ELF(@4D!K4 (@@``PM!P"\\@0 6QQ O@@@( @0 fH!@P@Q?H3xР -L>/PMP]main() returned_   ! X(@@T @@ 0/aaT (/// P-Kxv@-@PL00S @0080 0 0 0 YЍv``[P/00S 000/v3A-@Mp&P @ލ0s EPP /0 00j`mV  h@ wT 0R(0R OoB[edA[\ 4S/0!8 00 (   !/Hzhzlz@-S6P|s0 !!X0T0P0H000, !  !.[6[HzhzlzG-bM0SpPpP7P [~ЍG @T BP@   P PP 00 B4R  04!@a0C0 T @@ P@ P P CP P !6P|1Pl,PP P 8$ 0@ GG[[G[Q[T[W[Z[@-<@ P$P@ [[[@-l00: SׂT 88S!~0Y @% 00 I]@B@-0@0PS@!@]- 4Sʀ0! 0    !B? SOHb0 !! HoDm<j8߉0è3-Hzhzlz[[ [@B[ P00  /$@$0P  000/dPd<0 P0/S/0CQ/]s@-@0S7`P`P) P' P P0000 8㦿PЍp@RdPX0` P0RЍp@Y @P8P0Ѝp,[3[:[p@4A[]` @ @O-M$pP{倃 ?WwKv!7GR  EP00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0ំЁ6<P Q "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<H$1)0C$10!10C0PU0S 9#9S  @P :$1I)0C*$1,1,!p1c001 1 @P :|5*$10C$1 1 @P :$1Du*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1lt*0C$10! 10C01 @ Ps:$1*0C$1t1! 10C11 @ Pa:$1)0C$1bP#Fq㰃 uFW#F#Fx#xFp#pF$p`3`` \3!XT3 0C 0p 0F! 0I 0I yF": qF": iFt: bF\: [F0p09 SF 0p0 :IFXp!,G!p0 E<I$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/x* 1aG0\GXG010! ,1,! (1(!h$;'! 1"D ЍG[@\[@0 DSBO]3ᆳ,[0`AiP)i ` A[??,/li`?8[O[@ihaaTaa^^ _ _@4_H_\iP@`__ _o d@ @@@@- @0 PЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ hTTU   ,0PP<0P 0088@P`\  0<0 0^*0 00 \S 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/]` p@-dPT U@ $ ``06/Tp0`$ p@//p@-0 P T@``06/0 ``6/`0p@ /p@-P@@0 T000S 0d00h00p0x0h0x0p@艇 S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ]x)@A-0PST@ Sq .  Bu 00 `0*b6/`P   0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@[[p@-P0 ` T@003/U U 0  p 003/p[}@-00 {} Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-0`@TP Vp V h'00 3/P0T00 T0 `@4/A0T0 `@31[|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~R[ 0o/x_/0@-0M P@ 0rP 000 Ѝ0`.@p@-0@Tp@t "y$0dP 5/0 dP5/0!}0} 0p@}x_[A-(MP@D1P<4?0100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍAq05p`WV xxp XPd` 0 0@0 0(Ѝx_[][pA1@[h.@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@;A-0@TANA0P`dp 7/U |UA||U|U U 0dP5/|d0dP 5/0 4P5/ x_[p@-0@TxP\ApPP0 4P5/ 0 4P5/PZ| X|V|x_[C-1M@TiAЍpb0` dP5/ 0dP5/P 2|0|8|pPP p d09/0 49/ ~0 49/ 0 49/PU ||{0 dP5/0?<#x_[A-1@T PP0` dp7/ 0dp7/ {{{~0dp 7/0 4P5/ ~0 4P5/ 0 4P5/P{x_ [O-,1P@`(z,z0z4z0p,?{(<{09{46{{{y{ { L~@P0 p{ E~(l{ A~(r{ =~[P0k{ _{ ({ ,{0{4 {OTY{x_0S@- S S@@Xz3[00@o/]` @-\@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gy2RS 3C7CR008#8S800 0ܩ &ة1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011/P008#8S308#8S0x`0 pⅩ h(`8p<151``5008#8Sy308#8SsSW HdHd\[v[ ~[@-@`P@d `0`` 0X 0P0` P00X04 4!VPЍp[[8JL;@;@@-v@-@j0 0R/  Y]` [lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/4/-/-/-/-/-/-/A-PpX`0@ 2/ p 0S0@0 @0000@A-P M@`N0 0 0  p7/0P   p*7/0P   Ѝ "( p7/ P\ 000 00@001 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd  |000040J> 0 0000Ȅ 8/0$@0\0` p(~[[[[;[|_ a[ 0 /|_/$ R/P//C-p0MS *P`  7 @dP 001Q0000!T0    ᝑ40 00 d6/00@PPЍ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0"" //@- fo[@-@(00 S@ @#][QA-P@@@DT@ 0S 0S`T p` 00  z`T@T@A-@P@  `0p0```p0P0 pVPT> 0x fVPh4 0X \VP@* 04 RVPA [[_E@E@,[F@E@@-V@A@-P@@-J@ |0 0@->0 0@r0 0@l0P/f_@-<0@TP [0 0 @S_0P/QJ_p@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  pp_RW SW 0o/_///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S w@wP0T00S,0upG-M`@P2`0p 봂 XPs ʯ0* Rp "Sk pd2d P00 000!h8" p-PRP 00$P(0SHP㰑0SKP 1@ vP 1@vP h1@uP H1@u@10S h ,彄00h0 01@0b0!~dЍ0!p P_ a` P0p 0/vP0qw &v0* R t0@uP S T0@_[]K@` $[K@[G@K@ H@ @]JP[O@O@@-//G-s@dVʀ 0! $"0""   !P 0x &v-vP0S xP0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y u u x0S u xP0p uP ,0S -0S (05#0x uuP0p uP Q 0R(0l0 S$00 S YX0S`P\ d܃$0PX0 0 0?c 0!D d08 0   !Hzhzlz_\?gfffp@-T0P@0`0\00`X0`0s X 0\00p-x_'@-@09P @-0 @o/]//0000/QR R / /@-MP`@pT0 P0 S0 P @0S*0 TQ 0R @Ѝw`@VUUU'800: S/@-@@M]// 0!< 04 0 (   !/HzhzlzO-`@KP totx0pS㘀|P xPW PL t0S 0S ʌt P00 0SӀ0.X01 S5p,`eP< [ p0S7Zy0S2W 1x0: S}1!0?Ac4Sڀ tAwpS9PipX c 0&h0W00 S00S Z W  0l|0S+ p0 |PŏX 'Sd d C 00PEC 0 0C|0`  0 pX0 l ЍOJP0 Ѝx[]\?gfff:[Q@-Mp`@ p d4P 庬\ 峬 eJp10: SRZ e0s(sss@  1s@  1sP0P0P 00P0@k 0@k 0@k 0@k|0x 0t00 0@P <@00Ѝh[[W@V@]V@0W@X@D~B\?@-@-@<0 @0\?@-7@-0@P1 lp00200 lp0000 0000000000 kp000 Ѝ0\ P/0 !8 00 (  , !/Hzhzlzp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000`[e[t[//s@-P` P@ 10: S)Q00*r'r@ 0qP|+ 0@00D00<@H00L00P00P |?q0|0Ѝp00!00qq0 MP,Ѝp@]]@[Z@T\@<\@$\@[[@-rP@-ro@- 00* R | SrQ@ n Hf000* R Sr]` [@-@r၅0@-C9!: ^SpP3 @4T004 0040606L00L000 0l4/@-@, J$0 0Z?{Ѝ$]@0[G-P0 VPU0p`-H@T qp YX!Q0S@p )@P \HPHHt@ t@!@_@[Z[x[A-` f`V@lPpG@T 0Q`H0L ^@M H_G-`0000p@0  PU x0(60\ (0S Z00dPP, @\@ Ѝ"_P/RP0@-M@P 0 P @  0^@Ѝ00@-M@P 0 P @  0U@Ѝ0@-P0$M000@R<` p_G000SG0 P@ 80 0`08@ 0 05P0@0wG$Ѝbt_{0@-M@P 0 TP@  0;@~Ѝ0@-@0 ?P @  E@jЍ P@- R FF_0/_p@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p=2_Hzhzlzp@-HP0PSp P@ `6/)20  0p@/_p@-x`0SplPP@00C00SP 0 `6/T 000pp@臇Pp_G-pP`P@ P" P PV `FPE8@P P #P`/T00Y0S<4" `@[[[[/@-0,\ @T 4/Ѝ_00S/ R//_00S/ R//_p@-@P. .0p@80/_ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/A-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 h@h@ 0  )?)/ 0  )?)/^/@-@q dQ0P0C{q 8v q (qq l[ [[[%[@-H M@8^ һ000 0婷 Ѝ.[i@0@- 0@ ,MPr           0 040$0劷P 000 ✻,Ѝ0h@/0/!//A-pQ`.0  P@ x0EP Hpp`@tT:80*0 0'J x>@\@-8[@-R[///1/8#81/1/  R/ R/ 0s S40@o//0@3S0//{8[p@-@0PT3/>p`S0p@8/4$$#   p@/?[C[I[Q0 Q Q // k[?[n[q[O-P`$M 0 3/$Ѝ03/@yQ  0R $Π  M3/0 0Sp00 `"R 3/ 0A0CS000 3/00u00d0 0Q 0 3/$C H! 3/(!0AYS-000(c0C S#0x   03/ 03/@ 0t3/W  0\3/0 L3/W0A CRS 000 0R(3/07  1 2/0 30 r#03/ $:$(0". `: S0P3/$&0$ 0$3/0 0 &6z R'zppF0$03/60S 6&0S Z0  |3/03/ Z0Hp083/$O8 OS   F0$03/5t0S W0  3/   0 3/W? 0t3/0t3/0pd凰Jq" W  'pS 03/ GR03/0pW03/0S3/ '$0W$ 0FL0G$80 0C2/$01?3 ?3!?#;00 2/@ 0q0 00s00$* "0 : 0#$90"?  :$#: `0H#0$"<407S0 S0s03/ 03/ 03/ 03/0x0s0n0|i$3 l0$2 \0$0LD, R$03/ᴡ$03/t  03/03/0t3/W6 0t0q$0 3/$($0 :/0 oPq0 3/200$($0 %:/ $8$&$p0 7/0N[t[[[[[x[,[[[[[[[8[H[N[[[`[?[b[/h[[m[[r[@x[[[[[[[[["[([3[6[8[A[C[?[E[M[U[X[[[[ ?[//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O,- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P Ƶ!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S p@4 ,00,0/0 R,00,0/p@-(0c30@ T3PUpp@-2@02 P<0#0P20C22S mUpp@4 p@-\0!C !2 Q02(0$! D (0$!p@R/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R DɴP 0=S0@V20V 0  SR0T=Sp'p P@   hP  8 FP Ѝt[7@- 0@P P0P R ST @ Ѝ0@-@0 }P 7 eoЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 07PN@ @0 4/@7T7P @> 4/@7G8H1 !0R$04$0/o/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ __p@-AQ+ 0S R[ xh0_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0$00pB@<_Ai!i z[1?/ //0 ?1@o/ //0/////?  22//-P/6  N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N 1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  Ϗ(00(0/O- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!h`_03 /0@-$@4 < 4 @ 8 L < @ 0 < /p@-P$@4 40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0Op<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@;0` 1017800h5` !.p5W h0000 0 00 `L<`划0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X)M51011015 0\! 6 SSO-0`@p0M 46CSЍO0t ⚫000 0$0L0 0C0C004peЍt!pppV 0  Z 0cQ  ᶿ J<!PP)1\Z 0  wPP P0w  0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C 02/@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S 0@-0ZCU lPC^   LL& &0/0pP 0@- @ |M l Q \\ QQSH0t S喪0  !0 @d|Ѝ00!R 10/`p@-@P Pp `0 S   0@-4 0S$ @ ` O-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#  > t 0  !0 PKd~|ЍV@@ 0 ;/P t ש0 !0 P$@+d|ЍO\V`[^@,@@\@@x@ BO- p`0F   0 00p(`$ } 0,!% 0    0p(`$ } 0!% 0  ,  0p(`$ y} 0, !0`%$  *  0 00p(` b} 0!% 0 9   0p,(`$ N}0$,00 '!$ 0 B   0p(`$ 6}$0p,(`$ H# 0 L  ,    !} 0!0 S   0 00p,(`$ } 0 !0_  0 00p,(`$ | 0 !0m  0 00p,(`$ | $ 0 !z 0  0p,(` | $ $ 0 ! 0  0p,(` |4 0 ! 0$  0p,(` |< 0 ! $ 0  0p,(` |D 0 !0  0 00p,(`$ u|H 0 !0  0 00p,(`$ `|L 0 !0  0 00p,(`$ K|0 '!0  0 00p,(`$ 4| 0P!0@0 0 0p,(`$  @|<Ѝ:[ @p@P@h`@`G-`pMP `  @000P00p 0@R 0 p0 00 00000 0w?o2P0S0 SЍS0h`_d@A-xM@P`` pẻP0H~0X 00 000000wxЍ C-0|MT@T 0S P`p` ᑻH@V0X 00 000000w|Ѝ-`G-锐xMZ- @P`` pi ့H}+0X 00 000000TwxЍGp@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/@б@__@- @p03/_@-@0 @T  0 !! *@p "[A- ! 1M03/f0P `X@P pX0 Jq T@X@@@ K9@Rp`p0t /ᑦᓁ~]0pL p4∦0$p00 Ѝx_\`p_x>o /@- 40@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00P 0S#020 0yP 0S"020 0lP 0S"010 0_P 0S|"010 0R Pd 0Sh d0H Pf 0Sj @0> Ph 0Sl 04 Pj 0SnЍ0)Poq!000l0 Pn0Phj`!0@00e0 Pfh0!000cX0Pdf!0:0a,0Pbd 000_0P 0800Pp 0800P@ 070|0P 070H[3K[R[_[f[r[z[}[[[[B[[Y[\[c[o[w[[[[[@-H00S<00S0 00000Ѝ^^00/G-Sp@` A S5 S11P0 @D`Fp@03/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0``d`_O- 0@4`lTD r0P\qX pY  R: R:[ Ѝ PN Y  L\!TWX D p(p W*Y )  p 0S p    0@pWr P@@- ^ 0P \0 BQ0[A-Pp4`@IP 0Pp 0<0`@P00 (@0 0,0 r45G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0;P  `FP@VU0,00,0000,000000/O-0p `0 W W W Ѝ@04"0 S )4S 0"4PS| V1d0 ЍO/ @D P T*Q0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!+0 0 A3A3C?o20 0d @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0; @ `FJ  .\[_[G-@Pp @ЍTIЍb2"0S@ታ0j0O-@M<`N@N;@5TpP3:T#3p0 媀?oZ20S 0 埀PH 801P;0; 0 X0=Ѝ`@ 0 SPT<0 0 0Q0 R0S 000 R!>S>0 jJDV:V: 0 x>\3[p@-PN@N@ 0 p@0#\x>@-0 PS@0S 0#G-p`@00hTЍ PZe 0 UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍrO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0! H`P0``>0 BB6*a"*UbY P0 0  0 P PE 0H0 H B rO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T 厮P%@ P @[H0@@ ա:S P%0:0PD0@S Z Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R  (0+0  VPV0P00 0 SЍ R ߲ *0VPV0P00  0 | 8$ R Ų (0+0 VPV0P0 0 0P[[[[//C-M`@ݰPT#L,'@0'4UF/$ 2?0Rr 岟LQ PPPL P `1|pQ  000<0  cЍCЍ0[=[J[``$a(a,aaaT[C-HCM`PvT~ЍCLRn  "Ÿp"0*P*P l. (zD3SP 0S(nX!\1pP H s0( 0( W ; PWT3=WGT3ET3@?T3  :81!0S 1*B0S0 1F@T1-0pW0p!(`1 0(0u( G R$$T3 !1@TT0 0 0 0  xW pYU Ѝ@ 4\ [P[l\p\\\\\\\\AXVT\[\\\\\`A`A4`l`_!\@\C-`ቯPᄯ@P03/sTDc03/0L30HP3,G?b07@噯90C 00ɽ0  00⻽0  00⳽+0  00⫽H0  00⣽e0  00⛽0  00⓽0  00⋽0  00⃽0J 00{0N 00sC?0R 00jI?0V 00aN?0Z 00XS?^ 00PW?0b 00G>0f 00>a?0  005goj0 `-04L ЍC @K ЍC_\P\ P-`@P p!c pЗ!P  R $LApL 4DR 4/!`@S`!W , ,`! !oDЍNReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! |!oDЍN  0O   ! "`"Рo; T S3 RLDLOoB@ 0 s P 4(S$ [009  0S00&R ! R &R h!h R \A@X1T@@@(0 0qP0( 0S  R [ (0L0Ѝ0 t h0 Z0o Z ZA``PzO@0 0 T 0(0^ 0Y ( X_\_x>\\\O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 ]qP/ t 0 [0 0a`Pzo`0 0 O 0 0 0t 0 0 0$  00@4@>0  P0 @TL@0* R @YЍ_\O-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ?oT20S00 ?oT20S00 _HzhzlzG\00P (031000Co// !:!P/ 0 00S/@0. 04S/Q0 /0  @-%C.@-O-0@|P@A-P @`pTQ 0 "A2P 0`PR  V`p@V0A310030P/- R   B B  P^^ $ B$ , Q R!! B B!! P/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B   0S@0S//0O-P` @P\Q pQ00ЁU00SE R㴑; Ѝ ^^p1Q@` Wp0U0 WU0 `` 0!&Q0 !SL   0E&  @T00 ЍO/QᤠT ``  U [  R`` `!& 1!L0L  o@ _aG-1pS@0!R00R0P  \  \ 1!1`V0`0ó?0`QP 0  ^ ` 0S 0PR" S 5YY 0S 0h0hS 1S 0h   PU0S0`000\ p@-0PPdL4S N@l $60L0V L0?4`003/03/+Tpa _p@-`Pዧ@ <@1t ![TP_X[_P`\003/`003/03/`\T4PX4P__p耮a_p@-D@[PX_0``003/03/`X4P_pa_O-Ph4dpQLP4Q9 @䀟䠟fU*%*1Qh \ : 0010?0@03/@0Ph%!1PLP L0]뚟@03/@Za_ @\/O-p64M@00U6PH4S 0  0` T0 01000X00000_ 6T =0P0 +60$00$ 0(01,0(010Sp P p pV, 0S0PS0 4pp0V :r_W @p&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% P <00$  TY[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sj0(4S   0x W4Ѝ 0fO-@p@P` qPP`<`\   *60Q000  ԰ @03/00 3/03/  0P4 0?PUP'S 0h<0'O^T00  S  S80d5 ,0L42 S0`5 _a`0@-0@D0PSMPЍ00 0P "40 U0*0$@O-@pL\7T:r003/O4^$ZZVUP!N`$5ᔠ?`U0 0C0̣P @0  <@0H  00?@03/003/J` _aA-p@`P\$4$*$00S'](DF0@00V@U($<01S  2# R ]$60]X 0S(H$HJ$J@L W000  00 p@- 0$@0P000Sp`H4S d0)$4$OH P4@h5hE000D40@@DDpa \O-`MlP@[k0I 0000 T : 0 S:0SMЍO\]$jjf V `!vP@ p$5?pT*. , 0  ᚯ7뚯R0 <(0    dZ0  R!* Jp +4S 0,03/0+4Ѝ耮_O-^PPE@p댐匠ZT:O/ `fV`!P@ $5?0CT*0 GQ!803/@Z_O-@p$M`!Z'<01S 01 0  000Y' ^'v00100PqW X [  G EUP H <WP 0 P\$Ѝ @00@0 00 00皿  w뚿$,$$0 !R3 0?  PX P $Q <P 0 @00@0 00 0}0皏   8뚏P R0lœ\l% 0S 00 L0 @  0p 0 )ꀮa\\0 #!R/080/_s@-@PZ %60㞡`P 80 00<Ѝp@[ꀮO-q3Sa100@-4S[0,4T倁勰U !0 PU ,$$#2$$0 SQ8 0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$  2/03/00  !!000T(4xDT U0-40-4|D Ѝ|03/VBn __10 P0  044-4/@- 4@S 0 4cP $0T V0(4 0@0/ _@-$a   @* 0 4$(4*@T R0D4 p000 00S 000D40P0D4P$TPp,tq0000'0$4$0!*10 ,$020 0 Ѝa@_@-@X0 4Zp@-@Pp 4S u0 4廅ⅭP Pp 1T 0(4p誅1q*2h$T 0S0Q D$,$ ,$ B  B R @@TQD$h0 0TX0x$R x$p@ 4DPD$ _@af@g@-@P@G-`XxsPdGrZ@@@ @pW0S   YQ @T0,03/03/YP`P ~=zV7p0t0pU4 (0C4 040C4 0 @Xꀮ _0f@-@(P@K\O-0P 0UM0 0@p0 0 0   P@xPk($PUЍ0    0* 0 100R `0A  S + + 1 L4` 0 0 V'! B!! ! R 0Y0 0 皟  *0뚟 0  0 5  B    S 00 "ꀮa p@-PH,r@@@ <e@p耮p@-P7,a@@@ <T@p耮p@-@p@p@p\G-0X`TL4 90?003/03/@`p>P 0` S@03/@@@00?003/a_0' 70/aO-xBMgV<*dZʀ 0! $@"08"0"   !&j aw0W:Q<03/,03/03/ 0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0aHzhzlz_ hip@-PPP@}$F@0S0?@003/0p@/_ _@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-4TD,M`w|T0 0=$4  !0S2 $ ,P$ &20PYph  0000# `ˁ \ $4P$ ` V (P b<03/03/03/2 x嘧Ћ唗P  )5? T唇\딇(P@L(5? `X唇 "0S70977'3C?6C0C#:%. "&0#2>0#6!' 7\D h@p1q $4!*$010y,$020 0@,Q,1 00C0@@ @@1 0000 @@z0 0 000@@ @@@+0P000@@ @@ | <0,ЍO/ aw\\i\\_B\8a@f_h\L@@g(0f0@d@b@-魛0@ 壛 @G0H4踁aO-$M,($ 1@`}PQPP(PE\ܐ(Vᖨ(:$Ѝ0 i@Po0 0000009  "Ppp@W T:`m 00JpbdL?^x>\^\@0!S@0d4 S00h4 S$0;00;010?/ap@-0`S0@LT!* Sp0PT S`0dUP0SHP, $EOR0?pa\\-!01; 00? 000$ O-~0PP04 p~R@p R R1!ěd`V Ѝ|!t1d弋Ld!\1h帋PV[#0$ ! \ /FVfF<R0 R   P -$%/("(VR#  U뚿HXhF /JZjF\a@\ !:!/ . A- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p踁a !i@T@G-`@0匀pB00>0>0PT0?0?0000?$:aP($5?[%J \O-@ᨐ娀zT:00ЍO/ 06Sx`1`!-P$5?PT:0?L0 HS @03/003/ J_ 0$4 / 0  ")//0 !Р!/0 ! !/p@-PM%P# @,`5~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍpʈ^P002'0 S#3/^ 0P/^h0qp/@-餡P p< 0BS B 00PO-@2@BM<03/ sr $R0S0  "S  & P$ЍO?ᥞ`Ph 0Se `@tЍO iP;0Q@p1į0 00S\>0p00 I06SP1A 0 G0:0 0 0 00\ @X0`@Dp@ u00 eL0000L0\\ O-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJdqЍ\_\0/\0/x0/xT0@-@0 @RS ,0 Ѝ0000x\l0P/0 S/@- ^@LS:0 0CS(0 Sxl0P/0 S/@- ^@LS:0 0CS(0 Sx @-*0 0@0p@-`!P 㷴@P$P`00|@p@T@A-餀`@0PU |p R0P R 0L  %}.0$A ~@\\7@-Pd000@T T 0PE0%VE$ @ Ѝ00S 0ES:@@0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLLdЍ0  00R( 0 4|  0|l\\\p@-P!@0PS ?!600#Q0SP(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P14 X3P S9@A WT00 00pЍhp@-L(0H@P#04X3 @t3$0S$@p@6h@-`MtP4px@uT 10'*"*0*00(00,00 $0$00Ѝ\p@-PP@U00$000P1# 0P$P LD`0P1 V`p@m09SYS! 0C023 0tQqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`n\\11@@p@-l0( h@"6 0TX300$00p@\mP嶓P p@hG-@ᶓ`2PY P1ЍG\ D0T`0"R0L0Sl r 0 00000  R!a_Y 0S<00L0S,3d00!C=rnЍG lq 0 P1 ?P *0H P17$qP R  qqqx3 d00xC0 00 2@0S *"*]0S 0S$00P1 ) p40Cp4c ЍG`a\L\b\e\\|FA \7\F\*\T\8FA\?z\p@-PT1P @0`3/P P P1 T1 0P3/T1 0P3/P` P PP10S p( L6>c@00;000000 e66P1 p\\p@-M@ PP *l0B8#8S 00܍p:< 8000lP!Q     8@-M` PpP`-*0B8#8S) ' Q#P10 0,00@400300r2T10P3/P1+4 P1` ߍ-`0u\@-@8  ́t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@臝p@-*T1@0P3/PPX3VP <T1PP03/pX30;X3\O-MpP`@ HQ  0pdT10VP1 P1& P1  xccl=llB PE  p`%Țߚi ʈP1   L5LP<s pPFL0 $0,(p$  `oU0P $0UЍc moP0Q Q P\ P d*` tPtQL1S 8t/0T | Bv| mL1  0P!00P16n ?0 X3<X3n?0 X3@0X3X3|w d2 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ |}6> #W?0D0Y?ⰰX3@0 D ?80t# D h | W tLV  040t#A\ \@-AT1@0P3/P UT1P03/p@-P+T1@0P3/P00<pU0   " ""   00H00D000h0!\p@-2RP0@`2 R R0L00QP0 <0L 6#p@ /0L00P0 !\"\p@-P@` Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@`DMX(h000 P<0 $0b YH 0 \0p 0+ p t0S 3/0 $ _02\ 0:/ 2@ QP8 7P  ḓ2@  T7 P80!0d R2  R00p + 2\ h0A⁸h003/pW h003/O-0P`04@T p p 4[ ЍO  0S0 00E 0S     0R <0X2)QA    Q!PX @ [yP 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    PP X 0R{ R\ ` $ @` $\a$yp@-@P` 0B 04@0 0·p@0`0S 3/  0 pp@壳yp@-@P 0<X00X 0@0 00S` p@)00X0S0X  0@ 0 0 04⥶ 0 0 00 R0S 0=@Sp@A-`P@0pSbJcP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <DAA-@p`p0<00P P h0 03/<0P0 vA-@`帀0,! ,1Q 0 @#<\?Mb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  A ԲG-`@PP@  㸠,ps0S S8 @᫠@ D1. 尓 ,/ 408p<003/3 3@ ᰇ0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0y NEFXPi'TDG-p`P偭@PP 0,00202?Sb40003/S3 PPAyO-M M`0P @0MpP00SM000J/<,zPx <00090度dRS00X2PZ< :  R+00d [fd R  PWW jQd R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ąԂp 0p0p00S ۍ ЍOp[*Wۍ ЍtP tp0pGWpX8PLHD@W%\%\%\$\%\%\%\#\%\&\&\ &\O-x@4MPp80S<0:l=S4a08$QD`V< #" R<k厺D`08 R(ʑ80 S,d0S 3/ `80SN~lr R00 ` D hn< #"0^0<` `00SQ  00  `0q0 00 00q< `V N<0 0`1 <0 0Q Q<0` 0 x-&\Q&\y,pAp&\p@-P@`  PUDp0S \P0 P/ 0 /p@-@P@+pp@-@`P0 @Tp0S \@ Pp@-P1 P#UDP3c0 P0 0 00(005$ @,08Z,0PU 4R<Op&\@-@JH4F<D@D6@-@ ,A5{\0S&\p@-@P 00P`\t\sAp@A- a@TpUʀ 0! $ 0    !\ 0  @ 0! T0t l   ! 00 0h0 03/@T \p P Hzhzlz(e/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp Cp=,>p0帢,<zpsL!DH1003/j#-  Ѝ_?0Q R 0h100100100 0媶-/@@@&\ '\G-@p`Nz[h1H0 @H0P  0( 0 0 XЍp@-XM@X  )l< H0XЍ0@-P(@\M hɲ\Ѝ0X l$0 010408020H0P$020(\2p@-(0PXM 夲`XЍp00@S SQ 0R0@`X  k0T1008020 H0iTP`  zP0@ )\4)\@-(@00 3/ 40S 3/00 3/00 2/p@-$0@ `8P8P08<0,4p P vk `PU$09$0P@-@t`M0 03/$0PPy99$07U W$09$00<0S 3/ P0p03/7/PPl 0 4pW  7/PP <吳(0 凳n03/(0 /PP(0 $0 /8PUQgdPP(0$0$0 O(0 $0 P E$0 P :PU8P0S pp 0 0S $0p p00 00 Pj PU$09$0T$0 9$0Ѝ@W Ѝ@ЍQ)\l)\)\)\)\)\)\@AA-@`,L@?4  k h e2!!1 0\1 Tl04  0QPP 0@EG?0 0B0P[ 9 6P @P +P@  %P[@pk[ 0 x _ PP   0@40  0400P} 4 0 0P 0  0Pf 0P 0B ! YSV@ ܱRo)\+\+\<+\f+\;*\c*\*\*\+\ *\+\+\+\C-0@Pp`y*0) ⊮yⅮ,0J)00S V Ȱ`vVL`qsy2"jly /d ЍC`,\0,\$ X0R/0p@-)00+P@*0,,JJoNOPyVPp(!q,\C-OopPd`【\MBX  h0 1HiP 0?4/`V<?oU20S 00\ЍC'O-`lMp0pV Q ;T.;P"PP@X h5020t!(ST0TpU`10W ,PLPpX0G S<<000 0``|P7 R00,`0 兲0@0`P0 yuV 0UpC00 0 lЍ4 80 PV`2r,\A-`MpP`6@P*U@x 0PN0X TBP#h402|0PSd020P0$P@P(00 <T 80U`C00 05ⷮ`Ѝ2@,\@-$00$00 00  0@PT P P$00$0Ѝp P$00$0%>0S,0 0TP P0 3/ `PP, PP ꠆,\-\A-@00PP 0004P<0P0<00 03/pP` Hޯj`0p`0<0<,0S,-\B-\@-000 00>Ѝ@-1 0 1ЍA-@04pP0 3/$`Q\@    0 03/P t启`P X刯00018  1\1\1 Q004`V 6/P` b 娯@T :1y0  呯03/t副yPp`P^-\v-\P-\-\Mb-\-\0S/pp@-0@4PQ 0# WPL`0S 04A0P30PU*<p .\?-\0S/p@-0@4P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝx@P@@@0 P0`HC-Pp`"Q P 1  0{ Ѝ]x@P@@@0 oP0`HC-@P`pQ P 3  0U Ѝ7x@P@0 HP0 P ` GC-@P`#pQ P !3  0- Ѝx@P@0  P0 P ` G@-0000  0Ѝp@-0@4P; 0# p@@p@-0@4P, 0# p@1G-p-v0(0S P"@P vP`3@v `kGP 0S40(0 3/0000@005p@-P0(0Sp@` 0R000 Q0 (03/4p@@-u0(0Sx@Cp@-@`PU0 p@,0/0 3/Pp@-0@Q4Pp ` 2/P D$ @p 0`( "4`#/0S 0\/-48 \$ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0( MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00ᠮ@P8p0 ᯮX (d0 Xd000p0(00(h`X0l`射@P(0 00 0Ꮾ xP@P (0 y <03/ 403/Ѝ rZp@- P@@@4?`;QpC-@(0\MPp`x( X  7d< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2"P \Ѝ@ 0b0?o0cS2   ( (0` 1011SX c 010 80t0H0uP X  c 01(0 080H`cP 0  rr2 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000嚭P3 0娭0 FZ!0 00ᘭ哭t` 00 0冭0 $Z x Ѝ0 0 0r wG-@(0XMPp`x@ ?0 S㣤030#$ 0 X  =c011 H0P-X  .c< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2" P XЍ@ 0b0?o0cS2   ( (0` 1011SX b 01|0 H0oP X  b 01(0 080H`]P 0  2222 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000哬P7 0塬0 0Z%0 00ᑬ匬t` v00 0{0  Z m Ѝ0 0 0g21BP31 a1/G-0M01S`P`1 @o (0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0 @P;p@0 X (b0od0@0h0l0040(0D00p0(00X0@P(0 00 @0@ (v@bP@P (0 @ <03/ 403/TlЍb rG-`0( M@p0c   0P*5/PP@008P< 5/PPB,1P 0<㍫PP4< ᜫX (a0$d0H$X1000 R0L!00V,a`NP)d1S Se! 0 Ԑws 05h1h1S 0 !t P000 d\1Q00S 0 4PU 5/P 03/D.\\.\{.\.\'-\.\/\.\%/\E/\K/\k/\O-頠\1@Z!0P4` MV 6/Pp DR 03/(0L ` 000 ``00*8/PD00`80 8/PF9p 00㵨P8`0 ĨX p^00000\90308(0p 00DP(0 00 0㤨 frPP (0 Ꭸ <03/ 0403/X 嵦pߍ x|SPp`< !4 4tp00P  'P " (1pS  PXp(0o1S\1Q0Z0 S 04pW 7/Pp2 7夐8#t200( 0   0p*@7/pP008p@0 7/pP6p 0@0pP@0 X ]0 0@000(60 01(000wpP(0 00 @0ק@ 0r (pX ]012000 0SpP00 3/pP0 0p  H-`1 k 00PpP VWa ӥ 06$0(0 Q N  003pP 0 嶥 pP$08$0(0         Ho48#|2婒\1Y0 3/(p\@PUpP (0u B@ <03/ 403/W p0 `0 n0 c0 0 0 R0Zp ѠБ[0 [00 !0埣0s1 Fz AY x<X h70S T1[ H- W8 4W0A("$ pP ._(1S 0 Pt000ᴡ S<#0 0 R XX :1S* 1S' 0!`Pt161`!A?;`V)  ,    '. !R尰R , p[0 " !(   尀|000D.\ r/\-\/\/\ 0\/\|0\0\0\0\0\0\0\0\/\/\0\0\0\0\1\F1\71\A-P`@v $0 DS P9 PJ0 0(0 `L rPaH TXX p[1q#3!?A1c L\1`06 SQ 6 `'``La H`P  r{ 6Hv `'q`` HLaiP`d T_XX[ p[V<0q#3( ?A1c\1L!4L1-\gfff]1\1\p@-$`P`@0  p7 `l2 Xp-Pt)Hu%@v!8w`0xya |  pH!R0BS2l噣p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yza 2\C-lM@d p(X Z02X{P*00$0`80 ` 0 0 `h0&hS `Pb o(0P 0(0 p8P0`UlЍ40S04P0<0P(0PR`>:pX  UX$0@ #0 01020D@H0@P X @X$0` $0!01020d`H0@P X +X&0160 H0@\Ѝ@A-@M@! `Pp$0 1pA?!0@P !0E@P 1 4娞ߍ0 >@2\!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-Eh$O-P>h@GP)m_601naV!no1SKhGU~o p\`CVn⽖vfv~dvbvAh᥄$phCP 'CpPW ;$00G[ pSCP C1 sP}C-MPpgpQ@101U 0|10p!]?lŸ# 0t$0`Ap19l!cgM 0vuga 0~uxgv 0u mn0010ȁ1ԁo @mB01$ F40 00\` V10㨁 t1@t  Q Q  0zPA-军S@`p0 100PU0S0 8/00PQU0S0 8/P$4\zPp@-VP`,0@0 P`00 R @p 4@0@ 1Sp R  R ,2      0$4\z4z4\@-@ R 040 @z-^ 0/$0a(!"$a$"  b"!4b4#0/0@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Q0/o"0#?S R000  Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 PX\5\@- @q <`Q 0(AXq S65\B5\I5\0@-4M@PKc000(00 0 0    , 0 0NP 000 R4Ѝ0\ B@-£  P (0  P C њY5\O-4M`c@2`2020 00 P0 |5/0Pp  PH 5/0P D媙 pp P,5/ P 0!0>0 4P5/0 4P 5/YP 0 4 ;/U ^ 0 !0  8/h PE(_CSeb(/C#b?0E4}bP> 1  P C ⛚0P00 P(00 000 000QP 000 P (00= 000p000QPh0R  Q0 0\0 0M4Ѝ@\@-ӗG7\@-ϗn7\p@-@PPpH0. `@@@Dż$0媿 p@0-\x>00! $0 /Hz 0(0S 0@o/Hz@0 !!/@-0 !@@-0 !@p@-Px@x(P忘 $0dP$0 ,0KO R0(%P,04S00!pHz7\|B@-@Dp0DS 0 ! 0$ 0407\Hz0$/HzG-`0p$0PUGU !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pk10, TP2/Hz @- 0 ! 0^ Q    D $ 10@X@@@HzQ@-0DPTp@-$0D0P !@8pA-@@TTǖ@pP!@@aQ00, ,$041 0,7\Hz` @-,00@10CS@外0@!,1!,0,@Hz7\|B $0 0!0 00 /Hzhzlz,0P 0 Qp00//{@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S C{8\P0@-  d@/  R 0+{=8\@-P`k_@`00@c00  p 07/PP70q 2/U/,N 0 4 8 < @ D H L P0 L P< Ѝ@ܖ,P P@ Ѝ@a8\t8\{L B8\8\0@- !3 0 !0@- !& 0 !O-P`AqO@U@Tp p X0@U@ 0100 000TX Ѝ  0 @[T ≐<0  Pڶ 2/p[ 8\p@-P @@@p0/{A-`0@P0c  p   021   0 0Q000S$ SAz{8\"9\A-p0p` R0P0Q0C 0@ E@s @{G-l1TP@P\p @X 0HS(,0S Ӕz 0 p0@,0T`0,0 BX!0q10 @AX X iT0 P  @AC T @D{U9\9\9\9\$B\BG-0@pPs0  R( & 0 b ` a/`%RP  Q" 0`@&F @{@-(0@0@{ 0#0{ 0#0 {A-P@0B@`Ap0S  A{ 0#0{G-0Pp0XJ@0RPQC E` p0Z 0 @ G  @  ܓ{8\:\p@-@@0SpP=0 PpA-`P]8` `p00p D1@ s80P   8/P 埔Ѝ0t ?, x0Q  6CQ@ 6Ao60,  0Ao4D:\p@B`A@-@ 0@!S &BS &S; `Ѝp !S0SP 0SP0SP`p' 0P0  80P` ` 6/P@0 \` 6/ {,0` 3/0S8P 0P  p@`A4/!/!`!//` `! /!ḓ!!ȓ!ӓ!ۓ1/c 8!0/c#c4 4#1/!ٓ!!!!@-`P*\@%P0@00 p0 7/0P [P̒ d`6/0d` 6/ Ѝ@ c:\e:\~:\@-^o 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-1p@ 0dP5/0 D ` P0d8/0 48/V00V*U03S 0`4P 5/ P0d 8/ P叉V`!U0#02\?A-0p@ 0dP5/`P Pd08/0 48/V00V*U03S w0`4P 5/ P0d 8/MP彈V`!U0#02p@-D00@ !0 4P5/0 , !pp@-T0 @C04P 5/0 00dp@/@-@ (1(a(q <@Q0  C CP0 00P0 00P0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/ Ѝ@%4\?4:\,B-B7@-PH\ *x0Àp0F0FS0 iPg0@T :@@Dd0 0S B @DT Ѝ0'YA-0P@`0!0 4p7/9dp 7/0 dp7/0 !!@B-0 4 0/-0d /40P 0S/0S<0//|0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LT \\LXp` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPLITP,Z`N `Y  \ pXp B`\  ::0:0 & SC-M`pY@p0000 00 P0 5/PP LЍC0p82傟@   p@W("(000 00 $(0,0 0S3 HUn"0" n2U]"L" ]2L2PUP*00 PPp008/P  1 000:88/P ̏)>0:! yP!: wP<: R? p@ P 0j=0:* 00 Ѝ:\:\|:\ ;\6;\b;\8B0A-SPp @ሀW@0000W0Sbv000S00 0@HA-Pq``@::S QL2ML8P`D01 HO-@  P4 pჟ0  Q ` ! PU X!0pW㋰  } Ѝ '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0P x1 R8 8  01Pn$};\ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzh'th'tA- 0(0C*s`Ѝ1 @P0 d0L`P pWQ  YQ ,X`P,XQ XQ0<00D00 87 H0R. R/ WH01H0XH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 \2H02,00@008000@@0 0S%40040|A-@2PZD`q@pWA80@00S 80S0p 0sBPh 80S80S808   pDy(XDD呍< :RD01 "0D20LML q @c0@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0 |;\/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/4s@->0`@ P  B` 0ŒQΌ Q @0T00 P05/P  0 Ѝp;\p@-0P LԌ00T0@4`X 6/TX0d` 6/p@F<\O-,MVx @ d0SS0 p(а d0S ,ЍS CS 0C$0PA(0``03/PU 0PP0  (0`噻P  偍p7<\EB=<\p@-@$0 03/$003/ $00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ D0 0T @ ` BT0 0p@/0@-@ D T A-0@MA@q`PU P P% 0 !  R00 C1 $003/P00P$003/0P RR 00`C(d0 U T0X 4P5/T0 dPX5/P\?c<\m<\/O-@,M1 !dQ Bҹd0S1 TX00 P0H 5/pP L1,ЍO莌d0T 0C?odP2X5/x d0SS0p谟d0S @,ЍS CS 0C0(P` 0pPP3/p0p 0 0 $Ca h p00 pK h00x<\xBB<\ABABp@- R 0@P5/00 p p@-@9dP8 5/0dP 5/p@ m@-@@s@-@00 P0 5/PP \00Ѝp000(` 6/ 0000<\G-`0 p9d":/d0":/0"d:/Q`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z Z pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z  Z pWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < 000(0"(᷆<\<\p@-@N dP05/pp@-@N0 4P5/0 0p@-P`N@`00Ɇ00 p 0 7/P N Ѝ@m$ ,>`0p<SNH媆8008080(040,0 Ѝ@+ 0 00$0=\%=\A=\aBlbBl_B8_B@-@QP0S00 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-@LN`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-P!N 0 3&*?=0 `p?x0@xp6 x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X0@0/-0d$ /卅g=\ Q/0内=\D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PEU A1\?=\=\ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P@`U 0p U ό0S X@x0tdP 5/0dP 5/@p=\p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPp1-Q  /0L0GP%0 d:/ 0dp 7/ dp17/< P000!H 00`@00  00004040P  40L0H00H00X0( $00040(0(@0P0T `^T0XP0T0@`0dp 7/ d`x06/0d` 6/@`XpX 0V0R0SX0S<0 0 D`F >\+>\:>\\?_>\O-0@4P, 5/0P( 4`6/P PX0S   P0_ X0@0S X0<0X0H0@( X0L U l X`H0p+ L0p 0< 4:/04< ;/ 0 'X0L00 4p7/H0  <0% 0L0/ 0< 48/04< 9/04< :/H2$p 4 < (p,pLpL0S@0SP0<0cP ]PX0S  `  X0L P0 X0<0X0H0@(UAV\n \:PhV E1P` XpP X` `0HP0H0@% V P0S+;`P I %YE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MPJ@P" 0P 0 P05/`P n `4Ѝ0p"P `Y0P P5/N02p0ltPP\z>\A|>\`kB>\ N>\@A>\cBDA>\lcB?\?\ p0\ ?R"0/A-P` VP+7@P 00S lpP U@ X0@0X0@ `VX00 @@h|p@-lP VP`6@l`PUX0 U0 X00\0`0p0X0hA-L@`6lpPA@ \0S⯿@hA-@L6PU `80lpph0uⱿh8?\p@-@p`lPd⢿p@X0 @-\0@S ` 0\00s00`R`0(0C#p@   t ᄿX /|d0S/p@-`d`@P'h0 0!T0$LH @   !