐL,l LllLLllLLllL9uՋL$(l$ T$tD$4t$, L$t$ 9D$ |$t$ D$|$l\$t>D$ L$ ȃL$t U0uuD$0L$t9rދl$ ;l$$D$ $UP$\$L$<D$D$ |$t$,9W<$VW$L$0Ȩuˉ+D$lD$(T$\$0tL$tU7uuߋL$t9rk|$l T$tD$4L$(4ȃ90rt$<T$HD$ ‰$D$4|$L9|$lΉx9։|$LtՉЉ|$D͉L$(t$@D$P&D$DBD$DD$PՋT$T9tl$$ŋ)4t$9t0t$T+t$@1D$09l$$;l$Y9Qt$$VU$\$t$~ \$0l$1҈ډT$|$ T$t\$ 9؉t$8L$l$$$Pt$ D$4$T$|;D$~9L$,i\$ 9L$$Pt$ D$4$T$|;D$9D$t$w>t$,T$tt$9v(t$$Vt$ $;D$~ЋT$t9w؋L$,l$$96$Qt$ L$ $;D$*T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ sj$Qt$ L$ $;D$~bT$tL$;L$ s>$L$Qt$ $;D$~6T$tL$\$ D$ D$9l$^D$T$tL$9l$B|$tY9r1ɉl$H9u)ω9r1L 9u:D$ l$$49v$L$$Vt$ $;D$~ T$t\$ D$T$tбL$9v\l$$T$tl$$9v?\$ )1$Ut$ $;D$~T$tl$$\$ 뺉ًt$89l$|$tIE9rl$Ht`1ɐ9u)DE9r1  9uNjT$0Ѓ|$<T$0NONONONONONONOu]Ѓ|$<T$0rPMMOMOMOMOMOMOMOuD$L$L$ 99s9t$T$0d$Dt_|$L$(t$@t.9r9rL$(t$@|$\$t%E9rE9r|9u$t$4VW $Q7G1X^_[]ffffffUSWVP[Y|$H8tqw$XG$t,GO4$6tV1‹n1 uV ;Wuj26ƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUTƅtF PVW! u$N*jU!t@ PVW! 1G8t uGG $tD$ 81^_[]fff̀rS[$U|[ḃ̀rS[U|[SWV [Tt$ |$uqOPQjD$(|$u#PQjAR]>D$(t%>񐐐9t uD$))t8t)Pt u+D$ P^_[]fffffSV[mQL$D$T$ y9 RVQPB6Q4P 1^[ÐS[QD$y%9 Q PQj@R;B Q j@4R Q [fUSWV[ëPt$|$u~oPQj?R<l$tt41 |t$t$ t$ WW uD$ <=u.|$$ Q 9ttD$0Q M9u;Q s|9v9tfPK3ǃQ ǃQ $jWP 7078uyPD$0t$ )$jWP 7078u4)  $PjQ3 $Q L$Q ^_[]ÐUSWV[(EQ tQ 1t0DtPVtQ Hى|$jjD$P tE t5jVt$ F:Q tVt$V1ŋD$Q 9tP1ǃQ ǃQ Q UjP2 ^_[]ÐUSWV[ D81tR/tL,t4t$t$U uD$|=uօt D$1^_[]ÐUSWVP[ÊC|$1|PWtfƀ<=t^tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[B̢Pƅt40^[ÐSV[ÝB̢Pƅt40^[ÐSV[]B̢Pvƅth40^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[úAD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[XAD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[@D$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[X@L$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[Ø=T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t`WV躔t(truGPV.t WV[1ZESܒPQhRx ugSܒPQhRR yWV0^_[ÐUSWV[ |$t$tnu"rܒPQhR WVgt3oUVƓt"}uG jQWPV"1^_[]ÍErܒPQhR ukSWV[ |$t$tt?GG>tP1^_[ÍEܒPQhR umܒPQhR WVgtGPVƒtGPVEtG PV4kWV[USWV[+t$|$tmGou"ܒPQhR* EmܒPQh$R qܒPQh%R Jo t6tXudGFGFܒPQh RZ uGFG3Fn<Fn* GFG F   ^_[]fS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffffìrS[|[v̀rS[ä|[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[|$l$uj~ȓPQj:R(t$tu9# ȓPQj;Ru7tiFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1USWV4[$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF/l$0PQjU!.UX$\9ȋ$QU$` FfNbQPR$`U$`-1Ʌ9$Fx$P$T)PURQw-*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LbQPR$`$`,l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$` ~$PEDL$kPQ|$W$`Uu+t;$Tg$P$T)D$D AP|$Wt$L$QR"+L$)D$D Pt$t$t$R*L$)D$D Pt$t$t$R*L$)D$D Pt$t$t$Rw*L$r)D$hD Pt$t$t$R>*L$9)D$/DPt$t$t$R*L$)D$DPt$t$t$W)19D$F$PED$1$1kD$ AD$D$׋D$ tD$ $ 1QPt$t$UI)H)D$>Ń19t$un 1f$PL$$T)fv fD$ #VQURt$(L$ ;$T$,T$0L$RQPW#t(8WĿ$\9vpD$0Pe;fǍ/$0PQhWC(Wz$\9v QW$` %1QW$` D$0P(eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@r8ߋ\$_TɔPQhcRF H1 t1덉\$$\$$\$D$1\$Pal$D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj6D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$dJT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$#D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$N$l$$L$ L$덄$Pj?L$1;Bu>T$L$T$Btۋ$NF\$$T$jT$ ߋ\$IjjP x Pȍ~8L$$Pj`D$1tuyxj%$PD$8($'L$8$)L$D$D$P$t$W7$(t$DD$tuD$uL$rL$$L$rI3|lj$$Pj$$W'tGo\$tP ؋\$$$!L$$$PRt$W6T$vu4D$ 8\$$ЋD$ D$87\$t$8MNDž}l$$D$ @xuD$ @Džu$9)ɔPQhuR/D$88tqGqjj$PQjV0BT$p$D$t$|$ +x|$ \$L$@HD$@tsFH;D$wjjPuT$P[fD$>P[fD$>Pz[ f|$fD$L$f"D$<|$h$!VWt$PQhR&|$$|$ u"I>PQhRn? NV@)19vt$ jvt$Ut$$VPL$ e L$T$e$19s/D$ (L$>@9rt$ 1)ƋD$ȃWVP^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [8|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWΨ ;D$uY ^_[]Í~vTPQhR茦ZvTPQhRbuXffSP[Pt$1Ƀ $ȃ[ÐUSWV$Yt$8D$D$ L$`1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RWjP耖 |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$Ws Pt$l$ Urs t l$ /D$D$<F\$hPW&s |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR>rT$ \$WjRvT$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rq E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$wqT$ L$E E$\$l$TU{/4$Uh$L$$9sD$DQG1ɉȃ0^_[]D$D\$蔓SV[ͤt$ u"ǙPQh/RVߑ^[ffffffUSWV|[xj$-1tGljPW*yt)l$XD$\|+W.Q W.1|^_[]jjWjjUjWX.t҃,_D$ l$<$D$ƅuUW뚐USWV [Ø|$$(rl$ NBCD3EB 3M t處1 ^_[]Ë|$,j<Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rLV]s@sщʉѺ u׋ $)jQWj3F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj2F4~F:F:t1F;pS[Πt$t$[ÐD$@ ÐSWV[ÜT$|$9W v#wG,ʃt$<u0 Ћ0茒L  )r;GvQD$Ot$1^_[ÐUSWV[t$,~$ED$\$Pv(t$Q 9quJi$违D$^D$4$٠t$mD$<$7L$HL$D$ l$sD$$$˰$`$ttl$$;%`t %)l$ $D$D$]t$L D$06vt"l$ $D$D$`]t$L D$0ut"l$ $D$D$ ]t$L D$0ut"l$ $D$D$\t$L D$0vut"l$ $D$D$\t$L D$06ut"l$ $D$D$`\t$L D$0tt"l$ $D$D$ \t$L D$0tt"l$ Ě$D$D$[t$L D$0vt$t"l$ Ț$D$D$[`tL|$4tUL$DL$ D$̚D$,$t(dƁ Ot yI umD$4$D$4L$@L$ D$՚l$$$莭虅Ɓ Ot yI umD$4$D$4L$u:Lu|uy1WPVf$ ^VNF*>06V.`&u7Ep^_[ÐSWV[|$uƁYjVW'u y/WPV# ^_[ÐUSWV4[Ȅ$D$0D$IuD$HL$j.QPjT$PQj.jRx$tEL$PQV"I D.0;D$0u 4^_[]"USWV([(t$L$-uAD$QD$ +tD$ +u AD$Q`x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX8~1D$`8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʋ$y&P>֍PQhRbЃ^_[]ÐUSWV[v}fD$|$D$ D$P0JlHHPPg0ppp RQWjV͉$r D$ƀe^_[]USWVP[zul$PU辁aPU要ޚPU莁UPUvPU^PUFPU.jPU$ 1uR`MDHt?fj PU蚖 f8u$8 L$A.&L$0t9^_[]ÐUSWVP[sl$0?PUtxF u6jPU" 1u[`MDHtHej PU肕 e8u $8 6D$t8^_[]fffffffSWV[ s|$t$jWDGHO~;G~ t H WR9jWF^_[ÐSWV[ÜrT$L$Bpr~ ;B~ t 2~: RQ؍^_[ÐSWV[Ir|$(D$$u$PD$D$D$D$ jWCG0u ǀD$PW7jWE^_[ffSWV[üqLaHt Jt @t A ?t/t5Gtmo hPt$Q藖[fUSWVP[ mT$L$I):t$ 4$ t$,t$,t$,t$,WUVt$$QP4^_[]ÐUSWVx+[ÀlE4D$E0D$ $p+E E$D$M,E(U\$t$,tI\$RP`M,\$ u+L$ED$ @ f PU0M4:tUׅt1QW_O\$M,wt!<\tt<.uwu)ր:|$tk9E\$VRt$(7U\$ L$ 1)D$ E0|$}4},1tqtk<.t t<2t[|$T$ `T$ D.BE0}4B9DD$ @ PU0}4D$|.|$T$ uT$ |$rx)D$D$E0 E4u!