ɭp@|Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P@dP㝭\0 0T ?S53@0ᐭ2 03/Ppp@\?L?\| P0 P!ڠ 0@ S0/P P t`S /d/`/\/X/T/P/L/H/ /</8/4/ ?\W?\q?\?\?\?\?\@\ @\7@\N@\@\@\@\-3@-@000XT0D 1 01XzЍB\B\B\p@- 0PQ@ `M ` 8H}U < 0 =}܍pB\B\G-p`@ V@0s5 S20s/ PPE_oRP! Q GP P Q GPP Q GPP Q GPPY U @`FPY P 9/P@-@D0@00/X0 @-{(/B\@-D<1 S  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/PD\  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( !=8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0@ P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0ps`X d,0B"3/P @Z=@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 00D\D\@-@M. * 010K/0  $!(! 111 1014!, p1>  ލ0BA-P:o  Q'R Ro@:o`0So:(1$!o0aVKO0S: AlohhծoV XoP`oV: ,o$#0 S(0 o o@T`o\0Slom:0 do0S S||\otYo 0SP0S XQop0S\Q 4Go0Eo0 @o0 ;o0 6o0 1o0 ,o0  'o0@ "o0 o0  o0  o0  o0  p ooAwXop 0S<nQ 0(An$pnQ 0AnQ n,pD\E\E\cE\rE\tE\G\-E\EE\E\E\E\D\E\vF\E\E\E\E\E\E\F\F\!F\@F\LF\^F\iF\F\F\F\F\F\ G\G\+G\-G\=G\LG\WG\cG\hG\nG\xG\G\G\G\G\F\G\G\G\O-P@pa$!0r0C?o20S (!0r0C?o20SPA Q> <<P;P8 Q5 3<P2W10S w9pn R(knpW h㌨@h J=0041@041C}C/;=0Bp Y `W ,@n$p 0800P 5/P o @ 8$D0<4>`P2嬢42 4HVoG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$420Py ҵPVo0 ȵPLo0X4Ѝ$b\B&b\Bb\4BмCB`b\CC CXCCCCC8CCC\ClC(CpCCCb\b\ 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0e\A-`p67BT P@Php@-b@0 P nPpPP  0 22D 0(1S5Q  "Bf\b@-@ 0 2p@-`P6@P  P p@n 0t(0 0P p@0T1x0p0p0L1l0P16`nP0P PP@tn0T102p@PB.f\ dB$BJf\L C C| CMf\ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`;6|4S@ Pq8@Ptp@- 0 R\0S 0 000P00 Ѝf\p@-P600S PpU@t 0  twPP xQ t0x4< 0pPxxQ txTPZCO-M`p5@=m` tP  P ЍOm 0A(P0000h0 00S0404РE>L00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPp3U@a 0L#^P$  RPP $x0$=1S 0"P( P0 "T-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PUEkS  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0kBߍfPU$Q $]aCwi]n\#En\o\G-`@2Ph]j@ X P G@j 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}2g 0\ R`!0P xzj G P P01bjn\B!n\1S/6!Q0061210/-!R $!$10(!21//0| 00Q  Q  BQ6!0 210/-!R $!$10(!21/6! 6!6!061 ltG-@ |?p(,5PP` T1S`Ѝ-P  0$` 06/p` 0  刻p`ܑ TE 1TV 1T0CT 1 C T 1?A3c0哦\t]t@{t Il{]1@Xt@1(@jt@mt1(Mb?1S/,!t       000 l0/p@-@P,10,1@1  ``0d 0 `0d 0D!@0 0910BRS91091R91@09109!t3/P1Sp3/0T1pp@- ?`4P0@ @003/T1S ,P 0@0SpG-`0p#0?T1S@,P D(pZ  SPP⨏ZȀ F0P * 61p061 Y ( A6p61P061 $0( S S00@ 0990`1S@1Sp8@/80OτB 003A1+ \R? 6!@  6! i R6!@ =!@!051( `1RgS61>!0gD!0ETPR;1v011,1 ,10,1,1 ,10,1D!0R3003/08v/!Rs /1AoR6!=!@ 6!6!6!  S61>!061$0 0!1B88O-0 pLM?@P`LЍ0  1S +P P0 `pP 0WP0 n0`@0Sp̠L1S 3/P o7c`>0T1x`0d 0h0S SВ0 ` dQShP0 h00&091@1 91091D1S91P0 0CS91091t9! 03/0 3/37V?  !?l0@=K,!D0t0 D0@00$ )$ $ ($ $06$00`1C|1810<1l1D1ʭᴮ1 1181 01,10,1 `P0  03/`P3 0@00S-*eSw Rh00SZ=9 R = ?A3c2#d S 0"#!0 "#1R 3~?4qMP|]MbI4|+8\?`_p@-0 P"6 0?T1Sp@*P ?1S YU,1 ,10 Vp ,10,1S,1 ,10,10p@-@P 嬣@gp{O-T!R K*P 1!PR 1! A(0q 01pBR0  R<" 0" 5 @V`0@S @DWb A!  BR!V:,!K ,! ,!9! 9!D!R:9! 9!90@`FSAV    R<1! 0 03/p,! ,! ,!0@`S @D` BR9!@t4/,! ,! ,! 0!R p 0q3a 4A4qA!@ 0 2/@!  /! /! .!R .! $   h0A ЍO Ѝ8\?B0S/&O-T1S @r)P tPI03/0`S E ЍD1 SPf03/c8!03/03/`D1 S 0S @0V 3/1q0 R 03/ Q  $ P\ˠˠ \ Q  D!R0 ,!Le `V03/03/`j0Sf0S`V`3/0A  3/8!0 3/;!03/ < @010;0a>03/ 0p3/ 03/03/P0,,0 3/03/0P 01 03/1Sa S`0 3/1@S` 03/\ aQ}]4|_}]'o{]BD}]!~];~]8\B8BBBB|]L~]BU~]P}]`}]j}]w}]}]~]}]}]}]}]}]|]3}]|]|]<}]5~]pB0@-@PM0  0 00 Ѝ0p@-HP0S p`@]P 0ST00p4|@-k$0 0 t3/p@-_$@tP 03/03/p@-P$@]G-p@ `APCQR U010! A-P@` 0$ pE\:!Y X0 A\ ^G- P$`(p,00 N\:Y AY Y@0 G V @ AT/C-@P@@0$M,c 0`uЍHP p@-PH0 & @4 P t1  0p@=upH@-@xPt`$0M\pP t1 0040 000p`00QuЍHG-p0P 6 0`0x0@U  Z40 0 0uЍ0 00:/p Hvd@-@( $0$$"6 0@ctH@-@`Pp<<0$M((0 00sЍH@-@dP`p$0MH`nP t1 (0 00BwЍH0@-P$0M 0 0 jЍ0LC C@-(0 0600[ЍLC C@-@" 1R0@-80( 4@"6 0 *$p@dHA-pP`@"^ T 0pA/@-"@~s@-P`"AT 0( `4/@P XЍpvdx~]@-o/@-p@-"@R_ᓛt1~]A-@pQ (MR`SPt1 ! R0ót1 prX"*1]S8Ì1\1S `1S X1SEB9p0 # *6p0 #**6p0@ #*5p0 3 #?0\!#b`1?p1#X5X1%  /0#!0$+4l1t1h!@040q* /0#!  05 E!1 0`10\10X1YQ 1Q YQ zYxYvY8  EP"1(0`1!,0\100X1401L01P0, dX0X X原PHY@p(ЍA5 (Ѝ~]~]]N]b]|]~]`CCC]Cp@-P@Ro:Qvpp@-tA@ P0 R*@PpCt1/G-R@`PST1S OP UI%r%%` P1QY 0 9`0 3VP,{%*4*"qLOGؙ\?]]]p@-@R_iqҙT1!0CST1SKPp@qp@0S$00R0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000@P,00AP@(0 $000$  @<0L P '1IUDЍ0`]A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 tX9<l=D=S   0 ,U9l=hml]衆]Ӏ]O-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P DWT-X=\R6 l 0;/ 0P4xV]@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+XT-X=\R0P  5/x0PX0 `-W<T=X \S4 h `08/ 0 W蠆]@]000 ͓0\ScB⺜p@-Ph@#C1 01  hp@,CG-@}`J-1吀011S #S3P11011S MPP 10CS1NIPp@-@mP 10CS11sNp@2=  -0=X T=\`S4 0h /D A-@P`}X= 0\8/  D=SpWV<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/d]p@-]p@1-P XKV= S-<XS=0=80>03p ]] 0!< 04 0 (   !/HzhzlzO-`@P0ȠY p3 ⷣ LS ]P U  0 0 @ T0 Ѝ躁]\ P/0 !8 00 (  , !/Hzhzlzp@-@P T܇9S 9S 404 0@a 0 (p@C\?gfff"CD=S/p@-@=P0C==0CS=>3;3p@hCA-=PS`p @PVD=S@ 0 '=@S蠆A-@p !P`P  0P Q- 0T  \YUЍ0A S  ,LU 0  ]]@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  {L0d 9S 0Q Q   Ѝ0  D<]G-0Q@pP0MQ 0ЍQ z 4=3/|7S ("h70?0?h70?|7S 0 0@a 0 (|7S H/ox"L{"0 \%  R # _ 0Kq V BJ]\?gfff"CA@-`M MP@P#EVP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q XenP2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp 0SSp E /  ("( E JW@=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 00H0QN0 pN0N0%*:iFA-όp` 0P@sP 0 `kP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S* S S@@S@@n R 3 t0P X@Ѝp@ S S@ S@S@@@Ѝp`]O-@dM@=S D=Sd?`< $0 =0=S >S3;3dЍ9S9 YU 0S990090C9R0 D05 p 0 P 4 0 03/039Sb.030@]  NP303TW ?9SϓP U ȓPU 0S000000C0s R0(P 0 S30 03/pP[2 0 ᫀt JPPᡀ\"(0傿)0Rd-! "G\ʔG 0 唗D9Sㆍ P0S ` P 0!:> *00! 820a08/ᠾ(0"0D100 0>00KC19- S) 101/0< 20mᬽ(0 501=0$0P( `!0 Q/d=  P 0 H00YXZ Z!0  b 0  & 0 PD10=   =0C== S-,0{>0>p荂̍]p@-0=@S 3/`D]U' PP `V|_QpT=X \S2 d 0``6/T=X \S4 h ``(06/ P N]C-CdMpL 3` <3`0 dЍPh RU`@ l#0D?o2P0S P哒ᙄ  V00P`@UHP僒DH3@<30G-MMpG@ l$TSPPnW`T$A0Vk  V7* V  V @-R lu$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  0 }0 ۍЍ \ R\P@-R 6  -g P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!v0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0ᪿP Pl P9S9  09b sPP [@ VF x9i*F%?- S/@-@pP`,M r @"0 G,ЍC-3@@DM >  H=S  CR})9 N L)"" FPP> ?PP@ 9[0 l U Cz@PU0@0 `P3@ > Ud=;d=DЍSP-1R >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#|]$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> AP=0 .:^^XW3XR=3 ,=3/@]G  O-@P@MX,=3/`P0@= K>?oH-2R0S 9l&89d=0d=9S00`P  ?;< ?5989H-R%9" ;Sږo%#}> p ;C("( ;t0} 0M0 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332 |T=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  - t@Q BH=S 0 `Ѝ  H=S ?  00C0S00[2ӕ Q1ڮ۾=-  P  P3M `D/MT-X \R0 ` 003/ 㭺1YM<`T-X \R" D 003/T=X \S4 0h `9/= [0=<#]F]  -%3`]2D I]8 1Ђ]]]p@-P`E4P@@MT @:fp0p@-@2@=Sp>PS 0CS>02tIp@>S 0CS>02p@bBH=S >S >]C-PpMP@ `@P NЍ1Y0CYD1Ye 1Y 9 - 09 *j94P@4 =#@=S M\1Y7 1Y . [@P#@= S7 9S    @y S 4 ᘛ4P@3@ @p>0 @0 0F@@P4P@3@ UH=S@2iii9iO-@=@SdM .P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0JP L0 K  T-X=`R" D 0p\7/=-0C==0=1 k& T-X R$ H 00\3/00` (0P㖯) 0X*7BK= 0.`3 ;3B& T-X R$ H 00\3/<0 0` 0 P▯= 0)BZK= 0.73 ;3 T-X=\R  0P5/` 0p`1,)S { S  BS T=X \S=4 8h `P#85/= l3  d=0S $P #0=00 S0"( :0=T=X S2 0d ` 2 9S8t$8W9Sp02"'?`P' WM0 .0< p0pTp(p320@@00` P! (Tǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК P 3 "*8S00C8l 4yLnw 0PX(Gx9_ 8{P 0/9)` V%0 c ~ pQp  ⫐0H(མ=[8%)0:J= -JZ%8-J=0= x0F&>=~)0 S$IBb,Pp JW #G G G T⼄ᯗ lGV\ GX G )W n`` pQ 0 /p0G'བྷ=[#)08BI~= -JZh#BI=0= x0H(>=nf S0 0 042<#_0CSy0d=0d=9S9Sm `43/acd=0d=_H=S >Sh"PS 0>P9SMd=09`S 4Q`PEUP#8뎄 U >^pP>P5 0$ 0 0$ p5&00 02` S08#82́ 000H-Q0R RH RI x:I  0> h=P``:g>  L0>YP 1>#F&V   01  ?& 22?2 ?"LP0C.>2>2?5?# R #.D2P]]]荂t]x}]]]8]L]r]]X]]O- @ $MP( E $Ѝ] ?T=`X S2 d `P0\5/T=X \S4 h `Pp85/0D=0P0D=U_}0 4[P  PXB  :w E0 00 E0HeGQ R)E0SH=10S"lzE0H=0 000P0 0d1!,2# 0L=bE( q0(=v pWE0H=0dp0 0 1!ᤆ2# 0H-P=R0&SS+ 00x0  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=H=S% %S0B EH=嬥嬕S L}d\:9"a0@ghDPd:9ȏ"a@h 0$D  )+4),|04p@04\r0404043099!= 0 _P G:0㠠 0I10S S2 Ԋ=베YH08 >PG0  SBQQ Q"< 1?0:H=S0 d=  0 !P0 d0מ0d= d-H-R' R RB d-Pt#Qb?d= d#Qژ0d=T3)Q8<9 9<9< (S:S/G/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0T 0 Pe 0SbڴyX > 2 t=2(x=6=⾀ᰀ Ջv=\44=4!8=141:1:141=1=1=1 =?@p1X 0>9/  i>pL1a  8`>p0T8H0P-d=1R9 <9 p@-@AP3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002:`ap : 6N0@000eC@dCxuCdCdeCdgC xCpC\]@-@4S@/G-3PA@,p0 <300 U SH幄bVH3<3㷑> - 2X>00`V  P 3<300 UHG΄O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p9Ѝ腉]@-l3@S 4S 3/P @0l3踉]l3S/ 4@-S@3/0l3A-@P`,T1pT 0CT? 0CT  ʏ@1TP @30300S@ J@P3A0@S AS SP3@03l3S  ኏4P@3@ 2iiX@-@VT-0@ p@-@(4S 3/P7Jᓁ&⇙p//O-@`pM<0@P( 0 08DPE/0 S Ή](zC{C|C{C`iCZ]B](CpC\ClCp@-@P):pp@-@4P P]p@-DA-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0h;03 \P05/2 ,P5/2P,` 6/ `8 P@U! 8 P03\` &N6/0 `xp0 `VA5H7$P@ 470P,7#Ph]]]bCbC̊]]]#Ê]O-P \h ( ` ,@,4/ R@ Wd70 0 ,P5/0D(0@0O-p\h@R`C$x102c000 0Z PPP Ѝ00$10P t0S 3/0 \$8/ ,0,3/" t0S 3/0 \$9/ ٧ ,0,3/U d0@ }PU P\?܊]\0O-0Q05ph` @^ |0 3/}㠧0 ,9/p +40\89/  hP l0 [ $0\p 7/0 ,P,5/t0S  3/0 \$9/ g0 ,,9/t0S  3/0 $\;/ Q ,0,3/H XʠYY Yp0 PPYp0 P t0S  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PP t0S  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PX ЍX;6 t0S  3/_0 2$\ 0 ]^]g]p] 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@` 0p@i|PvP\ 0T @0<$3 0 0 0 00 0h0 03/|]]x]O-\0`pQh@P t0S 3/ 0\$;/ op +40\8;/}d0 ,8/p +4 0\88/ SWx0S 3/ OV(0,0000/@-@0\lhA-`pP{@C|X0VP`|`hp|k`|G|gdC0 RD   R8  | R, |  R  X R X s@CCC#\C@-@0Q !@\0@00A-`P@0S P 0q@P PsPp@-P@tp@p@-0`@hPaP 0 \00 ,@,4/pj{P 0 0 0 0h0 03/P 00 0pp@-@P#|p@0,)vG-P 10!Up0 0$C! $C1`(, |T 0 S0 (ЍG0 PЍ}sPP  0 P  0$徴PUP\?Mbً]O-@MphP{ls`P ߍO{yP$ \0W%p,,4,$0"Z:@<0 R80S@p<0$Rt{80SOʅߍ0s80S<0Qt0S 3/0 \p$7/ 0 ,p,7/p<00St0S 3/0 \$9/ ١0 ,,9/<0 R@ 8 R4S@0"w0r0S?{<00  :{<0S( 0 %xP ){0"w${ < xP {<00 Rp     {`mt0S 3/_02 \$0:/ mX0\ :/0\ :/0 ,:/XP<000 ,:/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 03<3$Ѝ 4à@  P ^8pP pP#8 Mb\?$;(8,5.`  @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPn\0 P0h0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@00V@0 00W`V 0  @0 4 iT0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

H0 0<00@-P@M  H @  )Ѝ0O-yM00 00P0x0S0pCU0D0y 0` $00(00$0 , 0 00`0@0 000x  0F| 40F0 000E4  P 2  pX$0 XѼP$0 E80P |2  pX$ 0dE X⽼P(0 ,0$0` 0 0@0050 0800x  0<0| 0F00 $TP ('$P ]P l1 > pXE$0 PXyP $EE0 ,0#0E0(0`0$0@ 0 0000 0x  840<| 00 E P | J#PpW@@#x0S0S @Pd#D0SSU0SS Px#yߍ]ԏ]TnTP P /@-P%/]]A-@pP0SUA@0A` `FV`! 0PE@G-@P`0S 0X  P @0PEp pGWp! 0%H0ppGWp!P @`FVO-PDM %  !  !  ! "+P%PP0#0P%PP! PP0!0#$0P 00#$, 0+<0 0"00 0#0@0+(0 0"0#,00 "`@ 0,p@,`P` @`&! @@$$p +! p p' p' , ,,0, '00#0#0#0# P(`pP!!@!P P%`#, p'p@$@ `! @$0#0#4(#0% (8,%p# p'p,$ !$@8(& @$+  4!() ,, 0,  , " " $* * 4 P< . , 0 0#!.(P%P%+0# 00$ 00#0#08000#0#0 00 ,,0#,0# 00DЍt!t1G-P@  P@@P਀` ᩐPP`pP0 `0 pQ@! P A, @.p  q)1 0` p%RPPR$BpP@P@PB! ,"0 @ @  說UUUU3333-$M  $ЍO-RM  RO R p pG pP` 1"A0 `TT0000h`ᄡ0V,`0 0`T0 ` S@F0@ S 0`` P   YߍpV \ ꓑ]UUUUp@-8@8P`\p 1001UUUUO-R`M R. R P P& Pp"Aq m TT00 0F[`N`0   T  WЍP[Q 5ꓑ]O-EMP@PC 2 00`$00r(0 0,00 0000 0 0`pG0( 0 V000000 0 >0  >2  >2  >2     lEߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/L00 0/LO-@p`PDM P800,p($@ @@ @`008 <0,(p$@ @@ @QP0 P000<00,(p$@ @ @P< >DЍ蠑]`CA-xM@P`` pT00H0X 00 000000xЍLA-@PM TЍQ  0`P pq 8P V ,P@TP@P 0P0 `!0SPPPP 0!0S(  광]]]L]|-]C]0/L @-7  @-2  @-- @--  @-(  @-#-/L-/L-/L-/L- /L-$/L-(/L-,/L-0/LO-M @;0_0 00 S0 0SPq020`0 03/  003/ 0  K0C00 <,p 003/  0<3/00 \00V 0(0,0 !" 000 03/0@0 4/ 03/ 0 3/@@00p0  l02"  P aP y0 90 000  $0S !&.LPP &> 0S !&> &>ş 0S " &> P0p0 59/5 0S !%tP p5 0S !P5<< ҫ$ş45 0S " 5 ëP0p0 49/4 0S !$P 4 0S !|4dd ✫Lğ`4 0S " @40( ⍫P0p0 49/4 0S !#MP 3 0S !3 ftß3 0S " l3XP WP0p0 83?9/?0 0S !? P ?0 0S !?0 0?0 0S " ?0 #P0tB0&.088/&.P &>, Q /&>P&.@00!08/!P 1 !1P&.!00x!0x8/`!DP H1P0 Ϫ!01ɪP&.00!08/ P 0 Ⱚ 0⪪P&.00? 0@4/? LoP ?0X8 ⑪$ ?0 ⋪Pߍp]]P]TnT_]X]_]h] 0A-aHM0 @1P4/@ #C@P @0 ce@ 0`00 !p7/@ 1.Pp @0 qO@0pp0 `X0 6/ `P 0, ?:`HЍx]]TnT]x]p@-`@pMPX [ W`a R O@Tᜲh pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\08M 00 00 P Z 8Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-`p0MMPStX@pP `⠰0 (`(0塱7 `❱ `♱` N Q7 (`VIM0bP w7 (zʱ G 27 (.h *`^0 `0_7 `[`⫱p 0b"!4b4# 0(0 7  (p0h 0p0` Mߍ.7 (1ၱ ( `F O-M0@, ? R$0(@0 0$0 0p t 07 0001  E0Pppn0ERt  7`EPS0婠@k0C?o200U 00 Q @7 t0 4 t# t0P  U0Q00pp0 Q@0  7 t0@ 4 t0@7 P@@R tRY@0Z_0S0}$Ѝm]]?]v]p@-l@P   ,ap0@-,M@P4\0  0  000Z?/,Ѝ0<] 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pP`4A~T 嚌, LaT@! `PU,QP N  U0 0  0K< 002  ?,QЍGq\@-$MF`||p0 P@P D0!4a000lQ  ቿ$Ѝ<\0@- $N@ .D\ 1D@- Ѝ@- { Ѝ@- Q@ 8:P@(6 @Y`D@D$HD,}G]?D{]hp@-X0 QPIPP 8@B@:<@: =O;Op`,}P P /A-`@0S (O pPU0p $0WD0P P0D00p0H0 @0@0QOPP@`D@D0},}p@-@NP?o 2R0SU T D00CD00S   ((Op  P0},}]p@-PHND0 @T0OpVP@ 00 00}`p@-@$PN 0 0C 07p@N,}@-@N 0 0 0@N0}G-Ѐ`  FRp@0SP03/PPV0$0pPW`坰SP p@V(0$ 00q,}@}\?@Dp@-\@lNPU 00S  @P 0 Np@,}ķ]4}LG-RP 0$ R\ AAR3 RA @ 2RW _2C6CR00W0P@  00e@e 00E`P 00@|N j@`RNLPA N@T 000@0?N< AMPU 03/@P$01`0$0@00S $00ꠐMX@D` `@|0 pD0S0W0T0SP`@`N  p@@ww w4},}`0}@-00@T P@| ,}]/@- 0p@-P@,PR᦯ቯ 0pt}p@-P@PZ0,`000<00@] h崯<@P Pt 0 @RPpp@, $ p@SDKDKDJDH]pHD]g]@-Lh 0O-`pp@DM!s0 00<0,(`$  pP<0400 ,0H0z@  00!(` 0 $ @`pDЍH]p@-P<@L0,`P@004 V  p@\?]]t}P/P0R/t}@-0 ,0S s<00,\?@- 0,خ\?@-0 @  00<P q P `PP tf Ѝp4 0PP P4P$t}]ID])]4/0|'RI032^O 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P(0@Tp0S @p@-@P 0T 00Q 1S  0<1i1Jp91S!!1! _df L(0003/p@Xx]}]荂 0P 0CP@@t #/d @#/ N @@80P 0CP(0P #@// ̇?0S@-c. QAAL0Q Q 0 0,1&'1 0Q袹]] P P/  N /P PP0// p@-`%P80@Tp P @p@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P8P 0"pA-wn0@S!P !R d"00ЍQD@2厏1p0! R U T 0 S1S !0h  REVv|@WpS 堁Q 6Vv1Wp舄U} UyLxP qG PLM0 S'0 Vv|Wp'e L0! R U!VV0 S|Q0!V&R! 1?0|8|Q|f]]x]]k]C-@p/W2 0iP>05/cw^ 0o`000S P0? p /00p W`0S1001^n80 Sd001c00N8fUJ0S00d0Q00@Sg/1!p11S4H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 S01 1S  0310@0xj.1S(01 ЍCb荂]]}]LD0.R  "-" R   wP/P/////|0R 0\ R\ !L/P x7S0S/h]x]O-`@u_Pw>0S4 0!zpx0Slr@TP P W $ 00\p]]]]p@-`@%PP0p@ .00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;긻]o]O-@0`pTM 0<^0 _ ⅿqw>0S9+ 3 a0 _p7  0 _p7  0 _p7  0 _p7 0 _Y YpPP0S] (RD_X 2 0PT TЍ\I0X0 S0   0P 0p _p7  0 _p7  0 _p7  0 y_p7 0 p_0 0RʻP 70A  `P( 0 S0 `` Q_p7  0 I_p7  0 A_p7  0 9_p7 0 1_pm]@B00 S   P 01А/x]G-P@PX"B-\8 Q2 +Q  Q/ QwⴀXa` 0 S&100SP6 P Q$u?0XPpQ0Q Q 00 P PWP2q?0^ PP00p |p  ppWQX" 0S `P48S|74XS h0|w7h78 TI:J4`Vh78h7T]J0000 000/s@-@d ^1 R S00#0 0S0:1D!0CR 0 D10D1! 0!0 0 0 00 0%00n\0D1S 0S00 000 R 0D10CD1! 0  R0Ѝp0!0 0  ̽]]΀\Q: / AA!  ////p@-@8 MQ1P 00#!" 0 0000 `0V :3/P 1 p 0L 10 18003/@ H808003/000<0 Ѝp ]+]|]G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::|]}xbDbDbDbD0S4 f( QQ  H]/៽]}0S< bAR0!RR    4AG!/]}P0P//}QG-@p ڐ1 0  $10$1Ѝt`PXQ1L(10(1<1P1 .0 Y ,X  p7岠`7 1  0 `W p71 ! `80S0S% `03/P1 H!A0 베,10,1W11!1P10o0 8003/ 0`R ᤚ0 9/P  120!S 0! t I0v W㲠`0`4!S 4!j 4 W0f c0000@]} ]A]7]p@-@P:3/:3/p@-@:3/:@/G-8p(MW$>1@P` ᴐᲠQ0 0#!"! 0 03/P1 0 00R0000 101(Ѝ \0R 1 <  101 :(ЍG/ ]]]C-`@ 1RP~P1US^1 Q0 0x1 000P Ѝ08 R< 0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*r@P  \# 0 3/P r@|]m]]C-Pp(0`S!R$  X 0@ n0 0R@@@N@80S*rPU 00 0@ Ѝ (0 S*!R ,  $03/P]|]/A-`P@HM p&40%V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p ?*P`ЍH]@-0<S !  0 b Ѝ0l]<@-@ P0@00]/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` F%ЍpG-R@P<M0 % ` 1 01(ppG0G  0h P 80R  $Ѝ%i$"P//O-@<`IMP 101p    8 000 S0 0>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  J0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍ]]A-@` >1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  I0 "IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #]]p@-  0 "000e $}P$\ 1 >  0 &0C   0SH Q1S=Y 00 0 0S9x 0 $0PP 0 IP 1 $ 4F0P H}F(= G CP 00[0Z0S  %P   V%PPl 0p000[|7S0E00S0S !R 0<<0ppW9p090& 05 !# #^  #P  R\ Qʐ! +0 00 p' l000101p0S5 SE 1S 0 0D; 0Sp10p180080|7S00S2S14+ * 00?B D10D10 q7/00` 00(0 0pP gP 0`00 01 |78*`S,0X 1 8*0 Z000 03  0  W P1 90R?C0C?0000`zX0@0. h71 H)00}?B '$00$0101Xx8S1 (00Q?B 000 00 0 2S1 ("00Q?B 0 a6/ 2" 0 S!-0002021 H$E!= 0xS!-00C02021  HE!= 0bPQ1Sz 3/w1  HDP1 8M HQ 0SH1L1 P10CP1S0 900S000000 0P0101? 0t 0S0t0`0S*f`P0`  H 0S0S0S0S0SXGbI0 0Sp S SLX R00 4(04$0$04Sf `Y (0 0C4!<0V0` 20 %S ! ( 04  C00010100`00$00 붡0 ,0$0 00SG Xe070倀08X ! Z P   P 00#@ e,0S 101e000?b(`c(0 0(00嶡$0S l`|V0`+g080 R ,003/P 1 # ?B B2101M00 0@00 Gb2L: XP40  0@004th0 0 0040a6/4cZ S  03  CH10H1EHqW1 HB ne*L10L11S 3/0SL1H100PHP1X7S  HA I1S 3/ S  HA0 709000000 0Spp0p 000O-S@Pp`MD #0So Sl 00 |7S7S  40040T@S PS- 1S ?-Cp BP000BSh S] S70CS40040500CS 1 ?/0=>C( 0C0L00L0"h7|7S2S 0J S1 4?D/Gr0=>C!0CL00L0S 40040Ѝ, Tv0d0252 5$YX0Zp0S1 =.Gr0;C!0CD00D00J S*1 >(.Gr0=>C!0CL00L00SS  2St *St 0S ! -00 P00P0SPn xl00phQ1 =-Gr0=>C!0CL00L0zx7S 0450!0P0C2X00Z0Q1 <,Gr0=>C!0CeL00L0Wx7S0X0Q1 <0,Gr0=>C!0CML00L0?0`0H5Q0[0 1 0; \H00H0Q  04 8 <+S0S JP |~0S! 8+0Gr:!H00H0l0S1 \:*Gr0C>C!0CD00D0 R1 *Gr9!H00H0X VY1  D*Gr9!T00T0YQ xQ 1  )GrX9!X00X0A=P:1  )Gr9!d10d1xU !/ ) W101<00<0101|7hWSPm2Sj U   Pd d87![0R 1  @?[ 71w. h7R7!66h7[071?%0#  1  @? ?w>0S)  45?|Q 2  yP5`0S ;!0:1h7 0 000T0"08U l7 ?l78l70 000T0"5   P! T P 0`P00 0P  ᥽x8Xh'* 13/?S PT0- d⋽|wW 7S 40040  0 RY/1 5%0N>C 0CD00D0BP*1 @5P%0=>C 0CL00L0P 2P P00S ! $04 zH00H0lZ1 4$0C 0C-`00`0x8Up W - pPU 1  Tc> 0 00 00 1 p2"0U>C 0CW   P   -P0P a6/1 HR  ,2<"0=>C, 0CL00L0㸑qἡ  @> 0 xph:S  0 3/P1  B 000|7S0 a86/h7 1A &00Y>B l00l0|7S0 a6/xYE1S h 00]>B J]]]]]]]] ]]5]Z]]]]]0]]]p]]]]0]] ]q]]]]]]]@@]]1]s]]]]]G]j]]]]]$]@]PPi]c]] 0 C  ! 00 B000 0|Q4px0p 0S0HP! 00C0\!00 0- B00000S 0GSX 1 !O00]>B 0S ! !0 0M B|7 "S ! "00m Bo7S ! h"00} BHW W㐑D  2I/Cp BU0000x8U,  PP` 2 020000P ,.1#  T<H3V P 0 0, a06/r2 `x8U f #00=B ],P^ #(00=B o eP  $>00=B h00h0H(4  T<` Z7S.W) W7,P H&0,0Z 1$  Tp< 0 x8U<10<1h00h0 1 3/P  ,忺0 a6/1 |5I/Cp B000Q7S 13/Y 0S! %0J?B y000|7Sp x0p |7D&S ! h&00 X7WS 000x8U   PP 2 020a6/1&  T;  6 0S }2 $7WSZ 1d'  T; 0 x8 U<10<1h00h013/V 1 3/O1S 7w/C BOd00d0|7S?0 a 86/7 W00(000 0 I(S1 t8d(Gr0=>C!0C)L00L0x ,P 1S 8(Gr0y>C!0Cp00p00S"0 $0000 0" 0A S*1 X9H)Gr0=>C!0CL00L000S0 S  S   0Q 0S"1 9)Gr0N>C! 0CD00D02S0 S P P$0 0$0 00S! p*0Gr:!H00H0Y1 :*Gr0 >C-B 0 a6/000  C !0pp$W,1 > pM.C B0L 4P 8P <S 0C?o020\3bqE0p01D/ d? ,B>C B借! 0?Q.C\ W1/ ?p/C00Z 1/ ?E.C*0A@0P ! ;F.C0 G  00 Q 0  1p :I.C B.D<08 q8 <0 HXB i pG p  1D*R D: >CK.B  C !0pp$W,1; 9 pM.C B0L 4P 8P <S 0C?o020\3bqE0p01`) h9 O.B>C BLL00cWF01 441)  T80 00S8C0FD CA@8,P "0,0,01S  T80 Sh8C0,T 0( a6/ox00x0]00 /Ph7 1S  T80 S7C0Y0( a6/C|00|01000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 0P ""0004P "$04020|7S7S 400400LS1 464&Gr0=>C!0CL00L0꺁xXX 1  T#850W 0 0tx8U<10<1h00h0 ᐕ 0\Q<1 h5T%Gr0N>C! 0CD00D0LP*1 4$Gr0=>C!0CL00L02P  P P0Z   P0S! X$0GrX4!mH00H0_0ḡἑ  1  T730W  0 0x8 U<10<1|00|013/;X㺯ᴒN  pH 202-wh7Q / ? 67Qh7 !, h7R7!66h71  Tb7Ÿ h0WR 0 0    Ÿ   13/20276h7'0R40040 0CS1 1!0=>C0 0CL00L00q001 01һP400401  T 70 ^|7S S 40040 1 3/x8U 0q00101 㟻P400401  T60 +|7S S 40040o 1 3/hx8Ue pa]]]$]@]Q]}]G]]s]0]]P]]']P]`]m]P]]] -0@-@PM0 0- P6 0Ѝ0@Ѝ/]A-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0彴!GR # 嵴D1"022222220 " 8,⦴" ZN⢴292S988-#87 0C2c70r0Q   ⊴0   04Q   0PP0C03254ꢹ]A-P L0R8pL `@|'R"`(R# #0 83/G?G/ @0?@D00Q0000L00 <00 R  4001H0O-`qF尡MT9 0 Yd (  ӟ00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0!GR # 0S/S10C1ߍ(0 ߳ 0" R 0Q   ӳ0   0" R 4Q   ų ?P0pG@ꢹ]@-1CMS@CߍP` @P p  `P 0,S0Q    R,!0R 1Ł@p@-2@SP 0aS 0 6/p@03A0AS@-@e j/C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍC7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@RCPPa4VA  MPP` 8. 0000000Q<<0  0 0000 P00' 䬲 0R ࣲ000U @ PDVOxc n⍲  ; xW_o`/R χ166S1 000P U0!01S 1PTЍCTЍC"1S PP  `P !ZR !ā BP2괁X PP  `P 2 01 SP0} pl 0"P1UP0UQ D `(0PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/]],D4D]0|7S2S/004 S00R  0 u0000/A- MPp%@`Pl0$`S9 BS` BS!? S* SU  S `Y$02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C Vr@`U0"0t"]0h7=$`B000i;0d 0k VL 000X]]]*-OH0DG-p M@`y'P`P0'XHS^ + BS*? S* S  S {`@'?;CS00$'S?  Sj BSX0Sj p7 h70h7s&Sc 5, BS  BS&?;C0CS0&SDX @0SC00P0S Q>⪎0pⲐWC嶠C ホ ɯ@0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0 F  (劯03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R<  ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  3x7 ?op2X  0RQ ÑVP P6P   Q A0 S -]%]EO]O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO1 ?Qf0 00 0p0:PPM.x0@FS00>Q >Q F0Q0 0CS*4PP/|>Q7S|'R h7   㖙0>Q $ QL >Q>|ЍOh>W0.|ЍO\:=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8PPH<0 SPo;XK=0S|7S=xh  >rPYp:3/0= 8PP <0S0#0$" 0#0 㼘< XV > PP 3S>ñ:3/V H4U< ' > ` `PPXqs`~!Rj8<PP8Q|7SxHⲵ 9P 1P|Ѝ 9 5 @P DQCA!*R;8 PP80SS*0|7S-9 iR B0<PP" @P>0CS|7S < @P 80S& < |'R R0<彲P  < @P 81#3/ @8 f |7S PpP P !PP x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> PP 8[x7 ?o2x`QQ 6P  x@Q @A0 S |Q x0@`P|V` x01@0S S2 Q_P|Xe 8i03A0AS7SP U|7S cP 13/P]!R8zPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4SPP 03/P Z0U 03/!R8_PP  8 m 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(Riii(]i9ii:ii8i8i(7io?]]) D] ]]]]* *]]ɀ]hzlziHz! 8PPj8` V#=0 ܕ h9!x! 8ӕ7S (#8 9! 8PHx 8  0BS !R r39S0S0 p Q ARQz0W8@ ᚕ  R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0SD@pX0 0CR00h'4PS4400Rh7PP 0 0Hᑩ-HAP h7~N#2000@000S@@T`' 0PP0T0 TPP  > 0S p7  h7 ; h7h7 ; h7N50000> 0 C 启h7P:: x71($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S|j|ЍO^F0 00 0p0PP- |ЍOHLP   03/P|ЍO`Wꔥ唅唵Yʀ 0! $%0    ! @aRa/#56PPWa/e 0!4&0 !    !0G-@M,00 `p@(0#00a0$  @<0PhP0(0(0 0Q@<0$  a,@hP<  }@Ѝ#]~]A- 8MP4/ ! A0     P,`p$0 0 a,(P @4 Wh0P! @   '.$00 0 ap,(P@4 Ch0P P#!X0X@XP R T:8Ѝ4 103/} E]__]C-MP 0`p` @0 0 00 l00P 0@ 0 c?o2P@@T0PЍC-p@P`M(` ֧X0  mu0 000000X00cЍO-QM0|MЍOCgQGR0 0P0p 0p;/o0"/6$R ʀ  !Ā .! 0 @!( , $@TR$@lU 1l #T   $`Q)  S  @*Q PP R$@M @(@@ P R$@iN@xP R$@@,@ ASXx( T(Q@, c@$ ,@Tu \ P,@$ ( x(Ri. Q - Q UWX H0徒/0$6 3D <t20!R0 o` BB!$ PN 0O 7!Gq "|'- "bt x  ԦD!(/( ̦# 4)%)M/ )6! 0`2$,(p0/0H0E  0<0@ fP| <400 00!@0 $ 0,(p<0ePe <0 00@!0 $ 0,(p<0ePP < 00@!0 $ 0,(p<0eP<> 0 00@!(0 $ 0,(p<0eP'w> 00@!30 $ 0,(p<0eP 0N@?P!$ ,(p @P<0@ eP  A\Ѝ]x E] Eg]ch@-@`PRp@-@`PUp0S00`00C0  `H-@-0 0b jЍ Ѝ/]p@-PP Ul7U`D@P [E0000 (% 0F@P@p]].C-1P@`p x8圀QH& 0x8 S Ved0 S Ѝ V0 lgS]@-1P@` x8pQ0Gp& 0hx8S 0 fS Ѝ@ Ȥ0 hS Ѝ]]@-1@  0@ iS]O-1020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍA:]]|] ) @0) 8408008,08089!= 01/EE(AEE E2 029 0/202/@-80000#Q0Sl78l7 .0 0 ( ( #- x Ѝ1@-@ h70  (0(0Rh7=h7l78l7]]]p@-@P83/p@d@-P` PQ@V<xw- w> G" !@ Br 00# B1   } @0@ GG?0@ Q  Ѝ7SD10A@ 2]=]N]Y]A-`P8p3/@P\00\0  s@-P8 `3/@P\00\0. 1 !0  ՟x П00x822x80!H0003/090020T100PЍp]|]A-P`8p3/@P\00\0  x8 0 0x822x822x┟x80!x8 99p@-@P`Z@pp@-P@P xG Gl1S 3/pA-P@p`000 T P L0?0?x80101 M? 061071 N? (Q 4 $Q 0 0 ,1SA/@-P ` pk@P 00 0t ЍA-|7PSS` h7M @ iN@p?0 R0S P@xHӧkA-|7`SSp@ h7] P i^P0S TAT20 R0S P@xH⣧0S i V1Sp1 [ 0H0  0#P⇧AЍ]A-pymP|7 `S 0 xHlT |7SS @P ]O@1    0!R000]C-P@@@`pAT ݐ  ឤP01S-P1 40 $0& Ѝ@4]G-`X  pR 0S R@nOoB@YPU@ [P 0R01 S  R 0S RGP0 P0T@`C-p`@P% 0P@TY Ѝ0S Pⱦ1 t0t B0    AT  P0S P @m]s]A-P@U, p&P ЍA0S0S i V1S1 .P0 !f 0!~P ЍAЍ]@-@xP 0x8i <P 0<8HP0H8p@-|7@SP yn089,8xxXP 0 022220000990{w>018|'R 13/p]A-1@`  y^I|7S118889,8|  PPp (# x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGQ ⋥AR]]@-@xQ `P P P 1  r<10<1Ѝpc+1 #h'0HH <<8 8 0 >Qh7U i^` Ph70h7Ѝp@]]]O-M80i~ 0<0p`P  0@P 83/@P\00\0 x8 0 0x822x822(7x8 991* h7' 000p 01X'r /@1 q? X 000 0SR 00S PZ R 00  Ě07 0⾚0 0 00嶚0?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4n$Q0 0h0 XЍO20 [ 0Ѝ]4]t]C-`@y'PP⾙08pS% 4(Y" U a !V T  `IP1 0@0C 0%- ЍU` z]]A-2@P !m00C02021 0  `2Pq 02HQWP,RP j,PP;=P8=P5=PA0SH1L1`P10CP1'=1S 3/]G-Pp(```b 0V x 'GTR@T 0V `嬢D 9/@] EA-x2!@0SP` Z2 L9|QI0S1 $2Su :0S 3/"<2< "!0!-200C0w>0SX? $~Q A1 0 lY0Sp7  |7S 1 4 &HE2-~Q A1 0 10S1  &h76h7p7  1 t h767h7V @`AAp@@]a]~]]]]/]O-P`|7MSS00 0Bppp|1 p 0%10W  A@ЍOda @T Z00Ѝ0W p|7S2  0S 4"|0 0P;00x8S} 0 0C8C80Q Ro P1S: 00! 0P0 00HP 0SH1L100P10CP1;H1S 0 R B0 Y 1 - 0 g1P 0Q113/0Sʐ1  0 X 2S 0 ᬑ9/000`)Sʐ1\  X 0$ 9* LS@\]]\?]]+]]C-2@SP`M !Ⰰ8#8X 0 q7/ЍC`< p 92<2<! !000w>0SB p!,20S 2 hkCWAⲂ0 ؁P 1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 _0 GP202~0001 E0 7S 1  th76h7? 1 *P eh776h7rpq@[]]] ]]^]]d]]]]A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3"@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 4 0BAPW 00Qp@ c]p@-PiN@ @P`xhVxHp 0^ 022220000990?p@@~]@-!]0!@S001 Ł<>HP1a 000Z.  yG   070$8@1}p`Uwh,884X P10XQ 00% E 0 Ei~  F   0' 08' jn P6D'@7<7f(Wox8 p  p'    H ( < ) x8 k Ѝ]EE]$E A-pʀjPMsQ` 0ES  B2U U U ,U UPPH$H@A{Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ s000 0t u"    @v w 0  " @x 0S @@p]A-0 0S@P p `*|7S00 0ؕ  ԕ Е003213030 0  ⽕   㵕  ⱕ ]t0/C-@`M4PP000v Ѝp0 `ݐ0=0 H02 |7S0000(001011 '`ݾ0T A   W00L7SPP7HWLW0P7]-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1H0S "N)R]O-0LM S< P@ 8h7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8P>0 060000H  0C FR{3@P000 Vڸ dz440Y000040  B    004@]4@Th 14U 0      $D"$  (00 #RH L0S0P  ~7@P000> 40H   CW0C00000 (0`0(00 0|7S000 0 >  80 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8nd 81081 8 ⳓ > ⯓x 0 08⥓  ⡓ >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: Lp$`Y  w4P`PPe2 I30 0Z 0 010 1 00 0 0 I0, 02, 00(0080$0`0000 S0 000((0C20 8000000C001!0110/1!LЍP`E6Y0 S  04,6P 426@/6@[80[ 0 00徠SX (L]|]`]]]]] ]]O-0S h'0 p  0j000   J0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0uPP0 = S  岀崠 85 0,⩏Y 1 P 00:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00y0  , R :01   0D0@001 PW|'R  3Grq穸 0 Q1 0100L7SPP7HWX0P7080LW2z@$Ѝ 0 PP 0ᰀ00(0101u|8S>HHPP |7h'S000 (  0/  p' ; W00  . x ێG lwh'0  4 R  O0Q  Ἆ0 00 0C0(0%3iPP3 h'00  0  ;X00  岀0  " 101G%0h'0  4 R 0C0(0p 101#RH L0S0P  1PP]]P]$]3p]]]A-`p-@P 00(0K0P 000pE  Ap@-`P-@P 0; 0(0 `  *pG-!=⼠p7p# 50`G@- PP1S  0 000Ѝ y0/ |'hR    0  + h  ۍ0 pw0S 00000   0-0  00|'RE00 0 ! h7   h72h7 Y0Sl7 00@10 @( #RH LQP  0PPp    N  0 00H   CR0C00(0p 0(00㲀0O  K G북?]]O-@fMP||7h'S000 0 0  ;0h7  9)+ S09h7  h72h7|7S{hgpe_ !PUP0!2!   # 90 9G9S!  p L 90 96PSH(Q PU ԿQ0CS*e1 S`0 `!  0嘋 ``` 0 Ⱑ PH!ຌh75h71 |  008 S0R 0C00 S 0S00Ѝ0`]x]@-`T1P!pR@MX1\!^0 X1\!1S *200 @E@a1 0 -Ѝ@/. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`3V1Ѝ@/Ѝ]]-0 /2S/p@-@Pa0 6/p@m 06 08880 8077090(10101/* * |E$DfE@-:@0S 3/ :S@0/p@-`@0SP0P    00T ,P1S 01pp},]P0/}P 0!/}@-@ 0@X]0 R  Լx]p@-<@P0S,d@T yP@p] Qp@-0@P PS l峼`0FUp@P嬼 B^R <妼`0FUp$埼0噼]]]]C-1@pg 4!1000$Z4xX倇X0d4`FV`|7S S 0 8C:0S 3/ Ѝ0 a6/  K|7S S 0 a6/x3V0|'R/I032+ D3Q' h7  {1  h7C 2 P@ qWX   ]@-0@M 60b1c2d3eI{J|K}L~S|7SV 9 h7 "w>0l!1@ABp7h4 D2! i  j9k9 0 g9!01"\0Y|7S!=0S* 9'w>0 02 9i9 00/\0n>|7S 93/1  |7T S499Ѝ@+x829009h72h7Ѝ,]]p7/p@-@f_frp@p7/G-`Pp㬁嬑Mw@WAL WO WO10@|'RN 5) 6) 7) 8)099!  089 079(!%069059000N9 O)PQ R   00 opWPx8S  19ЍGl 08 @\ X 00D 0590690790890Ѝ@]P]]̈]]\]@-h7#1 @  |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@|]O-pM`0`  Pd0@0 00P 000 0_o`@OCRPPU!R:"R :"R:0ЍC-MP 0`p` @(0 0 00  00P 0 0@C?o2P0S R0 Ѝ0O-DM ,00`pA(0a0$  @<0PGPJ00<0$   a ,(FP900<0$   a ,(FP)0'0000㨐$ 00a,( < FP0$0h0@00 00a,( @< FP   ⲷDЍ ](E8E1]G-SP Lo `0@4p8à St# 00000SW #0` 01`P1 0cc`0 d`uЍ@0@T@AJ0^0P0᳐0Y:0v]@-  0 @!  Q3  4000 P1#9P00T0&cX耖C@BC-P`尀p0@ A0 0S H#P `0` 00 Ѝ}]O-P@0MP00p1W;*0S`0 S00qp0少  A$0 ຃[! P p|0PQ`1P  0 bPP0p 0 0\ʶЍ[ <P W1 0CЍO趶}]]O-@0pM00P@`xPy 0SP S P S0P0܁ R@*00Q:0S  P 0 ≐00)  0Wb 0  Dj A ቐ 0R 0 )0S0 UP 0PO0S" GP PP >@G7G_PJ!0Rd, X@Ѝ` `b벰 0(}2]U]\]s]]{]@-@]@- 4,4 8 #8* Ѝ]p@-@0M SЍp@P` 00 0Ѝp]-$M840, (  0 $Ѝİ@-`plM$@P@ !0 0  ( 0  P0000C0 p0!0@0 0C0000 0d@S2 001 00@0Z'坤H0L 0 H0L 娤lЍ4İO-0HADM  0@ 00PYPpl0!   0 0 0,P(p$  `RD0  0 0 40P,P(p$  `?D 4 d @ 0   80P,P(p$ @`)D 0DЍ]İĖEO-\F,MPp +0 0 0 60d#dh&hV *0 0 0 $,ЍO'0 0S 0S*7'PP 0 0 0 ,ЍO00C0FT?P 0 0 0 00C0000q`P' 0S S S/ˣ 0$ 0 0$ ֣3"0ZT$S 巣(0, 0 (0, £`&< P 吩P N a0,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S J2  @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S "@ ~ @001004 0 004 <30 R S 80< 0 80< d 0S oP`0 0g Pc 00@0D 0 @0D 0S 0CSQ00N0 0S0Ʒ004 0 004 3 ۷70 R S ̢80< 0 80< ע Ƿ 0SP`0 0 ỷ 5P 00嫢@0D 0 @0D 嶢0SSSİ]0p@-00@4S 3P1 00'R0 0S0SteP 000 01S0H00``<2@ap p耯  BR/ $R/ #/0 0S/d@-P@1S `pV 0 @1 @T  Ѝ0S 0CS0@q 0S0 0S;00 ] @ꀯ@-p 801S@m R  R 0ꀯ@-@Z D0Q  0TS   z@M ꀯ03!"/03" /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/p@-@P 9m!>000pp@-@`P@P ~ᚶpP/~p@-@PP p@-@P A @-: @ 0<p@-@Pwp@' QeO-$M`@Pu pP u0$ЍT@ @ ` X0@00S @T  [00S 000S00 0T 0090P` ` @Z 0 [0 T90P0T 90P ` 0 0`0/G-pP@0`P T 4 06 S H0S 4 R30 PP@P8 0x00PPH0WZv 05 06 06 `SH0Y 0S 0C @ Q*  " EܤE ],0/@- 0MP3p0pp^`hP@z 03  !#,0 , @ 0  Ѝ@$ 0#000S2 0,0-jp4P 03  !#,00,0 03  #P,00,0,0 0 0$GЍR~|E0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@}|`pP1hSl l0p }AD}0P1p00`0101S0@@`q~@-60!0 0 0Ѝ@-@Td$,d,lH,l $.` G-@phRhb@M#0 p00 @@0A10A ZU>  R EF? H 0`p!+0 000,`(p$@ @@ @]?0 000!T1000 004,`(p$@ @ @H? 0!:0 0040@,`(p$@ @@ @5?0 400'㸐!=0  0080@,`(p$@@ @`?0 400MP!0 80@,`(p$@ @ @P`?@Ѝ ]~E@-@0 0S 0P@\0X0S@'P d0`0S ~p@-P@ó0 0DS P@ 00S \0X0S@гpDP 00Sd0`0S D0S 00P0#///0  S /0C\ B /p@-s @dPPRL0$!p@芳 0S  Q@D0R0 1~p@-P@ i0!S <S21p@-@yU@@-@o: 00@-@c C@иE0@s3p@-3@ PD Yd@P/p00S0U 0U!ph0U 0S d0S `0U X0U D9/80S/@-3`A0ASM=pײDPP@Ѝ@ 00S%0 00P0 R00U,0 0003/ᤲPDЍp@-M@`ᓲDPP@᯲Ѝp@00Sᢲ0S 3/0000,nPxD@-@$1@9Qvp@-@P 4'{001Pp0S 0Sp~@ p@- @P8n@P@p@P@ A-pHQY`P000-@PЍ0 p 000!>00H `oP ⰤP` z1S0 d z1@0H` zA0, z(10(1a~1i 0@-@MPPEUP xЍ0@M!>00 T ( P!0@PS   (10C(16ZЍ0 2i~C-0PSM 3/0 0`C @ <+P 00ЍCꅱpPXT}ᙱT Tj Y v 0#   Q @STX~p@-@,0P `0,0EMt x0Rx0t 1x0 0S  0 00 000p@~O-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y P 30Sڸ0003Zʀ !  , ! p !P3L3 H3@300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0St24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0` 0# 2 *VP0PPW P.t 03 8 pP,00,0/ W.,P0S  ` 0S0S  S  000 0S$ ",0 7pJ3S0S|00`{YU 0R PN 03/JBpHzhzlz~O-<PQtM p!< R$ 35Q X@ 0I@XlWP<W26 @<@,0 S00$<Q 3C5CQX U D ;W +W !BW-`S R R   `E  @ TW" |;W 0 @7f 0|z@ xz0S P qz!>d60 0 `0i0 0  00R 0`[DP@ w1`tЍ|:W 0 00 RV  00 S D:|`W| 'z  z 0Q` R0`1 0`< e0 @e 0z| @z3 P yP y 0 0 XZ 0  tЍO00000 /@PJ 6060X`\00` ?``^`8W 6C 0CW 80Sl8W1CWi 080 S`@8W0ST 0;뮮  |w80P@ î7'WW00W0S* T1`@ 0S0Z 0W0S00}0SZ|00SX]Tꀠ0Z0SX6&WW| T600 `0 0 `0pcPeTws@P7`o 0| 000?893 !>8# v000000OS]500 0 00 P3TBw% SJ00\50SBt%S?00X| b `3 8 3   00  03 P `P )T Y 0Kj,0   3 PYh0 r`Y SE0t01x0@t010S ؀SS P0؀ Y`V PP0Yd0'0 P2`0`V `000d0尳 !0S` 0S ` ` Y00 0 `3 !0S P 0ST  cR000}1 P v `@Y> `h0S 0S000PS 0 YPsZ V`[ 1 g /``` W003 P R0``0@Q 0Si ii io] i]iii@%iߖo?i@'i~]oi]]!i#i"iK08 P R/ !  /~ !  ~   O- MP@Dp r`0@0@@P1_P@U {T100#EЍ!>00  0 0`P H03:HD~P@$ UT 0Y00C?o20S7 0S4 P"@ ;T 10@0L0S DX  03 Lp@P 0  80S 3/@P ~0Q)@- 0@R0S b$",0S R Ϋ `P 03 0Q߫/~p@-`|P )0@0L0`0D00@0 0<0(080,040D00040,0009@pTEEEEEأEETE@-@@R0O-,M,00S@(`@P 0 0 0T1"T00XS%X@P  00 ")a! 1 00 $a$" 1040  0EpP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80&[0$0$0Y C *,ЍY 0 PP  0P0)0@p$"V @`PpV`[P 0p0(0 4p*4 0Ằ 0(1p0x p 0c8##4 Ib4#00 1 00 1 0 p0 0`p@`A-`p(@P P PU@0 !PTC-0@SPP @A0S`Დ;pp0 p0 @4"40 0 0W  0  0 @ 0C00 P00 R0("( ,00#,0 Ѝ 0p 0W7@-0P 4!4 8A#81C 0 P,000000! R ݑ0  0. Ѝ0 0`( "4`#/03" /A-@MlPlpP@@ @0 dD` P0@@ @P WЍ]4?,@-T@rL0010P @PЍ0S 00~ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/HzhzlzA-P`@0p Pe 0_0  Y?;$2020S A*E0p@-S/@@`eP0SP y0P 0Pd0 1@wp0@ 0R/!&   _ 0R/!&   _O-0PXQ p`H ($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 @-P@T Ѝ0S(2P`(`00p000W 1`pV (0@@-pDMW,8`P@P& 4  7_<00004 0000!40   000 PbUnkDЍT0S/8`p@-P@Tp0S 8`D0P H R<@5O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `X7%XpD%DH$H00!1P0&@@1!P\\ Q \\\ P0S 0S0 ,0SA- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Azpw&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QxP@P 000S  ]0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Sp7p,G-(p0@0SP,``M く ROd0" 0 0  0 P" P c  EiP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0pĘP @ 0 P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PShM;0S/70S] 0` R@( RS Xr   R R S"0 0 0S0C00匀(XG2#212(0 00p08_pP P1hЍsɤ000S 0CS # 00ߤ000괤P d0 Ϥ  1Ǥ က 60 0,P.L0+0SQ 0006l0S (000L00 00!1ZP\ 'P /0~A-p(`@pPD0S   !R, 00! {hP 8Hp0SP g徵$0S0 _A0_,0S/@-40@0006(01@,@-0SЍΑS !>00 0000808Ѝ8@- <0b",4b4#  #$  #(  #< Ѝ]p@-@0M SЍp@P` 4"48 #800Ѝp]Q<-cbrjQ 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # BtPpEp@-40 R@  000   "  Ѝ@-40@ R  000  s   ЍX0 0&-$M840, (  0b=$Ѝ8C-M 0P`` @8nxp0 P 00 00 0 0@'*?o2P0S B~Q ЍdC-PMp@O 0`  n`0 P  00 000 0@)?o2P0SP @TP@P Tg @P0aЍ\ T  dO- @p`0SDM!  0 ,@P 0(p$  `- 0儓!0 ,@0 040`(p$  `- 0 0 0'! 0 ,@0@ 0 84`0`(p$ -0 400!2 00 ,@0@ 0 80`(p$ -0 0 0!#0 ,@0@ 0 84p0`(p$ r-0 0 0!/0 4,@ 0@ 0 80`(p$ [-0 0 0!1 0;0 4,@0@ 0 80`(p$ C-0 400!h10H00< ,@0  0 80`(p$ *-0400 0 0!N0 ,@0@ 0 80`(p$ - 0400 0 0YP!  0 ,@8 0`(p$ P, XP# <]1ۍ0@0TEs,DЍ]dEEE8XE Fp@-P 㕅@lh 0S Q 0P @@@040p@-P(p@ {0d0 ,8O-PM@0010pC 6#21 2 P 0S `5 V#2!12  Ѝ 00s` Bj5010ZРJmቡZ  Tj@PZ  R` 30 K2 0 0S DCZK dZ| YXj !>000 ( h40800 `$`02 0 009P2'0 0 0 0 0$#$ (0"(DRD N PP ) P0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00! 0 S0!0| X X0\ 0 X0\ džU, 1†@ @ ꦆH L0 [H L ` d d` 娆U` 0 `ꝆU  7X (XU0P H0@`Nv0 @0 0 倆@D@@-!>@tPM `0@@Zp0 t0PcЍL000Y@O-=MmX @P=ЍO`X , 1$!0 1$!7- T=@@0D0D0S S  1$!0 1$!"@   0 0 0 @0 <   J @P0 0 0 0S P@0@S 0 0 0 @ATӅ 0$ 0 0$ 0TPP@ 0S彅0 0 0 ;`( "$`$"",R a(!"4a4##<S3 @1, @000@S S噅0 0 0 3 ;0S  P 4"48#8T~(0, 0 (0, e@(Sq0 0 0 X Q0(0 C@ @0;00 000p0P(0@P 0@0M1!0 1!40SvP@G 00001S0`0 ReP0@0U 00400S @0 @p0,P0$800010C 0 0STz 90S@s 0tPPm  t0@0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z vdP0t00u080S| $0S @E 0S [@@D 0x0噙<t0P0<0Z.@0 tG0处0 0 0 寄ꟙ 0R*+Z 4 0P $0ad$0J* 0$0@K@ xPdZSt0P00$0  Ad j$0Sx00000@@@T@xLP L)d @ vO0t00u0,0Sx 0SJ Zz 0R: x dt0PJ0   d *0000,0= "xLP@i L cYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ v{O0t00u00 0S 80x0徘Ἐ0P ٘0S ԘH @Hrb000tB0 c ὘000 vAO0t00u00 0S  x}c나t0P0  tS@T 30S@0@A@@$0p5a201P0P0S 0CS# 2X0X0SD0CO q00SK Pm`X0\ 0 X0\ G W T  X (  (  N #K0T0T0  R  Q W9 h W6 ` W3 X W0 R- H0\0\0S D0CS@p#@10S (0@S 0 0i X0\ 0 X0\ `004 S 000S @d P@0S 000010p0t 0 p0t ,0 @0<01# 0@3/D~~8]O- LM 58@Pp 0h (`000p,P$@ @@ @"000 (0@04p0@,P$@ @@ @y"' 80 004 ( 008p0@,P$@@ @Pb"7 0 00(008p4P0@,P$@@ @PM"X7 0 004(008p0@,P$@@ @P7"74 0 060 0(008p0@,P$@ @P "0406 0 0*0(008p0@,P$@@ @P "040H6 0 0=0(008p0@,P$@@ @P! 0405 0 0H0(008p0@,P$@@ @P! 0405 0P0(008p0@,P$@ @P! 040P5H 0\0(008p0@,P$@ @P! 0404 040h0(008p0@,P$@ @P!44 0w0 (008p0@,P$@ @P!040T4@ 00(008p0@,P$@ @Pp!040 0 00(008p0@,P$@@ @PZ!0@ 040p3 $0 00(008p0@,P$@@ @P>!04083 00(008p0@,P$@@ @P)!0402000< (008p0@,P$@ @ @!0402 00(008p0@,P$@@ @P  (040  D08p0@,P$@ @@ @ 1($0000D ,p @ @ 1$0000D ,p( @ @ T1`0D 0,p($@ @ @`  !0@S50@ T0 0@T J&0Ah@R{X@0LЍ RPP CB! ,0FD]\ F00 0@@PPPP 00@ЍHP P@ғUP1@P yP00dޓA-@ PRp   ?P 0SR`P1P 00嶓0\ Q ^0 0!0;02J 0!A-PS@` pPl0 A/4@~8!< 8!<~DhP/A-p`0PPQPEU `f @ T T@ @T@  /^0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴS2~0 0 0 =~3(,Ѝ0000 000000#![< 0C 0((04"<00 00000@ i,0@0,0VP *0C SUR}0 0 0 }0 0 0 7P5UPP(R}0 0 0 }V7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0P 0( 000@ xPb}0 0 0 m}000:, ,0@ 0,0 00800`PS@DO-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00}x0| 0 x0| )}0S( H00!>,00000408000S 0 0S 0 0R 0$@Pn@Pi,PP,0 0b m|0 p0 0 |`(0S004 3SH0L RP0/P 0 0C000000<@0 @\(0P 0(0}\000$#$ 8$#, kH0 00@V0g0 003[0010k0R ``P[v|0 p0 0 |3P 0LP [pa|0 0 0 l|@0000 0PTp @z0qS>q(0[     Y Z5|0 0 0 @|0 sR 0 W [U PR LP dZ`|0 p0 0 !|@0`0S0` sR 0PP3 P 0 PT@P H0S Yp{0 0 0 {AP@0D 0@040 D 0  PW0p/T@PY`{0 0 0 {p`0H4PS0@0D L`0@00 @000D 0ppW 0_P0X    J0  #RV  3Q 0S# tPP X{014!0 014!{1P80S t80,3/PP tO0 0t  P* [ 0S% (PP 00SPP ,0 ,00,0000 , 0S 3 V){0 0 0 4{(*PW ` 0RX L$KЍ 0S80S W `r80,3/`Pr `p0 0 00S Uz0 0 0 hU6 3 lUz@1D!0 @1D!Y0  8Uz@1D!0 @1D!z P @4"4D 8#8Q ( %0%<#*Tz@1D!0 @1D!z(P( 0<00 (0(DQ ,   40#0 @0AHXV Wp 0 ("50 @000PP(0Scsz1 !0 1 !~z`J`0<  )0 !><0 0 ` @0DPHP`P/ 0P+0S( 0#p# 30S  t)3#3 1`00t0Ȓ1z0 0 0 o@0 0 80,P(p$ ` @PFDЍX]p@-@`M0P0@@ @0 7dP  <@@T 0200 R00C1 2"Ѝp@]4?X0?@- oPBA@`A-@70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PAX0?`O-Mp 4"4 $,$8("( H#8! CQD0Gku0 0 0 FCSC 00 Z V`q "(?AT0&Gu0 4化 0 4Qu "`PE6u0 0 0 Au8 Ѝ R:F#u0 0 0 .uP R\ \ @ 嘕0`R u0 0 0 uhR Q 0 p" 0 崡10T01A0000W2SS}$@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !Rt0 0 0 t0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  !( !! B! RA10C100C0St80< 0 80< ^t \ N9!AQ ڴ! Q Ƞ,Ƞ B! R5Q  p 6! B!  B WZe 0R ` ``d1S b0 0}1`p[ |0R  B   B J `  X0- 嶀 q0(t"|p   0 ! 0 1C00S,00V(`8 s0 0 0 s-00  À !   0DX`X-//-/-/@-@-@-p00d0@ ` P #d0 (00  0 R(0 0S( pn Ѝ1M  k @-)]@-%]p@-@P0S 0S 0Pp0Pp*IP pl!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`7P 0 ], 0  02# |0R0@l@ 6rh0l 0 h0p0l t 0Sp0 t rl8]]FD-/ 0!< 04 0 (   !/HzhzlzT0M000S ~S 0S/0S001Ѝ/\ P/0 !8 0 0 (  , !/Hzhzlzp@-@P<`0plp@-P`@pp@-P`@pp@-P@ zpp@-@`P 000lp4A-@pP`y@Pn Z0@-S@ @p0`000S ~S 0S/@P_0P d0  0S 1@2 Ѝ00@0 0O-PplADM!0 (p0 00,$  P` 0!0 (p0 040,$  P`0 400!d0(p`p00@ 0 080,$ p @` DЍO]hGlG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 =]El@-p`( PSQMp $ @<0P P=Ud (0F0S* 10H   CR30C0000Tr 0(00(0 0 () $   R  h 00` 08 PЍ#RH L0S0P  @SASC 0 #RH L R    @P+ 0( R($!, $!$ 0S(0DS 00 0 0`P0 0p0 0 0 p7P(P PPDG-@pP`1W0 S8@ @P   04W@ P`S9@0004s@-aPU0@ QPd B% / P P d0R0;;d0ЍpU   Ѝp@3P P\P d0R00\d      0`( "4`#/@- 4"4!04"41@- O Ѝ 0<P   /  'G0M/ X 1M/  p@-P`8P@Pp0Säp@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@@-@0 :0@@-0 00   00sЍ]p@-P_u@p蘂p@-P@ vp@ꘂO- MQ( P '    @TS   RK 00 05 0R010 0! R010A0;S@T 1 R00 1`@ R00 0`R010 00C 0 01 0 i Ѝ HR@T  R1 ` p @0V 000 R / 00 000 R00 0R010 Wp 00C 0 V 00 000s RJ C\`C^L&\@Cn! ! !$ !$n  W `^K\CQ B C0 00000 SD0 000V R00 0R010 Wp 00C 0 1 a0R*An1 !0 1 !Ln B  %0 0H  00L0CS@`1@0 pWpP 202n8!< 8!@!<D @![D (!, (!0!,4 0!40n0T0 @0S0ppp@ 0@0 00S0ppp 00 ȅG- @`$p娂P0P= Y YH ‚,  Q. Q Q 3 ,10S  0PR00@ 0@ @,(#(0 4 <8#80#Q0P @ᇂm0 0 0 m,0 Q Q 0@ 00S  0*hȅO-@PDMpp4UXDЍ`0V V X `XV0CS0V  0 ;S0000 4"40HPV 0 ;S0@000Sg1h0 0#2S S . ,. g!0~g. s V0 0L L 0 ;S0<00h1h00l1V 0 ;S<00S0 <00 |]]]̅@-00SJ@ R  a``  B BUK00C0@0CTt]A-8AP`l80< 0 80< lPqW: AAdpT1WpT@dCAD@T@0PqTA0S 00S 00S01S *0S1PX!AQ1DAT@1T0@#H1;@0rAPqTAȅh`p\?O-CM0O0 0>l0 0 0 Il X70 <D0< 0`0SP% 0%* h0P h0 QP%*8~PU l1!0 1!lCߍ TPP 0P 0#2S S0 00S00 P0d#d 0h&h`F0P0000040 0#21VS(000%k1!0 1!k0S 0S0S0S 0S 0(``F 0P0000(0( R`F 00 RP 0 ( 0P 0(  QxPPUy (00CD0080D0 S  0Sw<P  0@0X0m\j8@`(0  0  00`0P@0@@s00 S000P 00 pP0Qk1!0 1!\k  pP0p 0h0e0$0e0 p00 h00!npPpp%k1!0 1!0k0 D opP0k1!0 1!k;0S 0 SZhp%  $ p4"4$!$8("( #8 |x:xx P| 0080f LM @I000$000000 00mpPdpp`j1!0 1!j0 mopPO0Kj1!0 1!jT90S 0 SZhp . p.$ p p4"4$!$8("( #8 . . 0@ 0 @HX3 001HS00C8@ă#8"@ē1V0:8SxPj!@ ! !$ !$Tjp0`F001X00C @ģ1V/ w1jX1\!0 X1\!IAp0060J R0 w Su 0 hPm xi p@Tg $ d13$0(40D1;S3`1S 80S X00 00D 080  0" 70P00SJ S0703 iP2T"0P22 T"i@ 0!0CS103/XQ, ` R 2000Cp!0C,0, 2R , ^0 SQ h!\00CS !0$< Co\P  P0 PQ t0CS,20l1\0h1V0CP C\|4!$Rx:+Ru, R0C HQ L!0CSڤ10C(q0``Fh1x!0| x!!| 1!h1!0CS0X1+10C10    BR901! Va0 BR1011d 01Rh0S ȅ]  ]]B]5]\?H?]̅]ȅ00SH00S$0}pP#}N \P 0 }$@} 0R00S 0@oP @g1!0 1!h No$4RX00D0 080 0 0h~P `Ag1!0 1!g@` 000dgX2\"0 X2\"8(Pc20ZPy0Sv0 0Sq* Pm0B @S0Vg<0`r !$!01g1!0 10! 00 0 00/ g0S `0S !  @ f{{0`0`SY/4!40 0H1S |(Ao000Q*pF A(afHL(HPLTPϬTf0Z 0C10$1 !0BQR !0BQR1$ Sw:   1S +R RR ʬ Q!Ł Ƀ" 0$! CR$1 0C0 !0CST01@01`10`1!8#8R0  <00 0 ;S SS 1R0S;S 1z0 1 Pe0 P0 00 00/ e1  uU ;SS SS000 10 1;+0CS004 0 ! CR%0!0CS+ {0l1\0h1)  1R ;.0CS 0dP1T!0P1>/T!6040^;zd0 0 0 do=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ So6dh1l!0 h1l!AdP 0Q/ 0;`80  BR0!0CSlxd0 0 0 !d`\0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS ڳcp1t!0 p1t!cU0404 (0pCcx!| x!!| !c,0SC H!R 0L0CS86A 01R81 03/ W91X0C1'0 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS908P(50`!10CS0X110C11W0#4 500( 50C01 0S 1  Q 40?07 0; % 0S 0;841# 0S 31V!0R1$ S *sb1!0 1!b$0$ 10101\1S$05\150 0 !$10BS$!% <f S <_0 W0P00J  0S0 B; S1 00S220 0S010;0 0;A821211 [PFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S hE0 h0 0w0 04 S0 z0P0000  h- -00S!>6 l 9&00090 S   hLȅ̅]\?@-0  0'S(P L@a1!0 1!a$0 Lȅ 0`( "4`#/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@p@-P!T1PB1AP \RtX1+8T@1D01@ xSx0 S 0; S0Ҳ;pr]L^\?O-0M@S 0 S/p`V 0S?(<(PP p( !R `0d  Sp3p# RppWO^hPPC 0S0S0S ͍ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4>00P4%4158>00P8%8150<01@00D00S_ P0Se P.P%p0'T00Sg 0 0C1!4!R4!480P00L00T000(00 :0Py  10S00(|! (  0B00  00!0CS41a-V`!;p00\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 .P0;00UA(0SP kUP!=0PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSP7P83P90%pwHp30 @P&QR P0S0S0S0s  `p?1S`~PpU1S\PE8\0P H0Q8SS8Q0P H0 8(G@0D S8D!00C S:08P0 RJP 8P0S8TP 41R1'!0!0S01Q441q0\=0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP18@0;V PF03 PE UV20k80oP Po0H00(000S4 \P08XP, Y( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 005`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#UЍ1 @a0 40K0 _0  W `4000:80U040<3 ^00S0U0S- 0 0 0 2^1pP 4 00S<;07b]024"0 024"] p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PHup0QAQQ0 3SH L0SP0\ 00<  0CU4 00 0000 Z 0 S 0 0$00 ($ QbT 5p0 Pe8r]G]]̅\?ȅD^D]0 0 0 0 80K]epP@ t4 00S$o01 P1 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RHo8 < Q pQ   AQ U 0 BRU RZ ȡ\X"\ X"\\ ( @0% 00   V  `< & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1N\004 0 004 Y\`P 0R 0!S S{ 8P ]0;t40J40` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S> l   '8NP0S 040Q: Q6 @ Q1J0 A\-Pap : :0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRppp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R 4e1M  0MX @p@-PUp@`S0P 4 dG0Pp`d  H Q1Q44!K010p@p@-PUp@`[0P 4 @\X[0Pp`d  H Q1Q44!'\010p@@-0 W.< 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0  :0p@-T0@00SDP@k wT$3Sp0p@aU]F@- @FA-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S 00PP   (  $ 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S0SPT0(T 0$ 0 0$ ꠄ 00!/᠄A-p`忩PUA@T P P (T0 0 0 (T~0:0aP@-@01S001蠄0SfC-0`S,M(P@%Pt!0@ S 0\q\1 00 DvS<10S UA 0 Sp< ( 0R*T ,Ѝ  0T0!  00"WP;@ 00d>SP`00S H00@ C3SR p0/] ^%H^F0S,4! x!/@-@0M <01,0 00 0S0Ѝ(F ^@-( (0 ǿ\NЍpFP Q Q@\ \2SQ Q @00P1Q0 Q(000S@080P1/$G-P0S`(tA``"0R^ !QOd2S01qy1O@T@!A0S(*VXA``2SN ̐ H9P<dBT@ppX0;PA` V pt00KT *0D10 T19G2h"R l2S0-Pp2S<0h2S lBT@HPpBT<@\? ^p@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 VX!F1T1S01S00p@Cz@-@tM0t2p S% `0PS ~O( 4 0 , ( 8$K2tЍTF@-0S6& ЍS6&ze]0b? S /A-@P(pjT0`8@ TL3K@D0S@D0S.@DV x0|  0T@ D/0X0 P1XYVL 0   @T8A%815AG0S0 S(00 b/ R /0SA-0`S0MUPSPQ 2q0@S0@?oR20S@Z P0@S PaQL L0 000 0WP  0 00 UP! Q U0`0@S010@Sʲ0TT#T1X%XS !0P90D0Ѝ  10CSa0Tw00000090P4 W R0( @Q+ Q 0p00 0sP00S @0G3WS "G!>20 2 0 $080  唽W 0/]FEp@-0P@(Q1 01  (p@QꠄA-8pP(`@Q1!01@@(AQꠄ 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=؅@-@P 02;@0:P@b@ 0 \3\#  BL^\?FO-m0@SM S( /H`P@$00#.0#A0@.H>@$00#|, 0 00 PU `0S lC5P  =5PP؅%@-0@ 0@00 00@@^S$$00S@ ЍD^؅%O-4b@=PSPPm0S S8 > t00#.0#8.> p00#`x, p\V 1  xQ6N1!0 1!N 8 V00;e1S 0 0A0 0g!P00@0@00=0=N1!0 1!N ЍO-0R:{N1 01N 0SH 0 A SS0!\ 0 ؅%ȅA-P`ATAAp@O-Q< JP0T 0 P0T JPT1X! 1C1S01S01S0# 01S ;SJ0 0 0 J01;SP!T11T10P1000110H1;S0;0103/1_pFȅL^\?p@-@Q够0  p@ݟ8P ;` S0 D1 B00R *PT11XC1S014cR :gJx0| 0 x0| rJ<YJX0\ 0 X0\ dJ0000ȅ̅@-@aMY0  Ѝ@葟`pP HQ/J`0d 0 `0d :J;S6S00 (  1( 1S D  B0R#*Jh0l 0 h0l J00  B !  +x01T01Ip0t 0 p0t I<ȅ̅\?p@-@P0  p@*`3P 01; S !R D0D00CR:001&̅\?@-T@ÞKH 04004 000@0̅\?x0 R   R-  R   R   R-  R/  / b /\?gfff@-j@0 yꐔGp@-@TPv0==09#9S p@諞P 000@-@o8m`k@h0S-//A-P@ap&1`P1!`KI; C("(R1S00 111,; SQ0A?0\?C-MP00`0p0 0` @( P  0`  00 000 0@?o2P0S R0 ЍO-M0l4@3`rXVP 0 S0  J@DT0V0 00p020@3弝@`T0V2|p3+0 S0 00(0 0000PP -(0@D00S Se [030#X0S -(_P 3 ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U(!  (@0 ( !( 0 `d (t0T0l Sh pq xy!&^? 0|10  @JS0 0( 0L(0 8( 0E(0 @ D  H d L 1P0 0T00S0+0X \00U(,  (@0 ( !( d0 x ` ( t00 lqh  p &'T0S^0yx1&^? 0|10P0  @J0 0( 0(0 8( 00 K =00Hs }@ -$M840, (  0Lf$Ѝȅ7@-PQ@ PP L R #^P Ѝ000@-MBc0 娴0P (P W PU 00 00!0 0\O@P5zЍ Ѝ@@간O-GMp!Z`@D1LR @Gߍ RP@ S @  R!JoQ 婒[ PR 009 0@o 00!L> 004p0,`(p008P$@ @040> 00!$0 0,`(p008P$@@ @"040= 00!+0 0,`(p008P$@@ @X= 00!/04 0,`(p008P$@@ @= 00!?0 40,`(p008P$@@ @040< 00!P0 0,`(p008P$@ @ 040L< 00!Y0 0,`(p008P$@@ @n 0 !c04 0,`(p0H08P$@ @@ @V0 400!h0 0,`(p0T08P$@ @@ @>0(04; 00!p000T ,P$@@ @(0 (00 !:H0z0$0T 0,P @ @ 040: 00Dʟ!0 0,`(p008P$@ @<: 00 ɟ!0 40,`(p008P$@ @0409 00!0 0,`(p008P$@@ @0409 00!0 0,`(p008P$@@ @040(9 00!0 0,`(p008P$@@ @0408 00ȟ!0 0,`(p008P$@ @040x8 00dȟ!0 0,`(p008P$@ @n0408 00ȟ!0 0,`(p008P$@ @V0 400!00 < 0,`(p008P$@ @@ @?040d7 00!0 0,`(p008P$@@ @(040 7 00!0 0,`(p008P$@@ @0406 00!0 0,`(p008P$@@ @040\6 00 !0 0,`(p008P$@ @0 400 0 0,`(p008P$@@ @040H5 00!05 0I?0,`(p008P$@ @0404 00ğ!K? 0,`(p008P$@ @0404 00!M?0 0,`(p008P$@@ @i04004 00!= 0 0,`(p008P$@@ @Q0403 00!S? 0 0,`(p008P$@@ @9040x3 00!V? 0 0,`(p008P$@@ @!0403 00!Y?0 0,`(p008P$@@ @ 0402 00!>0 0,`(p008P$@@ @0 400!_?0 0,`(p0P08P$@ @@ @0(02 00!=0D000P ,P$@@ @0(01 00!b? 000P ,P$@@ @080\1 00 !D0 40,`(p0H0080X0 00 !g? 0 40,`(p0H0 010 f1 SRBA>?0 0 0 I?0;0`1Pj 0@ Ắ@P a .A@P T0Sį7@S=0f1ꬄȅ\?G-PU@ p@`R000S S @ ီ@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; B@P p@-@T P0`S5pS=pp@-@T P0`S 0Sh=ppA-0`SPom@p0Sdb9@@+0S ;2XR* 0R 001000@0@=;x7@A-`@pP?000S S/@X>+2DL>42 咪@bP0S p@-P_@5@p/0S) A-@P`pLT0S1@ 0 `1 &!#00a!0 `10#`11<1/A-@0S `pTP 0S @XA@0S p@-@`1P 0p/A-@`00p0S 0S 1;10;0٫PPpPQ011PPQ7PH0qPP [0 1Sx01간G-p0M0@`0S6@ЍZP V V @|  !@  f`Y`r Yt3HX@P 0R000@P0S@+S; e@P@T 2TA O@P@T t2TA <@P@T (2TA )@P@T 1TA1HXg00 0S;  . ; 0= S00 000`0`S0e00d10200q0 000\ED1 P@@1T#3=P012|=T0814X0"\1 l0 1pp|00t00 p x02000020201111*@ ^\?^X?@-;@SS8#8S TS0 T @0;@0;;S0(P ; S Q 00?0/ S0P 0PD00  P $00  P \?;S]p@-0@(P0 Qp@_@P mp0S p@-P-@p/0S/p@-P@p@p@-0S@ `@PJi@P @@pO-QM⸀ 0S S4 Ѝd1p`1`\1@X1P 0` ]0 0 00  00P 00 0 0K0?o2P0S0S*  BR 0p0`0@0S`` S`V WpS0 0SPP/CjRP#US@@Ӗ/CjR@#T^|pxt@-0@". /@ ^p@-@\41P!P301108480pp@-@\41P!00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0w;S/0H @-0@0@Tw (0S w  @긔@^A-;@S0;)`! AR80;p4Q H0  C9PPP{ 00!0C,2#41000ЍA0404Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m Y0!aq?A3c 2#!0C01' At14X6' $A$A! T@T(#3#  p0p [(1!20  0/ [@ @0`FB`d1 #<S01R4!41$Ѝ 0  0  0 0$ЍOMb̫gfffA-p@`{P ! 0P@ T @ [PT` W <ɍX 0,0C 001 00 04A-`pPU㬃@ P00@@0T!PP@-@@ 8儍 <P4@|@^4(00S/!Q  B /( 0P/ R/0 S%7!3C" 3/0Q0@@/-P, , " " " " "    /@-@Q  088700 @0000C0%0 /0 0/%0$0 0Q: QA@/ 0Q: QA0//ᣋ. -%0  0$0s,P^ Q 0S3 X#Q R!0$  @XR5/p@-@`P@ ;VU2 %0%00( c&$00$0D0403$ 238P<`2%0 00$0%0$ 0 00$0%0$ 0 00$0 0400,0000(0(0$pA-l@Pp`$ $0S 0 p0V00$0000 0 H0p@-P@@ UT0* % %  (R%$   $ 8 $ 4  #"#8@  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   HX^̖O-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 DWP- 4QP'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   HX^lO-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000Hh^XO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:H^\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /Hp@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>0`0"#0 0 /0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` †@|pG M @I(PU@T D0D 0?8cЍ 0@0$@̖\?gfffO- S@Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0S' pW* '078!800$0#1S<0P%1P%PDЍ00a^p@-@P!t `0D0034 0 0 %0 0%0pHp@-@Pt `080034 0 n0 f%0 0%0pHp@-@`?PPpP 0V 0 10 V& >p0% 8 4 &#&#(    % ( %    % (0 @10(0D`04`06% 36 3(00000%0(0% 0 000%0e 00#2%0(0@10(0RO-@PlM3 $00 8%P !  ( %qp P$ 0`@  KPP 8<% 0 ! ! % 0 0`48(0@$00$0lЍX   %`0!&bPP` 8<DT0 4D0%0 010102%000(0C-MP 0`p` @0 0 00  00P 0 0@?o2P0S00D DSS  S00 Ѝ@-@ *101H00H0101p00p0101000 20 2000800 u$00 oHcG40!( ( "P @@ /-//-/-/@-$0$ КH]0 0(ܗ-$M840, (  0( ;$Ѝܗ@-9B^@-5B"^@-@ge-蜗՟1M/ _A-P0p`0勵@P& d0 0  0 ٮ 0CPP@64('/004 0 004 (2/bЍܗ@-@(0((0M @X@-@d0S 0S <^P0 0  0 P ܗ-/ 0!< 04 0 (   !/HzhzlzQA A-P,p@`዇10 00S S S ,00S @$!,0( "(0P x@(.0 0 0 (.^3 40 0S 0 P/ܗ\ P/0 !8 0 0 (  , !/HzhzlzA-@pP` )@PoA-@`pP @`p@-@P<`[0_忚吃Kpܗp@-P`@弙=pp@-P`@徙1pp@-P@'pp@-@`P101 000͛p41S/*hlG 0O-@`pRDM! 0   0p,@(`$   0! 0   4p0,@(`$  400 '! 0  8p0,@(`$ @ 0 !' 0  8p4@0,@(`$ @~ 4  0 !1 0  8p0,@(`$ @g 0 !; 0   8p4`0,@(`$ @Q 4 0 ! 0 M  8p0,@(`$ 7 0!` UP 0  8p40,@(`$ P!DЍO7^ܗhGlG\ 0 \ /O4xG-DhM (`-0 0 0 (!- 0Sp * 00dP  00 Qp%p *T?W (,0 0 0 (-hЍ  6P p 0S 4"4 8T"T#8X%XU (,0 0 0 (, ЯS Aa0  PP !> 12! P0 P $00S"(P,PHpWh P 0Xp  L0P L0 Qp%p :W 00USx 28 Ⰳ'0 N3T⼄&04` 0L 0vp 0(P\j `,(0, 0 (0, $P2!0$0備PP4(F,80< 0 80< (Q,"$TřPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX + 0$ 0 0$ (, 0 PE Pܗs^@-0S0SP0!0@SP R \`0  0 0 00oЍ 0妗0]Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B H@-`P@M 8p.@( .h`;( .7( `p0@3Ѝ^0@-ASS!0CS0Sf "B +1Q"A 0 0 0 B!A 0 0 0"!A 0 0 0 0!A 0$ 0 0!A (0, 0 (0, !A 004 00 00 Q Q!B 0 0 0 !B 0 0 0 @!Q Q Q!B !B !B !B فn^q^O-M @0(`PP2{pPX T60SH60S  0F00V  <P 1  QI4ZEp! 8$(0 8$({!Pߍ0P0@`0 h PhP 0S!00S 450S  .K'%020S 40S  .:'0$0W02DP#!C 0$ 0 0$ -!|40叞P2 0 R 0S ,40S 0  $02x  0P0! 30S .&0  #02x30S 0  X#0NK@0S ,30S 0  } #0^z00@ S1 Ko0P [20Sy  00 ]"0nZ0 ((C\TkTPL20S 0  E,"072P@ R" 1050 00S  10SC  .s&0  5"0!0C002-0+0000VP[?DDau͟410SSu E f   0086lBύd`0p0 0客P h噟卝Pdu<0Bύ1M^ف ^<GO-PM'U@50S xx50E00(0 001V(UM p0( 5(Et0/S0@PF ( p((0K0:00p\(`)2P440P,0( HDP7 PPPH0 p,%'PH₟U! 840S .p% Pp0c?10/S0㸢@PЍ/PPL 0`00:00pPW |1000pl4P( :0,PR(0 <0L30 P0#1 P1FP0: S |!  |!  V )V `F|!V.`2xtPp0P4puPP 0P` 4UbD200S F  R"`F|1V,`  [ w|1 000n 000f 000^ 000V 000N 000F 000>1!0 1!60!  ! . 000& 000 000 000 000 <^<v^y^O-(PWM@PExP |1 00U0h 8$(0 8$(s|1 0 00  0'S(メ@PJ 8$(0 8$(U|1 0 00 @00000 0S0% %` * D0⇣P D0 Q`%` *|0@V   c@P 0 0`0: 0P,0 >0S 0P. `$,00 0P/(8,(0 (8,(0匝B?! !X2 0HS%H=0S 0p. #0J. #20 02m/0SN,0H S00,H|1X1800S 000 R0  0P 0 Qg:Y 4<0[dPPh  000;[3 00/Un` 8$(0 8$(ka|1 000  0040004 0$0[ 0$? [? 38(0 8(> (0,0[(0, |1 80<0[80<UPPP @ 0 R 0 3SH0L0S 0 S`P0@`P@0 R0  H0FP H 0Q:00S U  88<(0 88 4<($$0 4 $$T#|1 @0D0@0D[ U%|1X0p t p tP Kfx | x |K|1 000U084(0 084(W080S U8 UῢP 0P0S0%0 * L0̡P L0 QF: 000S 70P51`rP*0S00S# L1D0S[ nPP 0  3S H0L RPp\0p0pG4pGW᨜(100 0 4"4 (0)Y0C$0pC0IS `p<00SW 00S S4 ` 0 SW`` W  0T uP  (c0S0  P` 0 S 0IS|50 p%0IS00X5PP 0S `Jst Ȟƞ0S  0R`%` *  P0 `P P0 Q``V 0W0 P XW$00C (0R0 RQ0H000p \ ?^R$00CS}\HX R(\0P8 40P8 40 0p( CR G0 Rʅ0pG00Sp$3```-Pxp`bp8``PPk X((  (Y0 Y Y )02s0 (0Hb88<(0 88x4<(|$0x4 |$( ^000<(0 0 ?o2R0S (Pp'`/100T0TpW^ 0 00~G940W0/p P2X00PX$0XDHX$0S: JOw0/08 X`p00S(0S `$0P0$0`$aP P P 0  0 40S PH0\0\X DH0 0  00 01`0`pW ~G pp<`Jف^ ^^^^^HHtف^Ppف᭙0;)024 807E)0 280|0|P 0S(0 0(028 )0 (  00E0 #R HL R\0P  0800B00V0080$00 ^ /V4T10d0dY~I0(0 00980Y 2h0hpW DpGWV1p0pY~I(0 0#R00 S( ,00S 0(0 S  0S 0 0H0l0lpS`000X`P P P0  0 80S 0S2<24.Jyr,0800u0 0 0 000 < T00< P0000K00CP10 $w$0 0`q&a$00$000C0,00,0ppEp]3( 0WpY (U 0 4M04pp(p2W|1 H0L0H0L0S|1 P0T0[P0T0US ᓟP 0X X|1 X0\0[X0\UzP :V8V|1 `0d0[`0dUbP QQu|1 h0l0[h0l'UyJP[Y^[Ui00`0S0% % *0 t0GP t 00Q:00S 8$(0 8$( RWߍPp00,W0{ AWC +W_ 0V`0 0 0P 00 Q:``V /0P0M <帰0 0  _P0 _0SU -*3W <W R00  x0՝P x 0QO:00S  3W Q  Qp R00  |0ⷝPx | 0Q1:00So  [00  0⠝Pa 0Q:00SX ,Ro P3-0@`:0000000P쐍Sp00,l9 p92#0Sr  3/m9`V"U d 90S(00  0 -嘗(0 0S(h.0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U pPP`d ,;0S(00  0 #-9(0 ⢲0S(ϱᓚ呚00K凚zP0T 0S P0T [ 8\ O-LMP`p췟 =000p,P(`$  :@; 0!0 0@D4p,P(`$  &T70D74?00 0@008p,P(`$ '䶟6 09> 00@008p4,P(`$ 0406 00!6 0? 00@008p,P(`$ ݶ04086 00!?0 0@008p,P(`$ Ŷ0 400!5̵ ?00@ 008p,P(`$ 嬶 0400 0 0!L5 ?00@008p,P(`$ 哶 0400 0 0!4 ?00@008p,P(`$ z0400 0 0!4 ?00@008p,P(`$ a0 0,4? 0 0@008p4P,P(`$ I 0403 00!3 ? 00@008p,P(`$ 00 400 `!;0 0@008p,P(`$  040,3 00A! 0 0@008p,P(`$ 0402 00 !0 0@8p,P(`$ 0〲40 0 00!