\$jt$jhVD$(\$1M0QU0E4A}4s[\D$E4D$ Cf U0}4D$u0}4WVuZ C)ljD$ s2\$L$jQjhRD$(D$ Ɖu0}4\$uuU$+PWQjdjV]9E4BPVu0`5 E49s)\$jQjhRE4M09U0)E49L$ u4U0D$T$t$\$w)D$D$ E0 E4u"\$jt$jhVD$\$E4M0QU0E4A~~}4s~ZD$E4D$E0A\$Af E4w-\$jQjhR\$E4M0QU0E4AE= U ME4u0} PVu,WA!A9AD$1))lj\$}$&#u E PQjdj$+W[9E4@PWu0<3 E49s%jQjhRE4M01U0)E41E4u0} MU }$"u UD$ E HM HL$HM xQ:ƃE t$ XV|$Wt$PQjdj$$+WZ 9E4?PWu0Z2 E49s%jQjhRE4M01U0)E41u;D$ !u E PZPL$ Qjdj$+W?Z9E4B?PWu01 E49s%jQjhRE4M01U0)E41u E P1Pt$ jdj$+WY9E4>PWu001 E49s%jQjhRE4M01U0)E41u gE PQjdj$+W4Y9E47>PWu00 E49s)\$jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$jQjhRE4M0QU0E4AD$դ`/}$D\$u M QU Qqu It$Ȥ\$QRPVjdj$ +PW\$ 9E4<P$ +Pu0./ E49s%jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-\$jQjhR\$E4M0QU0E4AդD$#M }4E0T$WP=;ХE }4;E0 E4u)\$jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E PL$ Qjdj$+WU9E4:PWu0W- E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+WcU9E4f:PWu0, E49s%jQjhRE4M01U0)E41E E P E Pt$ jdj$+WT9E49PWu0S, E49s)\$jQjhRE4M01U0)E41M AE  L$<%\$L$ L$L$L$*M01U0)E41E E |$\$7%Pt$jdj$+WS9E48ƃD$PWu0h+ E49s\$jt$jht$,D$(E4pE ;D$8}0L$ХT$T$ L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru CE PQjdj$+WR9E47PWu0) E49s)\$jQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$VPjdj$+WEQ9E4H6PWu0( E49s)\$jQjhRE4M01U0)E41|$\$E L$ L$L$L$*M01U0)E41E E D$\$O\$Pt$jdj$+WeP\$9E4d5PWu0' E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E PQjdj$+WO9E44PWu0' E49s)\$jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0 E49s)\$jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$jQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$)PQjdj$+P;F9E4:+Ƌ\$P$ +Pu0 E49s)\$jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$BD$Q|$XWu u$E? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ L$L$$+р਀tsRPt$ jdjVdD9E4g)PQu0 E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$|$X\$PVQj2jWC\$9E4(PWu0  E49s%jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$jQjhRE4M0QU0E4AE MU \$VWu,P}$E PL$ Qjdj$+W}A9E4&PWu0 E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+WA9E4&PWu0y E49s)\$jQjhRE4M01U0)E41E E ;D$%L$T$T$ T$L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+W!@9E4$%PWu0 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-\$jQjhR\$E4M0QU0E4Au wE PZPL$ Qjdj$+W*?9E4-$PWu0 E49s%jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0 E49s%jQjhRE4M01U0)E41u RE E P=E E P(E PWVQjdj$ +P=}$u E E PE E PE T$XPWVQj2jR=9E4"PWu0 E49s%jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W9E4!PWu0j E49s)\$jQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0  E49d\$jQjhRE461D$E4D$W\$L$D$L$L$L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$\$9E4Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0  E491\$jt$ jht$(D$(E4  L$D$L$L$L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$N\$9E4mPt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0v  E49-\$jt$ jht$(D$(E4\$I/}4E0)E4u)\$jQjhRE4M0QU0E4AC}$n }$bPL$ Qjdj$+W 19E4PWu0 E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0 E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0 E49s)\$jQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$jQjhRE4M0QU0E4A [g}4+E0-E4u)\$jQjhRE4M0QU0E4A}3}4E0 E4u)\$jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7$+t$$ +f@======2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +rz4|$7$+Rt$$+2|$7$+2z4|$7$ +r|$7$ +Rt$$ +DŽ$ +====2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +Rt$V$ +Ƅ$+=fDŽ$ +==2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +Rt$$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$ \$9E4(Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu01 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$٤\$jPjdj$+P(\$9E4 P$ +P|$ \$ D$D$D$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$*9E4M Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0V E495\$jt$ jht$(D$(E4|$ D$f E4w)\$jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u E M4 U0B  ru0M4B\$QVPb"  ƋM49s)\$jQjhRE4M0L$M0)D$E4z|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P袨PQjdj$+W6%9E49 PWu0 E49s)\$jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj}0WcƋE49s,\$jQjhRE4}0}0)E4E \$u4u0Pj薇}0WƋE49s,\$jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$jQjhRE4M0QU0E4AD$դw|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0s E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u uE M4MU0B  ru0M4B\$QVP (ƋM49s)\$jQjhRE4M0L$M0)D$E4|$t)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u ȮE M4U0B  ru0M4B\$QVP  {ƋM49s)\$jQjhRE4M0L$M0)D$E4|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u E M4U0B  ru0M4B\$QVP[ ƋE49s)\$jQjhRE4M0M0)E4sf )E4w)\$jQjhRE4M0QU0E4AE4D$E0D$|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$D$,;$p+u ȍe^_[]Ë\$USWV [&t$,|$(D$ .ʋ7l$Ut$Vt$40RQ‹L$$7>tVt2$QW)$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>sGD$D$s@(D$ 9s$jQjhR)))y"PQhR ^_[]1))lj$USWV Չ $[S$T$8D$4 D$L$D$"u$jQjhR|$4QA$93<$779$xD$D$D$ D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$jQjhRMQUA+<$-ynD$4L$D$ ^_[]ffffY"T$4D$#ѠѤÐUSWV[!|$ l$t$~Jt$~2UVAx(ƃ|$tލF9wȉ9v(+t$^_[]ÐUSWVP[J!|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }(^_[]E ffGftC,$RW'xǃ9w,$)xD$ hHGftf,$RWՠf 8 9Xσ95,$)5|$ oGwtc,$RWc 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.a ^_[]Ð~34$U蟞x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0QuuÝ]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[8|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$. ^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v k (+l$xD$$h,h,L$ H(ŋT$0PhRQuu۩U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0] (LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X\$1ɐ\ \\ \\ \\ 9u΅t1Ґ9uT$r;t$@L$\$Љ\$0 $ L$L$L$|$ |$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄S|$ t;|$$sF* $D$  8t(y" PQhZR^_[]Í PQhR`|$ L_ PQhR3%ED$Urt$mu-T$ҋt$ tT$Di@tRjuYt$ tDi@D* ;|$$L$ <9=jfffffffUSWV[D$$L$1w,|$ u kU0fϦPUWVt$(t$(QR+ gXL$u ÐXoL$w,1USWV[H|$0t$,1>0N xN|$|$4~D$ `D$lj<wsGuL1Fщ$T$T$$l$TUT$t& $LQщ$T$,$TjT$$D$1պ r $?TWT$T$Dz$ʍF$и rL$ʋD$T$ <$tpD$ЉT$ ;T$4O*g"PQj>R[2"PQj?R7D$ ^_[]ÉUSWVP[:t$ 6ǃ|$u2APQjgRaD$u f0x=|V4$~b1 9tJ|$,00r7 $ r7zB؃u9}B.벉$^_[]fX_s ÐS[>s ht$ P> [ffffÐ1ÐXu ffffffUSWVX[l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMne L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ e T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ e |$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p` txҋ9|Wy>TWPڋD$+D$py8ffffUSWV[ë l$Uƃ;D$v(`|$UW[1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[ $$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]ffSVP[l L$t$D$T$ $xRQVPAx9rRQP艩 ^[USWV[ |$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[Û |$t$l$tt$$PW%t^_[]VW t W LJWVUF ͐SWV[ t$|$jW1Ƀ PVW ^_[ÐUSWV[ |$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[\ t$t5|$r#u#jV#tjV$F1?^_[S[D$tL$ ttu H1[[ÐSWV[ìt$t_|$G?wSd>1RjV"t3jVU# tۃtjV"t jV/#e^_[ÐSWV[t$tAjVq"t2|$jV"wsf~ 1^_[ffS[îL$T$ pP[ÐUSWVT$0L$@[huD$\VD$ P譲ǃ\$D$t62=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$l$d$`$\$D$D$D$\$$|$,Vt$8PQRWiǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\z$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$t$,PVD D$,\$هPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$QPQjfRSV[]t$t$ u1 ^[ÐUSWVZt$0~: $D$D$D$D$D$ D$1$ ك˃>ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[î|$   >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[D$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[t$ >t0Vs 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[^D$ L$t9u[ÍaPQjpRS[D$ #L$t9u[ÍaPQjpRtD$t&L$tu1u 1tÐS[~L$ D$Qss)ǀ[Ãuu ǀ[ÍaPQjpRS[D$tL$ t 1[[ffUSWV[j 1tQ@@jjPf (8t(W(^_[]ÐSWVP[K|$u ˨PQjZR|OGQ9u0$jQP)f 08t  G $GT$pw1^_[ÐSWV[ìt$tRtC|$t3~t-0~r4;~rPV^_[ÐUSWVP[:t$u" ˨PQhRhF$t(.1tt$Vt 9<$u1^_[]ÐUSWVP[úT$J $Ћ*1|t$Wt94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|jVæjjV f jV跨^[ÐS[îD$ t$QPt$3[fffUSWV[{|$$Ƌ|$u"qRPQhRD$F t2t$$t$$t$$PV_ŋD$t V4t$$t$$t$$PV-V 1^_[]ÐUSWV,[ã$HD$$(u&qKՍRPQhBR蹿$Pt t$;$Lvt$;$L$DT$ Ph j.W9l$u D$(hPW$LWtNj$L`0<$DFŨtV$tCu<.uA$t)DNu.t"/1x.u<:t*uj:t$y$Tu<:uV$tC$u.lNu:t.uuـx.$P$DD$D$D$T$ L$$<$W}lb3t$ PWQRVUD$4P/z 1t$$P$D$P|$,$֋$DL$HA$Hу$P$DBT$B D$$HB)r[t$t$VUt$o# ~n$DA0A@$H$HU{T$)‹$Ps<1t$;$(uq,^_[]Ë$PՉT$PUVM $D7$H$@@ tt$$HV $P_nSWV[|$$Xt/ƋT$L$Wt$$t$$t$$PV|1^_[ÐUSWV[hl$8|$0u" qRPQhR蒻L$4uRuM?u!Wր1?u5u/ -t/9uqD$DT$@t$vy uy Pn<t&D$j.PWV$"tl$t,$y D$PUuL$QRPD$PWUk< $t!Q l$|$TG )|$TW4$ֶl$tNjM;L$ l$D$9r\$VpDfD$BFP_DǍFPQD΃ 931fT$Bf"D$+<|$l$H\$h$+Pt$Wt$uYt$Dc=9ƋD$L$0)9%\$Qt$HPe D$$LΉD$ꋄ$H@ tՍT$\$t$0D$D$l$ )ՃL$0)9sыt$FF\$URP趃 Vؤl$l$$T$<)ƒ\$0)19s>Q覤聩1$X;$(uH,^_[]Ë$LiRPU/ 1ɋ$L뽉&F|$;\$_U蚥USWVT[Ŷ$h>L$u&ՍRPQh^RWt1T$ T$G j(¸RD$D$ D$$D$7$1ɉ|$ D$ L$Pt$ Vaǃt$Vt$  t5ꐐ< t쐐D$D$ t$h < t< t򍃴PW5at1ɀ8 L$ D$1ɉL$L$ t WPYtT$$9s9ȉ86(Pt$T$$跜 D$ + $$ȍQ8D$H|$|$ D$Ɛ wxL$ $l$9r4T$(PL$Q&s l$T$+$‰$2t$ V`AƃL$sD$!D$$D$#D$ #$hL$$h|$ ?$nL$<)N)‹D$ L$HJL$)T$L$ωx|$t$tjD$B 19wz $PQW~ L$ A<0A )Ń9t$uыT$ B#PbL$$h|$ :ȋL$D$Pn^ƃ)s4$h$P/F 1T^_[]ËD$D$Vt$ W~ D$ 8|$tsD$D$wD$1ɐ$L$D$P]ƃ)ZVt$Wa~ D$ @L$<9L$ut$ FL$4$X8$h$hL$USWV [رt$(|$ u"ʪ;RPQh R.vy uy P#y t$tؗ˗$U\L$QRPUVW# $tQy|$ G .T$|$ W74$GuǸ ^_[]ÐUSWV[˰t$|$l$4y y Ph@QRUWV#^_[]ÐSV[}t$ 4y y Ph@QRV^[ÐUSWV[;{4Ģt6ƋT$L$y y Wh@PUVLV1^_[]ÐSWV[̯ u P tXǃy ǃy ǃy ǃy ǃy y 3y Ph@QWV^_[31퐐USWV։[$tt<|$0t^pRPQh`R<učpRPQhaR|$0upRPQhbR! GG ?.D$ D$R$D$t$JD$FFD$F t$..L$0))9|h)ƃ1t u/t$ t$hMt$ D$ D$ gt$t$hNt$ ϙE^_[]fffUSWV4[Hl$PD$0|$LuPQjIRjt$Ht*tIL$L;L$0PQjJRut$Lu"PQhR|$u"PQhRD$,D$(D$$D$ 1ɄE<:u~:7t$LL$ $t$ ~D$+L$81X|$.uQ$rD$09wCL$ V1ɅL.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0u ȃ4^_[]QHUSWV։[ĩ_~`LZu 1^_[]É4$t$0t$u'_ t E<)׋$$x`<$1L$D$ D$}T$uUm$T$E ulD$;tM 貑E=t܉t$L$0QP=tt$ T$ u#D$8=u$ELM D$|$uIt$MtȍL$0QPsL$t$6$D$$ʉD$|$ T$,t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$$D$ u?tUPuTE)΋M0E0D$D$ L$$tCE<)‰T$Ή4$MuT$$M8t$ ))ʉT$M< $+4$T$uED$ ))t$$M $D$ E L$,T$+T$T$($2T$9T$}oD$ L$(ȉE)΋L$$T$ y*sPQhR։D$uE@9tR蠊D$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQDD$e ߋD$)D$U讋u E;D$U4htjUpĬ^_[]Wt$t$$uT$ !ƒtˋE0tU@9t Q诉E0EEEe jU=p1뙋t$u)y'ȬsPQhRlE)EfffffffUSWV [t$@|$4\$uM>FD$FD$jt$8m1D$ D$t$<\$tj D$Pt$< ŅD$\$1Ʌtr|$~l\$ +tX9\$8utAp9r:1Ґ8uʃ9s뾐u.1%)D$ L$ÊD$t$t@uHFWVP=EtPQhRu뙸FWV1^_[ÐSWV[||$t$tCu"tPQhR袀t>t@uHFWVP=EtPQhRcu뙸FWV1^_[ÐUSWVP[ړ|$l$tRu"%tPQhREt`tBuU$EQUPAEtPQhRu늋EQUt$1^_[]ÐUSWVP[|$l$tRu"#tPQh&R@Et`tBuU$EQUPAEtPQh%R~u늋EQUt$1^_[]ÐUSWVP[Z|$l$tSu"N5tPQhFR~EtctCuX$EQUPCE5tPQhER1~u뉋EQUt $f1^_[]ÐUSWVP[Ú|$l$tSu"M@tPQheR}EtctCuX$EQUPCE@tPQhdRq}u뉋EQUt $f1^_[]ÐUSWVP[ڐ|$l$tSu"wYtPQhR}EtctCuX$EQUPCEYtPQhR|u뉋EQUt $f1^_[]ÐUSWVP[|$l$tSu"uftPQhR@|EtctCuX$EQUPCEftPQhR{u뉋EQUt $f1^_[]ÐUSWVP[Zt$|$txu"PtPQhR{u&E͍tPQhRU{tJt]uaGQWtQ $CEtPQhR {ua $G͉QWPt 1^_[]ÐUSWVP[jt$|$txu"PtPQhRzu&E͍ϭtPQhReztJt]uaGQWtQ $CEtPQhRzua $G͉QWPt 1^_[]ÐUSWVP[z|$l$tXu"mtPQhRyEtltHua1?$EQUPGEtPQhRLyu넋EQUt 1<$1^_[]ÐUSWVP[ê|$l$tRu"tPQh RxEt`tBuU$EQUPAEtPQhRxu늋EQUt$1^_[]ÐUSWV[|$T$u&E֍tPQh*RxL$u*PՍtPQh0RwL$(t )ŋt1tXuQBWQRP t?t=G UQWP%BWQRP ttGPUQWP 1^_[]ÐUSWV [t$$l$ u"EtPQh^Rw|$(tTtv6EEEL$QU/D$ȮtPQh_RvuԮtPQh`RnvcEϭtPQhRGvKڭϭtPQhRv$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$Uj ǀ|$tB}um먐SWV[̀|$t$tt4WV^_[ÍEtPQhRlu̍\tPQhRl먐SWV[L|$t$tt4WVJ^_[ÍEtPQhRdlu̍[tPQhR>lffffSV[t$t$Vt$t$t$~>.u^[ÐS[Ît$t$t$t$t$J[ÐSV[]t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[>|t$ t$ [ÐS[|D$t$ P[ÐS[{t$[ÐS[{t$Z[ffY{ ÐX{L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX{$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$iPQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$Tw;t$b\Gn߃^rxo;l$1\,, $*@wkdT$Ɖ*t$i $*@wi (Ћ4$@Wm;|$Yȃ|$ U(!Ћ$iPQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$i(^_[]Ë$iᐐS[Þwjt$t$t$[ÐUSWV([hw|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ B_0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[eL$T$ pPt$ [ÐUSWVT$[âeɉ$u&c$PQj?RQ\$t$4|$ |$0t;D$0|$ "v+vW1T$$VP^Fu+t-u#D$D$t$0tDD$t$0u20u- cL$T$ t$t$n[ffffUSWV[c$$$$DŽ$DŽ$$jP$8jPDŽ$PDŽ$TDŽ$XDŽ$l$`$pDŽ$hDŽ$t$`$W$P~$`;$uVļ^_[]ÍoPQjFR?NPQjGRN+S[Þapt$t$Pt$k[ÐSVP[laD$L$T$t$4$VRQP5^[ÐSVP[,aD$L$T$$pRQVP^[ffffffUSWV[`D$|$(u#5PQj@RMD$,2|$ '8u D$ L$(A0u ǀy$2l$(WuPn, E})Elj4$|$t$(VO~6Wt$(Vg, t)T $΋T$rwxsD$D$ ;0srnEt%  ȉ  ȉ ŃU2EGtL$L$ )l$( $Q(D$(H @^_[]F @4$utD$t0ِUSWV[+_t$l$|$ jW0WUVt$ jW2^_[]fffSWV[^H 8tflPQ=ȹ Džu:jY;t.Pȹ GGG ^_[ÐS[N^,ȹ PQ[fffffSWV[^t$|$4PWV0 ^_[ffUSWV[]l$|$NCPQVu t"t$UVz UVjjP"WbEPQVzu ^_[]fUSWV<[e]$T$PE$8tt6FNtO,$iGPQh~ReIuʍGPQhR?I릍 @QPD0,$NolȃFFD$$D$$Vjй ̹ Pj1Ʌ,$t$ D$D$D$ D$P_D$\Ǎ@t$8jWPhV3p=hVND$t}ƍMPVNtGL$T$RQWЃ D$ t2L$t*tBܮRjQPD-,$V D$;̫t P}ND$̹ й u QPBtjй t$|$|$|$ |$|$l$l| |$||$|4й ,$t̹ t$ jQP1Ct$HD$t*L$tt$t$уD$;̫t PME;$8u ȁ<^_[]S[^ZD$ L$01f[ÐUSWV[(Zt$,u"GPQhRVFNt$/kRQPW\o~1bD$D$ .D$D$װD$ǰ$"t$n;~F4UnFDtt$nFDtu&u8tMt$ nFDt4$nFDtt$jnFDXt$OnGj `m^_[]ÐUSWV[ÛX|$tVԹ tx11ع t5D$0dԹ 9rЋع uS3GPQhRtDԹ u1ɋع I `QP?t6Թ Il$u}ml|4Թ tع e`<.D5t?ot(1t PD9tGGPDGT$JRWO1^_[]ÐUSWV\[8Wt$||$xu"GPQh`RcC$|$x,$HD$8ƉD$WW i9t uD$tL$HD$ D$ W 9$ GPQhaRB0/GPQhbRZB@ܹ Hܹ u(!D$D$ D$ WjD$PD$xD$Թ tQj Pع AD$HL$L t$t$Ĕ^_[]ÐS[NQD$ L$01][ÐSWV[Q|$t$wv5u 76N]^_[fff̀rS[P|[USWV[øP|$ B$D$l$$pt$L$T$(PVUWt$<t9tB $)BT rB"1^_[]USWV[(P|$ t$@B$D$l$$D$T$(t$0PUWt$ $@ D$ 9 D$DD$D$\$8t$D$q P$j V8[$9jS9uBD$\$Lt$D$q P$j VZ$99u$@L$ \$ف`t$DPQ$j VjZ$99urD$\$Lt$D$qP$j VY$91#9u$H*R )tȋL$ \$فLt$DPQ$j VzY$99u$@L$ \$ف8t$DPQ$j V Y$9<#9u$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$t$.RPQjVW$99u$9 9$Htȋ\$mt$DPQ$j VWW$9s9ub\$aL$$$Wt$ $ƒ(\$mt$D$qP$j VV$99uD$DD$D$DL$\$$PWt$ $8‹L$Dtȋ$;d$V$$xQkd)Ѝ4 kd(d6$z D$D ljNj\$Pt$6!