<2 B>00@008p,P(`$ ϵ040 0 0 0!1 C>00@008p,P(`$ 嶵0401 00!0 0@008p,P(`$ 垵0400 0 0D! 0 0@008p,P(`$ 兵0400 0 0!00@ EN @0@8p,P(`$ k D jj0@刔D0儔Xj\DXDݴLЍ^ȞGG < ^فGp@-P @ldjh 0S Q0P@@@040p@jPjp@  0<TG-S@`p#0 0 0 .0  0 0 0 X 'R 3SH0L0S(.@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0&P 0 Q% *H'Q  8$(0 8$(Ѝ0 #0C?o231 厄P (MQMa<  #RH L0S0P  0㚗@0 0 0 o0H   C/R00C00000T  10S q? &0( 0 (  /R 3SH0L0S0ㅗ@P  [ [(`)p0, 08`1 01  A(7zف^Xف  ^O-0p'S(,`(M@P  P N[ P I[P  0 ЍO@ЍOЍ@-0  فC-0@4Mc02`PPQ7P(RrhaV 00SS*4ЍC'i%i X1`1 EP Z0S  (4Ѝ(/@P 400   0 ؖP h@T;hP XXku @h hXT 40 X`0d 0S S :H0$U0*`iB 004 0 004 s`Pd03/@<@GفO-ppP70S . 0'0000c1娷S 0 qHcǟhp`Lp DdxH\UPD T0P   0P 0 H4 TX0006`  ఍1P ~H U  0尊 0HP)0 d>0PL60Sh  .0L&0000 0b! 0R 1bZ [50% 0 . P 0 0>PB|50S  .o0|%0000 N0L00 M0[0TP ɊP  lP! Ὴ4 X0004`  ఍1lP |Cb1pS 0 ybH0U  HP ᖊ0 =Pl 'b1S 0 ]bCP 3(0,0<,0kP0 dp p-0* 81$ <=40$0 00}~~0T`P T ~=V P~=,3`U F}pKY @a a;P $0S(P[ 0SX0S `P H0S 0S PpPԀ p5H0S 0S  PP H)0S  0P (h0s0 0000s0 000d0 8Q00 00 3kP 10S000d0 00ֱ[ Z 0Xx W w`xBa!D ^P"!XX H0W40㖚 ^فYIفT ^\? ^ ^HH@-p@`T0P p@* Ѝ@-@aO @00`00008 900P 09*  `H $$0 0$0 (0$0(0 ,00,0 000 00PoD P`1P!Y  $0S DZ"1YX; p H9 8~ X HzL d sd o0008  cQ0 $00 000 000 00 0P0 X ENPPP30  :CPP P 000 d ^iikii O-pl8@QP`M #P8Q 6C0CQ 5CojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi D ^ixKO-prMD0P@`UT D% P5TX@@0S0 00SDPDM PT v ` Z` `$4R@@00S0 800S DT@ 4Q@80S/A-3`A0ASHMpiDP@$THЍ00S1[[w0 000S)VeP% 00000S .` e 0 0 00+`0UE)P3[D@0” E ^\?@-@9@A-HM`VpDP`@䀟T #P|1S  00 0HЍ00S"ZE00S .`  X 00000zPZD.@ l ^@-@|1@nQDp@-@P P oppp@-`PPPP\9#L n0@0L0`0D00@0 0<0(080,040D00040,000"n@pGGGGGG$GTGp@-P@hn0@`0Z9ZPP Kp@P0008C00 0/p@- @P!>00000pp@-@P 00000000p@-@ M Ѝp@-@VPPnPPp@-@0Q$MG 'R`l P'RX("($( 0t0  0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@"PAQ R000CS1$ ^P ^A-`pP@200SD0CS+XP 40GSFV`#0F0H PB  P< V? ~030#S00 D o`( o\Q\ X ^ QPQ `P H000S D0CS #S S Ѝ%S000 00 00 00 00 00000V0S  0000\dQRI p@-`@M 0 C^.^ P?R1 寰 000 C0PU'X Xh Xt XpX `0 0<000 BKP`ЍpA ER PPC/C-40@SOM  S|1 0 0 0|1 00 0Oߍ R@D  Q *40S $0 OߍCS S #3R |40S p$09|1 0 0; HT, ?`P2 p9 #4Bύa`a`001411 0``1P |30S #01|10 0(0 SP#2q12L PP ` ޯ2P<2034P09P 20S 0" XU pPP`20S p"07420S 0@"00000000 00000000 TJP1B110 0141P /P l10S 0 h3"p'qr D10$0$PU ~_EUX `m`!1` h0 P 00 R0("( ,00#,0Ѝp 0O7@-C(0 0CP P,0 00000! R ݑ0  0- Ѝ003" /0S/8@-@pl002p @-@06n 000(01@q0S/@-@6( @0 @ @G0S/@-@6( @0 @ @GO-  +!> 0n00S0 SP,d0)1PU  PP 0@0Ѝ R S 0S0S0S d0SP 00 ^0SE0@-@8P<$MP 0S$ 0R -}}P}P0S0S0s!.0  }P $Ѝ0 LPS0S ,0 @@|/8|O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  P0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 CPP 0SK 0SH0sEd0 0S0S0S0S090sX3#21208S- 00$`0D0 ` 0 X0P 0 Q S R `QCP T*0S0S0s0S0sY v!>7l0` x0(0t 00` 0QdP 0S10 0 P_04 @4帐3 PQx ED{T0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +Bi 00000S E0`( "4`4# :000[  T! PU1P iP P1P0P O-p((T"\P ,w\M0 0X " %X " app@T W% Pa@TFЍ R0S d  &R&R W d   (PD @ (E a0@1T  R0S d  &R &Rd   P @ R0S d  &R &R W d   PP @T R R @@^0S/ 0@-S0S   Q Q> (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 0j!0 Ѝ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50^s_p@-@08M S8Ѝp@uP`.p 4"48 #800u 8Ѝp^ 0 /*>@- @(lFѤfCC2<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00 فG-@Q M`@pI YF 0S BP`0d 0 `0d /@P Ѝ  0 yPP 4@@ W x xPA0 0 0 A@ Hu-PH0S |1 X0\0X0\0S1 0S.0s+ ? 0 xPP-TA  0S# UQ H0Q SppW |1 X0\0X0\_x00AR@T pفO-7M#2p嬠1 20Z@0000<SP000[d0# 0S P Q@P@ @d0< 6PPd`VH0Q40@P= 3PAP< x0\00C?o20S Q@PP Z@[V `VS 0S0S0S 0SG  f6lpT6 ddNP( 1PL0 T KPPL0 @vT &?PP ZPL5 #2!12ЍPP`Z@ W 0S0S0S 0S PT ( >PP (0p040p800`8P0 0UA_EUV: 4 @>PA40 R=`0d3l 00p0S/ 0 d>P), d>P#0 ,0R030S `0 @$0P```] 0s 0@0P1<00008`0,p($@ @ @峐'0404 00!E?0 008`0,p($@@ @囐040<4 00!I?0 008`0,p($@@ @僐0 400!>0D 008`0,p($@ @@ @i0 (00!`3D0O?0 $00,` @ @P0 (00!3D$0R?0 00,` @ @80 (00!2DB0>0 00,`$@ @ @"040`2 0V?0 008`0,p($@@ @ 0402 0Z?0 008`0,p($@@ @0401 00^_!0 8`0,p($@@ @Pۏ  k0P @@@!0CC10@ T0 !0^>6<#}ka@ p0LЍ R  RR  CB! ,0pH^|(   [q PJ0 0 0 |1 0 00 0F9)0 9)R @ =02F?! !2S28(0 8(8(0 8(0'S(p0 `R 0 0 0 |1 0 00 1 R  RQ Q$Q Q  \| R\ |0 0 0 |1 0$0 0$ {py0'S(pP _ p _00! !g0(  PpP K<,0 <,V 0` 4P 90 0 0 4 P h4 Pc40P0:0 00S1|1 000P8:pWP p0 0 0 @0D 0 @0D |1 80<080< l99LD00H00 \0 $0Dl$0pSB p @T `V x0S 0CSx00`0k03V80< 0800U < 0C0E003ꔰ|ځ\?pH߁p@-@PP `0 ᇃP 1M  {pᬂpkp 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/HzhzlzO-ȗpP#`PlM73Q} 85<085p0<t0p0PtX730S 5S @0( Tm@PH 0'S 0 3SH0L0S(#k@P6 0dS lS3 j@lЍ0Pp06 * P R# N_\640dS lS! 5%0 %L 5>ph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ Tf0 0 0 qx $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,u.P C20 0 0 =@` 8#(#Q@;( <Z.P $0R (0R(0, 0(080 , 0< 800 < a ((@004 0 004 #fP "0 00(00,mP i0 3SH0L RP0H0 0AaT iP (@(@@42P@TL000S;  U+ . LP. 0#0;P00C|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  3jf . P" ${P|;<3x0S00C0xP唀R P|P;^A-`0S@Pp唀0 S 0x̀ R 0 S030S]PQ R PU X|ځO-P |M RC0@S000CS:0 B S8 0S50S20S/e唅Y@0D 0 @0D dl5 HpoW` .L .HH@P :@H0 |Ѝ0 d0# 0# 0# 0# 0# 0#$ 0#01q5 %0 5 %W5%h0 50%$%0 0$%-P 7 P $P0S p   |ЍO!hPP-0'S 0 3SH0L0S(dPP 00# 0# 0# 0# 0# 0#$ 0# 1q0000W ,P,d P $P0Sp0( fP,d P2PLpH0082`p dR lR5 ,~d , =  0010p8#8Wp WpdW  lW0 H pph5l%0 h5l%, 0 @00a5%0 % 5彬 0@$0 x00 a000310吀00 0P0 pS  R 00D%0 00D%5,d 0p0pفz^|^xځ߁ X^O-B0`00 0 0 (ppGW 0 0 0 c"0W0PP 0RPP 0fP 0 PRPP0 0 0  ЍU 0  R 0 0 0 0S00 gTP 0 0 0  [Az 0$ 0 0$  0R*`./We0 0 0 p[(0, 0 (0, 00`S 0S 00 e@Tz _0<< Ì0J@  "xځ^ X^03" /A-p`P5_@P7U\_0` P@A-0@(S`p0_PPc7_(_( 0(0C00(00@ ÿ@@A-0@0t0Pt00`0x0x0|0|00S *PO 000S *PA  喿80S ppq*P82  8凿<0S ppq*P<#  <xp0S ppq*Pp  pi@0Sppq*P@  @XP *P *8P *<P *pP *@P7*-l 0/G- @XPp pc`P @H<,0 <,SIb|10 0 @b2`3 0  Gpف7@-0@ Q)R*SP S vP0sS  Ѝ0 :R0S00:Su@- @Ⅺ00t0x0|0qp@-``.Q00S@P P *00/U00S00=U00S0t00U00S ^P )001U00S 8P )080#U00S <P )0<03U00S @P )0H@0^2U`VppP )0p0pA-`P0 ,0@p4(ЍR GR*S # GR$1R # GR V R  R R  R  R R.c\00S 0S0S0S 0S0S `6P96PC)PQ  SV0  R0V0t0V0  R0 000 0 00PxV0 Vr0So R/lSi0S 0S0S0S] 0SZ 1$PU0(P 7I0 000 0 00P>V1q V8 00V41(P 80 000 0 00PVR V 00VჁ#W<`p`(P kV39V0 SRx03V\0 R000&V0 R|0^J^ @-@0PS`pMy(P7 a,0 00000(000Ѝp@-P``(@P J [P s(@p@-@PF@h(G-hMP pሠt@P0S( 0@$0 @@@0 0P @ P 6P@9hЍRsZ ռ0S @( @₨0 ,0" r!.$  ,00( $@\P@@\`P H0 o6@\@\Z 0(<$0G- pMS@P  )S *@B pGWP P @9p`d@4p~cP P*0+`0G<S000 000 0 00@Ps@P9WgWl;pGWp0  R0@pЍ d0R88d0 A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R559+0 @@0 0@P d0R55 Pks@P" A0:Pks@P A0 'P9 Ls@P 'm A 0h@`@`T &@P 8@`0`0000( 0CS0 P sP`PP  q4P 0'3Sб100S@7 0R;0S8@T5&@1PrPP0  R00sh700 rP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s p'b P3  `V 3S100 $t"PpW0 $ P 0S 0 000V $CP p4 zrPr408 0<0spafD\ 3P` P  2"PRpWO V 0S P p 5XpTP04P h!P`5X00 *-0E6r@PN0S S Sd04M d044Hd044Dr@P7WW > 40SKW$Vq#0GS##pc`V S19@ 38`8p40 00@=0 0 pG=g' !4gt# qC @(0`0(000 @0R] TQ -0# 3SH L0SP0\ 0p<[ ZWP W0 G[:`0d 0 `0d Eu< 0CS00S  00 $[ 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T `0d 0 `0d P ` @0S 0S0S0 000 `0 0 -P@Zp+0S `0 0 0 X0\ 0 X0\ <0S 00(  < X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0+PP`0D0H000Sx1S800X 0Sx1S 0P D`@V<WPP `0d 0 `0d m0P?o20T00S |1 P0T0P0TD0S`dp H $PwؖPl H0Rhtp H P^ܐpPT H0RP3{Uyh d00l 0p 0q  <>ⰐJύd0-P^ Ԑ[  Jύt0,oᩒYL 50S .d D5`%3 1`00>/Xuv`0d 0 `0d V |1 X0\0X0\Y1P@ DL P@ Dg `)P TP`0d 0 `0d PZ2QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P083VP T`PH00U@P  Up3\3:$R*PX&D0S U U0X x0S 0SX x0S\u s0S L0(0@ 1P>LPpm0 @GP@0S~R p<,0 <,U@ T0<<0 |1 0003S R0 0 0 T |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN <1 0R00S  @ P @rXD<:U<0PGU.[  .0%UߍT@PUPe\c X ( ,0 <"  W hP:0 0 0 E(Pz^ ^tځ $pف$" 0@/D0Q0*$ PP堠P0<1 0.lQYW=0S RG 0P0P @ $(  $@ 1,PP0 3  10S (10S }@ ,000,0D0 00 p_mS Q0 0 0 P U*Q0 0 0 Tt |1 h0l0h0lk00S p0(0 0p 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0nSP@#s77`0d 0 `0d B0@0 p3W@PWT p0t 0 p0t +0 0048900(0@0(0l4 000$0( 0S0 GYP 0X    @P 80RP  80  00J04!< 8Q#8<000,0 pA00 0400(4"<$ 00 YPu @0 0S @  ( 0x0| 0 x0| T |1 p0t0p0t,WPhpP @0$ ( 00/ 0$ }D000@ p@PExVVi0 0 0 tV |1 X0\0X0\APP/80< S001R  ! @0pS001P0/03" /Q/C-@M y0(pP `Po T0P4`@0!Q8P=A` A0P4`8@,Ѝ\?@B(0s/@-@$eO@7 O0(0@O-23 M4Ѝ ^ ^2i@@-@ 00CS 0@@-@L@FM@O-LMp`4q*PP=  0R@%@ * $0)VP $0 Q@%@ *<T0C 8$(0 8$(4b)0 R 00S0 P0S S SULЍ3 00 0 0 0SL2$  P0d#dLhB&hTz   ᑶP' 0$ $0S!  00 0 0  }PV 00 0E R0$0 00CS 0 @(0s  1 !0#30(0 v@0 4R0 ^Q80P R0SZ=9 R =?@3c2#V:`@`r0So\L@P 00 0 0$`0CS 0XLX^ف ^@\?MbG-0Pp M0@K`P 00 05h@P700. 0 00@(0 pņ 2S0@0B00 @ .P ἆ0S   <L ЍY(0$0f`U@hH1ip@-@P(K(P p@K@p@-@P(K@ KTp@@-@<wKP @T00 W@K@dK@K@P@- P $fLOLPRL@A-p` PN@P700 0 CP^@@-@01K00P &KL@ 0O-Ppl@DM! 0 0 ,($P PP Pp`<n 0! 0    <40,($P P Pn 0!L '@0  <40,($P P P@nDЍ^HHP P0S  (R0\0 /|10 /|10/|10/0  kA- a M#0 0嫅s0P00@Tp~OD+# Ѝ|10S 0>CS0 +z0P0L0%U?0T000H P'10@T ~ODT\?H @-4 R0R 0 06 ЍH0S%p@-PX0\ @06S \P `=J6S000c0#06o<J00C0p/@-0@0,M`S6S 6Q0C?o20S Q<,Ѝ@gJ@0 P pt0\ 00 00P p$p\NJII|16p@-0PM@\`P ^(0(S00 P 000 |0 00@X0<8@400 `4 L@\PЍp0  @`v^C-1嬁嬑1!$M0塄"#2a12bt1P00@TAOD4}3"`&ab"$Ѝ10p WAGN"j0s! s0@0P Pt" P @""@,TP  4"@T/"0s r0@0P000[0 0 \?HفG-|1P`p M0K S200S D0CS#@T3  p  0  0 0 3 @T p Ѝ  R   ` Ra R H0 0 0@ 00 03 S Đ#212 00 020@T D@DT 3"(00S ! ? 000 !H00@(^0@-M*= H厃勃00000 0|0c00@P d JTP0L $元0< Ѝ0@~ X^8Ht^~^\?HHp@-P@0@0d00+0?00:<0?00 0400S 40S3 !0 0p0ul0p@-P P@ῗU0 @@@D@H @Pp@0Sl G-@`qQ@ R HQD0PP ៗDY1`QC 0 0 0 P ጗01 0S@0@H0C Q+Q! H R   0L S L0`S@A 0 0 0 H0S P pxH R , 7H0S /^ ف^Q|Q/P/`4p@-@P >p@JG0@-@PP0$M @G|1 03/PG$Ѝ0p@-0 M @`HP}G|1 0@4/@GU HT06 Ѝpp@-0@SP M 00S(P  zP0@o Ѝp`!P 0U-) P GH0P 4   H RHH0P/@- Hk@|;@-|1@PH2`PM 0CPi 0Po 7C0CPVP 0P00PЍ1PC '7C 0CPB 0P0  PP  4`PP 6(06 06$0Xp\00p wpp,p"G<1P 0P,0S0pW 0W p0'u?0040 0S0$x8 '0-00,0000 0 0$0000000 000S0`V 0V `R0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$PFV]Fx00Cx0,Ѝ PP 0 `O-(0 )Z0S(`@UYBB (0, 0 (0,  Ѝ1M   YL@-@-褵@-80@0SP 㑷00@[/ @-wY-/p@-@4P(ľݲpP@-@PY@-0SP0`000S1P Ѝ~S 0@S0VPP0S 0S0s s0pS 0S 0S 0S@0P 0 1P -/ 0!< 04 0 (   !/Hzhzlz0O-TM$0`1`0(0(0SP ~SN 0PS/@?0S@;00100@P0#212$0,p<∀0 p 80@P $0P0 Q S R` dX $#2!12TЍ ?P @1@ O- Ppl0|ADM!  0 @ 0,(p$  P`] 0! 0  40,(p$  P`] 04 00!0   0 0 80,(p$ `] 0!0x @  0 0 84P0,(p$ @`] k8l0DЍ^PhGP-ILO-PcP4Mွ0 0 0 劽 30,QpP0@ 0M q@4Ѝ0SD0S S?0S0S0S0S  uP-0S0S0S0S  cP0s. 20 0 0 = (0Q#0 0 0 .@TW P 0 0CCP зPWpCCP 0 0 0 0 0   0$ 0 0$ ;Y ?@׼P0T 0S P0T g`@P2Tp |1" 0"0 ᇧLpف0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0xP Q Aoጨ `0 0 0H 叻Ѝ@0(p0p/^P%H ^O-M0(000406#@21,2`000S i 0 P  PP0016 pPPp00:S0P 00S S?@P7@0P0 0 i0H   C'Rk(0C00(00T 0p(0(0(00$080(00 0<0040000 80pPS4Q [H$0000`00040L<404000:S80 Rx BRu:(p03 80>@P ( 0y 80>@P#RH L0S0P  (>@ $P >/0s08 80 `  ( b00:S80S |U-U#BPh101r0S Pjb>4<2, 2 "12ЍdŸE|Q E Q<E|1Q- R|1000000000000000000000101}0  u000m000e000]000U000M4@巺0040004N ف^^Lp@-`1@P M R8@ 0 0 3P@R9@ 0S/@0S@ = Ѝp7@-Q@T0 QP   Q Ѝ0P QP0S)T   Ѝ0@@iTdTT Ѝ0@k@DT\ Ѝ0@n\ Ѝ0@ A-PpXN00 00000 @P& dVʀ0! 0     !0 0W@Ph\(@P Ѝ0Pp0 㚲 xHzhzlzPs@-@P` 0R0%0 * 0/?P  0Q0%0 *S @忹0 0 0 ʹx R ! Ѝp@`姹0 0 0 岹 0n0 ^pف@ #x@-@@" " @-0@S00S SS000C0S@  0唟P0SP ^ ^0S0S0S R @-01/xp@-@PTQ @P 0S  00S`P 3pS 000CSp'8D#L0@0p@-0@S8M  .0 000S 00S0T#TX%XU `P S 8Ѝp 000CS0P0U ^@-@v4P P @0S00S 8#S000CS/@-|1`S@P( d 00S(00  0 ~7 0RPP@::80< 0 80< RЍ-/p@-@4P (٫ pܗ-/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/HzhzlzA-@0S0S0S0SpP `@TQ8@A-@`pP t@p@-@P0S0S0S0S ` ͂101፼p9pp@-P@'p@lp@-@PQ'bpp@-Pv@QXpp@-PmUL0 T@P d0`d%@DT 0 p ܗO- Pp`0BDM!  0 @ 0p,`(P$  V 0! 0   4p0,`(P$  V14 0 !'>   0 08p0,`(P$ V 0!'> 4   0 08p0,`(P$ V 4 0!0 !'>   0 08p0,`(P$ lV 4 0 ! 0 1  8p0,`(P$ SV 0!t 9@ 0  8p4P0,`(P$ @=VP($0DЍOOl!^ $ܗhGtII0SWG-0`SMP@ 0@S>PD PP 10SЍU8 0 Sp* ( 0R*T% 0n5T 1!00 P100!L<00C0xXp@- HwzP@@+Ufp000_php@- PR@0 0S   ITpp@㚩@00 }A-`Pp@T 0V `000A00倻@0@-$M@P J|00 0 0P x$Ѝ0kI 0Q @-/t"^@-@T  0L^ S0   $@Ѝ "^"^t"^s@-P`@P0 @Ѝpp@-P`@P @pp@-P4@P p @-_0P@- P H0S <լ0@P0S  PiIp@-@P?Q000p@0S p@-@`P+Q0P00p@0S G-@ᩨp⼠P0`V S0PP@Bp R 0 pWppU ~0 0僺`G-(MP`ڋ@܋勂pP1֋兂pPHq  >{0 0 00sV  S1!11%*X!:Qax|0SxZZ PU  vP<]K\D1 P 0$1;V(ЍᢖpP pvpP ពWgvPbvPp\vPpu0 *+㄀P  7/P T0z P #0!"^"^hIyara #^2#^hIE#^cIgI0@-@$MP Q: |$Ѝ0 P 0 0000L000@ 00Ѝ00z P {#^FShIA-PMpP@ᄂ`0pjP0p0  p坹 0 , PXNJp埁` lPV0 80Pz0V404001 0`,@1$00(0$0P00 ROPPЍA:p8100ŕ`Pŕ8 lP < lP<D0@ l0P@0D0,0$ lP0$0$Q  HJ<0#S@0S  R:t>,0S݉0H0 0L04*PЍ#^#^#^xqI $^y$^$^$^)$^4$^>$^@-@_@-  zPZPZ   +zp@-@`PP ̌Pd00 PpPpp(00S0000S01/̀̀0   (0S"" /P/@-@0 y 00@-@ oB<A-Pp`@P@  0S 3/@P &@- @R 2/@O-LMppt0P|0 0W0 2`@xQ [Z 00Z 0!) Z7 Z< $0r0# $$00 } QH00$C0#t p0$0 "0 aQ$%00$00 @p0 ;/ LЍ[ 0 |LЍO/W5  03/P 03/ (03/P Xo `100@r[ `[0@X" Z V@ $0I3/PZ0A@ 03/P  03/P Z00S (0Y3/ 03/P @-0 0  00 0 00%Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/@-Q@ tq o%^%^P/p@-@P03/03/-  03/pp@-P@`03/0 V p-`V pp@-@`03/ 03/x-03/PPPl-03/pG-@0Pp3/`0 3/V- 03/`P` 03/ 0`>-pW0 3/ p03/03/,-03/P -03/03/0 S \`G-@0Pp3/တ ` `03/,03/TP `,03/pW⩐03/, 03/7P03/ 0``,0 3/03/03/  QA-p@` x0xS  &0 A Q*PP Z%Z@0 !P0 0  /X%^p@-@P` P $0 p@0/pO-PLMpt0  0000 ѽu @P P40080d(⦵4004000(p00040  00(0C00vLЍO4k 呵0 ;40 B0 0PS40(;40^LЍ8pW H0q;/P 1|! 0,01 0 ;?<D3Q#3?P [@P # [P0  R= 080#80C?o2S>^~0 7/,0@ 3 #R(0\\Lpn0 0,00 <0^\?7&^,IA-(@  0 S0000SA} 0#dt0  ~ P ,0]@[ 3 [iL/0 8/,0@ (0LP$0 5/(0LP0 A/%^7@-@(0HP 05/0<0(0LP0 5/040 Ѝ07@-( $ 0# 0@ Q 0HP 05/(0HP0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LP市 05/}_(0H`寂0 6/0S(PU 0S , P(0L`嚂0 ;6/Ѝpp@-,0@00(0L`w 06/=S  0"Sp1^@-eP 82^G-Ppw@`V᠐< O ⍯pp<0 00(`0`0$00,0$003/(00HTw0 8/3 03G82^s@-,0@!;90(0LP;w 05/}dP(0H`0w0 6/0SPU 0S , P(0L`w0 ;6/ЍpA- 0pP(@@pD0(0 `Hw 08/(0Hw 08/(0Hpv 07/0@00@0(0Hpv0 7/0  D00D00@0Ѝ D #D   D0 0 00D06 D0D0D07@-@P B 0R  0"S44 0"S (0HPv 05/(0LPv0 ;5/ Ѝ0$03 0 0"Sp42^@-_P 83^A- 0pP(@@pD0(0 `Hjv 08/(0Hbv 08/0@00@0(0HpUv0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H`8v 06/(0H`0v 06/ D0 R60 R R6 0R R6060D06G-Pp1v@`᠐≭ + !pp<0 00(`0<0$00,0$003/(00Hu0 8/3 03CG83^p@-@(0LPu0p@ /7@-@P B 0R  0"SAA 0"S (0HPu 05/(0LPu0 ;5/ Ѝ0$03 = 0"Sp43^@-lP 3^G-Ppu@`]̐H [ ┭p<0p 000 0C2?000(`00l0$00,0~$003/(00HPu0 8/3 03G3^A- 0pP(@@pD0(0 `H6u 08/(0H.u 08/0@00@0(0Hp!u0 7/0  D00D00@0Ѝ D #D  $ 0 D00 (0H`u 06/ D00Q0066D0 D00D007@-@P B 0R  0"SZZ 0"S (0HPt 05/(0LPt0 ;5/ Ѝ0$03 V 0"Sp3^@-P 4^A- 0pP(@@pD0(0 `Ht 08/0@00@0(0Hpt0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H`et 06/ D0  0  0D066D00D0G-Ppnt@`'᠐$ƫ 7 ^pp<0 00(`0H0$00,0S$003/(00H%t0 8/3 03G4^7@-@P B 0R  0"S 0"S (0HPs 05/(0LPs0 ;5/ Ѝ0$03  0"SpD4^A-Pps@`Tp<0 00$(`00,0< R A ⟫p0,0$003/(00Hs0 8/3 03AI<5^O5^p5^p@-@(0LPs1@S0$0|$ `$003/(00Hp0 8/3 03AU7^7^7^D8^8^7@-@P B 0R  0"S 0"S (0HPp 05/(0LPp0 ;5/ Ѝ0$03  0"Srp7^7@-@ 0S ,0 (0HPYp0 5/0  Ѝ00(0LPJp0 ;5/금@-!P 8^G-PpYp@`᠐`Ⱨ s Ipp<0 00(`00$00,0>$003/(00Hp0 8/3 03kG8^A- 0pP(@@pD0(0 `Ho 08/(0Ho 08/0@00@0(0Hpo0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`o 06/D0 Q6  60D0 D00D0 6 0 6007@-@P B 0R  0"S 0"S (0HPo 05/(0LP}o0 ;5/ Ѝ0$03  0"Smp8^@-AP,:^A- 0`@(P@`D0(0 pHLo 08/(0HDo 08/0@00@0(0H`7o0 6/0  D00D00@0Ѝ D03D00D0G-PpCo@`ᤐ⛦ + 3pp<0 00(`0<0$00<,0'$003/(00Hn0 8/3 03TG,:^7@-@P B 0R  0"S__ 0"S (0HPn 05/(0LPn0 ;5/ Ѝ0$03 [ 0"Sp(:^/G-PMPn@뺐 Ir?p`0D P D 0SA 0  ⬦ <0` 000 0C2?000(000$000,0$003/(00Hpen0 7/3 0 3 P(02H`Vn0 6/PЍ 0 k:^:^;^:^7@-@P B 0R  0"S 0"S (0HP%n 05/(0LPn0 ;5/ Ѝ0$03  0"S po:^p@-P0@ P@T0 0pp@-@X0S L厎P0@` P$P(P,00PP00@@p@;h#dIp@-$0S 4嬤@,P R00 p@%;^A-@ 0S p`P@UT P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$0@-@D0 000(S   0$00C$0@p@-PPL@T  0R 00 0 Tp03/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-4@P0 P0+   pIp@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ M$0;^A-@pP R00 0`0C 0 0p0 0 00 00S PP0p 0@@@ AZ 0 $@- 0 8 00 00 D  0 Ѝ7;^A-p0S `P r@P D \X U PP 叝@ 0@P4 0`@- 0@ @0@ x@-04 00 ( $  ᶔ0 0Ѝ=;^A-hp0S@ @`1PP @ s@P Ɨ0@0 @P@- 0S @@屗C;^p@-P`@U@p 0RnP PE @-N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝ(00S @- 3//p#p@-LP@0 S   R 2/$0Sp p@/A-P`P 0003/Djp@p 0 R @Tk$0Ah;^A-@4P. 0S+ 0QP0000`0 `06/#P`p00 60P00U000tIp@-Puk0@ Gk @  p;^p@-P@`]U000000њp@p@-P@ ``vUPEPeA0@00^00 0S Vp@S;^<^<^<^<^|p@- @l!`PjX0LS  1S P 0 p@ 0/pppA- @!pP`pFX0AS1S  0p 0A/C-pp@` @`!(!XPP 0S8' ЍS C0QU? @T8 0ll10А p1@0孖P@ Ys0810<1K<@10D1=`1\1R0 00003/PY 0 R 0YO000000 00 0II+p@- @!P`W\ p@8\  1S P 0 p@0/pppp@- @!P`W\ p@8\  1S P 0 p@40/pppA-P`0`%@ LpiW0S 01S 0S  AL@- @<!NW0S, S 巠0P"<^B<^A-`Ppi0婡P @R噠0P嘡P0s$呡040000U0 40S R p R@0X 4/#P P A[000 A_<^<^<^<^IA-`Ppi0VPЍ@qU00004Po!Q< !R :P000U00000SL0 H0 0S800 `8/#P  ЍAc<^=^5=^IA-`PpOi0P@Q P P0st040000U R000 0 !000 At_=^=^=^=^n 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-@0 A`!(V00QU0X<000hp 0`0h   8/`P 00h  P 5/0P00P 0<00QC\?QA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 B 0Pp 0 R   8/0 800@ \ZX0 03/ aЍ=^A-P*h`@P p0S`V⾖ P @-@0   00@A-pQ0@`P VP0QjP `O-Q4M`0I@PT`C P= 0   @ k0@000,  ( @$0 4/`P# 00$0 0,0(0@ 0 pS0 @ P 0  03/`4Ѝ0@00 ;/p 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8^>^.>^9>^;>^p# I@>^>^@-P@f0`(0PS 0S00pf 0 0000 R0S @dk`f0@DJf 00 @$ Ѝ;^_s@-@`fP@of0 0000 'Ѝpp@-P@D`0SpSP@fP pQ @-u/b>^C-@ 0P`p0 6(000 9/HPH`0S,0,0S  R 2/0`0 Ѝ_p#C-@ 0P`p0  (000 9/HPH`0S,0,0S  R 2/0`0 Ѝ_p#0 , /_s@-@P f40 000`0 6/ЍpG-PMpPt `p0P@ 04/p@x2VX %'17V. 7C0CV7 0% 0 & 000@PЍ2V 0tp 0PЍG/1Vk 0CV1V 70V@ 0S R  0CPS0 0 0@4!04/S@00S P 0 ٤@P0L00(0( 3/@P0 R  2/0 $ R 2/ 0 Y? 0 Y? i W|8PЍG@vPWLW`WXW (0Q40S0000//TW@A-pD2 M`QP8' @ $2Q{ 0Q 0CQ= @ Ѝ1Q: Y177Q o37QPl 08 0 ЍA/pW 0 V@P pP  0L@P0 @P  ЍA`00S P 0 .@P 0@000T00@0 p$@P 00$p0 03/@0s0S@NW aWMW(r>^O-Pc @!Qd\ 0U40S0000 Ѝ\0 0p ЍOA AT Z0  4p0` ЍOj0p $0 ;/p0  pp TW@0@-MP@Mdx0S  8P@YP  ڙЍ0y>^@-P 00 0  / ЍW P/ 0/A-pW0@(`$$0PV`T6/UUs@-@d40S PU T0(0Ѝp@/0 R ` 6/@TЍp0@D( 02/A-P`pcu@ UE01SC  40S 00Su0 00P4P00 0000S  R h R  A@@ 04/#P  I@-@c4QT T@0 R@ /P/p@-0@SP` 0P`4 R   p03/P p0S 0004 R   //?o2\0S//Q1S ///40S0/qA-p6@P400S0T0S0 p@QQ`V 40S@ 0@ 0 00Z0@S@   @>^@-@b40ST   @@=,A- @!PP`b0S8L S 0AT 0S 0S p`003/0S 03/0 R   2/8000S 0  2/ 00 0p@-8P@0S0T0pJP000 0$/p#0 0 0$0/p#p@-PxbP'Y`Pp\P@0P\ p@蜝#p>^ 0     R [$X(\,Y0]4Z< @ 8D 0/0 0 /  $ p@-p0`P@ P p@dP000PU P@T dP#,0 0S/ R  B /0#@-@0, @0 0 S0  0 0#$X0 0S/ R P  R   00/0/#8- 0000 0p@-@PH P` 0H0 00P0000000pG-`p0 @P05/ᘑpW 0 0ЍG/0 CR/ I0S0C 0 P0PEPE0cUP!00:/000P 05/0S0C0 P 5/0 0S0:00 0 0CR 2 5: P 5/0  P0A5/>^ P/F; S 0 0//Q/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/?^5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`Pp?^@-0@000\P 0\0`P 0`0P 00P 00P 00P 00P 000T@<\Q@- /6Q@-A/%Q& 4A0&S0&Q  @-.0 .0!/  / ?^9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 SW0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V ⨓0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 803/JЍ?^4?^0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 M0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPlIMYp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000&\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hlL p'00(Ap,Ap ppJ?^?^@-PP@ p`E3(0 0 000@)$080 %\ P `dP      Ѝ<@-0 @04 80\0`0d000000 Ѝd 0D32aP2"5/ PPEPEU+0 pD07/`P!  00rK R 0PD05/`P  bK0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?S +@0C4S00*SS *S *SU  SW $Ѝ*S 8$ЍC?*S ! BS;  SPh`h0S! lPP*S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S d8 0TipFQ D\PQ R00)P   8 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/]0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRC0A0d0>X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍColQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0s Qo\0Cl0S ekl0 S0C BR 0[l0S SV \$ЍC>I\ 0L0HPLPph Q@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0l 1R1R aRYRPRB0dBPP\pB APR40@0D0HPLPpPPPPPPPPPB R p\&P A Rt 0$P(pB R p\P A RtpR  p \0 AR00Ѥ pl0S0D!0 0   8l0S S S< 0T 0C 0 S S w o s p ml0 p S03S0!R 0CQccPW< T0X00`@^J?u&p$c>@^l?p$? A^@^A^A^A^#A^@^,A^; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000PD^/|E^D^xE^E^E^E^E^E^E^D^D^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^p 0S S"0A(0,D R  Á(,//0C-DM (00`p@ a<00,$  @P< 0PL @   p  a,($00 0@< DЍF^ $<0S/@-@0@QӀSA-@ S t hP`p^P   03/@fNT@; @AUF^ˀ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@p`Pp@@0S/p@-P @ 00 R PD  -s@ 0P34p $>J@0S/@-@@s0@04@dO-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ WV`@0  A0@0000@Y 0S@ T`` 0@,`@[ L#@080 0 @P >F^A-@PpOA@` 0 R<@)A-PU 80p`h0@6pCF^ @-@:80S 080 <0S4@A-P0 @R <"p0CS3 :   `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@UT00@-}U000p@- MP@l T`[P 0 R V ,TL ЍpRV RW SW lp@- \`PB0S@0 00P00CS0p p誀@p@- 0@PsBPP  p@p誀8@- (@`BPP @誀0 000/G-P`UP0@x000000T0Sp 0pW0S1h0$h00h뜐 / \0h0  @0l0 0p000000t0h0#P yh0|0000(00,000000S 0$@ 姌 TP {T垌嚌W<S P hP0\ PL P8G@$G^TH[J G^($3G^FG^QG^SG^EJdG^G^A-`MpP0mTH4@V =84V ,4V $4V 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQ`3V] 0T3V $H3V X 0 p4`P  A Wh X2Vp 0V`P2VA 2Vr 2V |@000000000 0 0 000`1v l00| 0pЍA/i 0     0 0 000l000Af0 0000 0`PlA ЍA @000000000@00000HA0 0000 0p`P@ 0S0 ЍA譎0+h0 00P0`P3 PЍA ``W W @W@W @W W@W @W@WWW W W W WW($8$@-@p`BS0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0  ЍP R 0 0q`@ @T@@~fvtA-@aP( #@0 pA誀40( R/$ R R/  /T-4( \0^/TT0Sp@- @RP 0-l0p0p@//@- @ P@A- `?PP@ @T@`V X0S PpW@0`P`p@P Pp誀D@- 4?P@T  P 誀 0!< 04 0 (   !/Hzhzlz RP RP }//C-QP `M 0q<0 0V@p# 䀖XW Ѝ0 8/P 0S 00p Wp04&08#8 S$=;G"0C S04W00G?o  2%`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  ,t0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZF^01 G^$'*G^s@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 T$A-P@Px0UTPS@UTp W `W` 0 `U`RT0 08+l00p3/`PTPTpU@ O AO G^G^\ P/0 !8 00 (  , !/Hzhzlzp@-@0Sp@z0PS 0p Sd :!*T0S` 0Sh0T0`!\?Mb@-MPOX0@S `**x0S 0$ P`V% 00S" 0p0CS00 00P < p00` P _OH8<)T@SO0 LЍT\?G^G^G^Q @-i/8H^p@-`P0@ O  `P0(0pTOJTOJYJp@-P@PPP(PpT@-Mp`PAO0@S 00K*n@0S$  hPP: TP0S4 S P0 0!! !1Ѝ@!*h0Uh0TPP @ R 00`SPU0P00 P N ㍄Ѝ\?MbDH^p@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ 刄A9hI^p@-0@SP S`ؼ `嵼 < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 Tx/0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02"I^I^p@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pLPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@,p)@-  001P()@-  001Pk)40 60 0 1Pn/)/@-P`xs@fop0lpp000 P$f0@@0 P0tp0 ЍI^)p@-PP@0S `t`0Pp0p)I^s@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HK3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RoqK0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0} 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00J\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcWHzhzlz$ 0)p@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` PJ ӁPlpWXPVsJ@ pJ <嶁00S 3/PP\pI^I^@-@JTT0 TQ S S @Q @-i/TJ^p@-@PX9Pp-JP 7P X0SP0Sp@ paJ^ 0`( "4`#/R/`0  B-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P Q   @-:#:^:,\:( 0 /pJ^A-Pp`@@0@Dp@0@L$<#@`W K0pG`@A-PlL0pLALA$ `@`W K0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0`!pW:X  QY Q  L 0PpJ^S/G-` p P#"Y@PX FK0S  nL00H@PR/G-PQ0Fh pY@p`V8h IL0S h BL@pG-Pl @R`T  Vp P匀`#801U "0S  L0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  K00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  pdP p A hd Q0000000P)QO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/HzhzlzO-`d)@4pS0ʀ0!4)0,)$)   !@WpVP`P 400 $uc0@04 00$00 , 0 4 00CSTYc40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ J{H { l Hp1ʡhPL|00 10000000  P 0 Tp ` 0h`Waf`` G`Fd 00C0c& 0R0 0C &0`.0` 0RS0C2x05A45t454545454544 W%00t%W$43 W 0倀TV} Ѝ R97;BSA S S  @<Π` P BP RY 0 S < b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ夂01 `@380!A!Q Q ^: 0 0S  u a`@2 |g( o4b`0{pFlpGW04 TP    ̈́I 000404040404PTP!  ̈́I 00p04l04T04P04X0HzhzlzK^`zJ`xJwJyJyJ{J4vJtJ\rJ}J<}JrJrJtJ|J|JDsJO-Pp`( 4M40S=0,0 T0$WpVP` D@ J IE-0@@ @@ P,p|004ЍT0     ,o,9 P,0D0 ,@@ D0 m /0P00#0CS04<0@pspp000X [0R bQ" B3Y 3R b\Q" B0Z 0R b] BP"YY !1"0202 $$Y0XZ0cY0[\ ]0`kX 0D2$ ÆahFh`bV`a$"A 0Qc2 {$0A$ Q0SW ASL 0CS>T0H90 P U=l0 S00P10000@!@1P@@T(T0 [!1P@@TZZZ0X00X00X0 S 0@00 pYD8#  T0,88 < T0 O^hJ^L^ 98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-F/L^O-PP L0!p!`W1 p` Q02 !X800#0Q00p0` P b C22  A X80z  " Sy  " 0S  xF0p0`   O^_^`^S/O-`4MP@XA P^!1 00 Z P0̹p c02Aq4Ѝ W Ġ   ! Ġ ! ,  ,Ġ 1!Ġ !  ̠̌  1!̠̌!!!P P h i P D\R@TqZp0pp PN0@000ȷ@T0 @BpGBS0(01 0 0d$000Cs0v 0S0 "<<"$0,04#$(#$0,0 S "<<"$0,0$ 32# $ (#$,0 0"00#0  0ERa0SP 0G0S@0#Ġ #4 <0!<Ġ< ! 00 Q Ġ    `1! Ġ ! 0##4<0 48,0(4(, L<\0? 00#00#0B0S (0 ! E00pP^<T! 4 8!004#  #4<  48 0 0$30##4<"q 0i3##4<44, 1 00A1@00Z@@P0S0$0 00 0C 000Cs0~ 0S N 0#,,#4 < 0#"<<"$0, 0  R ̠̌   `1!̠̌!0# # 480.̠t.4̌ x<^0[ 00#€t 00#0R Bp0(0 0b,0(0S^0S2 4 8 0 02##4<00 S0 b##4<032#$(#4 < l!0!  0S $0 !!D00@PW 0i3 ##4< 0 1 00R! 4 8!002#  #4< 48 0 0,30##4<00pO^_^`^O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? 1!pW:Y  ! !QZ ! !Q  tC `AO^_^`^O-$R@4M@ R^v C^r*P`! !!X V`"( !X P",!P Z S $p0~' 0p RhʠS: 0 02 (,0Y4:04!48#8400p0R2##48 0S0`0P 0" 00#0 R00`0PY*X0 0t 0c PRx `R 4Ѝ衯0 :00 B0c 0! 00#0Qa0 !    R h@P  "S ] 0qY4*X0 0t xp0c PR`00W 0PE0s00 #  "0  S r  !  " 0S 0 `FsBpG0s00 #  "0  S r  !  " 0S  TB0`0P0p0 cR2 ,00 (0 1$0Y:0 $4"4 8#8$04  p r  000!Q"  "$,   P r0  00>  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ A0`0PAO^`^_^00 04040404/ḚJLJ؎J\JO-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  gA0 `0P[:004!48#804pQ 0S  DA0 `0Pό\00PE0 S 0S 0 `F)ApGO-Q@,M@Q\ C\*P`!!P pV" ! P` P S"! P) 0 $0 剐<*4,2,2  )00XR:0 E 0=R0S  @0`0PX<:0 Q0$ Q0! 0 a`0X0@0cP[0$00k0僱 Y0K0c[3\;$;b!Z A bQ"]100 0 S0S  @0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `Fg@HL^T00  ,0X00500\04/hJ(JO-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  @0P00 $4"4 8#8$04  ` R0S  ?0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PE?pGO-4S@P,M@0S ^0L^*0p%!P0`P#80!)V` P \"P !)ᇀ ("( - $0⒎($⊠""00 0000 000 0YR:0E 0=R0S  d?0`0PY<:0  R0$ R0! 0ba0X0A0cQ[0$00k0僲 Y0K0c[3\;$; `ZB$aR!]18#80 0 S0S  &?0`0PP0 0t x0c PpR`X,Ѝ0PE0 R 0S 0`F ?HL^X0S  0R   Y  Z0X0[ 50 0\04/JĨJ,00S/  R 0A-`P V0@P0# (( >0`0p $>0$pv;P`o; A 0`000  @@"/p@-P$0@Tp5/@\0P/ L  \/-  , "  )A-p`^@P P@@@ @S PU$R : ^V WQ =P@^T0 N^@D@D\'LD@D BR@D@D\ @ N!N'O-Pp``08@TV#2 Ѝ 0 U`P@p@-P` 0@Tp 5/@@-P0P0P`@P , 0< 0 00 20ЍpO-PcTHHCUDsT# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@;j^O-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0P;//O-0`p,@}0L 5;k^3k^Vk^nk^k^'_P P /<m;!)p@- P%@P`0S }D>R Q]@-M000:0pp@-` MR@@Py30  `$!1/@P 08SMF@ Ѝp7@-P 0 N@PQ@P M00 Ѝ0s@-P@<`G` 0ЍpC-0000`00CSʺ0 V0  =# C!+. Ru4P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 040000 P4000S 0 ,00/ 0 S _R Qrޘ4P e> 0X&  ( , P B R   ,0d,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, 0`60A00hAl^T0T \/@- 1"\0?0A@PC 0C"4T0 0  ?d @;c U l0<#^ \0B#6*E2*@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ w@Pod)0PЍ耖0@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP000p^ G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP ))0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[p^C-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁*  *  *Y@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP *  * *`TF`% @P TT@@ YV@@@$T P 0!1RX 0SRRp^C-P@?00CSLM`LЍ@0 `p0R i* e* a* 0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ B( &*\ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 @-@tPt`0 `x0` @>NT` 0` 00 @@2N$ Ѝp@ڞs^/@-(R0@$R@О@-Q|L DЍC-@$M` })0pS rBL S?xxO@x  !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \P$ЍP @)0 H0 0I0 0J0 0L0 0M0630-*'X(0\0800sX yL000 BX0@0000H0H @0P0`g< 0L0@0@Y!!s^s^ 0Q0A-` @ P80 rGLppF\P:[pd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P800 00H0 C2 000\0 >0>00C000\ /ЍAt^O-@L8`p0,MP 0s @$ hY,Ѝ0 /\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B 0$ - \\P 0!;P> r 00 0Pd0;0hl0 Q! 0LP  AH B"     x\P0 00S\P00#Sb)t^p@-@PT P oA0 0`f`1cOp@-P`"@PM@ٜ0 000 001 0!$#00Ѝp@-P応L"@P4Ѝ #!Oxp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@x<"P$尜FЍ0 0婜x@-0Pp0 0^d"@TH啜Ѝp 0S (#`.#N@xG-P@|xp$X `D2 H.W L R ! V x$x 0 -   11 1`00C`0`0  0`0 11 1/@- & Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P Y l0d H BT02000V`pd000 0SNX\0S*(P  #$00,0  0[ $ ,0(R:P (P ~0(l ,0 B$"P 00s000p0pD 0S (VpP RpGhplg h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0Ppp`0 00z%0 {0%0 0808<r0"\!o0C00xD0l `$0 B"0$0$ 00V%0 0P T `Vp.0SUp P 'OVЍjt^O-R4MXP0v\0@Sq: # 00$0 0(l $p0 B$"`P5( 0 z/E 0 0! $1Q- q5 :CQ0 : 8 #8#40 (-0(00t0(P g4ЍZ  R 80 #8R#4P00 0RP ,,P$`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`pZ Ѝ@-P@-@;P0\0S1IO-@0,M0PP 6$00 ]6@P0@,Ѝ 8pXldT @L p A!$`P $00`+   0"P0:;征p45Z `"6P0X0SHX"  0` 6V ;`P @ 60\0S5Pt^O-LMtPp x`倐40儀s Z000X/| W@P0 @0$070 2|0 00@P0 $@$X0 ;YZ 000LЍ @P T 0 4  4 p @PZ9 0 0 $ 4 ( 8 < $ @ (0 D0d@<00NP<0 @ < @Rh  @  00 70<  @ $ D ( 00 00 08W 00X0SN0800S 0s \ S00\ ᅃ(0$000 0QPP30$010,000t010(0@1 110  00 10:0000l0$0d0 0TbLЍx|e00P@8P T P ZX00Gu^Lu^Qu^Vu^@-0Ms0P@ A @PT 10 00 |00 0t@x@`@T  Ѝ@T b  4M\u^4C-PRM@Ѝ R `  R@ @@ptx| 2|000x00000S0x3 p R0 -@   W @P 0S0 $5= 00` 0&0007?@CT0100S 1 @P0S 0@00S0@0HML50 @`0&00 0?@pCT 0g0'pp5 @@]CT0 @P@P Gl5 @BC0$ 0R 5@00 0 0^@+ _G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0!P08< rqHL rq0 000 hW@ 0>P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 LW,0@>P L000L00000| r 0 0 .W,0@>P~| L00 0L0000ЍGB0Sk iC-0M@p0S   RP- 0X0P S 80 \p`H@X!V0 @P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$8PP p00 0CS0! 0@T0PSWTPnO-`$M0S S@ d H 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 0:@PV 0 \ r\ >0>00S H0A0X0000 0H0  C200000 @P[; 0S0\ 0T [ İ000D 0 0 >0 .0 0sA@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP 勰p000 #8 *(80( 0>AP @ [B$ЍOr@<@:u^M!Ѝ/A-0 @p0`SP , PW--G-` P@U-@P pp, @P 0{ -00@ p-B@s@-@0P000CSF#SR`88 d0l 0C S c10PQ0/`P 0##sr$ 0s00#sr  Ѝp@>@8l A)A0<)a21 #|Ѝpu^7@-0TP@6"XD0@8 w#( #$0DD Ѝ0u^00\ <0X 0C S0 0 ! /+ 0 0 0Tu^G-0 S*S* P 8pL  PS  P;0S2  I00 > `!R 0;S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!0I~0`S0040 0#240<~ 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, Z000SF:  PF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$d0PD0\ T00CS0H08 S  8 \8 000X :0 L0TRQQ 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  l0 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0 * P+ \BP,0@ 000 000< 0C( 00\ @TpTp0S [   0|0P0P| |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D Zv^v^A-@Mp0@P`00 R@@00V T0L0 0L0800"0 VT@`00R 0 W@T@M00N0P 000Ѝ@-0`P pMX0S, \0R@#0*x P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, x@P  0 000 Ѝ80 000 m7@-@P(P ʄ: Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  0 0|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S }P3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  Ѝ@- `P@ P 0   0L 0 0<03100=: 0P ЍpvdG-0p` M8P0X0S, \0R@#* 0@P~x )0PP(0(wl0dT A@! 0C#p00$?@ p 0@ 0S 00!e   XpLP:!0.e2-8640q."@* "X %@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |3@P *v^ 0`( "4`#/p@-@(0Sp0PS&P 0 R@TpO- DMhR/@lp0-`p0P00`$,`9@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P ?Pự,幱$DЍ$ @P P0`ͭ< 0P0 8 $\$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R B(0W0 ,000,0Ѕ^000o, 0 < 00 0 0 )P0S;P7 000 Ѝ蠆A-PPP Up`U@ .0g@P0  A-0Sp@@P 0`PP`P0 P _00`p@-@Ƭ004P0 pp@-0`S@ʰ@P P0S00  |"pG-0`@ `Pp@lT Ѝ 4 WP0 00@0`@`}@\?O-M@Z0`@P %1 1PPU0Z00008p+08刂p0 P8=W(8p ([( (( (  (hP%u<00<0%#0 3!0nLVP0@8003!0I@T#%X2;>0 SC&P02#@ 05:"0P0 @ 0000000$000 p3@ 0 SS$ 0$R00S0} @"0刔pC 0Sjq@#!P$$(00D 0(0#00$ 0@@P$p00ʿW0 !H"Т3" R 0P03Py 30p 0Gg@P 0! 0C"@0 V0  0U80(, <00PQƥ0 1 000$00 100@p0@$0  0@ 0 0]fT8<$p 000~$0/0 0 w!P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S 3!@0~ĥT!@@g0 R工 P0R 0! 0p]! 0  41T 8@@8081T#\ ~匥#0S , 0S~I0p(~!A!a~ 0\ Re 0  8@@808^<1uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0 Q Q Q U90S S 1H0C200<00 0P  0 P0*&00000$0 0;00@Pap| 060QP T0 ;cS10! 0p$00:0 @P 060 %.P   jX- 0 0$00 "$Z 8S  0RP Ia$0 (000J ( RY#QQY*  R, ( RNڸ \RD  00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* d 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 ?% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AD000  0  0   gX0(0\0,0$p7B(00,0 040S W X0SZ%Q^L=O-P $@p @@DM $c T<✐0娰 ` 季P  0 DЍ`&W`V `#`P  0 0$3 0壴  !@ 8P+X 0S68T08f0TSJT嵢0S 0{ 0 R #1 TMX T垢 0V  01 Cr T 0!;{!P!{P0 ! !0Bq  H@o/@-M@P`  0 0P M@P 6Ѝp0@  4/@P2V@002d0  4/@P H6 嬻V 000( (0#'^ĂiE^ic^\?^KC-p` 0TM P p@P 6TЍ. "" g!>V4D`Y2!>3`04\@ 0$p 4/@P 8f6 c(00 0ܸꈆ^Ăi@^\?^Kp@- P0@@`C<04 @ 04/@P 5 պ/^iĂO^@- 0 0000 0NЍ @-0 000 00 0>Ѝ@-!>0004!4 0)ЍO-@Pp`LM$@Wpl5X P0 7 |8/P $垧 LЍ ``  4:/P q5 $刧 $`內88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 S_x0S $0x 00$0e^{^ 0剨ꤒKp@-@P$ Bp@ 0`( "4`#/O-P@Px}$0S (0S0 &R00j0 !L0 040$ 00@_ \40S+S,00P0 p@'P6 @0S1$'$'$'$'$'$'$0(080S 0 <H40S 1(0080('0P1('10x0 0;'P#RH L0S0P O {@Q2@P T 0B`0<`0 00 0x 0S#T20U0pX0%P' Pw^w101w刀匀(0ST0( @P2\ 0S 0 =@'I000$X:4@P 0 j0 00 000 0L0040 @P tTw1v0C1-QwT 1 Tt #T 000$ 4 0@@T0S000 T 0 @0@S0008Aᤠ 4/X0@#P00S% 00( <0R 10 1 @幤0 T0 0 0U>00X3m@P@Pf #P Pz R R 00U>000 C93H)10S@0   @U. p)%3000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@DX0#T00S 0 #T T0S0S0<2T@0 OoB0CB001 tb00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @0 00 S00  P  Уt60Q &(10(1Thud6@Ty 0S0Y @0 00000D60S: 8, 5(6P:# 80  <0L P0C1001008 ԕ 0`000d0嘚*0<00L 0  !  000d5 000 s 00bR0d`0Y D  P:dd0 00 0`0542(8p  ,?$<'Xy,XX0ra0HS^@2 00?FV;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :8`<U0 0 0* ]<0S<Ѝ8< 8    08 08  0`Ht^@^'_D0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8;0 00 ) *Ѝ0@;Ѝ0S} O-@$MTPP`L Hp RQGPP0UPPӔ0U  QS 0Q P:`0S00S XQ0R@3 q1 10!W?Q00 00U0P00H0 00000`00X0p-181qq$ЍP0PP\0001 1pWÏ`0W|q1 <UH-181q/ˈ^ш^Q׈^<^C-DMP` p Xg <  0$ 00 0@ "400 00 0 '0|0 0 P0 S  Rg P NgDЍL\ 0 \0? 0 0 900 0 0+g 0@-8@ ph0l P 0>P3<P<#/G-@$q`0d 00000`PO`0d P Z000Pp"SR \ R3#. : : x8   088  H@ 0`( "4`#/O-$0@ p2&0q00p0a@S 0F  `pF` p0 S  0 `@pupPU- 00pHkpo?0尡Z | Q ! |! BR!&p WPp0S 1S10C1p0S ~p =p;p0S hup 0XS  0 kpip%"p$d]%Q^< @- p0 00p@-<@P p0@SBpp 0R@C-@M@oT010#P,q,a 0 0R0U0S; A"p  0@\PoU    0SP@T  0 |0 R0S   0 o.&o00C0 oЍ0,0000|a q删!!  *P!X& e! ,++:10 0 ᱭ4 3P !*!0l 0 ᠭ4 "( 40  ++!\?f^o^G- MP  p@` $?@T Ѝ Z@~ʟZ R00 00@@dTP0T00PP2 $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X <0 T0 0C S 00   @P ៜZ? 0 0P0? P!KpC!0 SH080"@   004005000@@o?0 S0 f?0 ^?@X?-Q P@ 0P 00T 0,Ѝ@0S   R00   S @P ~m l@"A-pM0S S\1 @#P1P!PCh0 Z4a4H!!#l R100 0Y@P mЍ̀`V@S0@0P `X0 h00|400K"0@00S`000pP@4#l@ꔉ^^^|K<^- $\/p@-@PP 0SH0F(Up@$,3꼉^A-@P`pNW塓0 A/Sp@-@P`0 x0 @` 0 \0 @0`@z0@ 0<0@@;P )Ѝp^(K@-@ge@c;(A-P`p@ @V0L00唀@0 0L 0h,hd`dPTP533 0&L 0 (H ^7@-P0@P 0@T00 4 Ѝ0@-@p0PS` H`HV 00|03 >0 2008o<080S 0S  V 0 =; Ѝ(p@-P@"0S  0S w 0 e@QL\PP P 0S0^k55p( 0`( "4`#/7@-@00PJk000U  Ѝ0@G Ѝ0{kA-$PU0@$0፬1  )k` pv1S`kA!! @-P 0`S4 R13U  @Ѝp $`V@ 0@ @ !00 0C?o2 104A04/@P U 7T0S 0@0 0 0 0U>0f' T 0(T@0 0 07T0S  HQ' DR2320   (T @(^B^O-@Mpᯔ84@P0S0㻔0@0\5`4IW00 Q, 3Q00 3`0 0 00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  GtZ @H:7[ @ R20 030000 3SH0L RP \0 0@`00^ P ,00 B R  R@0 00  `!H0GS5040v400 3SH L0SP0\ 0 ғ0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0 㠓0`@0 <  0CS00S0W00  4 ^@-8@P(0, 0(00 , @x7@-P H_iK d \@200P.0 800(.0 D@@0Dp Ѝ0(K(^@-4c,8$0@H7iP(p@0/@-@H+i00H@ei@-Q0   0P0"3 i 0ЍA0C-P4 " @ 0@P s0  000000) 0 @P t2h"1@P 00 Z9@  1 $R00S 4 `P 101@@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ Y@P1@010@00@1$:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S %  000000t 偫0 R00ttp@ሀ@M@\?ow^O-P`1 @}pᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,g0S2 h 0! d0    !tT# 000 e.@Ps8p?P 0 R (@- 0@\?oHzhzlz^G-0@@p` !4#Q!PPC2 |2 0<0:t0p0x00008|0l 0 0X 00vPk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 08PK0 TPK!` 0  0SEp   0 zJ P0S00000 \0 Pp0p  A  P ~ {TU  S oQ vO zBᚂ( 0S& p@-`0 CSR!0@P P  G0 P z =0 0# JPp 0&p pG-p0M0`0@8 ;80PPi "\D00D0 D 0f U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSR|U3, BUDL (!PP00$ 0 0 0 013PP Q 00 0,,PPK 婀0Ѝ(0000(000000#000EQ QE1(L\Q #RH L0SP0\ 0 |( 0   ( <  0CS00S0   0 0,00S00  R,0 U^O-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C Sy|ZH AZkL ,<P@P P<0000<,00, 00 0,0r000J! !B1(L<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS {T<0000<,00,000,00DA AD*00010(LdTP QH L0SP0\ 0 {< 0   <, <  0CS00S0 ,  L 0 ,05<0 D #RHL RP \ ;_{< 0   <, 8, BTL ,<@PDY2P:?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<J@P@004000080 0 3@P AU 080 X0000CS000( (  PP(  4~@P, B[ ,@  0,0?0 0K1 1C! x2P 0 0 XPPX0 080 P000CS (  `P(  4~@000(2 0R$78 00 00CS000 (   y`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  @`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X H'P 4~P0%'TZ^O-0pdM00 ,0`0SfPdЍlV$HH&圀t00t0 $0   , V@8u 8QPPP# #RuHL R \P   BUL0S0\ P00  0CSPyU`g , BUBL $8PP }`800008$00$000$0 000EQ QE1(LC0SIo}`?P V8080 0寸,00S0U0SPqQ #RH L0SP0\ 0 My8 0   8$ <  0CS00S0 $  0 $08 ? PHLPP\ 6 $8fPP~,00(004 00 023NPP mQV 4( `000CS0(0&  @P  0|PP  @Q0$P000$0]000A A1 2 0R44 (0 00CS0(0   @P 3P T.X+'' SR0 000HS# SR80Co4( # C,0!0 0 0H03!R@P  08ЍGTG^^^0 X▹7@-P@0LP! ".0S, ,00 13/" Ѝ09^._t]^@-@0S 5@C-`M @P- 00 0SS S pA0 S2 I00>00 P 0   0@>ЍO-p0PDM,sr`l90V0< 4%P00P0H $078 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CSqTHhu@0 P@ X@ @T@ T0S@DЍR 0, BTQL $8@P2 }u TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L80 3SH L0SP0\ 0 Eq800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013P@P A4( <000CS0(0 ,  `P,  0t@fRSiP 0 0<`P<T 0tTN0K 00G 0S S@A4( 000CS0(0 ,  `P, 4 @DЍOsS@ 2 0@0T ^p@-`P@M8  ;8P00 k  08 H@  D 0 013/Ѝph+_@-p`@M8 % ᥗ   mP002  0H X@   0 013/Ѝh+_tp@-@ `(MP0} 0 0$00 000 P`@P A t(ЍpO-dM000/H0p0H0 <D ` $0O X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSMoU, BU?L $4 PP sX400004$00$000$0.000EQ QE1(Lg4$^0q  R[ 3SH L0SP0\ 0Ro400004$0PQ #RH L0SP0\ 0 so4 0   4$ <  0CS00S0 $  L 0 $040 3SH L0SP0\ 0Eo400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05o400004$03R 3SH L0SP0\ 0 n400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 M40q u R> 3SH L0SP0\ 05n400004$03R 3SH L0SP0\ 0 n400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05Vn400004$03R 3SH L0SP0\ 0 ?n400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,(80 ^0P3l:0S#S$Pe PPeR "؀(,x1 3پPP!  0sD E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 匾PPЍPO-00$`pT0DM|0T0 D $0' WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_jT@ڔb, BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  vPP, L 0^n@DЍ800008$00$000$0000DA AD1(LQ #RH L0SP0\ 0 9j8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0n4( 000CS0(0 ,  @P, w P 0m?@R 0 @P@T4( 000CS0(0 ,  @P, M P 0mH@\WAT!^O-0 0p0/PTM:0`<00SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSN`iU , BU@L 4HPP! Cm TЍH0000H400400040000EQ QE1(LH0A 3SH L0SP0\ 08iH0000H403Q #RH L0SP0\ 0 iH 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0W0PS5 QN0!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @lPM,P< P 0 0D0Le@PLU@4D8 000CS080 < 8 Dz@P< D8 000CS080 < 8 Db@P< p0@P@DlHP0 0D0L!@PLP 80DP @,l P@(l 0K0 00S Oo0BS@T@$0TPU^O-M<00`D  T P0 @0/P:0 <(000=00(0`SX040H00L00$`40 P 0S`Vڨ+tPH\00\0 0SP1<0,PS    T0(0 pSd 0Q8```$ #RHL R P \  BRH L0S0P0\ 0  0CShgV/ژ W, BVZ TdL `P: ~k 4<0S =00C00S{ʐ=w=D0$ V 00Ѝd0000dT00T000T00Fa aF00010(Ld0\ 3SH L0SP0\ 0S>gd0000dT0QQ #RH L0SP0\ 0 %gd 0   dT <  0CS00S0 T  0T00 Ld0 3SH L0SP0\ 0fd0000dT0<  0CS00S0T00 0T0^[XD0`S` <0S~ `f HL D`P   T\P$ A# d X`P0 0C0000 00C00 0 0<000<  d B'00X0 0`00\000 00`63`P a(0Sp `X p000CS0X0- h X `uP$ \^j `<  0CS00Sb0T000T0 } T0d`P h L5 0RK` X0 0 0CS0X0 h X `6Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh YP0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP VV` X0 00CS0X0 h X `pP \i`P0%'hUP\i`U0PE 000,0C0 0000 0S/0 000$0pS SPpp j;Q> 0P!Q ;$p[ P0hH0\DiV 0, X0C 040040_ 0 LP0$0, ?oU20SS 0 E000 0C0000000 0S 0 59$0 0/P  0$0SYQ0X 0`(0‐PP \h`wꀐ(|`Vb_^w^^0TLO-dM000&@`p0圐l0p0$ H pp  $0 8@(VP4n 8P  " QHLP\P@@ @D[L0S0P0\00C SJd[d A[<L $4@P h`400004$00$ 00 0$0000K! !B1(L@ZDmh`?@ V8080800S0T0S@dЍP QH L0SP0\ 0 Pd4 0   4$ <  0CS00S0 $  0 $04p0i 3SH L0S0\P00 0CW_L0S0P0\ 0  0CS dWe400004$00$000 $0000Gq qG 1800,000(00  0 )@P KAV 0( `000CS0(0  PP  ,g@. < 0CW 0 $4@P 2 0R p50 (0 00CS0(0   PP pP TpXP@Dp 'SR0000HS#SR8ppGor0( <000CS0(0  nPP `P 0 0<4PP<YP 0SW P00PX0?o2P @YP ,3gP0%'Wv[^0@-00 : ЍO-p0@0lM$ `H  x00x0000000 00 @@  ,0Y[P<{ 8P  # QHLPP@\@@DZHL0S0P0\00C SVbZ  AZHL ,<@P f `<0000<,00, 00 0,06000J! !B1(LoWOf `?@ [808 8080V0@00S0T0S@lЍP QH L0SP0\ 0 tb< 0   <, <  0CS00S0 ,  0 ,00<@0 3SgH L0S0P0\ 0  0CT}H L0S0P0\ 0  0CS 1bTW<0000<,00,000,0000DA AD $1< [ P8@@@N QHLQP\ATDHL0S0P0\00CS aT <0000<,00,000,00DA ADV00010(L < 0CT0$ ,<@P ATL ,<@P0S 0<@0 3SH L0S0\P00 0CSL0S0P0\ 0  0CS aT<0000<,00,000,0000DA AD 1/@0000 08004000 00埾@P A[g 80 p000CS000G ( 0 8KPP( > `42e@P QHL0SP0\0 *a<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<M@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(c`X\` ^`[L`HPVP'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( l,P 00 08D~PP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8PP(  4kd@`P0%'0000 R p58 00 00CS000 ( 0 8ZPP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8#PP( `P 00 08DPPDZP 0SW P00PX0?o2X HP 4cMP0%' `TT1T Z^@-4 0Ü   ЍO-p0\M0 0@ 0 00圐$<S0  D0 00,0*0 00, <00 `SPu 8QPPP+ #RH LQ\P AU!L0S0P0\ 0  0CSP_U > 0 x0?R*`b, BU:L <PPP ^cP0000P<00<000<0000EQ QE1(LP0[ 3SH L0SP0\ 0R=_P0000P<0PQ #RH L0SP0\ 0 $_P 0   P< <  0CS00S0 <  L 0 <0̿P0o 3SH L0SP0\ 0f^P0000P<0d<  0CS00S <0    <                0@xH00L00H0000  06 3PP Q0SZ L@ 00$0CST0@0" D  L`P HbP\Ѝ<  0CS00S0<000<0D P 0 0LTP`PT0$0UHL@ 000CS0@0 D @ Ld`PD 0000L@ 000CS0@0 D @ LK`PD `PFPL@ 000CS0@0 D @ L,PD  Z#3PH b[0k 刪0 08#800C0 0C00 00 0 0C0V` !8888YL @0 0 0CR S 0@0 D @ L`P?DXU(R0@S`HaHP1S0@0 D @ L`P D9(,kX04 #04 0000C000000C0  A0XN0 [p(00`Ḁ 00 L 0C00 00 0 0C0 @0XP Hha PH`0 H 0 0C0000 00C0L @0 0 0CR. S 0@0 D @ LQP H:aPL @0 0 0C R@@L`P`DV$ 01  S0@0 D @ L"PDV  000S U^O-0M0@00`p$ h,00+000\ 00;8 PPDP+ #RH LQ\P AU!L0S0P0\ 0  0CSY\U" y0 x0?R*, BUCL 0DPP$ `,P Y ЍD0000D000000000 000EQ QE1(LED0 3SH L0SP0\ 0 o\D0000D00 <  0CS00S00 00!0000 400 0 0@000 000000 00x0p00<00$0 08 3nPP Q@4 L000CS040 8  P <`Pi8 P 0 0L޿PLU<W@4 000C S 040 8  P8 0000bPGP@ 40 00CS040 8 4 @P8D [#3P<_ 0Sc0 +0 08#800C0 0C00 00 0 0C0X !8888@4 000C S 040 8 4 @Pm8 0 00@S<i_HP0,cX0 0 0000C000000C0  A000XV0 ` 0 000 S0Ḁ00  0C00@ 00 0 0C0 40 P <_ P0 H H ᚧ0 0C0000 00C0 0000@4 000C S 040 8 4 @P <^ PR@ 40 0 0C R0404@P8 X 01 00CV@ 4P0 00C SST040 8 4T @P8T @4 000CS040 8 4 @P8 %PQ @4 000CS040 8 4 @P8 0@?S@ 40 0 0C R 4  8@4|PG88 S> L~P8 ,Hp0 ,żX H0,P0 11x C60 0hd,P YM 0,0@ 40 00CS040 8 4 @=P78M<0 H0ZPH0T0,0S040 8 4 @P8 P@4 0 00CR4ղ4@P _][UI^'_O-00p L0DM✠0L0<$ H 00$0 P -0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS9YTڜg, BT+L $8@P ]800008$00$000$0 000DA AD1(LDW4q]?@Pl0SQ #RH L0SP0\ 0 dY8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS #YTv800008$00$000$0000DA AD 1͹p00(40  h0p >@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  0\ < 0CT0 $8@P )E0@?S`0\H@Pl00S=T 0l 08 U6 3 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0& 0 LL`p 0 \@P  0o\DЍ 0@QL  0 L  L. 0h`L0 0 0p  0x-@lЍ, BT3L 0@@P [@0000@000000000000DA AD1(L=0S;i[?@` V8080Q #RH L0SP0\ 0 UW@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@n@P@V0  R- 3SH L0SP0\ 0$W@0000@00"  @Q00@00000y0A A1 峷<  0CS00S00K000 00;Z@0q E R 3SH L0SP0\ 0 V@0000@00 <  0CS00S0000000:00'@0> 3SH L0SP0\ 05V@0000@003R 3SH L0SP0\ 0 |V@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 >V@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 V@0000@00 <  0CS00S00 00000008<@tz e|TZ@0  \ #RHL RP \ U@ 0   @0 , B R  R 0  000408C@@HL@tz )|TZ@0  \ #R HL RP\ A Q U@ 0 @ 00  00040H P 00CS@0 3SH L0SP0\ 0rU@0000@00\ #RHL RP \ [U@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 .U@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ U@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 T@0000@00 <  0CS00S00 00000001<  0CS00S900000002 '0#0 <00480 00 0|2 3ѱ@P `AV <4 000CS040Y ,  <|@P, P 8R 3SH L0SP0\ 0 _T@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  <@P, 0@?SP8WH@^؋^'_MbP < 40 0 0C R 4  ,< @P,e00 H0@P]H0VT6 <4 000CS040 ,  <@P,  8W`Y> ;*[PP <4 000CSST 4 T <g@P[UPP% 0 0<XXc@PXV <4 `000CS040 ,  <xPP,  8`W@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < FPP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  < PP, `P" 0 0<DӶPPDp[P 0S 0S P00PX0 P?o2X HP 8VT# $0 [P0%'T+p@- P`0 PP@0 p0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSSORT 0$00, BT@L L`@P -V`0000`L00L000L0000DA AD1(L0SHV?@80VT00S $0S S V@0S jT0 FQ #RH L0SP0\ 0 Q` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$Q`0000`L0"  @Q0L@000L00A A1 J<  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 ^Q`0000`L0 <  0CS00S0L@000L0 00P0 0\00X000 0:3v@P A 0S \P 000CS0P0f T P \!@PT ] X$`0q E R 3SH L0SP0\ 0 P`0000`L0 <  0CS00S0L000L0T900``0? 3SH L0SP0\ 06P`0000`L04R 3SH L0SP0\ 0 P`0000`L0 <  0CS00S0L 000L0,800<  0CS00S0L 000L0700`0 3SH L0SP0\ 0 uP`0000`L0 <  0CS00S0L 000L0,700`0 3SH L0SP0\ 0 IP`0000`L0 <  0CS00S0L 000L0|6008p<@tw vTW`0 S \ #RHL RP \ P` 0   `L , B R  R L  0L0408x@uHpL@tw ^vTW`0  \l #RHL RP \ cO` 0   `L `\ #RHL RP \ O` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 O`0000`L0 <  0CS00S0L 000L000, B R  R L  0L040HP\ #RHL RP \ OO` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 "O`0000`L0 <  0CS00S0L 000L000R 3SH L0SP0\ 0 N`0000`L0 <  0CS00S0L 00 0L0 81R01Z 10000 08Q@p ,C`HHEP0s0{ ,?@c;t7\P PP000C S0P0 T P \@PT 0@?Sp`PXRH@z^'_Mbp `P\ P0 0 0C R P  T\P}@PT[00 h0➸@PSh0T00 0S+ \P 000CS0P0 T P \Z@PT 8WPP \P 000CSST P T P\ @P!WUPP* 0P \x00x0@Px00 0S \P `000CS0P0 T P \PPT  XR@pW@H00,2300 @PH0T0d2 0R04\ P0 0 0CS0P0 T P \PPTXx|p RPNlh0Ipx |00\R  4 RI0 4 QSD80I?o200(0S> &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\d_PPsdY`40SZ00S P00`X00(pp?o2x h}Pp ( <0R0(0XQQTA80$ R00S x@t#sr8$srH(5 3 )@P/09 ,0 @0 Q 808(0S0ЍP0%' ^TO-@ 0lM/00p0@@P0\@h00h0勪   U (0 L0  <  (0= U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CYLY@y, B RL (<@P PP`!<0000<(00( 00 0(0000I I 1(LT00SKP~P`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0 [L< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< s@PyU <K0q ` R/ 3SH L0SP0\ 0&L<0000<(0$  @Q0(@000(00A Aw010 岬<  0CS00S0(000(0:00Y<0> 3SH L0SP0\ 05K<0000<(03R 3SH L0SP0\ 0 K<0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 pK<0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0 EK<0000<(0 <  0CS00S0( 000(0008<@ty qTY<0 S \ #RHL RP \ K< 0   <( , B R  R (  0(0408u@rHL@ty [qTY<0  \l #RHL RP \ cJ< 0   <( `\ #RHL RP \ J< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 J<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<⎾@PU<0 3SH L0SP0\ 0{/J<0000<(0y\ #RHL RP \ J< 0   <( , BR (  0(040<0 3SH L0SP0\ 0 I<0000<(0 <  0CS00S0( 000(000v AR( ( F0 0 0C11C!0 }t<  0CS00Sz0(" 00 0(00$1000 08@p 1B`HP0s0 !?@c@004000,8 0 0D13嶦@Pp UAn T`8, 000CS0,0 0  `@P0  4HM`"PPK 8, 000CS0,0 0  C@P0 0@?Sp 4%M`H@P^'_Mb8 ,0 0 0C R ,  0 @P0``H0 :@PH0T` 4L`8, 000CS0,0 0  @P0 jU P-@8, P000CS0,0* 0  ٻpP0 ! 4L@P 8, 000CSST , T  ዼ@P 0 0XX`勬@PX` 1 0R88 ,0 00CS0,0 0   㝻pP0X\ ` LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  _pP0 PP 0 0D%pPy 0DSp $0SX P00pX0?o2X HIP 4#LP0%'@ 0  g0X0X00,4 3 00 0@PX0T`00@`*T dU`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00 ' U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;GZhc, BZ-L 0H@P KPp H0000H0000 00 000000J J 1(L>0S3PiKp?@`]Q #RH L0SP0\ 0 ^GH 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS GXtH0000H000000000000H H10 ƧHU0 | KqU R$ 3SH L0SP0\ 0FH0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00>H0> 3SH L0SP0\ 05FH0000H003R 3SH L0SP0\ 0 FH0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0 UFH0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 *FH0000H00 <  0CS00S00 00000008<@tx |lTXH0 P \K #R HL RP\ A Q EH 0 H 00  000408`@]HL@tx) FlTXH0  \o #RHL RP \ fEH 0   H0 c \ #RHL RP \ EH 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 wEH0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043w@P AU( D4 000CS040 8  #@P8  @ I`pP U8080<00S0T0SpV ^,003 3 00 0@P,0T`0K?o 2R0S@  00@`\ #RHL RP \ DH 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 DH0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 pDH0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  &@P8  @H0@?Sp`@HH@^'_Mbp `D 40 0 0C R 4  8 @P8 @G00 P0@PP0UT`2 D4 000CS040 8  Ѷ@P8  @Gp`>WP D4 000CSST 4 T  {@PWX 0 0```y@P``@U D4 P000CS040 8  ፶P8  @uG@jp`02 0R $4D 40 00CS040 8   iP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 D3P8 PP 04 0DLPLZ㜀 $0SY P00X0?o2` PP @FP0%'T V [ YtЍ iXZLO-p M0`(0 00S$q@chAa3 1 H`P卣 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0EVPP PU 003 00 0H@Ѝ000zS0P$^^s_G-P `Mp儺PL'0S@ zP 0ᢁ003 P@( 0U&2¼ЍH0S0 RP@IP @ P0SH0S300 10 CS 8:8zꡑ^G-`@0 S_Tp  SXPڜ0H0S0S 0 PP@1 3 00000 00 0 P UU0S 00   T 0S 0T3T  -+Ѝ0 P O-0pdMA@dЍ%`000D $0ܳ8 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CS_AT, BTzL $8⚵@P BE800008$00$000$0000DA AD1(L80V 3S HL0SP \0  B R A800 80$ $ 00 0 $0 0(0400 00 00;@P ]A4( 地000CS0(0 ,  PP,  0D@B0,2 0R `54 (0 00CS0(0 ,   óPP,7`P T`2X/P@D`*'SR0000HS#VU8``Foob4( 40)l"0< 'Px0q d\%<3R=Sd0#S\$0( 嵏0 $0 (唊 RP$0 00 S21 00S  0IB˱ Q!-lP  %lP P<@@ 00 PE000 ; cP_oQeP?$00P40S 00 ~4000P0x RH0x0T3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#32024P t0t0$0<Ѝ(0v (0 0zt0P s4P sTU T^@-003!z?` 0% Ѝ^0@-qPM:Ѝ0@@w80@ 3P@z?00`0 Ѝ0#^C-M8`0@XP:@DŔ  8TAVp pϬQ @$ @T@ `8Ĕ< R d(P` ЍJ^^O-,M 0%!@ 0\PP``c\%1R=Sc `1R\0 嵟 Dp1>0S100! 0 $=$S 01000W 00p50 00Tp4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOTU ^^O-MO-`LM4000p@ T0$00`4$0 00: S(0B(0@,0[ 00㏄0 Eኄ?0 Ⴤ0 00D0R ,PЖ0 U*Q6P ,0T0@#P!0ZH#0( PS0$3 0000040 40LЍL P* [Y LR ^*[PX P+K(H%Q!4,Z3<8  Y3R 080 !<SD00S0055 1!08Q< 0*0 0 0S GX!0X 3؃0 R0P!0 R/0P L#" [0L,"\ Z YH# XJ0L,"\ Z YH# X0L#" [0SB 0C0?,@$ @ C*MИ^O-,0`@p(00P  ` L 0l7p0t ̠\ tQ 1K\Nt0 0/W  0U 2Ϡ!8 [ K P0 C @?F,`ᙕ@0A <0V 0S⎕L#" R: Ϡ!800L#" R*080G-p$0P` (0@  ` L 0l6p0t ̠\ ptQ 2I!0Rt0 0/V  0܂ 2Ϡ!8 Y I100 Ȃ P?˂,`P0A 0V 0S ?᪂L#" R: Ϡ!800L#" R*080O-@pP4M ů 0ጂ`\Ŕ5$!\X    0 T0 L)L,)l"300^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP h(=b  $  @jH000$ ~H0'H0 , `H0 00S  00S  00R<0D@$0C!d 0 A~$ 40`R0A|00S p 006@4",&0S H*hꘘ^^4^x>MTU TP=^͙^O-p`0P4M 0 ? ~0@00 !0\%0$01R 00@ ``&!! X0 00?P@? j4*!, ZS QS:OkP ,l 00\ Ó\ g4Ѝ $0 R  X   !,HhT+^U O-P0@Ḡ $M}0\ `#,^ 00 0T ? A)A<)a>21,, X :@ 0@PjP h 00Q Q qg $ЍH  0 0 PgT8^U O-PḰ@ 0$M?}0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X :@ 0@P@ jP h 00Q Q g $ЍH  0 0 PgTh^U C-`PḀ@p 0M| 0\Žß0.S\! 00 Q    ` a 00T40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P f40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00MiP0d0(T0(d C)CR)0c\1S"8 QR!<`0d 000100T&<0 &"40 `0010 0Dp0$0101 0 "p `@ H0PP0805@U50P%P0L05P000T40 `001 0 0p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0cP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0-PP <0 B2 b061")(!᝖''0001S 1' be X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(gb8U@e8 L0PP`P`U1S 00P000T\% 0 R qq p0@01 0 0@0p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000T0 p001 0 0p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0El0000 0(*P(l00Cl00 01 0g00T1 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPdpdPP0 0ap0T000400`0  0 F Ϭ 0f2fbd000 00 00  0OPd0+ bpG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( $Pdaa< 0(bd0000000%F/eP p+H0p`d10 `ub040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T%\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( 0p !0001S P 1 a X0P 0 PB2 b50>" pPG Q0 :1S1 !