ƒ $\$މǍD$DP!ƒ)tL$D8$9O 39u"$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$PQ\$щkd)Ët$ Qkd)i{kd)Ɖfd\$L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$t$DRP$j VR$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $t$DRP$j VR $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $|$DRP$j WP $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$t$DRP$j V?P$9qc9uRHx1t$DQP$j VO$99u $L$ 1t$DQP$j VO$99u $\$1ƍ|$DVP$j W$O$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u7G5\$]\$$,L$ $<$,\$t9u4$<$Ήƺųʉ kdk<)΍\$tVP$j t$TVM$$99u<$D$ ;D$pu t^_[]Ë\$IUSWV [ø8t$ X$Pb8*D$D$l$$pt$׋T$(PVUWt$<t9tk*L$)\*T O*"1$P> ^_[]ÐUSWV [7t$ X$P 8)D$D$l$$D$T$(t$0PUVt$<t9t)L$))T )"1$P ^_[]fffUSWV[87L$A~?\$T$ $uD11$\$t9hF9u9lFdVu )1^_[]ÉÃ|F11 9tu9u EdVu9u܋EdVUSWV[x6D$H~>\$T$  $uFø1$t;hF9u;dF\$uO(^_[]ÃÍxF1 9tn9uF.9uFߐSV[ý5V1 V^[USWV [Æ5$ ɉ$tEW1=$L$( ~7$, $WPX$uD$( uhZƋ$$ tDytkf|$~, hWP{N $ tǃ %V҉t$>.hFs/.lFƁdV$t">-00t!t$t.J"1ɋD$+(dF$ >-00uʅV~{<1\FOs*7ƁdV$t&>-00t!t$t,J1+O >-00uѻ D$( ^_[]ÐS[.3lP[|SV[2VlPg=V^[ÐSWV[ü2hZqƅt#T$#tV$81^_[ÐUSWVP[h2t@Հ:jt;ǀ}:ju1ɉjDžF $1퐐9}x.dVPNŃ=~߿TFFF fFdždFƆhFdžlFfdžpFdždVUTC><$~81퍻 9,$t".dVjEPW uƄ.dV_1^_[]ÐS[1t$W[ÐS[0t$jt$t$[ÐUSWV8^0M y|$,\$(Utlzt$ \$tBD$J9ÉL$ȋL$|zBtvL9\ }jJBD$9ˉD$|$L$=)؋L$C1҉u S,1҃l dVH(NtmL$;JJ|X1Ƀ|I9}%4}t$;tt}؉9|ۃU >׋2dFL$(\$ uW+7hFH 7lFdVP(}uMdF1+ [֋R+D Lt$ jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹\$΁€Y`;|$|$|ЉD$ L$$;D$|URut]9D U}\$ _ 1{H(nD$ \$ uuPR3tPL$;NL$NH}+L$T$1ֺHtt$΋|$׉11pu‰Ѝe^_[]SWV[Ü-t$W豾lP PjV$ Wx^_[ÐUSWV[+-t$l$W<lPcUjV$ W ^_[]ÐUSWV[û,|$t$U̽, uLhZP  t*Ǎj tjƃ, |$Un1W [(t tdVH(^_[]ÐSV[+t$L$t$ (t) t dVu tH(^[ÐS[Þ+ Pt$ [ÐUSWV[k+l$|$V|, uLhZ t*ōj tjbƃ, l$V P 't) t dVu tH(^_[]USWV[Û*l$|$V謻, uLhZ0 t*ōj tjƃ, l$VNt$ 8&t) t dVu tH(^_[]ÐUSWV[)t$D$t ,jPyU˺, uHhZO t*Ǎj tjƃ, Uqj ^_[]ÐUSWV[)t$U0lPW$ t ,jPsU, uHhZ~ t*ǍjFtjƃ, U蠹j 8ƉU{^_[]ÐS[.(L$ D$tA QP9[ÐS['D$t@ P[ÐUSWV['t$tF |$UѸ, uLhZU t*Ǎjtjƃ, |$UsW ^_[]ÐUSWV(['D$ $$AΉT$y |F D$ D$l$jP$HP$HW *|$t ֋|$ ωjD$P$HV)ʼnր|$t |$ |$O $<G~΍$$PjQ GL$>D$Hm~{ р$u7lF7dV-00tƄ$T$L$T$뮽8D$ ;$$R(^_[]Ã|$1L$D$;D$D$D$$<hFT$9ʉudFD$1t$9|$tT<$hF9tT$dFT$+1F T$jD$P$HPU(|$uqT$jD$P$H$H'|$uGD$$<dFL$ +t$1Ƀ~ N DTʼn֋|$ SWV,[$|$<$GD$GD$G D$ GD$GD$G D$ G$D$$D$jP|$x ,^_[ÐSWVT$D$t$>O<4lX~;F~^|1ɉ)^_[ÐUSWVP[J#$P`( ulP~l$|$$ tABR lX~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lX鐐~;YQq|1L$4$lX됐~;Cs{|61\$()l$$9}aD$L$ 4$lX1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lXL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[ U( ulP,|$t$$ tWVP ƉU蛱^_[]ÐUSWV`׉[D h/tfGt>:t!>/u(8y >:u߃>/VTD$?=/9 Enfo/E oneiEre/zE/shaE/usrEh/VP\9 j.V j.Pt49tx/ux.uHt/uщjV:jVШhUPw +"yAL$VuhD$0VcHE,D$8E-D$XlFD$TdVD$@lXD$2T$t$ r$t$\Ƌt$,t$ D$ ‹T$ v A,9D$0D$( D$tIL$8 $t$$)ЋL$0h/L$4QRUl6|$' D$,t9D$4t9yD$ $Ppx \$1D$XT$1t$884$D$L\T$փL$9l$ D$4$u0v J ryrjɉv J r J r J y Ë4$F 4$D$Ƅ(>t5t T9Ή9ED$Ƅ(>1|$ \$l$~{9T$ |$$>̀<t $> $OL$ mw9}+L$ U91t$81|$ t$ l$$G|$ D$Tʃ~ ׉v zy  pM|$+@uO 9l$0D$ uO 1҅4$Qȃ1rUD$ ̓1D$4$>8dVT>8eVT>8fVT>8gV9u4$l$D$ t/|$@14$./9ul$|$ 1 |$4$1ƄfVfDŽdVD$D\$1ҋD$T> \> L>y ˁ ˋ$D$ L$|$(9l$ 999T$D\$l$|$4$GL$P t|$,t<$wX<$مt$jL$LU|$4t<$w<$D$UD$`^_[]Ë\$l$|$tL$0} |) D$x|D Mt$Z\$D$x D$ l$D$D$1D$0D$$;D$ l$$ (|L$|Łt+~#1D$@\$UPt9u\$U΃1wD$dVUP4!D$8D$D$D$ PD$l$D$ 9D$\$JD$x @$|9$D$>:>uPJ߃ $$l$!|$OD$1$$;T$$(Y Il$__aG|$\$#1|$t$L$T$„1v~\${z\$3pFz\$3lFzZl$5hF\$3dFt$v~\${z \$3pFz\$3lF:Zl$5hF\$3dFt$ 9[D$\$l$tKt$NQVpF|lFtxhFdFD$x1 USWV։XD$tW<€Ѐ r<r Au)E=T$0\$V1Ʌ|$H$D$$D$(tcD$O~D TT$D$ IdXdX\$QWR D$T$(S]D$Nj\$jtD$D$D$D$~@XXL$\XD$$E$fF t><J1АP>FF11+D$0dFƆhFdžlFfdžpFdžtFƆxFdž|FfdžF$D$(F dV\$Ut$LPf Ƅ.dVeV\$Wt$,V: >АʀЀ rՀr HuNjT$()ʉ|$DOt,t ;`L$0L$L|$H|$u L$8tD$DD$@t$H<;t<,-T$($\$8,T$l\$8FdFD$XD$0D$`؉dFƆhFdžlFfdžpFtFD$TD$LD$\؉tFƆxF$|FfdžF11ɿQ<$t1:׉ډkd)в=uiǐ)$‹T$ip+9T$L$} $Yy։k1։|$ T$L$hF9L$$uD$L$D$ 9T$dύ$t$`MƉT$lt$\9|$t$Pt1+i)\P(\t$Pw  ףɋT$iQ9D$#|D$,‰t$,<$L$h|t$,)9(T$ T$8t$<|$ $T $t<$p;T$t$|;D$Pt$>>t$D$ L$,L$8D$$t$D$ L$D$ T$h‰T$8D$</T$,|$ uȋL$,;L$T$$CD$d:D$01+dFL$D$0|$$~zD$1 9T$$te>hF>qFu%D$+D$|$DߋD$tt$hF8t1+dFD$뒋D$؉dFƆhFdžlFfdžpF1+D$LtFƆxF$|FfdžFF|$DD$@FL$$Fu6L$TA T$XB ABIJFD$@!t$~L$+L$4D$@|fF|$DVUSWVՉ[ç  +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍø1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށƬ1i4Q9uB ^_[]ÐUSWV0T$ $XD$T$Dt14@lX~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ 麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$g)jhUt$ QT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$L$D$|$s؉D$͉)пjjUt$fD$(|$\$jhUt$DL$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPy)jhUt$cU\$T1ڽT$\$jjdUR$)jhUt$t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ°1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$8XD$UyqY QT$QT$ Q T$0L$XI$L$}tMt$$xq*ƉѺʉkĉȋt$$D$|$(xѺωt$$ppD$$xqVй*щp;D$x кUUUƒD$ p Ɓlq!\$oTe^_[]RT$)1T$D$ kčIT$(T$@)D$$1L$+FpnL$ 1ui)\P(\w ף1T$r$T$ ui)\PT$(\wD$= ף먹QkdD$ +|$ |$ iʐ)ʉ\$(|$|$ ʼn ō@L$+~'G\$( |D$FQqPƔt$ OD$<|$sD$<D$,2|$ ED$D$,;D$<D$,D$D$ƋD$l$|$Ft jP~n~ e1^_[]fUSWV[l$|$u|DPQjFRt$u#t|DPQjGR|$$u{e|DPQjHR1uN)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffUSWV[l$t$|$u"PQhR!U^_[]ÐUSWVP$[Õt$u"PQhR8 Ut,jtRx $Hp X X 19"l xuxt)txu8u뮾U^_[]ÃUSWV[8 D$ P]T X X $\ L$ L$ǐ|$$tD$$9G t GtOX  tGwЃ GЋX 9tX DžuZT u';|$r$;|$s<$$<$C<$1T t$ N~T u#t7Wu^_[]ÐSWV[\t$u"PQhR8 W}"l  xuxt&t xu8uju $p@@ X X 1WN}^_[ffUSWV[Å$$$t#ueXPQjPR$D$$DŽ$DŽ$$ jPp|$<jP}DŽ$TDŽ$XDŽ$\DŽ$ps1|$$d$t$l$x$d$$$P& $d7XPQjQR[T;$u ^_[]腊S[pt$t$Pt$t$G[ÐSWVP[D$L$T$t$ 4$pVRWQP ^_[ÐSWVP[ËD$L$T$t$ |$$<$WVRQP^_[ffffUSWV[Kt$}XjWE`HM`~;Ep~ t EXHMX WRqjW^_[]ÐSWV[L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[mD$ L$ $XQPR[ÐSVP[<D$L$T$$XRQPV0D^[fffffUSWV[|$$t$ |$(uK{PQj=R"t$t qTD$(H @1r<$tQt$udK{PQjQRj|$,W8G uy$‰Ņl1<$1qyQuE)ljuދl$$$)1t$ ōACAAAjQ˼Ջ)v1WPVӴ L$(9l$Q|uh}T$RPV蠴 L$(A)y-K{PQhRL$8A)AjQ6l$$jU%$+D$1t$ ʼn^_[]ffffSP[D$ L$T$$RQPK[ÐSVP[D$L$T$t$4$VRQPA^[fffffffUSWVP[Êt$|$u гPQj>RPV|1踯ht$t$ p x=|Pxq0fF FfFfn vF$F,F( F $tjjjV^_[]fSWV[Ü|$uNPQj;RjWRw jWN^_[ffSWV[<|$W藑;D$w+t$9w 9w9w 9wPWV ^_[{fffffSV[D$;D$wt$ Pt$Vi~ ^[<VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[Ô|[USWV[{t$uUPQj aV);F|V荮u?1FT$i.;Ft F t uVPu^_[]fffffUSWV[Ët$|$l$jU\pWVPUjUM^_[]ÐUSWV[0uMD$h$}$tkG0u ǀD$?u D$xG t $W賯t} ;ʴ$PQh3RM}\$fʴ$PQh4R}\$5G f ftE$u)$PQhRG\$$X$DŽ$lDŽ$p$tjP-q$jPqDŽ$DŽ$DŽ$$`h jP MA f$Af$A$A,$AD$$X$$DŽ$DŽ$DŽ$$Vuu WƅxWk1Ƀ ΋D$h$@M9I @9D$,ED$|$T$D$D$ D$D$`D$dD$XD$(1ɋu~1_t%t됐L$4)L$P8ى2J֋T$ L$)L$T$ rcUҍ$\$tV$D$PR˥\$ D$D$ thp9L$PTC$$PQhR\$UL$wD$ L8D$'Ƅ$/D$4D$0D$T$ |$4ƉِAσ s&1L$0ȁ1ҍ$X1 D$xT$|$t$8$u $\QwPƒ.D$ƒ;T$0v$D$8MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$0D$$xD$0|$\uƄ$/D$(t$P\$WrD$(L+D$L PD$L$W n|$ptD$'-D$D$\=\$4u#D$(8NT$ L$Lu]|$`o$mD$@T$ L$߃GD$DufЉڋL$dtL$0\$@|B9\$0|<)y1ɉL$0i|$`$$$D$8D$' L$0ӋT$L$Lt $0|$@Љڃ\$@م D$0tD$0ȉD$|$X|$@2|$XC9D$@9D$T1ҐT$H11ҀD$D$t\$@)D$‹D$HЉD$L$T\$@9$D$8D$%D$D$@D$HD$TD$D1)+$1 \$Ѻgfff)À0D$,L$ I<ϋD$, L$ IϋD$,L$ ID$,L$ IEHMPwEHMPEHMP1D$,L$ IEHMvEHM1D$ y1۸D$'-‰D$D$t$X1 D$t$u RjPj1Ƀ,EHMT$|$PH8T$T$ ϋD$,L$ IϋD$,L$ I D$,L$ I8EHMEHMEHM8EHMT$L$PT$T$ JEHM1qEHM1wEHM1:EHMD$D$H$QtO‹D$D$t1 $X׍D$tu $\Qt$ PRt W11ɉL$8L$(ɋU$|$0x<$|$0Wjt$@ |$\$4T$ tW+D$8L$0L$9GD$A$t$8uD$y"ʴPQh&R賶\$4T$ D$D$'1D$@D$HD$T1EHM1D$EHM1D$ 1GEHM8EHM1D$EHM1D$ D$EHM1aEHMD$ ɉyD$'-11D$sEHM0EHM7EHM811ҋL$t! t L$t D$$/D$ȉD$'|$0x% D$tRD$@ uT|$0uM$|$$|$@|$D$@D$?% T$0t9\$UρD$? ٍ$$t$XPWt$ t$PQ$|$\$uM$t=\$|$T$?T$D$$t$Xt$HWt$ Pt$0(.Ǎ$|$8)D$e!D$1D$@D$HD$TD$D$D|$0\$4T$ |$ ;|$D$|$'$/L$Lt)L$\$PD$D%D$\$4|$L$ \$׋$GÉ\$L$ [Uu/$$PQhRU\$ۋ|$.$D$PR諌D$D$ $0|$'sG >$B\$L$ rʋUu/$$PQhR^U\$1ۅt<$D$PR1ۃD$D$ $Xg1ɍ$E|$|$'u5|$|$'u D$ $|$'txD$'BL$ D$D$L$ rHUi$D$PR'D$D$ $t $/Ƅ$.0$.BL$ D$D$L$ rLU6e$D$PR蛊D$D$ $t|$OGL$ \$׋$(GÉ\$L$ <Eu/$$PQhRBE\$ۋ|$$L$QPΉD$D$ $2G K$(B\$L$ rʋUu/$$PQhR莯U\$1ۅt<$D$PR1ۃD$D$ $X1ɍ$E|$$$PQhRUD$hD$ $$/$$PQhR覮UD$D$ $|$D$ $D$ +D$L$ |$|$ljЋ]D$G $(BD$D$L$ r‰څu/$$PQhRǭUD$D$t=$D$PRS]D$D$ $P1ɍ$;T$ $(\$ T$ B|$lj|$L$ E$L$QP跆D$D$ $L$4D$0|$D$DD$8D$BD$ÉD$D$ D$ EL$4D$0D$Dus뚐F$$PQhR&EL$D$ $L$4D$0|$D$D)|$L׃UD$DD$8GT$ D$ÉD$T$ Uu3$$PQhRkL$DU\$D$ۋ|$ $D$PRD$D$ $L$4D$`B|$\I׋D$(L$dȉD$L+D$8L$@9ɋ]D$8OD$ȉD$L$ L$ څu/$$PQhR{UD$$D$PR ]D$D$ $vD$8$XD$x$Y$XG\$ L$L$\$ +u/$$PQhR轩UL$1ۅ~$D$PRK1ۃD$D$ $P$$PQhRHL$DE\$IL$M $؃L$GÉsT$D$`|$[D$0$(D$BЋT$ L$L$L$T$ Eu3$$PQhRHEL$L$|$C$L$QPсD$D$ 1D$$L$ "'1ND$щЉډÐT$$ 0\$T$T$|$D1ҿ;|$|$DڋT$rÃ|$@B<0:|$D0.D$LD$҉|$8^ $ 1ۍ$D$`1ɍ$D$8T$dBGLL$CD$ Eu/$$PQhR˦EL$D$ɋ|$tT$L$QPSD$D$ D$ $L$4t/D$L$ L$4|$D$ $L$4D$0+D$dуNj]ʋL$ D$G $(BL$D$D$ r‰څu/$$PQhR跥UL$1ɅtB$D$PRG]D$D$ D$$1ɅOD$$4D$`\$ ]ʋL$ ϋ $( B|$L$GD$ څu/$$PQhRUL$D$ɋ|$tU$D$PRh~D$D$ $D$`L$4t-D$D$`ˋL$4|$1ۍ$D$`L$4É\$ \$\$CD$ $0D$`BEu7$$PQhRL$DET$T$ |$ U $L$QP}D$D$ $L$45 ( D$ $|$@)L$ D$D$׋$(G|$lj|$L$ REu/$$PQhREL$$L$QP|D$D$ $ D$G 9$(BD$D$L$ r‰څu/$$PQhRWUD$D$t=$D$PR{]D$D$ $PK1ɍ$;D$ 1D$$D$ D$D D$0u ыT$ D$x|$ GD$D$JL$ rEu/$$PQhRaEL$$L$QPzD$D$ 1D$$kKD$XD$ $D$@D$8|$XT$ t0D$Tƒ|$H|$8D$L9wD$8D$X]D$D D$0T$ u1D$x$X$XBL$ D$D$L$ Zڅu/$$PQhR&UD$7$D$PRy]D$D$ $|$0 L$ |$|$|$8|$8T$D$TuD$XUD$?|$ GD$D$L$ ruu/$$PQhR^UD$tG$D$PRxD$D$ D$$t'i D$D$ D$1ɍ$D$L+D$8T$X9ÅۉD$8ZD$\$ ؉D$D$AD$ UҋD$u/$$PQhRvUD$tM$D$PR xD$D$ D$$\$ t-} 1$D$ D$1ɍ$\$ D$X8)׋$(G|$lj|$L$ NEu/$$PQhR舝EL$$L$QPwD$D$ 1D$$r D$G 7$(BD$D$L$ r‹Uu/$$PQhRƜUD$D$t:$D$PRRvD$D$ $R1ɍ$?D$D$ 1D$$T$ T$҃\$H)ӃT$T)‹D$X|$8ljЅ‰\$H<47|$0ߋ$jj RWkA )ˀ0$D$$ËD$XD$H(|$@ ߉ىËT$DML$ߋ$jj T$HRW谑T$D )ـ0|$OL$Y|$|$8|$tL$H t9ϋ|$@uу rL$L\$KL$HytL$H\$D$AD$ $|$0D$ 1D$$D$\x Ћ]T$ ߃]T$ D$G D$BD$D$L$ rljڅu/$$PQhRUD$D$t=$D$PRs]D$D$ $U1ɍ$@]T$ |$:B|$lj|$|$AD$ ryڅۋ|$0D$u/$$PQhRXUD$$D$PRr]D$D$ $t Y|$0|$\D$(L$d+D$8|$09DžD$8zD$D$L$ L$ rqڅu/$$PQhR藘UD$t=$D$PR+r]D$D$ $t1D$ $D$0)L$ |$|$D$G $(BD$D$L$ r‰څu/$$PQhR觗UD$D$t=$D$PR3q]D$D$ $P1ɍ$;׋$(G|$lj|$L$ rwE|$u/$$PQhREL$tB$L$QP|pD$D$ $L$4t*L$4|$L$4D$ $D$DT$ L$ |$T$ \$C D$$B|$L$ rċUu/$$PQhRU|$1t:$D$PRxoD$D$ $T1ɍ$A|$UuS0T$ Ӌ$Clj|$L$ UrҋL$4L$4u:$$PQhRL$DU|$$D$PRnL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZxt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PXwE|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $P<^_[]þUSWVP[èD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$"USWV [VD$ 069rljT$D$uj$jWPH >(79$T$JHJHJHJHJ H JH RPE$jWP ؉(щ8t!lj0t$ل贉0*)4$PjVՅ $L$D$ 81 ^_[]ffffUSWVP[3EET$@t$DT$$dpU }lj#jD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]CUSWV׉[wl$YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[cm|$hE t$p |$<$ MM$Uj#jl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjP )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]~ffffUSWV[E\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$]uNjD$L$ttW% ?L$@\$D$4\$#j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃4܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃8ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$dM |$ ؃<D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋@|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jadwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PeWD$P#dW`VD$P؋|$ |$(|$ |wD$0ufsD$\$t$WOe\$ Džjwc|$|$l\$WPe`؋L$1ҋD$DD$4D$RC_D$t/L$4t9t\$Q"_D$\$P_\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$+^T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$^eD$T$|$Z D$1e^_[]ÉL$D$4|$ \$D$0L$T$tWjt$`L$¸tQT$Rbu d$|$ \$T$~0vt@L$(t$$D$4|$0thjt$`¸ҋL$"QT$RaD$ |$9t$D$ 1|$ \$T$N|$9u@F9L$|$ \$T$@<9uF9uL$1nFd|$,D$|$ 0|$0t!|$9tD$ 1F|$ \$T$)|$ \$T$L$NfffffUSWV[||$ t$nD$.t>L$$t6 ruLQU1d$t?$L$Ui$1ynL$^_[]þT]n0ffffUSWV[|t$|$l$t?xxj'PQj5R;hu1 1 ^_[]fffVL$T$ tu1 ^Á1 ^fffffUSWV[@{M1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PKT\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<#j)B$tW\$R&SD$PVD$ ,RL$ )M ~D$$Pt$ VL$ P_T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃4܋܃$ۄ$܋҉t$$~@CM ~O$VSM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك,|$tT$L$؃8ݜ$$$$$݄$D|$@ػD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nك,D$!