< 2_8U@e8 L0PP`P`U00T\%0 R qq(0@01 0 0@Jp0$01 01 01 0` 0Pp@=P0p Q0@558 50P%P0L05P000Ts0 (001 0 0p00101 0 0PeP1S 01Pp 0 0T0 C)C)ct00<21 ( 0l0000 0(l'Pl00Cl00 01Sb00T-1 P  0 p001 P@000 0 0 HPPx0d000 000p`0T0x` C)C)ct02160" *(PPdaPP0 0a0T00|0400`8P<0d000000(0!cPPd00L0L 0ql0< R 0P00 `x0PT40@HP d`80slpJx`40V:[ h04Ch000T1P Pl0R 0 L0P 00 0 0O@H@0H 00 (0 0B@Hp001 P 000 0@00H00 0PPp4ph0400 0000T0 C)C)ct0201<" ("PP4 d_4ph4d`PP480< s0L <001d T`<04p80P0`X`10Jㅞ`Pu00T5L0 010l02H0 0 0p001 01 0000 0#PPV4 ppt0p!R  !  0  T B)B1) b072  0(PP400407l0 2H0L q_8_1S !00h  0 0(bPP  0T0() C C")0c7#10 0 ad 000"00  ( QPHd0p ἐ?00T0 `C0)0c VQQ? Qt/" \5 S 0?!>0  0 F Ϭ 0f2f_d000 00 00  0 Pd0) |_pG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( Pd^^8 0(bd0000000%FaPd0H 00d9_|040n 000?Q00cTO-@Pᛅp(,`PT: [0 S0S  PZ@V 0000000@@000@ @O-需TMpP0S@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0s$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0u_o@RTP$M^U000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUP7PPP!;8%P@5PL0PorAO-p|M00-P `븰[ 000P|Ѝ0 00\@000S/ :0 80P0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P ]U P n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ 2`PU@7 \0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @H `( LP@% 0@D TTw 0,0 X \PU@ms\V 0080\0000!Pir0   R  R*4 R\@-忹ʚ^000S -/0   R Q   -//@-P`00S-@! < ׫@P@P 0@0 0 P]@ 0S R @ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 剫@P 0ST 0S@Pu@PL 0pI@p p G ppi '뼰0@0 0  Cp 00 @W  A K@K0P L" l1. Q*Z  S0 S 0 S00@$Ѝ 0p@ 0 宂 p᪂ ޅ 夂  q  ;@P &  z  rq弰帀  @-@@A-P@00S= 00CS9< ڪPP0Sk@p?oV20#S 00W: 0R R 0000@0` R @@-A-P`00SE 00SC 00A0 厪@P 0S 0S@Ѝx@P}p ;뼀 0@0 0 Wp ]@ @ A H"Hpy ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$tp8H\0`0P00 00 P (0 P6\0 44#T20T20$ ;60 0RڼǷt ?0:# 4080$0H0(#00C\X@P\;@P \4ZdЍ\0000S00$00?@D0@0S@@T @ 0d\00 0劄800t RY\Z0 @0S 00004L0?tPP0(0`E 0/#\00000,< 1P(080< SH007D0 R00S 00S`0 1`0 0 400$0C0 0o T0 C)Cba)0c9c00, `Pg  R !00 R(  ) 080S03 S300S P" 00 00p00S01 0( A0L 0 0P 0 ,0 0,000 000<0`V0<0(00C(0~S 0 00T0C00 T0 C)C) c0<;2 , 00PPT 0U0T0S 0S P0 劜_o$0R_P@0S \YUSߚ^@-`Pp!0MV @ pᝀ0 W p0 P  $0 Q D 0  0V `0 P ( ,0 Q @ @0D 0 @0D 0  U P0 P 0 40 Q$ H 0, 00:00Ѝ    O-`0Mpp@P0 s00Su 0@ 00@`p\%1R,5S0 0 0 n0 o."\哞T1`Z 0 ?  Ϡ ,2 0 `x 0en`0 C c00T0 ` C)Cba0)0c"03[P0000x 0`0>n\0\%R ,W YЍ0 X TTO-]M 0 0$0@ C0CSR ]ߍ0S1  ;100P`S00|hp 0\5pSB\\?@5D0L 04; pW SØ,.1  0 Su0R: pSWk00S(pn 0)PY 0000 0 Df8(\$Q?00 \0[&/ 0x[& 0 0 0 0Pr  P$P$8ŕ0 @L (QcY!0800<00PS 0W)R 0V:0 0 $00 01 $0加S 0 0kP0$ c2# S,P!Q  RQIp S1Q\Q\3PR= $08u< p 0 H0pß $0YW/  0C10$0  W 00 $ 0H P 10$ 0X #H0P$ p  ~p. ?c 00 S100 0 P 0u0S 0 000 0R    0幈00 0/SP0 c0 SRQR3000Z,00004000 ZP t0T RX  R?&4D00\h p BW, W pq0S*0p ,Y ! !X4@X Y   !0 C 0[00 0 0pQt1(( R@ 0pPi1XXϠ R$0 0 0p0 0R$       0 0000y0P0[0 S0&t 0( 0Sp0 0St0Sx0|\% 0R  P ! P01@ # 0@0H  p 0T0 C)C )0c8Ì"h0 30P(0@0S" 00 0 00 0S(0 01H0DL0H0LpW* p,0S40 0,04 rs \%5R,00 0!!0 ,0 S400 P00 L ᜐ pl̠: S?:0p000000S00000 00,0 S400 P00 A1ᜐ a8:<P0%:00S-Ȳ8%$"6600Q 00Si 0_P 0 b R320 QP1Q SQ ☐ pBᜠ b<  YS:0 B z'z b~3p2z0W p11$0 吓S 0  0H0$p5 5C20000 0G00=0 p 0~pY 0X%0'00 0UP 0 S100 0 P 8@ŕ L     1ptpt1p@0S(0#S [ 0(0$ 0埆$0(80 0<080 H0<00 0R8   < < L   0 Rh  Bh    R  L000c\%P0R !0 !08 P L@ l0 ^85@50%00L508Q Q0(0<0 0S 0 01H0L0H0LpW8up@5pL0p85@00L0T^&^pGWm8Q Q0(0 TS1 p?H0L0H0LQ 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"7@P 000 5~9S|T@ЍQG-p0 `$PR@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000QPV@-`00p0dPUj@ 0  Vp@ T \ ЍXT80< @31)` Q0R 0008<Ĕ?eP0 C c00 0 ڛP `吪 0#0X  0 h 0S000 0`,``000徥008 1$01B0I> 0008<Ĕ?dP0 C c0 ,$0嘛P `OV0L"-0 0 40h00i000R\^^^ћ^^MG-p0`@W PU 000W Ghh R 00 0h RhV9S000rᤒ/MO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPr p$`W0@: ,0W0:F,Ѝ\0Q.0] 08T @)@)`"30`KPd 00\ Ó\ GxG0哸+0[0: 0 TU p0Sp/p@-@PM 00@0@ @@@㣝|`0 0@0@ @@@㕝P0 @@ @@@P ㈝ Ѝp@T=^L8 p00CSp0/@- @ @T=L@-0 R  @ @0b ` 0qЍЀ-M zPpoЍ6^O-0,M H P00q0 ijpW XⲤ@?n /h+p+ 0 $+4JP v  0q % ! % G\%0R004\5 P  ] ,Ѝtl4RR  Oh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3Xq  ,000j0P0<(%0 0R@0@0 0T`0$}S> ) %> 1S 0DV<3<3ơ0P4T$0X4S E>0X4'40`AVL V$5S0P=$bx $b`P PតP/ ᥊80HL0S40pH0pՓT0 C)C)0c"03IPP  0p  XF80`$%!0, R0 ei0P T:꜀ \+\ἠ_<#| YP  0 ?<#Ή p 0Px 0\`0 C c00T0P C)CRQ 0)0c03"tIPP P$,b"   EcL^8 TTe^?^@^0O-PRp@0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 S*E0400P008T0<P C)C44)0c03"~H0P440$ R:E4 5Ҡ  0 Z00C?o200004圀ArT$%,0R00-L0Yg$5S0PŒ, H[4dS944S@040T3 0P1b110 1<(%0 0R@0@00P :>0 $  * NPf 0L00T h00J4P DUo P ؇$<Ӈ00b0(V 2 20800080 H0S0L0 C40œ T0 C)C4)0c03"G0P4 0,0n,04 MD,04080g$%0 , Rh 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P0ܸZ 0 <Ѝ\4S  5  0|V000\ \ 0^* a@fd^8 TT 8T^e^?^@^ġ^@-0S0qjP@  sA@La@0T  Ѝ 070@T _R_070zc`0u/PpY0Y V{<C^@s_hk4M^4A-P00`SP p`@P  `@PH嵌0  ``@ЍLC-@p3$M/P++  h0$+4`P6T0h 0mT0 51 50@0\%R=S04, 030304040 50m0" " 200(0\5WC`$Ѝ^AT8 O-,M@40ARp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"03=P$ 0`m0$000SC8 PAG-pMR R`@A ZP   hPV!P4 ]PP0 RPq0mP V 0S 0 0R\ņچV 0\P 0]始0 P@0&00 0PPU:040000 0oiPP,V,`L`` 儖P1U0 i0PUp`z c vfKdp`=S0 Po04=S:0 0S0SMP(0 aPPP 0 0S 50ó 5y=S  0  PP Ѝ0 5< 0HV0004!4!000C?o20000\4S Xu/V8 5 0 5=S# UFTPo=S 0 1C>00}0SUT,010PWPU _ġ^?^@^^,^A-@`L1pPP ;00' pPB=TSFP 0 !<=\0S y= S剕f$%0,RL1h哄P ㎄^ᇄ000:0O-P@`=$MS =S  ⑞8]T㜡T00p@0 X]P9=]T 00T RdXX T vPpT=S+ 001CnP$Ѝ  P T 0Pل p 0   Ah^Mp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0gP 9 ;909  000&00PTP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0\M0(0 0 0 ) 0% 0 000 ) S RQ0Sd0$0$ 00 0 ^0X:$0S$> 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  0q80 V 0(00 0 0P40S B#H0 .`np`` ? 0:P00S P0S 0)㊣ 0p0`085< `F V`!V"40S #H08<Ř  Ÿ   . ?ූxD HLW  < W Q  #&&  "00`0,00,000"R0 0 00T9qTQQ80@ 0(00 ?P;H0 C2 00000 0&",R0 0 00p[@0Sh0'C( 0C8RP] 000 #8 '(80(0>PK $00(0 +\Ѝv0( 0 8 @  1/t[!p@- @P7 Pp0p@0@-@Ppl9S ʰ;S  0"*`PQ 0 SL0L0..0P0h 0   ЍTXPO-pLMP4  P3s:Pp R00`5M:eP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@AP80' @DXT $@0,0 $bY8 >080[ 0 0 0 \$  0 $ R0 8P = 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@ 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  ዡ) R 0P0 1R H0C200 00 0;% P ЍO-需,0 0/\*0 ,\0 0 ) n,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` a@P 4<" 0 @P4<Ѝ8e@5``L0`(04S =oobT`V 00 0S:7=@-P`c@P0 0@P   0 00PY0 ⫑ЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?nR p p 0 00000.0>000 Ɠ@P9 W000 04@P, 0S)8 0 @@T0S3, 00S00j@P  0  0@3 1005\Ѝ2 M:pP 0   0,09:@ZGvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-\^T^t- P0 SQO- 4 R 40  #H/" R @RP `@ p`f9gpTpTP^@!`n``p R  ^N  ``QRV^ 40S40p ЍHp@D `4`j PUiQNo @`j `>i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000`0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(0:PP 0 =$05L0 C c#3800 9!600< 0宎2#T20T25P $7 Ѝ`Q(0$ 54D40SU 7700 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000G@-0S    P (000 00 0 <ЍN p@-0@00P`06/ 000`06/P z00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0yPEP0W(0,0ů _8-t1 000040 0 0ƍpP /$yLЍ0x 0 | P ( 01/P0@ 0 p 01/H4QxOGpUp(6*C/Q @ ?QD   00ã 0]PMMM\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0l!  0`*Lc  hQ Ѝ!ꉪ^@-0,@00V@"4/ЍTnTuT^0@-@0@000@@PD @DPPP0 0 P: 08S00P0000@^4^(^^^T^p@-@`P(0P0  _ P b_K000@09#60pO-P@p0KM 0`@`0U0:KߍP1 00P0 0 ;0!Q \0:V&0'0S(.^S(,0S ^ P\)0.SP PO-P10DMp @0! 0x 01 0x 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 8@P0 h 40R 0 h`F ` l 0w wDЍ@>O- p`0MP$00$ 00@0000D000 t0專P @"D0900 00 0KS@$00|00000 9P |0S080$0@OoB@ЍNPM@`00 0`0|0S0800`0007X000C?o270L00000L0000[00CT0T R ?R5:0X80@040X0  <00 @0C0?d00?\00\0I0H00,008#8@0 0h0X0H S80S0X0T0 H00(80TX ,=0t@P t iXT0 P 30X t00?@Pq0 00(0t0(P0000ഐYg & R   0 P 0\  R Rj 4 R      IRLXP^P`z( ( (L R  A, T R? 4 R  R8 l0dPl014 RB  R?\0XH800,0tP ;3`0Sw [08S 0$00 :d$X 0h0@0 C 0)X @<  X 0S (<  ,  8 R\0c<04 XR@@)@@@@R0*#f @圐 0R@ @000P2X0[00SW 0 cX00T0 0 儀0"XQ wx`$0x000 >:{00S6 9S3 D0  P@0S 0d \0H0L@X :H@Pi[0 @<0@J,0,@0X[Q@T[=00S X0  <  C 0L 儀0"XQvx` xpĆ@P9  0 0 0`pEP @zv! x0w@Px0$ 0@X0[00Sf D0  坆P@ 0 儀0"XQ@  x0w@Px0$ 0y x0w@PH00SR@>f^q^@A-Mp@ `0- 0?PP$ 0 T 9 0C8C890000崅0TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP$0  @@  9 0C8C890000j0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?}@Pm@00$0@T  R@@@@@`ᴰK [00S S% bP[,Ǒ  @ `@ T@ 0P@@@@@B [0[ᴀǑ@Ƒ`0S 4"40 [ ӄ0@P00 R ?R *  1/,Ѝ肫^O- ,M@RP0Sp0 P刐`0I $ C0  ?1/P6 0 00P 00000)b@ 4"400 00C0 0   [l@X0 00`06/T,Ѝ ,ЍOꩫ^-DMLH ,  0徖DЍ^@-0"HP Ѝ@-0 \ 0 00\ЍA- MP8@<`P^0yᨀPPP)0P p@`  Ѝ 0 @@-)@0: Ѝ@- @ 0 0)0 Ѝs@-`@0 0JPPPP ׆L0 00 ЍpO-^|/ 00CS0/0 H>|P@- P O-M000@`00 psPPvPP0 qЍ 0@0)000Q 9  h1P1 00*t00)0 P=P 00 0 00Qd0X0 000P05/PP  宄  0  P`3P ̄U000 40 90000q'_|7@- 0@ 00L jPP0ȃ Ѝ07@- 0" 00L Y@P000 000屃 Ѝ00  0/ @o/p@-@nPڈ000P0 5/pC- !0PM R`p0 R0R0 5 0/AT@P( p0S2 I00@> ʠ,ʠ`@*J0  m@R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#+0 0 p~@PX0|0#880'00 Rd0X00$00|0 *P\P3Ѝ z0s8 0@@z 0 { 訖@*0 pK~@P 嬰0 Rt 娠0 Rp000*P\Pf3"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 l@@ 0 p}@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *ו00)0 p}@P# 9  :(090*P\P2-@@@@ ^A-`p0S t 0d0 0 0P0 Lf@P90VnЍ@znO-` 0M0wsPR@X1)RP##G*D1 0PA@0 03}PPP79 08C890 000000p07/P 婁p 0 L. ǁ[ P ) B(B()    ڀU ᄀ Ѝ|C-` @PpTLp T, T4000S-@ Ѝ贀 e@00@ OT   b? 00 0P @ w 070 @'|8^O-3(00(0XH`$p@p P(p@`,V0h )/Y L@/DP @18@AS8 80< <@@U"#T^@/0@-`0ML@T LPL   @A0 0,0 0X0@@:lЍ0"p^ @-VP@LO-plM $@6 `@ lЍn @`  t!@N@ S * 0L0x$ @$F 6 J0 0 07PP6"R0   46 6Z(`,  [tB"  YV[ pf$ЍO=(0 AT  QPP SPUR QP  RQ  R R  0ROn0@P 0 J000 A`P X0P`@ď T0,0PJ`@$Ѝ# 0s/p@-@`M' UOP1'<塻800`S< < # ׻ 5 0`5PP50  R $0AQ0%4 0fU-H_`Ѝp5 0 P 25V(0,#6jV3,^ꀴ٭^C-Ap J@QU儻` Ѝ<0@8PU |t("AR0@4 R`001S B XWP Q00P `YZV U T,0!X00W0S `"V0P `UꀳO-@M ` @VsC f %  ! . R  81  0SIw![+4    BR - 00> $!*;  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ <P C2 2 O2X    0 ,  4 @, #\G- P@ U `D`(00@0$V0:Pp%$01Sv0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0p^^#O-4MX傉 8d娉0:hR 0P?)v%t(0$ 0AT,0@T83 0B!0U QY (@ 0`0DC3f0S   $0D#0* 00 f$0(0S, , " 80S< < # 0P 02( $ (( P( ,A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0`09 0 *"*0 # 30 #6: ,00$0T 0! 0 0*Śh0 d!/l!0 \    ,  d . 01/pP6 4Ѝ 0`0DC3fd0 R  R Z ܛ ž,d2`x56[d0$0 6 0/0 =p,0W ᦞ 0h 0 0,00#\?^\O- 00S #6:(00  $ (01/#P1 0B!S0S@(06` 0 0T:01<Ѝ0@s 0,  x0J0S Y5 (P0,,105V0$0_2P,)/$0   0 ,)0,/,/,30, Z 00 0 0#\?^0@-,A,Q0  M*[P & [0,0,  P0 Q0$( R*0 000p0&P pu ,#004 ,0  $ 0,,Ѝ0@Q#L>^,^8##x>Q^̕N^/O-pP@ R [i WQ PB0 0  ; Y HW;p9@!Pa 0U 00  @@`V,@P  6 0&53PK <0 ( 0y5  Dps+Y  Ѝ 0 E++*O+ 0D0 0-YU  0DACV  0 =5SpMp pӮ^ܮ^^O-`pAM$ P@\)0h0i0j00$0Xp7>0S .82<082$1<0S$10|$1|: R$ R l 7<K<@D0H@T0 @HP O P<< 04P@0T  BRT 50 H $@ H@L   P000 <8 /H$ | XY p X 0h0h R 2˟`A&f,P 0V`!0CFAT#60CS  00`00\@d`h0YpD 00|0|=P0 D>PP0V200C?o20S6 Y 1S Z 0 * ) * VX P x(0,p 0 06?  0 1/Y Q0F\@0C0`00d0 pP0H0(00d`WMZ <0囗!P0rH@a <#PP |p P0 @0S k0Sl00l0 0SP0XHp0 <P P@q < d< .0`@\`0d`0_X0bcX0P0x0g(0S [00p0W0 `V 0S  <0 P3P0S_)R)k) 0#s3<0G(l0[ 0ÃQ 0   MP uY i7 0/ O0 X<0Pe Gk0S* 0S'0P 8`t0H 0X<P6 063p00 80<p) P P680  B  X<P 030 Sl0 0Ãl00$PU XZ B 0@ P 0<5/ PPs0P <;x 0"20P@800 " 0 R002` 81/80S1O E q Gr  Y R; 6(0<0P3*PZ2P0S(((0 $2l0Z0P 0   0 ,0R< 0 0(0g' ,0( F 0 SZ <0-k0ASTt0CP0@`X Hp,`F( 2<`0 0 P ^ < 3!#L20L2 0U20 800 8  4  @ 04@1/PPN #UIX3 X0/ 0@t03#H20H2t0S0 (2P000v l00l00S k0Sl00l0 P0X<Hp0 P `Pf <& 02x)-0@ X<0P000#10yuP<jW``V@ |40x P4'4'4'40 0  V P@ 0DAP@ <t@4 0 0 0'4Y'4'T4@ T  0'14' 1 R"P';'' 0@0 0P0X<Hp0 uPp00 80<bp PZ8`t 0 ~10 &0us1XSj3$^^*^\? ^5^?^I^̹^C- @ pP)m0 P RSPP P D1P  ✒P 0@0S E5`P '&$'JT03P5:P  ЍT^p@-@P`g  p@)QG-@ 0S`pPU@# * 0 @P U  ZX 0 x>X 0x>A-@p@`@P' ΄0 F@x>@- .    Ѝ0.   Rp@-P@ 000>p@.00.@- 80000  0 ;  d0ЍP>^D# 0 `fD# 0 ZfD# 0 fD# / /A-D0Dp0Pc00S@0000圓vAr @-,0@ ,0,0t ,0 1,*,*h%& 00S:^%0@ 6, P0T8v0v@-\0Cኞ0h0H0aᕞr1(@ +0 X^\?^0 0@-@0S#300H#@-@0SkP  y$+0  =$3NO!뻜( 8v|0W<\6 : 2wЍH#^/?^O-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! 2`PE000 pP  Vx>4 0S/(0(0 S;3S8#0/t>,/C-pbDMPA  p101U 00 1 000! P |j 0  0P$P(0PD1P 000  P  0 ! B)1PPp]000P P0:PP00 yP00Pz0 00x(0x0)0:00 T PypDЍt>p%?h%\'^x%^h&^&/pTT^)hPA-, N0RǠȠ̌' @N@  0 `p0PP |mj000/U>PP(0 :00 0 P RjЍ^X^G-p`0P00@ @@ A|0  T0XhG 0$pP 0 d #\$P$lW V$J`h%t>\#^O-DM@p xT:DЍ!嗏Z`VU3#:E V@P`2+$\@-. .   Ѝp@-N@N@`P@ | p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0y$`0S @+P (0  $0P 0S  $0`,Ѝ zI ~"@0 jh%t>\^O-N@N$M@0`wPP$p`AfX01000  >$0PV l(`0 P  x$Ѝ H 8"@0 ᚍz\^t>p@-P`N40@N@ 0 p@wt>\p@-8PPp|y@xy0P3#pt>@-@P  0'- n  0R 1 0-A-p`V@0 0SP%PU! 0B0 0S0S 0  B;  090S 0S0S"U 8`FPpP0 ꜰ^A-Pp`VX+ @$A0S0Sr"000r""`0 0@X @&$Tp@-0Pp0 B"@x"0S D""O"Rp@-@P U Tp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXk@$0 SV 0 RP0`PX000 00Cd Sd05$0000 R0X00\0d080D0<0H0S + 0` 68 4000 R 0F 0H0S qLX.9Sl `0< IpPe 0@ P 0  Q 0S `0L$ Hs@lЍ觑000pD`0 HL P r #RM4 0/x [p 404 J,00,0f@0S `0LHE$0 S@ $ 0CA0Sl!000l!!@ 0S `} `0R $@Hp0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #Ph2 d0/ vL(WX HD0 @CD0 0 &X `P 0DA8P LD 0 !D D !D 00 0Y D 0  $!p<Y 0 |D;PsbD00^0 B H@1 0 pP0 pp0p 0!pP 0D00 0    0K0@000"l0-\0) LID%LP T  H'\?^^,^O-4M$0X0 P\!0@lX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X% T \n4Ѝz,X Y , !!  !0 / U@\?°^/;@-$F0 @ꀵ̰^,@-`@ 0 ```` PP  " 0@0 0܏ 00 0 0SC!ЍpC-`M 0 ````p @P 4 P!ᬏz"W' 0`0C0@ 0; 0! 0WD0 0tW1 0S1  T 000Ѝ 0; 0p 0S:0P//0 R:P3#//p@- P@ᨧ00%^p@ _-0 @0 1p@- ` H0@SP`B   DD00 $p@';p(0, 0 (0, $0Sp0Spp@/0G-8M,00@p00P  0P0(p$@ @ @`(0,0T0P 0H00'>000(p$@ @Pp8ЍHO^>NG-M 0p` @`1P0 P 00 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0YP >P @-^P010-<0@- P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#0\0R 0B  UL b  00L# 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B ,0Sp@A-Pp`^@P 10H10@0P 0A!&0D$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```-0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`0S #S Pޥ)0S w[000p@-P@SP 0S p000p030/@-P 堥@-@ $M0 * , 000 00P ][$Ѝ^4?-A-P`pP @F00 1000000 @ 0@AA-P`poP @(0010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO--p@-PQ@PTpHP 0 D B"&0=00 $00S 3/ `D@A-p`P<0V`!@0 UP1UP!{P @ 0S*0S 3 0S*0S GT 0S PЍ0S$0SH0S0 P 00 $"A6SA-P@`pS&S<0V`!@0 T!1Q!)@P @ 0S*0S 0T 0VЍ0V* 

 M;@00CS@0Z pA-P@pUPP0` 000 PP00`V D#&R $ p@0S 2 PU000pЍ4 R @ R  00B W $6SV X130PPV40S @0S00 80$0S0 0 0@00@0 P@0S P080 _pP 04 R@  B@  0VP`U40S @00CS@0  `L#O-P@4M0`<0UP!@0, T@1T@!Pp4Ѝ,` 0 Upt230{0 000C0Uw0  lpQ @ R cp U 0 R H$Z 0  0 U01 C00 0C00[ C$> U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ 0P P  $R  0S0S 0S   [ 0 S K\P 0 0  BR @-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P030000p3O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  P*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  P>Z   R 2/  U   U    B    AX D D H H 0  0 pG-|@ pP`h$00LP0PP@O-M Q@ 0| ЍOQ 0QSp80ISP#X*WZ 0P UPQ #Y PK3 00 0PP@04⨨0P04 wWp  >0P`ph@00(0(0V,l4s0s 00V0S` Y 01 0!W@T # 2RW 0P0S  >PЍ pWg 0 0CRb00l"hD$0]00l $P" 0000H00SU4 @D08 !O, Q ,0P S""D00<00+!D%"D%!D$0 00p 0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !0P0P `@IPZ0sU P3h̹^^T^@-@pP`MS  0p@ P Ѝ@0ЍG-0@P0`Sp0S 00S R 3/000( <@  < 0 000SX@`@@O-0TM|x@L00000p 0D0#@0 D05 0 D !6  PD000 @) 0 00 00,0 H gP; HP K  [0 S 000`(0$00000080 0 S*00S400S  ZL00(0 0$0, 00S`PZ @H0 PHP0400 S00# 0 0 000 @0S VLP 00SD  Y  K0 C 0 < D@P 0< 00 0 00C0, QS00$P0$ 00S 3/(,00(,000 00080408 400408080<0<00@0HPHD 0D ) BD80"&920( 2040S10010$00$000 0C(00S @@ 0  R*0Q~ R{`H0@8 @PB`@ 00R0 R0%`@@HP0 0 S* Uc~Z00S `Y@@T  V' LP9@TЍT 0 PH0 | z 0 B  H00  M0 P L00(0D 0$0 00:@⹿T@@@L#O-P`@Mp@0 0h<0V`!@0 T!1Q!@P @@ 0S*0Q* 00Z R:㈱Q0 Z8Y $ Q\  M 00S  04S0 08p S40 004 000 {00 $0 S40 @0 @0 W }00 0 P  @Z 0S:}"Ѝ ̹^@-0f ЍC-` <@"# p0 v"0@P@00T@W}20S R 3/ Ѝ<0S0 00 0C0 @00 0 0  00P 000H0S 0@0S 0 0@0SH0 S S 080 =40 0zE00000 00P 000HP 0 D B"&00D0H000 $00S 3/0 $00"00000^>O-2*M00P`[0pr  0P 07/ Ѝ@4 R @ RO0  F 8  $Q@S =0q0 0 0$0H R, S Ͻ DJ0P0H0[ \1Xq3000 80 P[  q  N0SH0S 㟽 DJ0P  0  ɾ0:#:00 0H0ݽZ0 $0 03/ 0, `F(00 0 7/nP@T@pO-M,08<P4 / [ ,?00/0 0 E/00 /0 0 /080 ֿ/ 0<0$ (0/0, 00/04 80/(0< H0/,0L /T P0<0DX0/@0\ p/`0d 0 Ht&xL|TX\fjfklkalal`mbm`njh 0n/1!n"  # r# 0΄z/1!  L ~)  I * *! / <" /#΍  @  ͍ @ %- , &- . . @0o/|"!x2"!(1" !2"!"!"!"!" !"/" /$ $  #8!# H/#-?BC@! D!  (# ,#L1H 0 04PT!8$ <#X\ @ÍDd1`!(0L3 0H#hlPTب6>Щ$@ 0@00@(0 B0 2@@ R"` 0p0?U0 0S?#03@, 03030300ߍL#KC-MP@P`` p0  Y PH1 R*Q, g! 0L CT04 ,  0000<0@0D0H008  00000000rЍ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221ӀрL#>0a/Q/0S //C-Mp0@`00 0` P(0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 SP Y 0 03/:#:SSX  0 7 0D %6SP0S 0P 46Se0 x00 0$Po 0 i\L#@- J$JL^ >00>0^0 s *0#03<@ Q03 R0S O-,M Z%ZU@N@>0 0Y*1 00000T5$6 0 0U:@L5,Ѝ 0FpC W|#$ QP9 @Tk0 S@PP Z P R:Z 1 0 $`  PR0 HX qV l0V00'0J R$0 0$000$0S Z@X 0! $0 (,0 D 0PJ0SV 吸X 匸$ DD0P Q @w@xꔮ^O-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { OP 0 0(0S 00 0<00800400 0 @00P@0vC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00\$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 08$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 xP0 hUh*Po$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20]Y ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P 0D00 Pp@p@-P@ U p@p@-P@P T@@pG-`@P $o T0G 0pM YJPO-tM@$0$0圀@T` O0 $$FJ0H0围p T 000@  ,00 000 000,00 0 1/pP  $0tЍ Pp,0Q P,Q,0,0@TÏ6 ÿQ Q00   0P000P0A` 0S P   pޱ^*'@-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6 Ѝ@-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6 ЍO-A11 0R tqsw0\ ,R 0 (R 0!L P ᢌ` Ѝ P @`V2 QE A00S00S  R 0  ~wT PP\ /P101101@@@U$L#G-` PpSP |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T$ 0p@- @P!  ` 0( 0S݋H0;H0e0 P0RJP  0.  0+  0< 0000p̹^ 0p@- @P!  ` 0( 0S孋H0;H0M0 X0RP 0.  0+ 00C0 0< 00 0p̹^7@-""&*C6@PP 0 Ѝ0 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@P@=T@Ppp@-@P@qT@PpO- s@0PSDM@0S^ D0S@Z b10  B0S#0 0.`0@`F`0`0@00I0S @0UADЍO. ?@@D @00r@P ^0 Q"0p`0[) 1 pW1 @  P T Y.DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@AF   L#$4?/$^@-T R*0B 00 (HR0\ L#^A-`Pp@P @P0SPD0S TG P  BP$S^A-$aP0AS q0!>00000000 81Pn 6810`U 0CS*G뤀p0WqW000N@N@W\0oЍP< 0 lJ>/L#~^/^\Բ^O-B2 ApP LD P⩉U@@cpbGc`@jP$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0mP`P`EO@0   S0P    @P 0>0000000x (0D0 , 6`)`F d뛦*@^L#$B}4?/>/p@-`P@,0`P @ p/0@$p@-PU@Fp@x0@QX00 1Ġ  S0 Rp@Fb^L#"^ l @- 0pt0SKs@-P@ ` `"""&*C6V 00#  0+0 0Ѝp@A-@ PP` ""&*C6> U`" 0pᡈ P(,`0p S 0: ` S 0; 0̈`P ᆈ̹^T^@-@`P0pv0:0徯0 p Ѝ0 /@-@J0:00M0 Ѝ/"&*C60S/o 0S/s 00CS0/@-@>d#@-@t P@e @-0@S000d#0S/@-@\ P@Q 0Pp@-0@0P*p@@-0@ R0 @E00B@ A-@ P ""&*C60S7 0 P , 0; 00  0:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(0 0 00 0S0SPU 0⯇P `V' 0S 0x0U 0  :0V281` 0 >>⣂R P A 0S 0 `(0`s 0p 0s1Qm9 0 6 &! R  010@ 0"61@ 0"601008 00000儇d#$L#O-M 0DP @@pH뤲2 a  00"603S P0 PYYHP TDY  V PY ,"($($ W     " "| 00W @(0 0p,0<  0+ #$ X  Z-f0L PY 0 P0 PE ЍP  0,P0SX  R * |R + 0`؆  P ᒆ ̆ L#^̹^T^A-Pp`VUAA0Ds 0 0 0P 0P 0  0 0b`0 00]IT$p@-0@ RP0 @00 R TpP00}00yTUpp@@-@@~ep@-@P0p@De@-  @-  @% @- 0S Q P0Sp@- 0P p @nP T  0Rp@pp̹^000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/`Z@Z0Z0@-@t0tM@@@0 @&LP @ @4P00S 3/@TЍ0>x>0/^O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z峄 0S 0 ,0 00 6$0$pU0Fj$,Ѝ d啄0X 00L ^0 fPEz$L#D0/^^@-PfM5g0@j0 06S g0 0JЍ@螄pmp 0 ZPT 0S  p50勄 P BЍ\0/L#O-P0M  R0 Q" @K `p0Z000 U00 0Z$[ T{ ]ЍU Z `@ p ( , "&Jp@ `p@` T@ 0S0` 02000S MU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 0S  00 00`T 0 P0  ( ,"6  U $U }z#@-0 f9 Ѝ\G-`@M@fo PrEVY)X 0   P0  ( ,"& 000  V0 O*劃@Ѝ0 C-@PpȐ:`V686P@`piV 0 t@fh0@P6`XE@SY:PTPE_o@RPP>@@/ʳ^L#Gp@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0pL#Q`0@AX X 00 0,0 0049 Ѝ0@$ӳ^@L#^\?@/$\#@-X0 < PD坂@@0ׂ@0PNP!PL#@$`#P/@-aXT~H0, P<]@(岂,@ R T0 0`#@L#$@/A- 0@S0p# PU# P`ၪᑂEM 0S `U 0S 0  ; 0 B 0SuP0S`zPiV Up@- 0@  P P B0 0p p(0, #6 sP ,O-EM 7 5@5 `n`P ?\5\Ep#T5 8L  ݁ 0S 0SC0S@40%0P000 00 0RV `X000@0 0 0S#1 @ P<Z  88 P? 8 <D@    D< P   (,! bp D 04 @PD :<Z> D@0[:[ 1 0 1T0 H_^$\#>T$#@-P P0 `AX!h1@@400@D @ P PЍKL#0  48 h0Q8 D 8 4P  BP 00 4000L 8 4 L T  T 0$000/း0  48 l0Q8 D 8 4P  BP 0400/ 48 $0Q8 L 8 4T  BT ꀸ@-04040@D 8 4 D P  P 00 00耸@-0< 00CS 0G^p@-X`PP@ r `U@ 0l,0@U f@_Tpܸ踀 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzO-,M2BPHQT!LaPD`@!  pqt``1 0 A0 0S00 0T0Pl  x )#4 0!$,#4$00 0. ^,Ġ0030#0!"T\#400 U00030#00!Q"$0030#0`0吳0+ [*#*^30%%!0  Y 00#*0 U0030%%0!PU$PP*Q 3 :   S  \ xP P 900H L< R80L0<0@H@H0,ЍO? P  KP/ȸX/@-4@~,0$<@ Q8 L @ <00@$ꀸP/O-$~ R <@T 10`0 1~P  < @0R!80L0@0< 40!S<018 L 0!4 @0 pW, 0 S()P 0S ~P!0000 SP0S n~ 0$0 0$[ 0R0S Y~ @0D0@0Dl~ pXl~W @0 e~?~101婥}p~耸P/L#/X/̹^>T^O-\MP P 9A0 p@9ꀸO@-@ !00 0/0TX0P/း@-@@b}% 1( #4<@ X0S X @}ꀸL#A-`Pp A0S  0C0aAax?} A R 0PA 000-}000e}b}A- 0@R0$0$0@00P}PD`ᔀ0 S  Q0p}P0  0R0$A81}00000(}3S \?p@-x@ t\h0 Ph t  ( 0 p@ꀸK^/////// 01>.2h !0S000C0< 0S0 00 00000/$@-@P R00 O-TMPx0 @S@S#2[@T U0!:3A00C 000|00  U00 Z0Sl  v'(0, 0P0SZ H0L00H#6$000c,0x00c(0D|0J600P @0$#6CP0#v0P,0  $0$ 0S[@jTЍ6$0Pv0#fVnWj* @)P@!@1 V`!x0@D @#60c@(00S00PIW@1@!@D @P`1,@x0S (00C $ 00C 0@0D 4 B Q 4 R00C@<08 8<0 F A0|00Z ~Pl 0 ZPR 08 0H0S0H0L0H\0 pS00R0S<D ,0P`s 60C00 0@G @D@ @T@1T@1x0S (00T@1d0VSP1x0S (0px0pUP! E R %p# 6`F :  T* 804  80 $4  Q* `F$ R 0U:Z @PZ@HP a{$ p 0 p R0L0 0P@8 0|000|0 R0L0 08 0|bL @ 00#"(0, 0P@0#0P00S 0S @)T 0S^  P2[+X'*PPUP1[`! `1EpV.PppW PFE0 S0 0Z" l@XP1P!pP`1gEp 0  |Z PP @|uA J@hL#/^^ Uz/04 S/P @- 80@^/0@/@/0 \/у0P1@A-@p`H1ƒ RL R^!^D*   R `V`F`P7 E@V P^@o#PA A B R`V`F` V P L@@^p@-P@y2 Q*    0R p`VHy7`F`V @ LPp@^O-10S^7쀟`Pp U@p50 @i5g5W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ KL#^@*^e^^0@-@X0S0/"R\:@\*QL0@0C?0@@- pP 02 0  Ѝ@p <0 P 0 D R 2 P///@$@-P@-@@-P 0@@-P 0@@-P 0@@-P 0@02P 00 /@02/@02 /@@-@P02 @O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000xp@L#@-@PL0"D0S 03>4000@,02Ѝ000$^/@^@-0XP`B 0\`R 00P@0 0 0 Ѝp@s@-P0@D0S00Sx Th6P: T 6`A P860`P@Ѝp$ε^L#^ ^0^Z^@0O-M`  0p0P0p300ЍZ4? 0$$Q0D0BS0S Z5*a5P .0P Z`V50`F`@V @ DpD @R` 00C 0R P 06# 00 P 00C 0z^$@}^^DL#O-,MPP@P U.` 0peP 0㤠N@T P,Ѝh ``F&&$ $    01/勞 00`@0/@- P00 QPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P`0vw6 00DZЍp0 P/0S  4\Q 8< Q < < 8H  BH /802L# P00S/P 0 (Q, Q/820P  /?p@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P30S  002L#P0P/@- T000 T0 @S2G-@0Q00P00CP0vP'P""R,40Hq0S)44140P !* PvL00CL0$ T00CT04;P 3 `>v000P00P0uv`0``FV`xE``dv, (B00 @M Iv `L#24<^?p@-0@P v;vuT00T04vP00p 0 E2@-P@D`ڜ40 00` =w@ %Ѝp2$Q,O@-P@H`<0 060`0 #w@ Ѝp2$Q,O00@-  50 0000 0&@P0 S 0  _P!l6pP @0S &($0GP0&00CSu00h`P0S %h $0T T0,0h0X 00$$\,3`Vh @@p|0S@0dP$5 5n_Ws`PrP`  `S#sV u@ nPi? `0r04p00S 00 < #(rP r00r EB@ r$4 0$ 0P0 N0 !h340X !&`PY& Yp2`0P 30X !&prbr0_r @b!h'`P0 0 0(0S0,2?d4;&fj0S0F0Ye 00 210X!10 0 4C#"#04>0CYC 0.[1 -1 I "-넱x!(0.>Phm0S !0S     , $!lAP  /(0,`(0q00000L L P P r`VqPd r@0Hr F@@L#2$^?`G4^^,^7^@^Q^u^^2 Ը^^O^1 0S/G-H0Spn-単qPUc-qGט@T P 0  4  ` \sqV  TA-#R<00# H00CH08@?L# ^22K^!^G-0H0SG0P SQ@ 00GqpW R00S0 00@T p 0$  0 0S0p` #R<00# 0800X<0@800 00 0T0 0T0Pq(08@ IqL#2@-T@L0S@ DpdX40 0-P@T@@.qL#?p@-@4Pp@e$0 0$0p@qꀽ#p/p@-`LPp@( 0Fu 0 0C 0T00CT0p@pꀽL#O-00 0 @-@nH0 0E@ o(~&O-$MPH0TQ@`LpP0#0@ 00S 0S 垕0S R0 0`P60 0 H00\XTPLp$ЍO&&O-Mp8000 0 0RЍl ` 0 ,` BPT 8O|O$OP Q /HCC?O-|MP`x Dih@ pT PF 000000 0 000000 00($00(0 000040 080(2<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 .F0PT00PE 000" @)P @@ )P0@00|Ѝ`Ps@-@P`AP Ѝp@rЍp@- L@yP 0S 1(S2S Pl^O-0|M3S `PP1S S2S @$$'@P $X|Ѝ22 0 00 00 0$pP $?@E  000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J J@D@0> $@"R)0&0CS$@ e 0000 0$>@P $0SW00CP $@"R"T@10 @ " 0TL000@ @,@2S0$0S(0 40s0N@N@4@800XSB 0tp<1W00 {@P tp0t00S3 @  C0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!@P00( 0;0@P40〰 0D0@PDP5S7S 2$0 $00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$k 1 0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $2 00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@ 0(@1!00L0 0H0T ,0 S0002 02000x0h@|0l0$03/@P! 0@H0 0@0@$OOA-PpU@` U R+P  Q M0P j R@T P q^0O-Mx02 CR@#2` 0}00 00 0$V@P n p2 S OofBA aЍ0S%P U"0P0 0$1P PEPPE0PPEw@ U @-P@`pP  0 00 -PX0@0X0 ЍG-X0 `Ѝ0@S P .`P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ Pp  咼Z`    凼`{p 0&00X $p0 $0X 0  0~<`P0 ;` sX0V X  Rc !vSX0`P 0X0 0\0kR 00dX0!"Up^W LD !W4 ipP bꜺ^P P P?^?//?@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀA-P@U 00 ` 00000p U`  .`?A- $0p0 $0 0@R`P:    U@` P 00 00$00?x @0D0@0D0S/p@-@P`0S000p P P?A-@T1  0`/ @+ P!p@P0|l 0000 q 0  0 0@P 003/Ѝ@@-$Ma01@00 0000 PP0p  GW 0 00 .  00VP$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000P$P,ЍA-X0 00$@0#,C04@ R1D@(2Dp<`C0PB` R 0 00000H0Es 0 0000 000H0P 000 0 PPЍ?$O$0 0!0 00 /Hzhzlz@-0`iM0 0 EP 0 iߍ1@P p0 tpWPdZ  mJU00> !0pGGxGGedA@-<0DT 0 !0  !O-Qz ,M! a0S a3D P䢟D202 000*0@P S8Q0  c,`00 p 0Q  \PTPU DN@LDP`$DPh|PXDP D0/SY0`0DP0F-0p 0pa s0!00 "0#PSq`0 U  h  00`r#P:0 0C4/,`000Q P0@`@ 8 c[#P#$ ,)B00   P0U0P0S@ PP@U00@p\Ѝܺ^Ӏ3 _^ 0^^W^x^^^^ɻ^ڻ^^^^0@- ! 0 !@- @0S 0@GGp@-T0PO`d !0UF Ϡd 0!T@!p,/@-0`M0@ 0 Q00 00 U @`T#ʴM@Q   4/0 0 &#: 4/?&6 :  X 4/`ЍHA@D3TnT;_d^__o^X@t^zT__x^,/}^^r^ 0O-p`'DM@O! 0 0 0 00`(p$ 0,0> 00!0 0 00`(p$ '0 !0 ,0  00`(p$  Ѫ 0 ,00!= 0"00= 0 00`(p$ 廪 0 ,00!= 0)0 0 00`(p$ 奪 0,X !/0 0 00`(p$ p吪0H ,090 0 00`(p$  |0,0G0 0 00`(p$  h0,0O0 0 00`(p$  T0 ,00![0 0 00`(p$  @; 00!e00<$ ,0  00`(p )S0,0 0$!`;0o0 0 00`(p 0 ,00!x0 0 00`(p$  0 ,00!:00 0 00`(p$ 0,0: 00!p: 000'> 0 00`(p$ ө0 ,00!:D00 0 00`(p$ 復 0,00 0 00`(p$  媩 0R!0 ,0  00`(p$  p喩9 00R!0 ,$ 0 04`0(p 0ɟ 0 00R!0$ ,0  04`(p f0ȟ00$00 0 0R!0 ,0  04`(p N%0,00 0 00`(p$  :&0+,00!0 0 00`(p$  &(0,00 0 00`(p$  )0,00 0 00`(p$  *0,00 0 00`(p$  +0,0< 0 00`(p$  ֨,0 ,00!>0 0 00`(p$  -0,0;$05 00!50>00'> 0 00`(p 姨.0,05 00!K?00'> 0 00`(p$ 吨10+,00!N? 0 00`(p$  |20,04 00!O?0 0 00`(p$ f30 ,00!|4 0Q? 0 00`(p$ Q60 ,00!(40S? $0  00`(p ;70 ,00!3 0U? 0 00`(p$ &90(,00!W? 0 00`(p$  <0P,0Y? 0 00`(p$  >0,0]? 0 00`(p$  ?0 ,00!