؃|$8=؋كDT$8؃<D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃D$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثv#T$u؋T$xvq|$D$D$ ؋@S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtK+D$HD$T$,‹|$LD$~$RQOt,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$Q2QT$|$t$$$Y|$D~RD$T$ L$$jjt$H D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PRNDž~#T$?؋L$؃T$$jj QG |$@c΋$jj t$G ‹D$8 |$Dt$$$/L$|$D$D$t$QfFD$ t.L$t9t$QFFD$$P6FT$%T$$1|$D$Ȁy0ItL$RFL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wDO L$O ‰D$ t$QR 7 jt$MM|$D$ D$$t$|$ W_D$,t$WnNt$ t$Nt$t$,k$jj PE ljD$ D$L$L$D$D$QPƉ|$Wt$ Mt$ t$GNt$,N0L$ x $tPrDL$(T$D:Pt$ MVIDT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PD D$D$ L$9$jj QD D$jj t$D NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VD D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$KL$ |$$F|$$t$t$ Z0D$ t$(Vt$bKt$t$z|$D$ jj QB D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPI\$ht$D$ PJugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ HD$I$t$t$ ID$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[ldD$1r 1 9vW=t8Ɖ^_[ÐSWV[ dD$1r 1 9vWK=t:L$T$8ƃXt𐐐Xut^_[ÐSV[}cD$ PHpR=^[USWV XHcT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RU5F|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[~aSVH[UaD$0hjPO D$(D$,DŽ$@DŽ$DD$ D$D$$jPjU L$(VPQj$fD$$D$ D$D$D$D$D$jPjQ jQjYQS[n`۵S[N`fffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffUSWV[k_t$|$uo8PQj?RK1t^jjt$t$t$t$[ffUS[^Mt6C$D$i@B)iD$jPp1e[]ffSWV [é]|$ t$uqPQj;RID$D$ <$L$jjPVjQ,1Ƀىȃ ^_[fffSWV[,]t$FN ue9rF;F|@FPh6tHNjFN PQR( V<7GHND^_[1L$AQ u9rÃÐUSWV[[\L$t$y9~}V6W5ƅt\ȉ1ɃFщNt2 V9w)yQhPMJ >t (h1^_[]ÐUSWV[à[}uuM[\$D$4PD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋt$(PV'T$4D$(هPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ D$p '3 |$4t$N  D$0P QVR| t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP/ 7T$t (hD$D$,BBD$8t$ D$PD$|$@D$(D$ D$ D$$\$F%Ƌ*D$)D$D$l$ ~H5T$ud1Xz $9EL$D$ȅɋl$ |$@T$V|$D$x8D$\$DL$tftYt?TrDJ؋$PVD$YFt D$$QVD$D$t$V|$|$t1L$D$FN ur9rF;F|CF$PeŋF U PQR V;EHND1$tD$ )D$ F$t19t%D$uFD$$jV}D$T$D$J)~"L$9ztMFl$HEP2J9/L$l$HE$ ."F1 O|D$u$QV=D$1 D$D$l$WVD$HFN $9rF;F|DFPNjFN PQR VtGHND[$>|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}%"P"L$D$ffffUSWVt$F98[ý* |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[)u }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[(t$D$T$<n~,D$9r9s#L$9w)QjP ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX(ǀܽ ǀ fǀ ǀ fǀ ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[&D$H~( 1u 9r1$PƉ^[fUSWV[{&L$H?t$P w t{ ?u1>PƅD$t/Fn?t$P裵FF ^_[]1?t$Px@4 )ʉʁ oΉ@oUSWV[{%t$tbF!r VOH}t3$W}F  tW˴  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[h$l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR] E!r&UyE!r\Uc1H}$$P蝲}T$,B ti4$u\H}th$$PS1}F  t14$-$ T$, D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[þ!j,tL$H@[ÐUSWV$[È!D$9| 9}T$P7P|$, $r0wD$PjR  $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU 9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[5$t|1A1 ƶPQjERHP$1jjU͟ ʼn$tƒ9tt)D$P$Rts#D$ =uXtZfx $tu f~ $fFvF$F,F( F -OĀ^_[]fffffS[t$t$jt$[fffffSWV[ì|$uiPQj=RjWbGHO~ H0 WjWC^_[ÐSV[-t$ u8PQjIR^FHN~ H VL^[fffUSWV[t$u{FPQj>Ratrt!w 11ҊNt\tGɍyw@ؐ+u˽뿁뷁 ՋL$) 1^_[]fSWV[|$f jWG0ǀǀ 1G t W ƋO twуy y wG0tW@9t QG0|G0ǀǀjW G GG:ǷPQj8R7f  ^_[f̀rS[ä|[SV[Ít$ uηPQj;RF0u ǀVuFH^[SWV[|$u@ PQjJRM8uGG Ⱦ uuL O @G0taW@9t QG0GG81t&WG GGfG u WG t'HVE\PV-GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐSV[Ýt$ uJ PQj;RF Ш u V1^[fSWV[Lt$t`1mT$ |$L$D$t#t8uӉ6@VRQWP@26@VRQWP}6@VRQWPL^_[ÐXL$|AA A AAAÐfffffUSWV[e$uthj1$džt.%u%D$PQ1t+8$u!8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF40 DhjP$ t;$PQ|$=|F P/$FEt$P$FV EtF4Et UMtЅBt N&tEu0 hVn VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFQj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC(1V(1^_[]14dž$j$tJpHHlH H H|HH 88oUSWVՉ[ôjq&lj1&NL$jP$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[94jQ@# t D81t>0HrPtot u8~)1 9}8tQ݋t PܐVt81^_[]ÐSWV[<|$tOWf^_[ÐSV[D$ p|$s t.jt$ 1dž,dž,^[S[ÎL$tAt[[ÐSV[MD$ p|$t_dž,1t$t$ ^[ÐSV[D$L$ qt dž,&t 1҃ƒt$t$^[dž,빐USWV[xL$(D$x)$xuLJ$LJ(LJ 11t f} t2nD$(tE9(G($19wJjjWQ}Ɖ鉅 hf}u A(9vA($9(LJ(u${]PQhR1(f|Eu;DEjVPWQ ƋhLJ(f}tf}LJ $m]PQhR1jAf|E@u(9LJ $LJ([LJ,^_[]Ë(L}w*jt$(t$(VRu‰w$ trT}t$t$ r|})ǁ$w<$_ t)׋t$ ~t$΋|$$7)ʉW $(15SWV[<|$tU^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[|$(o(o(OG0!D$;G9} $wD$D$ P5$L$L$D$QPt$ $L$QjP t$i$D$ Gjw $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wi ^_[]ÐSV[Ít$ t$t$ #F,;F(~#F0^[ÐSWV[F4aAQj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrUSWV[8D$ t$$|$ B~r?5PQjbRBF 7f.ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]fffffffUSWV[K|$oEtjPu' EjWuEtP0E EtPDžDžtPDžDžUWVt^_[]ÐUSWV[H|$0D$,pFtjP6! Ft>^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6q 6Y 1KfffffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fSV[D$;D$wt$ Pt$V) ^[ E9sލU,$D$)$hPT$ RQ$ $t#9<$v,$}/(9w$) $L$L$  D$D$$t%ht$WXP $t* $hW8踸1Ƀ89t$1퐋D$(j?Pt$輒 tWH0tȋL$):,T$D$19u^D$PW8uk9t$u?)/ED$PW7E/1Ʌ#D$$=@1ɷ1Ƀ8dfffSV[}D$;D$w.L$t$ 9w9w9w9wPQVb ^[dffUSWVT[(ED$PD$LD$HD$DD$@T$@P D$FD$FD$FD$FD$ F D$F$L$N|$ j@jD$P7 9tE;D$PuT^_[]ÍPTbUSWVx[HED$tĬtG\Vƅ@~ / 9E;D$tx^_[]ÍVSĬD$pD$lD$hD$dD$`D$\D$XD$TD$PD$LD$HD$DD$DL$T$dPb 1ɍT 08u y?u8|G\GGPQRQ GPQOTƃĬVRjHJǃ#j9J11$j"J<$jjjhjWjD5tjWP4 u WV41VaT?PQ%1j"`ϰUSWV[$E$ uD$|D$xD$tD$pL$0T$pP D$LFD$HFD$DFD$@FD$tD$ 9tUXD$L$$D$(0jVD$0j U(1^_[]ÐUSWV [öt$ T$r&|s PQhRӓT$fzfz~F l$$uBr?5PQjbR艓ftB׍Bs811br?5PQjbRG[1W)11lN.lN.lN.lN.9uمt# N1Ґ,Q.9uL$$DAfAfAl$$}E 4$uEr?5PQjbR舒ftH׍BsA11r?5PQjbRC1)11l$$lMt$$.t$$lNt$$.t$$lNt$$.t$$lNt$$.l$$9ut' M1Ґ,Qt$$.l$$9uL$$EDfAA A jQD$0h^_[]ÐUSWVP׉ $[l$D$fJfJ D D B uD5OP )fOfOɉEDDD5 L t5PQ#= D5tcju t$6ge twH jP6Bg 7E (D W)fWfW7PQR< ED7fGG G jWD$0f 1^_[]ø荒USWV4T$XD$ D$PL$(f\$r+\$ i PQh|R\$D$xr(\$ ?5PQjbR膏\$D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$D$f;D$f9u(D$t$Tf9L$I T$ T$LB4 t$4 L )\$LC T$ t փ L \$L$f9v>NL$TAʉT$T$LB4 t$4 D$f9w;L$,9D$$f9t7ŋT$HJ)fJfLBЃD$\$ Vt$P8:\$ r+\$ i PQhR貍\$9D$0g|$t(D$ tD$ Kf1D$A4-=r+\$ i PQhR2\$D$HfpT$(B(t>BL$;u3Bf9rfBt$f9s D$HBL$L J)fBff9|$vD$Pf)8D$LD$ދD$f91i\$\$L{ \$ Ńt$LF)fFfD^\$ QRP8 f9|$t$19t΋L$I T$ щt$\$\$L{ 4 L \$ VL$Tyʹ9\$\$L{ \$ 1/fy&\$ i PQhRdD$L$Lfif9uD$LfhD$4^_[]Ë\$ 莍fffffffUSWV[ø|$8D$,hEtjPua E l$wJrr GE(uI1G T$0:zD$PVtHUD$PV|$a$ML$fMjPu` juu^ t1BQ A8E,jjuc^ ?fpjWu#` jt$u"^ Džwr?5PQjbR:G or&?5PQjbRwD/DD$ l$?5PQjbR衈E,jju.] Ǎ?D$ l$wr5t$ PjbQ8G GtfAjWu^ jVu\ Džxl$:蕍E(Err/D$?5T$ PQjbRYD$$T$f9B$fD$},|$ f9{l$9aFjRu] jvu[ E‹npr?5׍PQjbR襆|$qbjWjWl$u] <$wr?5PQjbR3ft$><$fD$l$.E(uEft,$fD$$E($EfD$1OH$fD$u,9 GjRu=\ jwu=Z ftB :$f|$wrjRu[ jVuY 1rjRu[ tYjVuY `@=r'Ǎ?5֍PQjbRjR*|$B uSfiDBtjR7 [ jV7 Y 1ul$$fl$1l$?D$5D$ B fyDBtjRu}Z jVuX t3xrt$t$jbP蟃{$8t$EtP^E EE($}fu E(jQt$  OfL$$Ɖl$;tjVuX 7GfD$Gft$fD$t $A4 ;tjt$unX $@jPujV :ʼnpr?5PQjbR老fw,$l$fwWt$U) t$l$whr?5PQjbRf9u>pjPl$uW tljVuU fGOT$,‹OJ3t$ $;tjQu:W D$,0L$fHL$fH1^_[]Ë$;ujVD$0V ҸffffUSWV0[ӓu~,jj6T &|$ NL$eL$A }HʋfqDBtjR7PV jV7ST L$D$xr?5PQjbRc1fut$ t$ jt$$t$$t$$t$$t$$0% [fffffS[Ȭt$t$t$Ѓ [fffffYόD$X PT PP PL PH P D P@ P< @(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^؋L$<A$iA D$AQT$QT$IL$1t$$\ l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjP(v F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPu <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVt^_[]ÐY_D$x Pt Pp Pl Ph P d P` P\ @(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[nt$t$t$ [ÐS[>t$ t$ F[ÐS[L$T$ j[ÐSV[t$ tA| j@PVP FPhjP(s F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8 D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPAi FP3nPtPWjPi UVj~jUi FPNHVLN@VDPV^_[]ÐSV[Mzt$ tA< j@PVKF FPhjPh F@FDFHFL^[ÐS[yt$t$t$ [ÐS[þyt$ t$ [ÐSWV[Üyt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVkg ^_[fffffffT$D$fSVP[xD$L$t$$hjjjRQP  $^[ffffffUSWV[pxMD$$&yd| Ḱ ~? gL$6 \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <H 1D$D$ D$D$L$8T$jjPQjRatD$8H D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$ûFL$һL$L$L$IhjjjPQRD$L$8T$jjPQt$RL$81 u!jP) _UiK1D:0D$D$D$ D$L$8T$jjPQjR`t$8|$<QPWVID$D$D$ D$L$8T$jjPQjRD$XL$ L$#hjjjPQRM uMD$D$ D$L$8T$jjPQt$RtD$8ce^_[]fffffS[nq [ÐUSWV$[Hql$8D$D$D$D$ L$D$QPj ̬$P1t3P t!jMDžu t$<$*L ol$jVjA $^_[]Ë<$ېUSWV[[o̬WtV6u]MaPƅt3]tUmuW0\tUmujW.^_[]ffS [ÛnT t [D$D$$T T$jjPQjR0t1T uVPQjARZT 둸S\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[kml$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPTOV QRPg ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPSt,NQW QRP FEE1^_[]ÐSWV[kD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [ØjT$0|$,D$(L$$)q092sVPR$D$00$D$ jU0J+ Ÿtr|$9rL$EQPt$V jUD$(0,D$ )t+Ɖ4$juD$(0* ŅD$u1 ^_[]ÐUSWV[èiL$$D$(T$xD$PQk1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0, L$,+|$ $t*D$D$Pt$(L$njUD$,0+ 1ɉȃ^_[]ÐUSWV[Øh|$D$ hj07) tk@ uVxPQ4$9vDt$jW6F) t9<$)HL$PV9|$w jP7+ 1ɉȃ^_[]ùfffffff̀rS[g|[ḿ̀rS[ôg|[̀rS[Ôg|[S[~g|[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[f$D$D$huET1}8XM4tI$P0CE8*$$E4E0|$ 1D$L$j`QPu8VR ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$PLT|$ W>N$Ƅ$D$T PW t.$Ƅ$8u$L$ThPQ0 $ 1 $Y?l$$PW}$D$t2) $j UW$WaƄ,j W$U !RjD$$PU: ʼnQD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFCt_`u|$ <5$h$PW h$PWr U|$|$Tt$h$PW? |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$P4 E$$t8OltC$($,2D$XP$0V $0$$toOt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TP)$,$ $$t%(tPD$(PQ( $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tP$$t M"$($,uWP  t$l$$t$|$t$P^E$$8$j`7t@8@P$i$t$|$t$PE$$t8L&t$l$tW$,$$t(SL?$($,t t$7$QP t$$t$$tP9$$tL$$sSWV[ÌYtM΋uA~8t:~4~"`N4F8 I9rPFF8^_[ffffffUSWV[Y$$$$$9$u t!6t$!P$VURQD$bI$>I+`|$ $L$1t2`r/j`PWD$ .$D$ `1t`rŃ`j`PWL$ #L$ `댃$t!$9b`Y|$ D$荫($ $` $hjD$ PE tF;EuED$E$D$ETt+hPt$$V Vbƃ t$ $tVD$PQ"L$ t$$uO$;$uSuO-wBI$uxT|$|$ $u5$t&aH0;$^_[]Ë$lD$|$ $$Pt uTd틴$L$t$T$9rD$Pt$U! 1gL$Y;L$OG :ffS[^UD$L$ AQ jQ0" [ÐSWV[ U|$t$t+jP6 tH  W6^_[ff̀rS[äT|[D$t8t9@€tuuuuH+D$ffUSWV^5T$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXHSD$L$ht$dl$`u/t+t'\$PQjkRa?L$x|$lu'\$PQjlR3?L$x1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$Z D$$PT$)rh,D$GD$ \$UW|$t׉t$ l$Uуx6l$V\$t$ |$WT$tx:|$ 4l$l$x \$|$ Wt$T$tx|$|$D$؉D$ )\$VD$@P|$t׉UVуx4\$Ut$@VT$tyx\$Ut$@VT$tx|$+D$l$ \$UD$ PT$tD$ WUT$t|$ x!A\$|$Wl$ UT$tx($x \$t$|$ WT$tx|$l$|$\$V|$W|$t׉ljl$UVуx1T$|$\$ T\$t$Vl$UT$tx+T$|$\$ x#\$t$Vl$UT$txT$\$ |$,tPD$tY\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$VWT$tL$uӃ|$,\$h|$tOD$tY\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq21pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[@t$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øPjj%Q-.SWV[\?D$L$Pt prxxp| pPxtz xyVR,1^_[ÐUSWV[>|$ l$9v`wDt9xtNȅuT$81$Xq30<01*׋PtIQPEjPQD$ pD$,L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y/ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p+ D$ L$Q$ЈA1ÐSV[<t$ V P*tHP tQ P V)1^[ÐSWV[|<t$>gthGt tww$Ѓ gpNjPQwu;u<tww$Ѓ .^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[,;D$t$tA|$1ɐt 9u)tPjQG) ^_[fffffffUSWV[ø:t$0|$,ttq,TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P, Pt$8=t +l$1jt$81^_[]fffffffUSWV[9|$(T$$tMtpGJB t zRty+ m6PQjGR%T$4uxm6PQjHR%T$4h`+F \$/}u-D$ $$L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$a D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$L$T$( 9J9s\$VWPK t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[[5|$tpjW0G 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;HW|P7W& jW^_[]ÀO @1USWV[{4t$uPQjVR N 1tQ~tJ.