= 0 00`(p$  ֧,c? 0 00`(p$  §@0 ,00!1 0f?0 0 00`(p$ p嬧A0 ,00!1 0g?00'> 0 00`(p$ 啧B0\,0j? 0 00`(p$  偧C0 ,0m?0 0 00`(p$  lD0,0q?0 0 00`(p$  WE0d,0u?0!Լ^l$PTPD?PpWR3#PP?"P&PXwPv^PP!P&PP  PX*PP4@PP;_H_P 0 00`(p$  F0|,0>0 0 00`(p$   G0,0}? 0 00`(p$  H0,01 00'!?0 0 00`(p$ ߦJ0 ,00!1 0? 0 00`(p$ ʦK0 ,00!1 0?0 0 00`(p$ 崦O0 ,00!(20#>0 0 00`(p$ 垦 0!?0 ,0 <00`(p$  p剦 0! =00<0 ( ,`$  pu0$03 00!3< 0?(0  0,` ^;d$0 0 00!|30?00'>< (0  0,` C; 0 0 0!%>00'>(0  0< ,`$ + 0!?0'>@A( 0< 0,`$  0 '!?0< (0  0,`$ &>0,0> 0 00`(p$  05 00! 00 D,0  00`(p$ ѥ5 00!? D,0  00`(p$ 弥 0!5O@,0 0 0`(p$ @妥DЍO-ADMP/ `p  0  0p,`(`$P P P<凥 , $ 0 /      <0p(` P Pp ,  O@ 0 <0p(`$P P P@\DЍԼ^ Pp%PpC-QM`p \@ ,\ \ 0` )0 P 00 000 0@?o2P0S R0T8R \70Ѝ8873̼^@-p|0M@P? 0`` 0 P 00 000000נЍC-p0MP0 0`` @0 P 00 000 0@嶠?o2P0S  ЍGC-p0MP0 0`` @0 P 00 000 0@占?o2P0S R ЍL?/uA-MⰀp(0@P`` p 0R R#  L,* Ơ$ d `  L\# Ơ1 00X  00 000000FЍ,/L#C-@0M(0`SP0 P$0p ` $0 P-0S S P h00X  00 000000Ѝ_G-MP 0`` @p 0P 0  00 0 0 p@?o2P0S  0000 0 P00  ЍO-P|M p嬀`@` +0H`000 00 0@ 0 废0P?o2P0S 0000 0 PPP0SP +H0r|ЍO-P|M @pb``  +0H`0 00@ 000 0v?o2P@@TP0SP +H0eP8|ЍC-|Mp@P` `S0X X@0 XϜ-@XX H0XS  00000 00 00p0000 X@H|Ѝ@<C-@|MpP``  $1T0 T@@Y00?(P @6 (V(RXX @H YR00 D @0  00 Q 0 00 0000p00ƞX@H|Ѝ<@G-pP`0M 0` @0 P 00 000 0@噞?o2P0SD0Q 04QS03"# %05Ѝxo\? NMb@-1P3@k `q&0VM P0 ! 0l:01 00$00夥$00$0P@垥$00$0T0(00,0 0S00@000`H8p0900S  @0VH00L0H0 H⌥0 0P00T0<00 %0`00d0`0h0$Ql Ѝ0 `p 0 H0i l Ѝ@詯^^@BA-`MPp@8t 0` 0 P 00 0000@?o2P0St0PЍG-@Q0Mp000` @`0 ` 00 0 0 `@弝?o2P0S, 000 0000 P 0R Y<0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 ЍP?ɚ;6eA-M@P`pe(0` u0 000000X00gЍC-`0M@0 0p` PU0 P 00 000 0PG?o2P0S@0S@T0$K 0%PS0 0+@PPЍH?|>G-`RMAxp P` ($1 0 1 010P 0@Hp?o2P0SMЍC-鄐|M@P`` pH0X 00 000000ٜ|Ѝ4Ms@-P`O00@0S 0 UЍpXGO-PM@`Ȱ0U0s 0ȰĠp@ЍO7X 0UT@@ p廞wXU2U`010# 0ZC L R?0Q}P XVU|pWU4U}Y[$FFU  P  | &U| RU|# W!`IKq@pUXQ 0`FV`G: ~U"apP0U  L ;?0|`UV gUU010#`| 0ZU|Y[ E EU 3 PFU|0S Z1`IK@ Ѝ0 M@XH Ӏ@ӀO-PR`@$MB @pU0 RSU@D @$Ѝ Z X  w     VD6U  (TZ0 H @p 8MO-|" 0(00 00,p$@ @@ @`- 0(000'> 00,p$@ @@ @` 0(00 00,p$@ @@ @` 0P(0 0,p$@ @@ @P`0Ѝ茿^P ƒ #60 P *R  P 0 / 0CA-0@`P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0sL0 0!d 0 P:00 4l^^@-L@P 0S  00P 00004p@-?x@`PUpPx>00ST+4x<0 80=vx^44l^\?^0000 cx40@-M 0000P 0`@PP8 @P 0 @@0@ 0 @P Ѝ0S c @!<!@P V@0Dp?  @Sp!@@Dp@PCp x`0S@|gx0000 }@P L0S00p 00=@P 44 ^`8PO-RM0SP@ AXa w0SPs,0 Ёa,0zX9P08 0(Lr Q0(@8(0H> C'(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$0b$0 ( $0,0Y!@0<]|x|yP[0) 100S$ ,(P?0 00000000 00 @0X sPP  @ ,0a0wЍ 04@B\?X?Ӏ^4O-MQ@L @pP `VTP@%ЍH0 0D00@00 01/PP P@ `p@-P,0@TpP @l@-@@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  o` ЍX/\/RA-PR`@P\p 0!S tP d!%X@PP@@-X^ :S!\@  Ws@-D0`P @P`00Ѝp4@-@0 4 0 40 #4@0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/A-pP `}V@P vPuP %vkV f@000V 0 `@ 0S 0 00 P000 @  v 4lp@-@PM`u@@ @@@`0     7 O h    $(Ѝp43^4?P/H0 R R 0 R R lp@-@`PlBu2@PTup0`0 00$P 00000@u@ 4@-@P u 0S 0 0S0   L00C0gu@ 0S 0S 00  4@-$ P P PЍ@-  Ѝ40@- 0 Ѝs@-@PM`|`N0 0Ѝp7@-@᭹wPPPP8P 08  Ѝ0@ Ѝ04s@-h` yP0@0@PDPHPLPPPTPXP 0PPЍp47@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\>0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ4B4=4@-p@`MZ1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  ZЍ 4 4$4@- $Ѝ4@-0 0 0$Ѝ4@-0 00 0 0$0Ѝ48 0(  R@0/HP 4/@-  @((vP @ tP@Ѝ4 @-L0 00H4p@-000@S0S00 L0P0pH400CS0/0LH4@- MPH4/@-p0M`0@ 00P0$00|0 0, S00` ($0 ` 00 000000ЍX?T?\?4@-000S ,0 R@)Ѝ@Ѝ0M00Ѝ/40O-aA CJ "C0?P.001P rPP0SPPSUᦼ`P P 0 0=0d1  QPP 0S @) TPP 0P80S101?1?11` P@V@@pp@-@HPE@080C@00S  0 Ep@E΀@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PEzE @0 PUEt#*p0@00XPS 0  P@WE003SEEp<΀D?\^΀@-@@Tp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0 Q2-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|WЍO#QQ(0pS<0(00 0 00?o 2?B0HS?0 $00H?oR20S50H?or20S.XD`xW01x0#L0D4`P(000U L0S:Z0S7 $0S`0$ S0D0@0 P 05@DT`?D0l`P D `=,0mD1@4008040 0S`,D^DDkP80Z80 0T0T@T XH3$ 0R 0 S030#R0S 0H0C0 0000P 0@oCTA? 0jP: dC =$0 C1@0000 0S  0S  0000@T  C00S $ 0R >C000?Z0F 04C $1CB ;jYWP13 W@ 8W #0S/ 0@0 0D00H00L00P0 0X0$0\0(0`0,0d000h040l080p00S<0t00< tѐ B@0 85P0@J@`$00 @⾐0 4⹐40 HD00Ა0 L⭐P@00S0y000 B`FB`/΀GӀ@ӀlO-@!  00 C0 BశWڜ!0R0[ 0 !j 0  !j X 0A1`0 1$ЍOJ@$Ѝ@-@`Pp@00000<@ 0P100Q٫@ Ѝ@- `P1 @00}1 ?@T 0 Ѝ@ Ѝ΀G-p`ܐ3 PP 0 @P  PU03aP  0 `? 㹫?0 ,00 @P΀@-@'@ ?@-@?@@@-@P 40 H@01 ΀031 0gg O-l2M 31 T2(0@1=0T?q1WPPӄaՇ0cU.  `P n  J ⮵PR0?Sòʂ?1?1P1`11Q1儡U]?ЍSP  債 ~X  Y P(P1SQP`>00*?Uy00002q EŠ0 3 1΀O-13A1Lp墪glPP\넁`pU0^U ]8  Q020?SP !011QPk?QQ?  ?10 ЍO~[ 00P 0SW ( R 尐uU  P00 Ѝ΀s@-0Sa @1S@ @A1S1S Pk?P10``1SЍp0S  R R    gPQ p@-@T 0`QT@dPT\>IPHPPM>UP@pT 0d3IPvtӀ1MR  !Ѝ/1MR  !Ѝ/G-pPt3a @P    T<@@-M@`Pp0P @# W#!!  0@@ @ 0  @C  0  @P@ЍO-%upWpMH@Pl3졓1 0 00S? ` q= 210030 10 .11 R`` =%+ W- T^X 0\P0 03 9V Ѝ3 r=0P g += {^0Q`/wt@A-@PxM␀ Pp`x ᆳdp` P =T HP  m,?=xЍdHP 0 mӀA-P`h0hp@0 0"+ - 0(00  03 b3Q-//-//-/-/-/-/-/$0 0!0 00 /Hzhzlz0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Q7@-P@ hw<`0 R 0SP D00000S! 0"PT < Ѝ0΀lp@-XP`@ PD03 1pV T( P p#p΀π0 100S/I΀̀@-@0<0m9@h<΀@-000S Ό 0#  Ѝ̀@-@0S0 R000000S 0s0000S0St00ddVPX00SLi$A@'90 0 0 Ѝl΀^^^(6̀ππ7@-@P B %h04t 000l00p0000 Ѝ0蔌Pp@-@P, &00 00 0X0$00(0tp@ČP@-@ ͧ@ $`@ s@-@`P0 0 00h1d`S\PZ_`0 00 0 !`0`@Ѝp^^p@-QAM0 0$0 0S$0 S*I;01S< `10X00a01y;V  ⪱0 `  ,;!(0,0(0,婋  H K 0R1!0CSQ B0 00 UP t.S1! B0C 04;0  4yπ΀@P\?πPl΀3H^86X^^A-P`P p吀H0L,A0 U P#H0LTp0    0S:|03/0S:@l΀̀@-<0DT 0 !0  !p@-00P@00/pπ0@- ! 0 !A-p@d` P⣌0S C C0CS0#T R$ h0l0h0lA΀l@-00@0Nπ@-*0 @0 0uЍp@-PHM` P@ (岌P P`(:( O (R $ E  HQ:HЍp΀0@-A4MP000S :b0S)  BR/* v t 00 000X!h0l0h0l810000Sb0P=P4Ѝ0 Ro4Ѝ0@ : ,aR !00 0` 0@,P(p$ w~ 0!(#w?P  0 0,P(p$ f~ 0`!2" 0y?0P0 0,P(p$ R~ 0!2"P0B>0 0 0,P(p$ >~0 00!8"~?0 0 0,P(p$ `)~0 00!!< 0 0,P(p$ `~0 00!!? 0 0,P(p$ `~0 00!P!?0 0 0,P(p$ `}0 00!?00< 0 0,P($ `} 21I21 S,AT0t tJl00 <8O 8DЍ8t@3^^X6lPПP΀PؐPπ@- ddkj`0PT|P@0   040 P mЍ@ꜙPπ^^P/d 0 0// 0"/// Bp@- ` pP@TMpA-P@0`Q P@mA-`PD0@XppQ P P@`6Rp@-P@ R" 0t  0!R4 0 R R 0`00  0t0$0p\ 0\0\ 0\0 0`0000 0^p@-P@@2tPT2pp@-@`PP 2'00p`t0E2pp@-@PP1(0, 0@@62pp@-P@@1$P+2Upp@-d0Q@P` 1 @0, 1(0@S@U 2pC- M` Ѝ0 SpA" S) S /0P@H10@ 0`01 % 0!0 UTQ30 ާ?P@0 էP@`S@T0P@`FV`@Tt0P@00 mP0 0 000 0!ʚ;@Bʚ;R7@-@P R: 0- puX0 0X0 0Q 00 0@00C@0X0 0X00"eP 0p`00q 0 0\0 0" Ѝ004 ^PPp@-@P1@081@0p@G1X0@/p@-P 0X0p@0PX00 0@008@0r$p@/.p@-@PP0(0, 0 (0, `q pp@1p@-P@@0p@ 1p@-P@P00`01p@ߒᴒ(Np@峜n@-P0T<@P0`Ѝp0x0t0 0@ 0000K`P 0 ` 0d@ 0 0\00\010Q0Ӏ@-`@ |q0@-@|o0@O-X`M@``x0p0x00P000 00@PT``p dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 000X005 \`$0`0/(00,  #0@0#?0 \0>00 0 000p 0`P G0 E0 `10>0 0!#4#0 !Al# +0//x00CSx08bЍT `[ _C-pP `P' 0堐   ( HU@ /@8V-`0@@<%+3 1 03 Ѝ^A-PU@d0p00`h0/,/^p@-@d0`P/,p@/p@-@Px0Sp8UpA-@P pPg/X0 @ 0P  /x0S/Vp@0x`X03V00  ///A-R@P` |p7/h003/p/h 0 * !01 0 R) p  /X0$ @00C@0 R 00 X00X0N/ L/h00 lA!#4#0!10  3/p@-@`P a@0 1p0@00F=00`'t` pA-A@ `p.@0Q0@+/ # # P 402 /,0P/0 0R03 0@2#/m`6p@- @`00PT 0T@)0,@P"UPP@ 00tUdoUP ,Ά<U0@p U@k h6A-P` p@0U @TP K. A-P0@(PP3pa9.7.@01@0q.1S1S i.$.8A,H1 Q  PP10SPh0 0///C-@LM@ r\0 0`0 0PPP P: PLЍ(u`P ďpp-` qp` 0" .0 ŏnPP@-T@ gh6P0^O-P 0pQS lQ`T%P40P <T r @ TP$ @0R @R0@ @ D [  9  @@000㓔$ 30T 0DC1 00  V00T`6h6p@-@P 0S @TP |Tp@P\TpPU @Tp PP  PtTph6A-P -hAT h0pS ``-\0$ 20S$0 H-@AC-^A-Ppᘀ,ATA6-h0S ``,\ $00$0  uP$00$0$0S -@^G-p㔀oATPP,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101,0S 0h0/L^O-M( 0$0 d0P 0 (0S $6 Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` CSP 0S< SP3S 90?00P03 @#04/PP30C3000 Z kS P P  ,1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>w0!#4# 11 | p+h003/PPp@dpP |+0 0P+X00X0+0 P+X0@0 X0Ry0X008 0@@0@@0@0 $(f0 R 0R @T @k t+Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|+0@K+X0@0X0H7300+ pRW Y U0@,0@`S 0 0C 0000P +X0@ Z+P@0X06300x0S  M+H+ + P>+ 0\00`0; P~P|3Sp< 5310 0P3S7 H@X_p0s0( PӀ hK0`0xP*00@017[@+s@ 0S 03# @04/3pC(0PpA 8@P @0!S3S XH$Pt@ #T@0p00h t0 p00*s耍0 ** @hTX0x# @00 00S R 8 *0SZ 8**]k 0Q 00 0h0T83S *{X0 X "0X0@00C@0 w*|004* (0l*+*X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@07*  )) 0S@ 8j&* $* 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 8@) ) 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| )000h0 0S 0040)h P 5/P40)U ) )6h6`^@-,0 00000 00Ѝ^p@-P@Tp`QP @G-`p3aML)1 PUG)P :)p@-P@``1) 0@I @p@i)p@-@PP$) 09 0p@])00/A-@P@pET|`)h0000h0I)@^00/0S00  0S00o/p@-@PP(X0d`q)P#)iX00X0F)p@)0 @-@L呝8PP@[@-@~X0 0dX0h$`03$!0$ H@ ?pP tP @x6 0'w|x6 0|x6O-p`@嘰  HQ:/PDPWe \   0P ?P Ѝ0S 40A3/0`@00@`XGO-dMZ@$ ` +0T L0P $0(`RT a`P8p$p* dЍ P,`P$0p$p 1 00`V /DP 0Sy@!PPt!(PPn00i( 0;0!iPP_P1 00 0000 0 PPN0$ 0C0:P0 1 T01 R :!M* ` !l  2/`PH0T S *P S:00S18 ,0 0Rn pP ptP tX0Z `x\P P`Rnx6G-M@` 8pYP+0P@@0/S WЍ0 0 S?@# ,* b0 C /  C1$@ NN00<`00 q` NV@ k`F Ұ0W@C0`F`O-`4Md@q̔ 0L0 ?0NX) 微듛ϛ4LP0 0/0 0,0p p00 000P ٍ,0/pt0Q0*#P,00 0`PP墛,0L {0P0tP000 PhP|P0I0(0L0 C5<0X0pPtPlPxP:$M >^PP X0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S p20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRm:D04Ѝ(PH! E'b$ ~$ R!0 R $0_$0P(P`10`1Q\`X00X0 P\`X00X0X0 0dX0e$!$$ H P pP tP d^M<ZM`0 0R0U0S \{ x6i^k^ЀA-P0 `p00l 0 0010 (@0P Ѝ P'06P 0@00 0 0CS 0P`V pZPp P'0P 00@0G-PM" @@L a0 @@9 xQ1q0; 0 @0p0 PpH(@T `X-W0AU2@P 000` S'Ѝ 00S S S  00@0P0p 01@ 01p@ 00P!0 R Ѐx6nu^n^C-@PM> (0S; $ X7 `V6 g0Ԑp03/ @0^P00^P 00` 0 `P 003/Ѝ 圯 D 0 (0p`003/x>^rP/(0S/P/ R  00/G-Q @DK08( Q!P( U Kp PU PU ^Kp R(0  @` jpP PU *\K(0P(@S0`(`(@0S   0 ЀnoG-PQ pLK@(`T `(䀟VKE$t! 0S}$@0S LPPtp$d|Kv"(@T 0Q S   0 U`@ЀnӀ^A-@`PpU 0S A  0S SP@-@ԏb➷PϏ]_#hP lP 0t@pA-@`j00Sʬʏ#Ѝ0 0 0uPPᓊ0 0,0pp00 00 0cP ,0/pt0Q0!*yрL?O- `0  0 RR&  700 q$1|pqL0 48<0L0 1 111G#  C#;Jp h#\p <0<0$,0S,F,p,[ppPpulP`0<1xp8p^N4#P P0$(, 0P08P#T0T0(H(`0pQ h1d0l1=0c?0h0040083pp0 `0(40q40pW 4pw40q40q40!0R "40p#0, h001"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@te 1\D03/"(Js40004Z0c"@"1S' A"{II(0 T 5@ b"5`0`S "<ЍE'40Y40pWWev $G"  S @yITI x"BY s#@@^^^QӀ@ӀЀ0O-,MpQ #0A`P#@t@T ,0〠X2 P.@PP T P` X !P P`@#0SKÈV 0{U> :$@l$ @PB b`0V):\ `V 0T0 ` @P0 00# $ 00`00 @PQ  $@0@,Ѝ 0S S+$0@P X x$$ B`PD?рP|0S/@-@h3/0|0h0O-a0#6040080>0#60D0>0#6000<00@00Dt80S N#!0/1000L09L0W!5@ 0 0  0PpW(pWL0<L00P y. .`1Sp hpPw0  0  pW bpq!0R  p :T0    [0 h 000[  [ 0D6p30pGor  'GqP $$0 1 p0Y0#03W0S7$!$$WpWpA /xz xDL #DD0ĐN  IȖ`1H!<1d1D1l0 $p $07/pP[T!@X0A  81((0<1,0@100D140 mpPGh l0 0,03/l00S 3/l0 0$J(0Sm Zk Yh 00Lp @07/(0 03/3 0000 ( 0 0pP(01G 0 03/1G0S`,G X D#\H4F epP >tP :0S pW  00 0003/p0Hh1S u -l0q 00S p0S|$@}F$0p  $@F0tp0P  1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/@10S XF0S0FQX 0"#  "pH PBP0. pl 000p7(p(p ,p L0 0Z000C0cXat0 ^(0S uKAp<ЍMXGӀk^Ѐx6Ԁ0@-_MP P@P0 _ߍ0@-(000000 0ЍP@- $0000000ЍPO-dlQX (X0Ph >i10S#`10$0P T`^p@-Pa|@T 0Sp 0uP T L P06P0 0S P0 P08P0]A0C0 J l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/3H-wA0`SM bP0P:P00Sړ00P0*  pIP|0l 0\000Z 00C0  0 s[o0 1111@I0Z00S H81S 뒏KC`ys6$@0$04GM僟` 180S 3/m>mT0  o3n-[0 00[ 0 [ 010S2 [ ` 0`Z0|`` 0I 0S  LH@ ,8 `0 000 0 V &[ ] !(w/r*5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x l%0@ ( H R( S0,02 P   , @0`080(0< 0 D0(00H0K0(0 <l}o1S r'  01501 0Z0C000000Bl lV  0 =Z4$v9sF1 P 0PL 0S 0S5p@ 5 =5Rl0Q Q*00p;N `* x0S u`J3^ԀӀ{Ӏ^@Ӏ^p@-a@PP0  b !O-M00S`؀  ?X 980S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y #&P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0 RP  !P  00C0X 0000PB ,0Z R R%@   B X /  5@00PPUPP0,0 ,0p0bZ0S000lP030dP060 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< 5 =5`V2`H0S& x 0&%0@ @ H R@ S0D02 P   D X0`0P0T(0 0\0(000`0 J {᳂|p(;(X;((X;0S X (3X (0-0020Z00S   00C0p0St t ' `c%DTv% a PI!,F<(H>vtP D( 62 %@J%; B/o"S R0 400P%`0 _0Z 0RP B+ 40 0? JӀ@ӀӀ3р0@-q@M QaT0P0` ,0 TP X ⤣Ѝ00@-P0dM 0 0@S0 0S0 Q  ?o 2Q0S X dЍ00@-@0P SMS0R  0 0 0000?o2Q0S  ?o2Q0S ?o2Q0S Sߍ0p@-5lP@0U5Pp@0`P *Pvt5<50 Spp@@-X0C50S[0  5J 00S @QXGO-`$10|0L048<0L0 !80 !!L0?! 0  > OL0 0? n001P &DP  \D+ <0<0, q,0S(:0[00,00[` P055 l`0<10x080B4hP P0$(, 0P0ႀT0T0(J< ( ht4[$ =0c?0h00400h0 0`00,00?p 40!! 140S  3/*10 0S [0[00[0x0*Sp p0t (0x@tH05AAQ  RB0BS  R ly505`0@1d0Sd d0h 0d@h03 R @0@Y 1\D03/2022! Z! ! ! ! !20C22S 7W`20S PP1211S T0  p(Jg?4pP04B 0 0Z 0000 l0S `0l 0005AAQ  RB0BS  R y5A0AS l0k Gm@ @ $90pZ0_W0S5D0DSXPBl0 GрL?hox7 ^D^K^T^Y^3lQӀ@ӀXG@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC2 1啸@f@00@00 0:0 !!0400000, !  !H<x<P 0 +U@0gi<Pe<P3S 7o7p@-X@P0`S @8;@Tp@ ;03/@|oh*Q7 0o_@-0@T0 3/@|oA-Pp `h @P  p `l00 (R $@ @0@0 |o^o R 0$0 e |oP@-@`$PP0!4p$ L00 PU(0(0S%  Ѝ@S 0 0 3/00PTp PU(0 S 04 0 3/P Ѝ|o^^^^p@-`P㕷@  ` Sl000p@-@P@w0S   oG-P`X  0003 0@T@T. 0pSW00  J@pW @ 7/0SpW  W @ @@A-Pp`@ ``p}0S0@@PA-P`@pl0S 0S   A00 00S<0 3R W pWp@-@P@@|Tp@- -@07;^O-`0Sp,M@PTXdP ` x/o 00 00P0" 00  `00 @00 @>`P }d,Ѝ[  叶$ \0 $$0wZ`p?p = U 0S $ 0 0P 212 2<22@022 02SY 00(@qr@-|0C0P $l!Q2  L1S  8 %(& W<D^77}^0@-@D0081 0S Ѝ!77p@-40CP0[;P0UKpp@-@00SP00#;#P0Tpp@K-0 0/^$0$$1!S1z?0^h 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz00S/A-@`văPqrPX`00S P P P4 00$  Z̀^^^^^0 0 0/@р7O-`Q$MxC1'xS 01O000$ЍO} 㰁0H0SP 1O ap}0x0@o e0S z 0H0SP (1O apSw}$ЍOs}10S6 O 0@0P.00000P0S$00 0 YY 0  a @ Q x0 Z`$1!S1Pz?0/ 8[RJ@р@р\?35Q7^hG-霐P`VU`P@@ t@ 0!0C8R#8 @< A@02S Q B!0@р0@o/@р 0P/,㥴р0@- 0D0R@00,$00P s C-p0MP0 0`` @姛0 P 00 000 0@W?o2P0S  R Ѝ脽0@-@0$@0 @0 @Pk[<Ѝ0рR^:Q:Qр$;Q@-p p@p@0@@SC 1X01ir@ Hr@@<<80m@廷рopрZR_^(qg^prA- 0b@SPpb@|b0@X4100S |0 !!04L0H0@000, !  !Hzhzlz@-@Q't T 0310"0|P0PQЍ xJ 00S|P 00S t T0 #!R `0SӀ@- P 00Sp@-P@WPpTUp7@-P@{00 Ѝ07@-P@{00 Ѝ0@7@-@00PDP 000U  Ѝ000/0@-P0M0@000TЍ00 0 @P 0 P QPp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@uP?0S P00 0000@-2 @0 0R  R@\ 0CS00S$@o0 9 |5B^p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3Sz@p@-PP@W t PpP0 l t BR 8P08P0P0 O8P0MPJ^p@-@`Q- P08P0Z0S P0S 0 000C0.p@O41041/41!0CS41/4p@-@Qp@p@-01Q@101`41Sp< PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT@ W0`` 0Y81S-8AQZ. Ph`0 !0L @0;/2 00  00Cr`P }RiЍe 㷱8APU 0RU `0SNPX㠱Pܡ  2/0@ ! * 0 0 r`P 2Xㆱ  2/ `0*l`P   0*sXo 0000@ :0<`0@0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* N'#x>#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S K*t20,y0u1 00$nV;0 0 `!`0  0 0 0 004 00 0(00\/1S ! !! 1 00C000C00100C0F   = P g P90S Q9Z0S YP 㦮00$P sm^W,0 ЍFrӀрO-PM`pDT 3RU 嵼@s,0 \ *00 0 0P 0WP |s #@T  ᠰ5/L h Q4qp 3z 2 C@,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S L0P0<P0u.n nZ20H0S@1 1]X@00#y]& @p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S ?P 00LP 00S  | x p@0@@SC 1\0100 1<0SЍ3/rрZR_^g^^ Ӏрр A-0p3a 8Q@T0S 00(Xq 3081 0*JqX'@x>03hl2/@-@1 0S@sA-Q 2@sr 0  BR 00 1@0S 3/ᩲ劽OmT 5P0PSN P0   1hS!!1 !  >  P01 P  !<* @P0#Ꮄu0$ 0P+00C00S  P W\0  JX(1S,1S |`V J8[a厒Ӏv^m^G-@QdqKP00`P  衔 κ'P03P07 F7S  <P > ; 00C0  +0 $J $  0 000P00P0Ѝ O-pA000,P0   P  n W& PP_ 01^0USS [G  `W qP (1 S0(100C00,1)|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010ws  Q 0P 0R 徿`P ` ```A- Pp`3@2::P@1@!<`J-PP   a0@D@P0Q @@Lp@-@PPp@U``FUPP@p န  B PR / t0Q   0RL     / Q `r7p@-P00@Tp0 P @`rp@- P0Sp8 P`@ 0 QV  Pp!!0p@-P@@0$P0p7@-@000P @@߬7C-MP00`0p0 0` @0 P 00 000 0@O?o2P0S R0 Ѝ7@-D 0P0PP0@EU Ѝ05U^0/7-@-0@00(Ѝ@Ѝ/^O-P`С,M @TpPP VPp cP @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #`0S 0 PP 0x P 0 000!R00! 0V0C0@`r^7#^^O-0@!T0TX qP `1 !R  !t1 `V`婻 ` 10 VP `P `V@&0Q@D0 帑P `Y0 `  S      X~@ᤫ Ѝ`0   0P (  `V`^`r7t^7@-P p 0@P X Ѝ0Q000 $!@ ^^^<^-@-<00S 0,0 ЍЍ/рx^^G-`"Q0B  @PpX  p$0S00SpQp @W 003/pP  P 03/p80S 8T$0S R0 0C0!R 00! 0S% P Y$`X!P  Y0000000@0@@000000!00C0^^^^7^`rD^A-0a0Q,q@T  ܼ@U$0S- 0* %~<0P000@03/ P R00S ' :0S (0, 0 VW"P<000@ 0"  `r7L#7\?рY^w^0 /$/@-@RP` Ѝp@Oɷ0 0 00 0fP Ѝp@-Q`M P0 ( 000T@P @P ЍXp PU@ 0  @P0P S  !  00C0`r7O-DMB,0RbS20,0 e002"@000S200  ^ B/PT:0`PhB(0 <0 P0`,P$  <Q<0 Sa '~0 00 0 0< ,`(P$ pP0 00 0< 0,`(P$ P"0 0< 0X,`(P$  P*0000  0< ,`(P$  @P0 0000/@0  0,`(P$ @p< @PX@m0000DЍ XP 0  @g7^7^H_x>77_7 XQ_^8рtrYQ4^@- @0@@ ,0@`r P %UЍX^H^`bQ@-$0 0S@   0`r@o/@-P`㊶0 H 000)@PҸ@޸Ѝp@-@Ǹ000@Ӹ@-@Ὸ00C0@˸G-`PAqT:pW @P P  0 FPP  = 0S  ŽP1P0 嶎Ph p2PP " 80p0@@@ꬤ_H_`^`r^t^^^0   7@-$@ 0$00} @87\?O-M00`00W0p4p Q @p8 00(0@P rЍpp@-M`P  rP@@ oV qP@ qЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0|p ЍQ`Qp@-`@PP 0S Tt  `p XP@0SpT   88^^4^,0 0S @-@88O^A-Pp`@៛00$0p ` P@ r0@-l@P0^P UPU  PU0^00 0@wr7@-4P)p@P $000 o Ѝ0`QQ@-` [@gtPp1S`00Y1S0@<0 AA0,000 o Ѝ88\?@94Q@-0@p`PM  000@٦«|ҫ0t t@p`0PP P02@P =00[Y ( Ѝ@Yj^P8Q9Q9H9xQ@-`0@0 0@0 0000 0@00C@0Ӏ@Ҁ|0H S/P  \\1h^ |000S \/0!`0 SQ/PQ//Ӏ@-PZ00C0 -@-umF\2O-0S0PrPRM 0@0\* 0 Q00S  0 0Ѝ 0@`g`@  c0V  Z 0倐 00 00000 0\00  0#00 00000V00 @`F Bkb0@@D0fb @T0@0@h @0`0 ` P` P@~r@ҀӀӀ0u9 9G-MP 0`` @p  0P 0  00 0 0 p@<?o2P0S 0000 0ڨP0S0 0Ѝ@-@TZ0S[00[0~&{&d@@-p0 0  ^8 0@0000@00C@0Ӏ@Ҁ 0@-81M@T,  끵Q q 0  P@@   t!00P s 0Ҷ0 x0@@ 00@@`@Q 3@ԫ HЍ0@E^Ӏ9Ӏ0u@Ҁr^4?Q^Q0O- 000p(P$@ @A@0谟,00 000p(P$@ @ @P-@/0,00 000p(P$@ @ @P\@00,0T0` 00`0p(P$@ @ @ @<Ѝ@uh^Q9QDQ000/p@-00CSP0@@$P,\U ᮘTpp@(㨘Ӏ A-0 0 2#PU 0`S@T Al<pd0S R@D1$ 0R @TAyӀӀ{@-M`pᠴ@P00` 0 0  00@00T0S@1 0 0S @Ѝ袴 0S 1S Ӏ@-@P0`0` 0 0  0 0 @00T0S@ 0S@Ѝp1S1S Ӏp@-P`  0 0@0T 0R0S 0S @P4Pp@Qc 0SӀӀ&HFD 0  !"P/ R0S//ӀQp@-@ @PX9Td0P1@0P !0@@T@dpӀp@-P(@p`UpӀp@-`P_\ T `@00  RAP @p7pӀӀ `0S  0  /Ӏ 0 ګ9p@-@Td0QDSh h h0d 01 0Sp@p@{ӀA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0n  BR fO-SP ` (` pv"0 0*@T 0 SV`0S U0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#oboYQVT T R S+@0`00@p@S V `0P @$00@01 00001}[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@x @V (]W XӀӀ{@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0Ӏp@-L0@3P1S P0 00SS000ppp@-P0PSA,00S jaPp]p@蓤XwG-0PPpa|@P @T P03P0)ATAU 8YL0<L0xWgTGb 0 X90偳90@唳9s@-xR   @ ⪧8⧧ | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/-  0 R0d1`0S00#0H1``0S/00 /0 h/6& *P 1:h@ 0g0`0/0? ?,0l`00000)C t0*|`CS4  |Ѝp@Yr^^o90 0O0$@ 0;00 X@ T VJ8@y 04|5  x@P DATy @c54ЍtV@y 0X01 /@P0X@0 Z 01/@P0Z@A5h_ P% Y[00 @@00P@ VJ0700Z0 CSRL0 t@꒟ @kT@ f0J0 H@P Z$0,0 00/0@0 ^00 0p`K@ӀQC-M p#@P0S !PU  A` 0 q@P`P vЍ@@-@0 000 0@0マoЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍO50S0000(00S40SU YPEU U00=0j4 P 1L0:`@|40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S \0 00080@ 0P  @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S ; 40SW; 0000  raW000  9 ea aaW& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@AaH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/Ni8<1W<1@1@1D1D10Q/Q\8 RRu1 1tW  11222/W22!2? !. (2W(2,2,20/+80 LJ0Z 01$ 8-[ 0S%GS 10 Rx ?RQ X,j g2WP00 70  70 70 70  70$ $70( (70, ,700 0704 4708 870d d70l l70p p70x x70| |70 70 70 }70 x70 r70 m70A/Ag70B/Bb70C/C]70.X70E/@S7@0F/F10L70G/GG70.B70/<72@0@ 0 Dp470070 00C0$0 0$0(0 0C(0,0 0,0 0S @T00 Y80S $0 C00,0Y * )4@,00 U=0t q1 LЍ R@ҀT^Ӏ1`00/1`<10/1<10/p@-@Q100pӀp@-PP`@V11 GP@ 10$00@pӀp@-PL`@V11 .P@ 100@pӀ@-@up@-P@mlp@-@e@-@bp@-P@ZYp@-@Rp@-@`Py PpR0p@葘pp@-@Q0` `00p R0Q`R /O-MPp8c`u@w5xGuYw PWx   P @ P  0 囚P  ЍٗP  җP  ΗPŗP    ᾗP   ẗP᱗PᬗP u ᣗP ៗwNtN널I▗iuN rNᚗx ᙗw ᒗ ႗PzO-MpP`8Ùw@u6vHwZu lPXvl   \P @ XP  0 P  Ѝ>P  7P  3P*P    #P   PPP tw v u   P@- 0  Ѝ"0@-00  Ѝ@-0t`qӖ@uЖP˖$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`q᪖@u᧖Pᢖ$0P 000 Ѝ71M000/s@-@`֘00 0P἖@PЍp@4᫘Ѝp@-@PT@#a8n1  'q 埨ЍpӀ0A-a(M 000` 0P@P p0 塬@P ?T@(ЍA1P0 ` $0R  `P 0p0z/`00 ¢0 00=]Ӏ^(0310S/00S/z<@-d03" " R @" B"2S k&@T*P p@-P@Tp z000000@p@-\03Q0S m@T 00@ _TpG-@`T; T[ T[VY h1*ERU:0CVQ @p81`3  1 0S`} P U* W0@ @03A }{ @T@0U00CS  @00J @@(vA-@ `x60 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `PJ60 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#厮@P 0 |0| 0 00 0 P#3S<0 R00Q sJ(G̀3̀^ZJ0@-M 0000 0@r0P     P ЍBA-@ `$P B  pᣔP堔UV#3ᔔP哔U V VX031S ( ,02 0P03#6P A-q`pQ TlPP<@ ovB PӀ@-QM`@NP0T  R 0@ 00 0@`PP P4P 2p/W )p(WP Ѝ(MO-QM@p帰Q @PH0P @@0P 0幖@P:00CS@5 aL0` 000 0n0 00P 00 0 0 p*0@?o2P0S` 00 0刖@P  P0R00P0 Ѝ^O-QM⨠崀:p0PS5` =@P0 @@0 0Z@P⒟ Ѝ 0` Xn0"00  P 0 0 I*?oZ20S@ @@O-(DM  ! 0!% Ppa B, 0  0p ,`(P$  1.0 000@!<.  -  0 04p,`(P$ @\.+0$ !H.  6 / 00  4p,`(P . 0!0}0@0C0000   0 S po4?C-@`Pᰐ1qS21 0! 28. h R R R ' ٗX0@00P0#*1S0Ap@0 0@00002S000000SP ЍCdC000@1^@<@-@0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@E` T`W p W 3U  GUaP 0S<@vp@-@PG p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0'Bp@-TPC%0C0\0(@T@ 0S 0ABXp@-K 0!0@@70  /\^0/000S/@- 0@} ЍZ^Dvb00/00//O-H`Q@S 0p0202  ㇢[0D3" B"2S1 ЍOTp `00S; ; 0  ^[ ;0 40;V 00S 0 Ѝ^G-P@0 pspD EY 6UP;`P WVV `XoD 0G<<fD0 X]D0 QA-Ppp `D0@c`  TDD@A-P:D`@ @V`X;pX# ԡ@_;0 "S ȡV@0 A;K;p@-P @H0c   㱡0S@Cp0 S pP/0S#/P/ 00@o/P/P/ /p@-@P'{@0000p]Ӆp@-@P{@P 0000p]Ӆuk@-@CzkPC@3{/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ T@PR  03/@0 @R/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` a0 P 00 000 0P?o2P0SP00S 0@ 0003/P Ŕ 0<0Y!@P<0W0 00PSPDT`@Ѝ_Pp@@PvR,(Rp@-4` Q[ `hpT0傌@  0P8+e_`Ԁp@-@[@JhPp{@0p@ 匌Ԁp@-4`8SpP0P Q@  v+9_084@p@Ԁ0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@ Ӏ ^p@-@T 0 R X0 ËPP T x ^0000@pt ZJ0Ԁ0 0S/0 ԋԀO-pPP`@U#`V0[00 U00 t  w^` @T 0S V x J00p@-@0PQp R00  ㍋Ԁ0@-@PPM RS   PP P 0   >PP  E2 1"  P0E"0A 30Ѝ0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@M04`pP,0 000"!       P0?S$P(P,P0P4 PЍ L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ ^@-Pa@>i?,10!(1T00!41  1 00000110010 0 ]@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0 PA_10101A-0P`q ( ɜ@IT  0k@P 010 10010-A!  !!! 1P $P A-@ 0S Pp`eP0 8P0q@0D"0!!#  0SW00S@ p0>S? 0 0CS#0T P@G F 0 S 0 0000@4S P@@ @@^O-Z0M0C01@S FKP3 1,<00Jp"@03 qp[`) `P iP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  [0P pQ   BV *V .`P [3  @@P gP= 0@; B "Vx1Sp` 0[ 0p!x!ZR|||!xztZ0SP RU <0|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R /1P0jW^@ԀԀG-P葐lp@U" PP1@T' L0S` ZR` 0  ``@PX P@T %P @TUЍ`0SL``g 0  ``PX Z0S 0CSPd@Ӏ@Ӏp@-xM@?x ` PF0U0000`0 06(0$(P lP, 000l+P0 fb!xЍp@-P0@1P00Z00l 0000l@ ⎆A-p`@T$ L0SP0S:@]0SP`P+U ,'UVA1P@ӀӀӀG-1`pAZ0S'P\W TP0SP0SP;0S|PP0S G'0 QU 1ӀӀ0@-|M@t PF00P |Ѝ07@-PRQ0@2  0$100\ P P P $a Ѝ0@A-P`p@TW [0  d@p@-xM@`Pt E0 0 0`xЍp01 10/O-`P1Mpp0AL" P0  Z(XΌSP54c@㇒) l 0R[0"? R (`pap0` 1RY PX 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOXYP k` 0 0  2ЍOЍӀ ^O-p1|MSA僿P0  hXN T0%@4|ЍO R (alS`^t D0! Rp 40堀尐1!` p$Y0  fWl>`0STwP 1`@T 0c/ 4/|ЍȃӀ^p@-@HP`50S Rp@O@!p@}ӀO-p`PA$MZ0S P R ~U 0 bSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000lPPP04P0ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` 6X !!  Rv UX [  l Q W   0 0?P}WqPPP p402S SU 000 000 000 000S0X 1C HQL!`0S7ڠ01,0 [ Q , lP( $0 ?PP01 P02 Pqo Ӏ^A-P@q` 4Rk`nC2! !! ! ! !! !0  E2 1 U"! ( !, ! !02A ^p@-@P8`0` [V` -p@ !^@-APP0  P08P0剽[  "!p!,' :P0|`V0S 0 00 $00C0ѼVP08P0߼a7P0OZ/000X B0XHqL1' 䀟P&  03/`00S P F|z?V` 0 t`؈;VP02P0P0 :P0yx`$ĈX^b^^vl^^C-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  xB` RV1嬁p0P 5 1 ` X 0 8/Y/ g P  0 Fs |Ѝp@-@ 314020SS \呇Sp@ە<@P` Pp 03/p@^@p@-@P@`PN@  03/@p@p@-@P@`PN@  03/@pp@-@P@`PN@  03/@pp@-@P@`PN@  03/@p耾0A-PpZ0P01P0?`0Sl 00C0|@Tᓻ 0SP0 ᠻ R; AV  3 ` p000G-`1SxMpA 1 0t A001Wpp00 0 0$00(00,0@ 0rA0( S :P0  /t奈0 R (! xЍ%@ SX`40` 㠐p0`1RU P 1 `@T 0c/ 4/U^A-Pp@ 0`V S R @0nXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/HzhzlzA-D`DpP@O0S B00U@`00ՀDG00/p@-0@00S00P00R -  P 0Q 0 p@$Eb 0 }&0C0d0a3P .20 0`p@^p@-P@IU "Op@-TC\  P 0 P  &}`@(3p@-@P R` Q00l=#0`PP0  p@P0=P0/G-1́`S0Sp YP@I DP@@D P @P0Y0>00^X^^^^^@-L0!C !!R@ 3 3P@A-l0,q@0 PR `  0*  @X @R X A$ Q ,1gP ,1! / x/ / /@-剄^////@-@ +NӀ///N/-////@-   Wo Ѝ@-  Wo ЍQ@-@ @IAP  ,P ^^@-@NP @@@C-@QM@ЍP`pP @P 6M RPP \ D0a0CQ R P  Q0@pD@P MP  MP 0 MpPt$6MP1MPL0y0 cRY0 0PÑL뉙! &ခ"** 00LPL6#::00^^ ^A-QMP@`0pDzOP 0 wPP幁 Q?P@ R?קW 嬁媁ЍQXOPLPLPLPLp |匁WLPLT偁 >vLP|L$u^^6^<^^^ ^(^2^@-03@M` TV 0   n30S&  OP B0 rs #8QPP  ;0"0 !& 0! "_ @PP(LPCX\LP>HWLP9<2$b0`L@L7:!#:  : 000@0QJR1L+KP-LP (LP?apЍ>P@% KP> LP9 4XPP5 p|0 pZz`]n pyMiV!sNP[>TU K Q`PNKPKP04 40 0000=3`GJ^O^^ ^[^h^k^zd@V^O-@0pSM800880S PP8 830:QP>@|KPP p8hNP0ST CD80 0 0S ~?CS^?KP30000000000T007u0 0 `* +T +K$KP PKPxKKPlad`8}0P00S K 88KQڷ0 0R`A*S 00B80 (0PP0 08(0PP `6(,  JP/ 0#pZ JXH8u}`P'Z %0 + 6 006 #:: 00 40 `!#_ 1$0$0YJPJPV8LMPH   008`P d# \5%00[8D @8+}P: ,MP4% jJ@PboJ咂`JPJP JPD4x?a|4PC`D R  LP hP@8LP_P 8LP 8YJ0P D R&3[  P8LPD0S h 03 }2 h30S ЍPUCT3 I ^OPP,IbPdR'JP"JPI0w0cRW  !) I 106 #:: 0000PII 6#::0lJ 00nPPa' # I@PZIρIPIP |IP81l?a⹁1P 1 tNP0 d~~@1PUu*0P0000h,!0 Qa 890*6 0 81000 0~8PP8 P~ M~00`Gvu^x^|^3^^^ ^h^^^^^J^m^^^^4M^^^<^2^^\?R^O^/^/ Gp@- @RP` Jx0tPS|0|Pp@x0Q0R h R t|0 p@jtP|0p@-釲`^p@- 0@SP`pPp@S h0S p p@FpPpP00SD0P 800S,01@o/̀ZZ 0!< 04 0 (   !/Hzhzlz7@-h@hdPbw 00@0V 5000V H@@40DV Ѝ0`^G-`P0pP&40sQ!D p@ D0@0, ЍGЍՀ^O-`zP 0p@ Ѝ0 P&40sQ!Db  c@ H0@h0 0 $ X@0JՀ^C-@CP  ЍC8x0TP` q 3p <0P90$ pTP  Ѝ^D00S/p@-P0` D@c 0 p@̀ՀL03"R  R P2@@-'/0#202/P /@- @PR\0M( \ %*0q R!0`!|0$!0^z/ 0(``b`adad`0|\  0 0#0 004 0 004 004 PHP 0 LP3 0S @D0S 004 Ѝv^^^ ^C-@M 'Q U c r@p p2 p0Q1 0U0C?o20S 0 0 ူ0S 2S(@UPP S0 02220l0@0#0$@0`1S3WJ@S0x"2R '.|2x2U j 0S$Y!0002h2820h20l" l"X40\S R   WE 222`,10S 103/  0rPSr+ r ,i0S 0000X4Ѝ1Spc 0 02P2p2ZQ222@0#0 0@0}S282vG@-0CW@@-(0CL282@G-pȁȡCRU 0S b+Q t!@0D0@0Dj+2@ K+dVʀ 0! $!0!!   !0S f 0000SlPR0 0 0 282202;Q20C2Hzhzlz20C22S/|@-$02020CT@-P@[0p@- @0BQS05@ ?0S 000 R 0 0p@'P08P0000Ou|2R 0 0p@*Qs0 `'0 0Pp7p@X^^A- 妾1aq@T. L0S图L00 վ@Z R  BRl  00Z0|PU 3S ӮP0 P R Qۮ8@,孾T  @AiӀ@ӀO-030#0c$M[ 3 10100S0#0K2PU L0SB0p|@0T0"W50a2 R z/` ygPP0Hu40\ 0S؃0$! 0Pz/ 22  y40T000T00S P0  0S 0CS Z0!Q500 ) Fd 0500pA0S,0 P: ^:pzO@&0` Wz 0`y @T  @ `00S L#tP$ЍOݽ`` 0Pc5U504v\?Ӏ@Ӏ^^^^D^^/P000@-0ll@lP R P00Q# R" 0RR 00ocRRP00G- @`p PP㬀PBPU|U@  `R0s#0"s#R Q0Vs# ocRRрӀ/0$ R @- \/XG 00S/PXGs@-80`SP 000 89,U`@P  Ѝp @P ,Y3P` T30`0P40P0 R8@0`y ^@-0 <dT:p@  =03/GvH__G 0<0/vP o@-&0#202G03GjGO-`0M@S10Z00Rp @04S8P <rЍU00SY0 #4000 @0SP8PWZ@0  0 00000 0iP 0 S*`  ^0 Q0 00 @v^O-$M`XPQHTp 04S Tur200 X0{?oW20SX 0 H@T P5 P0 R1S 0S,00 00000 0iP $Ѝx@L0 0F 0 pP4/Z@@Z4@,@(@$@-9^^hRԍRR@RR R0C- pTMW`0 0B S @ Uw@P TЍ P!Jw@P00S kP0 0P00000Z@W  BxT@T0S 0S @XGG-MⰠ0堐P4S qЍU 0`0S0Y0S`@p`0  PT -$0 00P0HZ  00 0`000 P:/b^O-MP 0`0尐崀$R vq@Ѝ0S@Q0ps 000 00*@PH R Xp40S& 0(0PR 0P0S(0R 1 1H0S G0 0B!B P04800`08 ## 0S PIQ Y0`00000P0Vp` SJ J@^O-@RYM0Pጁ堡1 @TpPl R  U Y ,$ .0 @ R4  00pwp pw  0>! a v```J P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,pYߍР010804 P00F0p<0,MP`B>P H1R0!sR g |WpPP1 00 400 80@8@UpP` `84p40SR40 8✦$@TR4`S,p` `0Y8 @T2B@P @=PV0S1S X@T01X0| ;p$@Pt  >X@070l@ *00 0@0QP P0S p0 0R  O 0$0S !0(0, 0P$0 , e*$0 ! >$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@ovP 0p 0^^#^^^-C-M00( 00P00q0PE 000 0g@P aT@ЍCЍ/ S?@X X` p )4X001 ``\    p @`$0$@JBPP804 \@\CRQ f%PU Q@R0 0P @@`  R XP L0@:$&@P 0$ X= 0 X@' A-` 1V`04S nAWPp`8@T 00S8@P 4p0p8pPPUV  0P 0p0 XP Xp`@4 802#T*0 R0 R P8@GvR^A-P0 n0 p RAn sA S s `Cn@Hn@,n@0pxnTw^^^^^O-`PM PU (` ) Sᡨ00Ѝ    p @$G 1( P,00 00J P 0 10P0 00`0 0@$0$ C 00 0GC-` $MPS@p@ ppY 00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`m00 T @00$R01 @00-^Q|O-//0 R/ 06S/`jYvȋR@- 0 ` ЍG@-@0 00 #3  0 0 0 0 00   0/Ip@-P@03/0@0pp@-hP@0S03/03/@p Q \ :$0@X{@-@ Ѝ@-@  00Ѝʚ;@-@  00Ѝ@B@-@TpM00PP`I 0EV P0SwЍX{@-@  00Ѝʚ;@-@  00Ѝ@B@-0a @k$ 01 0Q1*S10Q0 0Bl?l`P0 @$00R000R 0P0*03/03/@FX Ѝ@7SD  0 0(l\?0^I^IX{I3q^c0@-0@AIA-Pխ1@ R R $0$ "?o2W0S A$@$ 0S p倀0x`000 0\奭@TH߭T 80800"#NIX{IрMbӀ\?^0M0000Ѝ/X{M-p0M| 0 ""$ O!$" (@,$[`3# 0SP@S  {"! ,  8 `5 \@  ⊭ R   4 0 !i0ЍI K@Iʚ;^1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P00 0 0P0 R00pX{O-@Pp`.0$(0,0 0#   \$0 x$ $@ \ 3 Q\ P0 00"0(00(,4Q0$P \ P \ P 0  L P0@ rPpQ0 jX{@ʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P0S $000S2/p@!IX{Ip@- xҫp0p@Q0}/’\ \#3$0Pb4 8@#4i03/p@0/I\?MbI@BX{^0S0/0G-P@M@(p(0< 0800,p$@ @@ @`kP0 P000'>0,(p$@ @ @P<08 X@Ѝ^RC-Mp 0@P`` 堐56t0 00  00P 0 0$?oY20S 0S0ńЍ80< 0S 800< /ap@-@I@0`0@0a,PU 80< 0 y`p@1aP`@-@PP@N@-P@`0S 44q4a 0S@0 Y( 0R0000 A`0 b<` 0SƂ 00"#! "#1`P73 $103$!D0 3/Ԫ0 00000@000Mb\?@-{h-^0p@-`Q@P0 @20`, fup720` p@fU^Y^0H-@`,M0堪P0S? T$PU? ,XO80< 0 80< ̪ VbP@ `H  @R ppD ̱00P1D H?pkW  ab !0 _@0I_p00 0P00000p`p=>0S9 0R 0(0 0 ,P0$  R 0(00$P 0b=P`Z| Q 0   P`FH]^e^tR\?C-@,MP` 0 $0(  ,0p@0000 HPD` @_@U  t000000 T0 塖PP l_Ʃ,Ѝũ00B`{^^`Rp@-@`PPIM PpPAM00p@-@X0M 0@0@ @@@ _  00@@Ѝ@膩^I0SA-@p`ဩ@T庩` M Ps@P `MH0V P@f@0T@SP P0PT TPX0\ P0 X0\ 呩U `L@@H V P@I@-@d=X0\ 0S X00\ @P0ST T % kT@`L0SA-"<p8`@T SL0P!`gT ST0S SL Ѝ0V @@0T@S 0 |0P 0P0 T0 0 U SkL@ V @ILRR(RI@-@hè0 0S 00 @0S   $TS@?Lp@-@SPSpp@-@PS@p0-@- p@ 0P` 0sd0`00^PЍ@Ѝ/s@-P@w00`V ᮨ` ^ 0  0Ѝp@^R^p@-@8P官 3 $!彘<^00p0S/p@-P@;B,0S  (0 0@0(0^p@q0 0R0000 000 @0S  Sp@-0P@0 0R 0(0 0 N;P^pp/p@-@PPp0Sp]@-X0@SHKj@ %jp0S/ R/h l00hID @-(ɧ 0   l0@IPRD0 ,P100S//尧@@A-xM⨧p`@TާxЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x t0000x0(0\0\P0 ӀI0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0CX0 0000 0@0YP H0L 0P0S 0003/(@ʚ;I0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0SP 08kH \0AQ00\0`0S;,Ѝ0%p@-PvJ 0@   S%0S@#p cJ@@- AP@T@-@ iP hЍ \Q?/ɚ;0@-@MP gP0 Ѝ0P@-@ P P0 T0S000305: 0$Pʚ;ʚ;@-@ PQ  hЍG-p`@M00  0`@iP <PT 0 00 @Ѝ R  T@0@C0#PPPU 00Sg  hP $ 0 S (0@P0R0P100Q:UGjP !S R(QQ\( 0 BR0 \00 \0 0 Q R^ 0 R R 0u{^ʚ;0@-@,MP fP0S00 0MPQ 0 gP,Ѝ0p@-@(MP` f0P 0S000, PQ 00 00(Ѝp g0P @- R R S12S1`01 0g Ѝ@-0@SM 0Q  00g   gP Ѝ0@-R@P$M 1` laT U  WfP  @04 S#*/00$Ѝ0^@B@-0 ЍA-@QP   0!H`Ap0 AR pW=) -` p`3UP0 S00 10\00 1 p 00 00\ @@S0P S0."? A(8I@BZ{c /I?B0p@-0M 00000` 0P_W@PP  e0P@0S!Q Q  f@0ЍppC-P `0EQ@P XP\ ` f HUp0Sp0 0@S((0,0,0p0 pRIJ0`0X00CS/@-@8~X0S000S(0S, , " @@-@X00CS@<0@-@00S &R, l00& 00@GIA-X0@0CS8CPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0@ʚ;ɚ;6ep@-P0S H LA  R5k9 SEUt $\RnE#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A: #dP^@-0 Ѝ䔃@A-1`PU 0FS0!RX00CS 0S 0SxxS 0oHHL@LpH@L@PPp^P@HL@P0ɚ;6eO-4MX0YP4Ѝ0@S`pePePP`ATPW 8H0L 0P0S# X 0BQ%SR  HeP H0 L0 H0P L RP 0 H0LP p BS m HeP H0 L0S H0P L BRP T0SH0LP0P0S0 $0P0Pɚ;6eʚ;p@-@HM` !bP P1U(P0 0WPU (%cHЍpp@-`V 0@S@@P(P'p}"p@-@ M P b Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M   P b$Ѝ0Q/ЍO-MP`fdPbdP@p0 0PW 01S 100[%T C@W DpU0 @ U 0  0t pxP 40匐P@@Ϡ0H0L0P #0 RQ @ U U% p FT#-H6dP H L d0H PL QP H LPcC6e^ɚ;C-P`U@p,M0S U `P ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@X?p@-@`Pm0SpG-1C0(q`@@XP`X R00G蓟 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#Sdl_,-|0 pPR @> 3T`@ A@0@$}0 @H0@}Ѝp Js^6S@-d@0P }0P H  L0P }0P  L@3 J~^p@-P<0@Tp0 RP @A-Pp@P`  0RP `VX00PW@ G0S PP000@-M@PPP, +0QPaUP 0S   p00S  QR000 !R  R 0PЍ0 @-@x0P@tp@-0QX0P@ @0Ppp@+'Pp@TpO-,MP`PC MpP> P 3Pf2 0@00尴00a00h0l0@P0<043\0 0PpST U0Wp00 01S PU 01S PuG@,ЍpW1 00S00C00 00[ 2 0S 0R dK 2P!  G!0s0S  0 Sp -p0p%0%0 UC0PPC&P PE0S L 00"0CQ 0 \dD$0  |X0480080<00<00S 0 P:2D0 D 010 D!Y 0H Y"HBX HPcp A 2L200SM PPJ 00 X1 } `P. 40S 0P0Ng pP   R   0Z lY  LH 0A P<^^^^^^!^*^2^;^p@-@P`}0Pp p@0/A-`0@Pp t Q A 0P1 P P O-`p0004PUW Ѝ@0SP  R@ 0S 0CSP  0\NP tP [ 0 ;/P hJ0@-M@P Ѝ0O-@P`p||0S Ѝ P @pU 05/T OXk_,@-@ p0d000C@姍 JA-X`P>X A/p0@,X,0p P0@,@A荍 J@-@<HP0 SP T0 0D X @T@D@@x Jp@-40SXJP`0@4'00(0P `L  @L@p@ZP^ Jp@-h0P0Sp@/`0@400(0` PT  @T@p@:̀ J@-@LP00CSP0 T X0,R( X0D0X0T eC@ JPJp@-P`ٌ@Tp@pV0  4 R SD    03/R0 庌0@ Jp@-@$PHP(p@p@-奌`P@Tpތy R0T0 L ԌP 03/<0(qJ0儌 J^A-0P0`SxpX@ 6/P0S 0S @T/@\0` P0\ JA-@PTA@0S-卌Q0SK`XPUKV0Xa0XPIDL1@0 X $40S PGkT!TA0B $G?p @0R :<RP!`%`56/@@T 6//0t"#0A6/T@3/P0 3/P` R0\0  / Jk_3^^\?zTpvT^!^Mb^$0$$08S 0  3\8S(J Jp@-@PHʋT 0S 0AT 0 0 @p<@-@LP0A-P`嬋媋U㰀q@0S 0@T 0 0d0S\0S #S`0S (ŋ0$A偋 J<G-MP8 `p@PH'I 0S0 0,20SV 20SR GVQ3I.QJ014XXpPk0 00i3-A0 03/H-T\A4g-$$P``V<0IH7`TЍlI cI IW 7/pP 0R  qP0 4S 0S p^ J̀H^[^PJPhJA^R^A- Mp` P @P 0 A@ ЍU H00S <00S 'G5/ 1pI J̀^@-$M@P8 `py0 $Ѝp@-PM ` @P 0S0 0(0 03/8k00\0@ 夊jЍp JPJP L0. JG-@pNPPU`0S23`0p0?PP \|UL70 0 4p$/(`P@iPЍb000_=0S0S<0K 0SH 3/PPD0e0<00<0x!L0.h?4P 0(0S 3/4Y.0S  H0`0d@ 50U0C0   S(0S%_-P  {GP  0R @P 0S0 4S "+00 J@-@v0P|0S@/|/A-`@ፈpȀ<0P 0S#Q003P0 000>00C0>ᬈp@-@Pe00CS00>p@蚈//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS A6+0`S0Y030#@D 0Shl`}W !+ P0!!0A-P@l`hpT1S S@ R Tjh@l@NA*1GQ @p@-P @PJ0P  $     PU $  U p@pnQ P  80R 0 Q }P 80R 0 <p@-P 0 0S S, S@t@>pm@P`F`i`V80S@[@P``W` 0V80S@SC-pP@P x@p p0O`@P  Ѝ@<0< <@P 0 0  07^>S?S"^1S8S0/P @-o//0@-\# R P 0|@ 5S0P4C0200 R 0 @b34 P000T0B00 b B0 \ /-L \  QG-@0P00P00pP"!bHUZ :T0 JPZ T 0 T0A0U!O-@MPP 80P6#bP"ᆡ  80P 0Fp 080Y0S:PE pw V    r R:V  Ip 0 0CS005Ѝ 0 0 0X*&B pT^O-RMP`<p W0HЍV ,580R#"  80Q  H p㛠!0I@ 080T R00C0 @t Y    0 CR1!p0TAY  p `F @ 0 0 0{^^0 b B30 @-A00 00/^O-Mp@0@#0S0PD0R    R# 0 p 0A | 00  @ Q'r Hf 됧# I  ` @ V RЍ JR1!qdgAY  0 PE1 `Q05 000 00^+^A-P` pW: '0@ `'0`rb@-@'@'7@-@P 0P S $p 00C 0 Ѝ0  7@-@P 0P S@ 0 Ѝ0HO- RMP8`<@x ЍOX Ѝ7  p WTpX RT:#p1 00I"00T0X0S 0s T :  @0 @D 0 P @  0`@@-@P 0 S 00C 0ЍpA-p@=`P0T@! X R BkЍAEp@-PPU@000p0  R: DP pC-P0@M 00Ԑ`pW  0S" 0 00  00Ѝ  0  P   0  Pp0 00 P hT^W^O-@`|PDM L<0 0,(`$@ @@ @P`p<@<0S 400P ,0H0000,0(`$@ @ @PpDЍ\^(K,KxtSp@-@P$ 0 P @ Xp(Khp@-@\ PU HKPp8 0S00  0S00:(KhO-0Mp`M 0CS0?`($$P@TW- + 8+ ' tЁ0 SU  ۍЍW G P UP 0 RP@\U @ 040 0;%`@03/l^(Khrh^^0/0/0/0/p@-@P0Pp$ P @-@ 03/(}  00C 0嶁@ %(K0/p@-P@Ppp@-@P$  S60 0p^@-@K@6p@-0 P@F0000@0@00p@yp@-@P6`0S0S00 R00 00C0p@a6A-@`p000SV P00CS07DP U P0 3/0PP0`$0 0!0 00 /Hzhzlz@-@pMP7 S0H` @00<tg$ b$R0`07 7+P <x>8 h1 S(0Z?00Ѝ^^^^@-@+P \> 6$t@2$^@-<0DT 0 !0  !0@- ! 0 !@-PDMp@`i+ 7HP+0 000007 *P  >7 0`DЍ^p@-P`#0@`  +pL|Sh{SO-l03100P (Ѝ@<<0 00!4 Ѝ0 0  ,(Ѝ/\r S& @-0@(M0T (Ѝ@^>t03100P (Ѝ@'=0  < 0 Ѝ  0(Ѝ/\rG-p@ࠟW `PU0``0C00S 0WP1R 0S0 P0pG0000C00 0C000 0  c\ 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q j 0R  ^P 0 @T   0S  R `F P0 Ѝ  \@-P`pᴇ@P0  @ Ѝ@-P`pᡇ@P0 &@} ЍA-@`pzPPdVz@Ѝz~@Jz,HzT0 @UӀ\ `=;\ X=*hNxO-$M@H0SP00$ЍQ0`HpPc0SL  R0I 00  G BR L0? U*0R0CH  0| P@! P:  0 Q L 0 P@0 0^^^^ˠ@-Dp@ppP `@ P Ѝ^O-DMp`0A  (0<00p,`$  P<5 0!D1< 00 0 0,p(`$  1 00H'!0< 0 0 0 0,p(`$  0 00!0< 0  0@,p(`$ X0 00!P0@ 0 0,p(`$ @< DЍ^|S`SSS 0O-GM@!H01E0P-@0  PPR 0S#@ ` p V000P0 0@$Gߍ@ /,,@' - Q`@p   B B<c?PwcU+~`P@ pW@rmDPP @ ]@P@PW<@-@p" ``P`= @` @`@PT=IDP MD /0@BG-M0S` QPPRp`100Ѝ  =\幉U1#H1@ U00T0S `  H000P040h080p0<00@00D0#""$(, X\ 0$0 0 #%@D `d 80<0(00 , h00 l00p00 t00x00|000$`P0pJ00@lNpNO-@Pp$MU0`VP奉@$ЍZ0SW@@`  U   ⡹@  R o$PP0p@I 0  0剹pN 0SP// 0SP//O- s@-`RP1`0@0 Ѝp@!Ѝp@- @`,4 ((01 0000CL ЍtN=S^p@-@H`PS0S(0p k@<>p@-@PT`_L0!RQ41`!`p@ T`@tN=^s@-d000S `@8P0d0?oT0cЍp!C13/=A-@`TPp WPhd圀PVpʀ 0! $ 0    ! 0!d!0    !Hzhzlz 0 <0G-P0p@H0儀`cP@  (P  Z0 0 0 ZUP㕘JG >>p@-`<0@BP@Up0p@/p@-P(0@00C0Up0p@/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz G-0 M P   @ p X@`lP X 0000 ЍG@1 : @P>xNA-X`PpW0S8 Aq P@m@xNU^p@-@P0 p@ >p@-@0PD@Tp>@p@-@PDPpUp@00@p00S:J/>00S:[ />00 R !>0 >0 >0 >"111/"111/ 211/ -L0!0\Q S0>,0 0R/Q0 />@-0 o>D0 0R/- 0R> <0Q/1S co `/ > -@0^1 0 co ` >40@0\/- 0\ >40@0\/- 0\  >40@0\/- 0\ >A-@`P$0pW^@P> 2; 2NA-P`@$p0SQ A@>A-P`@$p0SQ @>A-P`@(p0SQ  @>O-` Rp;:Pа$M0@T$Ѝ0S:?T@Q; P 0 ?0@4'V`1  L      T: 0I37@-@0@T t0Ѝ@\P0 1 8*b0 PЍ@>,p@-P@P  p-0t  B^\  {ŠP0 !.0 . @>,@-0+00Z,@  0*Q>^@/-@- p$P0 P2@~`0 P( Ѝ@Ѝ/A-pP`@j0P U @0p@-@`XPW@P  00p@-@P@{PA /R/qN/@-^N/@-^@-^@-^N/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`P@0 0/0 p@p@-@`[PP 0 000 p@[0@-@0Cs@-@0 PЀ `[0 <,W,p[0 000ЍppT`p@-@`Pl0S T[0 0S 00 [p@K/NG-`MpP@ᰐP!0 )3 0000X0P3/H3 00P00 ЍN^^TnT__p@-T@d[\00 P@ B?"@U$/[p 00C0/(0, N@-@ Z0@ @@[Np@-T@`Z PUP 0 001`00 0RPP[pNa0@-$0P 0 0 ЍN@-@Z0W@ZNp@-A@ <`PZ0 0RW@ZpNp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PiZ0L$PBU 0PZPp p@ 30 p@1|f~fNNA- pM`PIZ| 0R( p@T1 00S 0E0C@S@1T( T@# 00S0 SphdZ M@LZT W 0VZ#@Ѝ@P KZNOp@-@T P,0,h0Z X$@p@wX OOp@-0 \ \ \p`AP@ U0 \=U 0@0 \ @ @p7@-@ PP 0PEP0CT  00 Ѝ0 @-@ P00Ѝs@-P @P ` 0V@Ѝps@-P @P ` 0V@Ѝps@-P @P ` 0V@Ѝp0@-MP @P  dP @Ѝ0 aG-@ppp@@0 0P `0R0%S  !Ppk0 `1Ѝ@0M0("(!R!8 010Ѝ/A-@00P("(%RpЍ%8`pW @0S0H5  P @0 0 P%80S0("(H@-@ P@ /A-P@p` 03/ 03/0\ @`1  !0 \! Q/  0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-@MPp@l0`Q ЍAQ 0000 0PЍJ Ѝ"TA-QU@p`PW ApU 1 R 00 03/p[p@-QU@`PpV 01p`U 1S 0 p[A-P0QppU@`P `U1S0 V p[G-pMS`f@Q03/ЍG@Q 00000 ` 0PЍ1 G@\ 1Q  013/ Pq181"T-1R001@ 1S ; @ 1S/ 4@-(0@tQ 0 @p[1 2/ hO-P@|80 S2Ԁ<0t`̠Wʀ ! , !8!< UTЍH_A-Pp`0唀0@T @@DT0V`0@T  T000 0a 00V@ЍH_@- X( b0*̧P Ѝ,X0 0,00@-DM000,00(0L0 0D0@00P0<0A$ <0< DЍ0t2T\_@-\ \l ! S*8l 4 DR  l V Ѝa_O-BRMP `p S@T KS000[ Ѝ0ࠉZT0 0lT0SX0p 0"t  ! "@ #H #L $P $< %4 %8 & k& l' l' k( ( m) n)  Q[ !F P$0 000S 0 T0s R0 (RT00CST0 [ @0S ( , İ İ ذ ܰ ܰ 䰝 䰍 $ 0 4 00 0 0j O$Op@-@PTp0!5/@_ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-P`p0t0@T @_@DT0V`00@ T0ЍH_A-P0p01A`pQp 0 S 00000V 0 S 00000A|Sa40040Sa40040H_0@-0$M @ 00P0U: R 0U  000 0 0S 0S0 00 000  0 $Ѝ00 @ U 0!*  0 R 0 p@-0PS@ 00  0R :p 000 0 @p 0 000 p@-0SPp0@ P\ `R` 0 `7@-1PS0@ @0C0H00CH00S   t0@ 0D S l0 0l  0S0P<00C<00000S000 Ѝ0_0S p@-E@ P0Rp/0-Q$M 00!  0S  0 R 0  0S   0 R 0 Q 0 00 000  0 $Ѝ O-M@P<0@U`8D0  Q0 Y$ (45% 0SP0 S 0 S:00 0  P0 c0?o0c 00SPy V `@0p00800p ppppS@@T`臁 13/ pX WG-p0 @0 0 P  (`,(0, 0/X(0, 0Q S000C00Ѝ 0$ 0 0$ P@  13/P pV 0 H/PH_\A-@Px`K@pPEPxE{804P"8%< 40R:ALpp@-@Px`KH0,PU< 40R*p@Kp@-@Px`K0Pp@KA-`@xPpK? 00+0`@`PPPEP0p/E28AK//\00S /@-X <!t  L  R0S @-nK@K OO-PP@QP1 ! !1@11/ qQa 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    + _s_R_l__-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/N-@-T031[  1 0S 00 00 ZЍЍ/-@-T031[  1 0S 00 00 @ЍЍ/-@-0 0001Ѝ Ѝ/s@-P@`0 `"Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@Z@-@P`00 `TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <!1 @P >`Ѝ  00 U00S`C 0S. z,@T@p T @@ϔ 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 _ gfff_@-< 0 0 0,0; }@ Zl_ t@-@@-?@-@P0 @ @ @800S @ @,Ѝ0@ Ѝ/N0Q   __@-`@P 0 P000S   ЍpN-?@-@P@P 0  000Ѝ0@ Ѝ/ 0S LP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@Md0 4 0 000 [Ѝ@ Ѝ/_@-P`|10S A3S Á l@ PT n#T212@00@00A0S<$10SA0 00S 0 0Q000 Z#p0 Pb 0 pp0 0S `0` 0Q01Z]P/0 `oZZ NNa0_[ ___-@-`00/s@-@P`T 0 ,@J0 `Ѝp@3_-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 `$00S Ѝ@ Ѝ3_Z-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`BT 0 ,@0 `kЍp@93_-@-  ЍЍ/-@-00f Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0  0SЍA4Ѝ3Z__-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p$00S Ѝ@ Ѝ3_Z-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_@:A@(p@01 010101/A-a(P!R Ap@1!#880Ro@$1 q0$12020yA@@-`R( q@_@T0  (0!R@D!!!R Ѝ@@A@@ P u@@ Ѝ0 00P Y@Bp00S/@-`0`@0S@0D 0 @0D F@@0D 0 @0D @|@Z<B|0P-  !T LD.!      /Hzhzlzl 0CS@-T0 !< 04 ,   !/+_Hzhzlz@-~P 0Pp@-Y4 0P@U4OoBPp$0 0!0 00 /Hzhzlz@-<0DT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@A u?Pp@-@i? j@00/A-@Pp` >00$0@p#0 GAA-P@`wp '0S00  0S00 -x0SAA-@PpY` 00@000#0 A[0@-P@`xpM00Q ` 0 T4 0S0Ѝ> 3?[00@-j_G-@Rᜐ> PU``1S `VN PQ pq p D0 P00>`LTp@-@P>0S` p@>0U* `V 0a@-@@ |>p@-`Py>@Tp00v>`0S   0S>p@ s`p@-@`PX>@T 0S@A @>pP/0S /O-p`P;>0S R 1 ЍOm>k>*>@X:d> 10@>@T R AN>L>  ЍO R !  R   />->T  Ѝ_@- M@  0 R0 00CS0 R=9 = 0 Ѝ@- M@ 0 0S 0  AQ0S00  00 Ѝʚ;@- M@ ᩎ0 0S 0  AQ0S00  00u Ѝʚ;p@-P@P@ᇎp@-PM@ 0 `\0` p^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00,ʚ;A-qP M3 B2=T t13AT \h=@ ЍH@=000 ^U=S=0 000@0 0@P! /00B! 0㨀!!3Ba<T -P*=p@ ^#=! @ 00P P@ᵍIӀʚ;@-P@ 0 00   `pP10e 6 0S0  @P0S0 0  00Ѝpɚ;ʚ;C-@` 0M0RPЍ0 QPP pYP  R0 AQ@XPP0 00S2TP Ѝ000 @ 00@- X( b0A*(P Ѝ(@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@P~3 X0P4 R0 40 Q Ѝ0@a0U -,^ :!!<  12QX0 0((X 0 p@-@PC3`Qp@|31S.A-@pP`.30 00@c3ЍO-s,M@0`PVP`$ 0+t3B 3 3  2404#C8("<pXw/ 0C0CVp40 2p8<000Td0av@PY `zh 2d0H0> T`X` 0+0J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,Q*1011410Q&3*`5WpF&8!U. P0`Pd PR0   0 PSD d0 $SP= F@,Ѝ`QH  B(`z`1QES 0 @APi h00<  W0O< @@ Q ? P q`F pఃd0 lLC2( @,0,@SI$1((0(1w2(\c_lṮT_]TA-@p0 M`00P 00 0p0@N0 00  0|0p0@0 \0\ &P(X00@0 p0P0 ? Ѝ \pT_TNN(4?-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-i_00@-M00|0|@| 0x00c00PP X R} 8ԓ40 0 Ѝ0@蒓X^\T__T\?,,00 C#' ,00/<4?00 Q0000$  B',#  /4?A-@PM` pK10 0 0! 0?P W 0  \ \0P  PP -1Ѝ$ 0  0 PF_@TL_p@-P@1 PU1WA-@P1t0 3R 0SP` p!VU A81S0G-0P3x0@ g0p `V 00 01`03/V00 0 0 Fb@-@G@Qs@-0PQ0 7 0@S 00 `0ЂЄ 0S 002 @Ѝp@ (TO-0Pp,0 `0@ `F`! P ҇(0P@0 0 PP PUP@4?p@-P@K0000PPp@0/A-=0P@0S 00 `q06/-0 0$ 0 0$  $0RPBB@-L@L03/@0`0d 0 RS`0d D@>0BBA-`pP/@"^\Up `0 0 P0 @0 00SAT0Dn0 000  0BB 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz0@S@-70 /O_A-@q`@T;0 ( c/1Q0 @ץ @U/D f f  f f  0EP}00 0Ev00\0 0L0000040Ѝ褂B__v_e_T__T\00S/QA-H@H@`PQ /p"R0:AD/\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 00@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 R00 00 R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`*@*(lp@+p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4MJ* 0SPX *`%ꔰ[Y( Ⱐ@`@P  (@`$  *0 0`P ( Z*4Ѝ@A$@(`&Rl00& 0T0C 0Q `*h 0l0P$0hP P0$06* @)00 .*j PU T`h0Ss`P@$`(Pp@-@ $)P0P@ P00P0]@PpO-pP`$)@T @)T ) )00'0pD ),4Vp) ЍG-@Q8@T80S <`)P@0U:)@8080D0@0u)p)GL80兑P p W 80 0   Pp@-PL@y 0D0<8@0 <@)08 8  0 S  2)8)80S r)p8@k)A-@`P$p$)h`0l0@h00 00 00Q0V)p@-@$P`) @TI)p(0S H0S?)p$P ($0S2)@H R+)h07@-P @P@P 80S)@ Ѝ0<00)18P /p@-0P@ PP00] p@(4 _@-@U(@E @- @(0 0003A-`@p( 0S P %00 00(A(QU q(00CS0(`(@-@p(X(@e(@-@TP 0T0 @Wy{0@-p0 0mPP@`TV P Ѝ80S {(V P@00TP TP0 <0@ 80f(V  y{18P /O-pp3TM`3@ 'P00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0P @@ ∲   Hp p'X L尵T`P@% `P80S '00 000'T`- @p`~D0<'80!0S0 80R1``80a8000'w'$  1 P 0R,:' 0  @#T 0T0WW W  'T0T0TC0}' 9'0Y00000o'1y{0SS  S/@- @P1@8@- @P1@8p@-P`& 0SS 0 000p@*'0AT &0S 00 0Z00CS0'`'@-@&0TP0s0XT0'L$@z@- @   0 03/@P0W0>   @ `3V0 0,Q * Q :$@  0  @001 001 000    _   f@u#000 S H0] 00C 2 0 0 00 3/@PW 0  "  00 0 0 3/@P 00 3/@0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  {(0`S10 0ᕏP@0+E@g 0 03/0 0 0 0 00 @ _D?~f}f3{f@|f@-@{P p p@-@Pn0P @ 003/@>p@-@M P Ѝp@-`@O0P @ 040S-@  3/@p@-$M:@P @, 00`V-@% 0 10 !0S! S S@ 1P 000 00p q] 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  MnP0000Ѝ7@-@P @nP 6P Ѝ0@-"0`p SB@ pP P`0 @  O-@oopb W T0!03SP (0S0P _p(0SY @ 1!H  @@P PU @pP-dM"h0 (00@#0 00 ,8dЍ8TA-0P`p@0 TЍ@- #+0@-$G-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;0 ЍO-`0#MPܰ" 0$0P @Ѝ(0SppW @P (0S0pWpWpW @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 -P@x  @q0  @P @g0  @PHP ([1 01  010 0PPQ`0 @ @ T8TEp@-0PS@`M  ]P0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqP  (0S[X\00X0 00 ` ]X 0 /  0$[ _O-0p IR@4M, [P  @P!@T  @P @  R @0` @P "@ A4Ѝ?@-@p0t 0 0x0 @p@-d0d@P&r"0@3@#Vpp@-d0d@Pzh0l (00, @@Vpp0p@-Q@ 1CQ 1CQ pP]h0l 00010p00f@p@-d0@P0S S p80`h0pP=ywp0@` _ _p@-@d0P+@ip@dp@-@d0P]p@Xp@-P@P ,@*pp@-@P` t&'00F= 00'`P000@0 pp@-P@A` h0l 0H0` &r0`3:0@pG-0SP'@  pܢPP srF h0l Y^:0 h0l n$AЍX#x0S `P000p0t 0 p0t &p0t `0Sp0x0 t S PP #`PA-0SP-@ `Wphl 0 y0S 0Q h0ln $@{  dPX!x0S PmЍp0t 0 p0t p0t P0Sp0x0 t S PP #PO-50S`5 P.`P-00p嬰 0 0(0 @ @H @00y0hl`n%+  @ 0300 Ѝ _0 0R0,00 0 0/ns@-P`00@t  EPЍpp@-P@L`U<<P@P PPP@ @pCCCs@-@`00P EPЍpQ@-@ @ O-`pP(@T 0(  Y e$Z  @ IPW(@ X H$[  @T 0( k p,0H0@0,0mPPj@-@nP@oЍ0P :0Q:///0/P$ Qp@-$PP $@*p@0/P$ Qp@-$Pp@&P $@* A-@`00PUE4P@ 0S 0S00T5 0`8P40S$p(PU 'P@86@ЍA$p EPЍCCCA-P0\!Qp# `!0  MPP  PP0S Ѝ@@P P0 0$pPB 0>804P(Pt,0=0S``T0`0 sPP`(jU0S G| _CCCO-STM@xp|N `PP#@E W 0S@P;0  00 0  R0 0200p f@P(P ,}H4@L@$  P  #@P ,jTЍ,048@<0P80,0 @`H@TK 4@TH VWm k`P0  RS> QQ< <`4@0p40S@  @004PD00$L0~v@0SD  D 040S8e@T0@P0S 0AQ 0S 0 7P 2 ,#P`,`ɚ;6eĄ _ʚ;0@-@M0@d QP#!0  P@   k@ T@Ѝ0A-PR  p@P `VP $0 p|P0(0PЍ@P/@-MP@`)P V0 ! 000Ѝ"RS+ P `V $pP2U0!0P  RR   *P2U0!ПP!SSp@- ({ 0 @P↟ p@肟C| _qCO-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO10P ,ЍO;0P 0 $07JY )P@/ [, $ @P&$P Y 0 0 0` ($`P : P 6,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P @Pa0+ S0&%&b"x1Y, 0 $0@PM$ 0RXP 0 00(P[2 *"*kA 0 BQ    "A0C?o2S0S0S000  P S00S00S sPP IPN@H\ _r _w _ _0@- 0@SP$M  pP 0 P     $Ѝ0 0 R  //p@-`Q0@0 Q*:Pbp00\p 0@-@ 0P  JP DЍC-@$MP  P 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V PPPXX V   _@B _@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @PP0P$4ЍXG@-P@`?P 0 Ѝp0 ` O-R@|M %PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@ź` O@P V Ṻ 8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @1Pv (( R LP0PP _ ᆡ@XG0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0h3 FP 0PED00S 0 @OX0P4ЍӀXG@-P@`1P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@᷹`  A@P V ᬹ8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 AF (0X0B 0 R  @OY (( R LP0OP B i@XGӀ0@-0 0I ЍO-1PMp0`P P @@ P @f * 0 03/PZ  ᷸Q@f [ $/ ᆋ  P 5/PP [ $/ = P R 0 CN  0 S @ 0 0@ub xz/  A$4` 0 , $(    TIf rdAedAedAXG}f~fg~< _G-pM7 P) D0` SP 0 嵔 Ǚ@,ʀ)Ѝ>    7@P  07 000LP8'7 ⩀(P0S6  S1#U S1 #0 LP  7@P0@7 L@P  7 }0 @LPd h@PU @5UP0 pAP @< _ _ _00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0/p@-P@IX ㌷pG- P @`$pX X X@(0WPP@ 0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0  \@#dRЍlpp~Np@W02: 0 @  01/@A-@`Pp 0@G-pP@`m S!@"0R  2  00@ 0@T0"(0  ,0`$0 @A-@`pP? ᱉8; 2`p0#΅"^0@@XA-QPp Q! Q`+lj`@2` R`   Q`02.@20%C-Pp`2  Ѝ S @ R0P0@A`0 00Z(0 #c 0R P A-`Pp S@"@Q  0" R0Q@H0 00Z 0@ "cЍG-`VP:Pp  @ T 0 PP$!c2 02~PP 0 ( h @  &aG P 200ЍV ȵ _ _G-` R P0S0R@9@ 㳵0+p@P)V  U @$Pᢵ0p _@PᩑP`@ P0 rZ@ YpW ჵဵO-0TMp$00S00 0`P#`TЍ0 0!`P0@  0`P003 ``3 1P00fC p$`W[3pWb 840`op@⫲W[<3pW4@T0,0 T 1 #0p$, ,0 @Tp00P00S Z 1 !, ,0` T00P00S U 1, ` VP P 04P{0`$`P ϘPPp0`$`P ĘPPp  i R<  <` Ei`` P  R , ("( $ , 0 0@@00 0$0000pu  ei R<  <` E\i`` P  R , (( $ , 0 0@@00 0$00pOxP@t8P 0 03/`@NV`J`N``g _`rlrĀ _ B @-00S/A-@P`p !00P0000 0n?@r?v_` A-P@pA` $0SH0( ` $ 0R`0P p@-P80@T ,P]pAD0O-T"DM`!p <4B 00 0,p(`$  @P< [ 0! 00< 0 <00,p(`$  `Z<0 Sc 0'a!<0 ` 0 0,(p$ Z0 00<!0 0  0,(p$ Z0 00<!)0 0  0,(p$ Z 0 00<!80 0  0,(p$ Z 0`F@!  0,(p$ ` @< ZDЍ , _ QN 0 DDp@-@PBoPPUP 9( P =;p@z+ R00 A-\0P3`q00CS@@0$B@T <q{A-@` 0p PP ЍZ@P` 0 PP 0`P  `PղP1S!!1! PU020( l P h b@Dp@-@PM TP0QPP+0@@@NT& QP`@@ @@@`0  ,xP0 @@nQ PT`L0Ѝp800@0 _D _4?DD;U{p@-@P`0P ( R p pU  @@p@-pPPM @P @  @P0S00C>S@0`S@ 0S@ xQ103Ѝ0@-@M P  P 9 Ѝ0@-PM @P  p@P @p0`S  0W000Q  @ЍO-@$M 0Hp̱0` PP ñTPP<@ἡ3 Pz@P  $ (  , ^ R !W$  RR R0R Pz㊱@  @80j/ 0R( P 0W`0" ╘1 00 0 100ʽͽ嬡@ VpP= @   P $)D1 00? 0@0 4<00000 P Py0 00  pL0 T# $Ѝ0S@ P^vo^`rτn0X@Sk/1!p @@PFV0갂 _8 _A _o D@D0p@-P @`M P  lPAЍp/G- p0`^PP PK@nk^ 0 Sj$0SD `V10 c /o 0b4 baQ  S  !R!0C31$00C$0 PE ? U 40  2?oW20SP   'P)ЍV   09P P` `0 200"20 #P<#(P@- 0000@uP 00Ѝ0@-@PP$M  P 0 _P 00$Ѝ0O- 3P MⰰR`)0S: S: Y`  @ `P 2 > P `P  `Ѝ r]U(`; p 0S:$ 0REXc00 40h!  @ 1@1181$0 SfPU `x0S P x ⦂|0 00$0080匰$00$0 A(b [ VU   <M [ 0d P `P   P0 #R< # 0S000@@ P0 0  @@P(`(`l갂DDӀ0@-00 Ѝ@-@PM  PЍp@-`0SA 1X03/5H0HSp< 5H0HS p@  !p@ =ӀC-$M@`p\PP @ \0 0@0 0h00<0p `0000@0@P \$Ѝd _(PUA-`AMp 1PT @P*0@& (@P! 0  0c? 0  0@P B@TZЍˮ@-10/10/G-Qp 0`PX @iW0S P0 tH @@P P @8 P P0P@@G R H@p@-PA PP p+@ pp@-@Q @P @pP0$P R "@ @@s@-@Pa 0 @ TQ  @Ѝp@-p|M?WP$x AP` 00`0p 0{0$Xp0w u pPP W 8P |ЍӀp@-@aP[ 1S t@T 0S 0QU00001501 0S px PPO-03pP@`ᄠT oP 0 S ? T @ 0SxPP02P0rp _C-p`$MRP0P P0CJP0 4P0X%@ RP0 0  0E@P $Ѝ0( ?0 ` !@p@ #P U<@ <@U  p _@-`@V  PP  ` 0S  PQ Ѝp jP P0 \C-@MT;0 p0I S@#* aV PP @P U Ѝ 5@A-p@Wq0P @P ?T0003aO _@P  ۬@֬$q$Qv W@Ƭ@-0P@3UQa$ 4PP\ Ѝpm$Q  oayM  0R # w@-0S@~P 4ЍG-pW@ PP F0`0Sui [@P0S +m@/p@-@1P 0c↓ iₓ$ Q$3180p`p@-`R" 0P1S 0@S PpP0  00pp////// B 0@Ps //Q 0S P 40 P0@1S///{A-@Yt03@`P |0S 0 R0`hDd0P0U TpH{0ADͫ0Q00C0 R0 Q<Ӏр{O-0@pPDM(0( <00,p$@ @@ @`<@R<0S% 0 00< 00000'>0,0(p$@ @RT0P0000,(p$@ @ @P< RDЍ _{|`U_UA-@pP k0 P`㨀0 V:MT` V 1@`NPЍ0`1S 0 + _ _<{ _C-M 0@p` PT$a0 P 00 000 0PCN?o2P0S@.0S@*WPPU@$ @lpU*0!R0X H@P@$ @$PЍ{<@-808@ P 3Ӫ  @8?{\U _0@-M 000 00 0pչ@P@,P 0R 㰪`0 S |Pᤪ @ R \@0`80> @7@P Ѝ{<@-0 000 0 000@ᓹPЍ@Ѝ0C-Mp0 000p0 0{PQaV  0RI@P0P X@ЍwP w3pU W @0U@PU0pPpU#Q  @0S P 剨P dT@ Q0S 2, Q<рӀ@0G-M 00 00 0`P@ hKpP L@Ѝx4143P@刀70S S@ u`q tp P@b`TQ  V@u`L@@@ |PUEY W 1S P0ሀ0,Q<Ӏ0"!S/ 00/P /A-L0C@1S`H1P@ATA pq`@00@-0BRUbPEQᆢBDU"XOW[YgP @Pa X g i0Pe Z  0ѧ0XWYPELD  O0P 7P 0  B0P *P  60P P   *0PT P   0PrT P   0PdT P  SzW < 0PY 7  0P0 01 0 100/oX" R0  0/oW" R  0/oY" R_  ᕰ 0X z  z _p@-P@U`0M  PPP  P P 000Ѝp@-@PP4M  P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V P˦P V@P81 00H@P ^@ U ᱦEߍ$_@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  PP P   P0(ЍpE/08!PR/p@-SP@HanP@10D1@A `0p 0 pO-0`SP O0S 0@Q @280SP81^0S ]8@0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00`   0 9UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍOY @ PHD _A-`唀p?`@T|@0C0P@PEP7 0 F0 f021@& 0@@AHD4?@-@( [x@p@-@0Sp 0P R @1S0@1  0S0000p@@-0M?SU1p`0@SPT:4V `P Z@@D@ V@@ S @Ѝ$`嚱V00S @@0` 00=@P@T /@Tt T T 0 d0 Ѝ@00@Ӏp@-@xMP` x w` }P0 xЍpp@-P@xM`x w001`0 0?0$ uxЍpp@-@PaM. w- .g. aލp0p@-MaP. =@P 0@  .@JT@ލpO-A$M>ZL`0R00pPA 0V4U 0S31@0b Xw " 㙋h H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 X-W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[LH1H0S ,1 G[0(0[0뭳H0SP2 v2 02000008`1 01 1R 0  0\-P kP0 4P0 yPL0S g,$ЍP[H0 ^Ԁ{)_@Ӏ0@-P@Pp@-P@P ;Pp:p@-@P \q9000,03/@pp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@wP1QB 1CQ [?0Q Pp@e{ 1R::1Ppn!0Q 0 0!0000\0S: R :SP0C BS000DKP s@t_s@Ă~f s@-@R0 0 0h0庰@Rp@-d0T@`}R0\,0(@P@UwRp0Q/p@-t0@QP d0QcR\0S0010_Rp R0*UR0\0pp~fTf@p@-PU @d0`(0p`h0@Rp/?Rpp_p@-@d0P2Rp#p@0Rp@-P@P(RrUUhupfpA-@Pp ;pR\00tp00@`0R00F= 00'`PP姩媩 @-0 @0 hp$@A\  \ R/ A-0SP(@ `Qhp\ 0R$S$X#P0S0 0 0 0 P0S00 S PPQЍP S QWP\0 JQ  u~P@p@-A@ PQ\0S`V0p@[QpO-50S8QpP Q1 M@P)00夰 0 0(0 婜`@h⮮p#IJXQWKK0 rTSQ%+  `(0300 Ѝ@_0p@-@PᴷP D0R ᆷp`(QU'Q|p p_@- M0@ P  ЍO-P4M`UXp޼PڼP wP  81R H 4Ѝ@PW =U8H0L 0P0S XX0 S'IH0 L0 H0P L RP 0 H0LP ?Tp 0\0X0SPP0PIPdI_ɚ;6e@-@LM`p nP P0U(P~?oU20S  sLЍ B 0  @o/p@-dPp@d"| 00C/(0, | 1R@0@@1B @@VJp{QQ03 0# 1Q10C2q0Cq0CQ0C0C3+C? R0//p@-@pP%p@ {p@-@pPp@{O-M0(0P`p` @膂\$ X $  Oo0z>BP@T$ЍOЍȂ-@-0 000kЍ Ѝ/l_ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlze{{@- P{@-@(V080ҭ(Э@{s@-Pn10@T H?P4庭(Ѝp@t DPЍp{{A-<1P@$"000000D1hPWPUP U D1 _```fh !`F000000000UD!000000D13 !_ 0? R(  U P D00000 h1P  U  _?0S00hPS0C0 0 00`,(P$  Pp;(0 0 0!?0 0 04`0P,(P$ ;1 0 00!? 0 0 04`0,(P$ o;000X1 00 00!*>0 0 04`,(P$ X;1 80 00!?0 00 04`,(P$ B; 0!?0 0 800`,(P$  Pp-;h0 00!X0+N@0'> 0 ,`($ @<08 ;DЍ{l_U0UȂU- B 1011 S!1 0 !q 0$)Ȃ{p@-@PX0U00 00@1B  HpDP{@-@$?0  (@sp@-@P LQ 86Q 1 _? = 0>;0p0<0~|Q hK$p@p@-@P R `c/0000`0001S 0V (wp?{_Ӏ{A-P`p0| @@ @@1B  lAT 4/0 y#P@P {p@-@0P#PP@ cm p\?{@- @$T^{G-DaP@ 88$ 0 4 0 T 4 T ( ,8q U( ,1:00%<$ P - 8 < 8 $ < $  R P @u r oU <0SPTeHb P @14 0 LS 0000?Y$0!D1  L0S81  UP h:P000@1 t1S 3/P0000  P , 9\0+4 V1SSQ   ^li090@W1SSQ D15 0L s yD15D1;6RH L1 S S RP N1SSQ1 e P P p\ p0U P P  l p0D P P V  "@ Z1 S S R ,L 00 S   | 1R"Dy  PX^ U_ H1S I1S J1S* ( U& 0 08C0  :/0H1 S S R  P PEUP#U PE0 S = {l_@1  p@-P@$Mp/{@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`PpA@@ | 1R@ 0@1B @ TPT Q X @{p@-T@p`<?P,00(@@Up{O-0DM S @0 Pp#48@3@(00wD h1 Q/[ , S) d40P[01 0S4`DЍP H3`Vp<0Ya00VX0FS[`0#4 0=0 0PS!RRQ   R V`0# 0 # ?0cR81  TP hv P000@1 t1S 3/P000,"Q8 SQY0=@0T0R@2 @A0.@!B +@)  `qQ =!008  R(00C?2cO 0@CdB$@FSzYL0S800q0)T0S 0  8#`?0 `X1S#V V#VH /S0`PhC0CU P<U D<U50 6B <Q ]k0CQ$0CQ;0S 軟3!1PS ;U;U0CU;+0S00;U %40cS KS V0CSX{T 5P 0 :/zC { P 0  9//:Q ::0S[  S 1 0S [0 !P X N @ F4:P } Ѝ:0AUE 9UPu +1 0R6[03 PP9U9088 0;b9U 0CU 0UiD 10S 0RS&9U 90SQ9U( 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0応Pz k\8U >0Uu >C0CU 0R000U(U d7Un70 S' S007U& |7U0Y_ zP4  Jt I+,70Sd70S  P;H7Uu0pp1S 3/P  L]p8,U|00P0| 0CJ0;PUPPAKXvX:0 0Z - RT 0H0HS ]PP  0D @0D 0P)H8cP ]V!,帝,mz]Z@T T ЍO, Ns%0S ! S ,[0 0S00c0 1 0R[0 0S00\1 0S[  $0|00@1$0\1(0S`1 yd,4U D1 "    2D10D!810 R<1 0;; 0D!"0D1 Rs 8P D12D100FNx Pttg0D!  %<D!0% Q}[z   Q0(03/tE0<0?wP xvoP7 100100@[00[0xgCP$0S ! S-[0* UUpSePP 1 0RPPQ=0 52?P0S ЍOvSF%!UЍO ! Petrtht@t0^t {t,@Bt @utf@F_t€2_Ȁ<_Ct gtӀ\?vtt nt ot st@jt@wt@HtH~ftV_t,_{%_p@-@P0U R  @  @1B  N0pR00|P{H/H!/81 - p@-U1@ C/oS" R 0\ <0 rP 03/pT1 S S R 0<0l1S (Il13/#/#p{/p@-P,0@TppP @/@-@P&D0@PP  80P  R 00 0S{䂀p@-PP L0@T 0S 408 CTT 00 0;p@{@-@P($08 CTT 00C 0@%{A-@gnP/pPP` YpPa00|0p @R 0PQ 00400S  R  0?{|_@-$PP V䂀__@-@XT08 CTT 0S 00S   {/䂀 8080 1l1S 0 0