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[2t$uPQj%L$T$ pPt$ [ÐUSWV(T$X%D$D$1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[ l$$t$|$tu"j.PQhR-D$,tL$ z91Ʌ1^_[]ÐT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[=t$u".PQhRkD$ t|$tT$t121Ҁ9 11^[ËD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[E$kЉׅtϋ$tRWPQ$$$4UhVH$yPVj S[þt$jt$t$PUSWV[Õ$$$$kЉՅt$ t$RUPW$,$<QhVt$t;l$VPQhUJPUj tWD$ hjP' D$D$DŽ$DŽ$ L$VPQj$;$^_[]ǃP҃¿+w狔4у̃ǃƒCS[þt$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[:D$ D$D$$jVjt X uƃX tjljj0jVj3 jIjfffffffSV0[Út$̀rS[|[S[jPt$t$t$[ffSVP[ÜD$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[|[PS[ [fffffffS[ H8t3[Ë[ffff̀rS[Ô |[S[~ j1[ffSV[] t u#l V>u耑1l ^[Ðfffffff1ÐÐ1Ð1ÐX  Ð1ÐÐUSWV,[x l$D|$@` 0u"YC PQhRƃn$C fl Fwh =uЋp Ɛ=r4$UhW두d 덋h |$@l$Dt=l t2 9s8u+pd ƃ` D$D$(D$$D$ D$D$D$d D$h D$ l fD$p D$D$Uj(P׃8^_[]ÐfffffffUSWV[Å $$$D$@$t-u)PQhR$  $$D$ D$8|$$l$ BE <%t9sߐD$D$D$,D$ l$\$4D$ L$ zt*[D$ H1 w71A*MЃ rl$ D$l$xD$떐l$D$느1퐐,AȉӍQЃ r܉l$,l$\$48 L$ tȉD$ L$$$L$,ɋ\$4\$,L$+D$ L$L$@L$1:lu D$ʋl$L$ L$L$r$D$yD$$TD$x!u4u uCu@ug $O $)ED$El$; $l$( $l$D$ $)l$ l$ ED$ l$( $f $l$f(L$L$ɋ<$D$ x7uu u"u /@t/<$l$D$oЍW$‹D$ L$-L$xL$ L$l$1͉l$1Ϲ,$D$D$ O?D$D$ Uu3 $ $D$DD$ cbD$,$D$u'u um@tl$ED$D$11$(uT$D$l$(PjUD$$- )L$9ȋ\$ȋT$D$,$D$u'u um@tl$ED$D$17uD$8D$ $u~ Ϩu @tɉgL$DD$D$DD$(\$,$ED$D$L$uD$8x1) $1BED$}D$1iED$}ЃD$K)A $T$l$ uL$ L$ʃ,$uʹD$T$T$D$ |$T$,$D$ xd$D$ T$8u$D$|$_te$\$|$ ؃E1ҿ9T$ T$8Ér$|$ À0ʼnD$1;|$l$ r͍iD$00 $rgD$D$\$4jj WP轔T$ tb 9hPW Ƅ$'D$?D$D$ D$D$D$D$D$D$#$@y#PD$PWt$ QR0E;$(u ,^_[]~ffffff̀rS[Ä|[D$L$ T$HffffffVD$L$T$ t$pH^VL$L$ t$t$D$T$ pT$Pʚ;|p6eĉP^SWVD$L$(T$+T$ |$|$$t$19}ʚ;)ڃx)Ήp^_[L$D$+L$D$ t1Ʌ ËL$19L$ yÈÐUSV[DuD$ Pjt*jP9x/$iL$T$VN*D$FD$ L$NFFe^[]D$L$T$ PiL$HUSV[ÔuD$ Pj:t*jP艌x/$iL$T$VN*D$FD$ L$NFFe^[]L$D$T$ QMbl$‰QffUSWV [$0D$$$ $fEt$$,$,$,PhD$ Pjjj$@$@$@jU(ƅu]E $@tR$4hD$PVU ƅE t'4jjjPhD$PVUy ƅ~s$4WVD$PU<ƅyvE @t73$t'}P'EP'xEtLGP,G$OfWfw f,VRQt$ Prr߾WU._D$;$u# ^_[]ÉGffuXyUSWV(]uD$$$$@$<rjV^1t81ۀ.Qu닼$@9vy.Åt1eD$ 1ۅu\$D$#hPWVJt/$P$P$P$PPV1\$d9ٸu^T$L$\$$P$P$P$PjWVN\$ ƅF$<L$T$t$D$~D$D$ *D$sF D$D$ i^DFT$L$D$~HD$\$D$D$ ɋ$<t .u xuD$$P$P$P$PP$TRFT8=z$<1t<tu-D$ +$L!5u D$$<X1‹t у9#|$L$  \$$@D$u]D$D$D$ uA|$u:$P$P$P$PjW$T.Ɖ1t P$@|$ $<t.jPZ[D$;$$uL(^_[]þ|$t؉j$@[É뿉j됋$@D$L$/uUSWV [u$ M$1@ u  tE;$4 ^_[]ÍP詌tЍIQPutƄ$T$` $D$1PhhRL$$t$ T$DH@u u{F$$RiT$D$u$DH@utD$(tDP@u Vu$,FPQW D7t$&ysUSWV[$$$ $$@t-t~Y$,$,PUQtRL$)WUPhQ=s>$4$4$4$4U$0R&U=r,j$ X;$u;^_[]Åt|.u|$nUPQhWf;t$ s E$EtJPEDt%uHPW u퍃PPxt^V[ML$0 ;$u ^_[]`USWV[t$xPFLdžft91 9s)tQLDŽͅtMtt|b9utKxt PKW膮džtPidžf^_[]ÐUSV[Eu jPo$D$F$FBbfF e^[]ÐUSWVx[ÓEL$ L$pu D$jPyoD$3D$fGt$VjWV4 VWGL$ ;L$pue^_[]^USWV[t$xPLJdž|$ft;19s)tQJDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[ԾD$Att$0UP8 EO $L$(T$ L$L$L$ F< t< tjt$V^  jPV] "j PV] jPV] &]j PV] |j PV] +jPVz]  jjPV`] qjPVF] tj PV,] jjPV] jPV\ jPV\ jPV\ j PV\  'jPV\ jPVs\ $`FP!5d$/FP!|Gt^GddGtAPt$'F P{!|GGt,PQ7< < {$H׋$u $P뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]7PVf?r?D$PVt$ D$L$Ƅ|$7PVf?r?D$PVt$ D$L$Ƅ($H^_[]ÐUSWVx[Ø$$l3x h3t p;| t|[9h@t[|x$D$D$%D$ D$D$D$PjjjQtctt.T$tvƊt_`L$9 $|Gy $ DAD.D$8VlH9s .1%40(FFF@FFFF, t 9uD19u< z |$R   1>F( th 9tF F$Fw( r R   ^_[]19u뫐S[EQPRʰ jSWV[üt$8 t3 9t^t, z t7 9u ~t vV^[19uΐS[Þt$ׄ[ÐWVX}L$ tsAQQBQQAA, tD 49u4 4~ v  ^_19uSWV[ܖt$trT t/<t) z TQ9t$|$|WƋHL$T$TQ9vPt$ |$|WU&ƋHL$(T$P2Q D$ff|$(f}r#L$0IT$4RуDE9T$0vZVWƋHfyrD$0@T$4RЃTQ9v*t$4t$4VWk uR"t$4GT$0t$431ɀNG8G8tO(1;G4~ Wwp^_[]ÐUSWV](qt$4\$0V{4ufr\$0K4T$Ns DDxKS !T$S$1҉|$9,$~t$ 4L$͋|$!E;l$\$08un19؋$p LL$08rT$0jjjjQPRT\$08mD$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$0j1Pj> V`1JуT$  1fljڋ$jt$8VPR$1ɃFttHT$*]tjLjfLjfw8\$$|m PQhRY\$T$ D$4@ftjf|jfDjfȃ^_[]Ë$V J1Ʌt‰ D$0L$ЃVhPt[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08Y1USWV[XlT$B =t $|$ t<|$,t5|$$|$(j<WZT$ D@fw'֍ PQh#RXF P=tfOtfO1 ŋJD~t-9$w$D$ u( D$ uD$D֋$;PD$ u fjT$Ty)‰T$ L$ʉL$‹D$Rt$VPT$ D$ Ɖt$)$ƋD$L$f xD$ L$fDy9f)tyfyuM|FaT$PQhRNT$2|Fr"PQhRN1<$V $D$D$ $09wЉl$$uL$D;QuLN)L$.Wt$P |$$)Hf,Nf?Ń$r)PQhRMT$flFL$fLFt%f~t$t$<2tWŋpf~l$M|FPQhRlM1$^_[]ÐUSWV[`t$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UxƋD$cPUT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σr+PQhRK$E ʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]ÐUSWV[_|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQ,u uhDnjt$Pt$0VvtRV tm9u.NWRVt t ^_[]ÐSWV[]t$|$LQjPQWvt2HfyuftfDHjWPVFu`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVt+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TNGDHjWPVt t&dž(@f8u$dž  ^_[]ÐUSWV[f[zA =tl$$G)B fT$L$D$ uf͋t PaH,$UjA|$(todž(dž $FDGjRPVrtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$tL^_[]DGjt$ PVmr t׋@f8u$dž wSWV[Y|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[ÖYT$$wA =tF)G D$ *$Ffu^L$t PF4$j?L$t$,t$,jWQPt$DFjWPQ,qtjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ. $JЃ^_[]ÐUSWV[HXt$0l$$D$jPj :|$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/202411190100Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20241118205345Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complex%s: not completely converted%s: invalid field width%s: expected numeric valueUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20230516%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:inN:o:pP:q:r:Rs:tT:u:vVx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%untpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.0.8--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.0.8 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.8 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclasswaitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timeread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %sinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sdhcp_bind%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_readudp%s not founddhcp_openbpfdhcp_readbpfdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s%s: deleting IP address %sipv4_deladdripv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cinet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 router solicitation for %0.1f secondsipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: soliciting an IPv6 routeripv6nd_startrs1%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: DHCPv6 Vendor Class too big%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s%s: ADV %s from %s%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %sSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addressesdhcp6_startrequest%s: failed to request DHCPv6 address%s: no advertising IPv6 router wants DHCP%s: extending DHCPv6 lease%s: %s received from %sTIMEOUT6BOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 address%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebindSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist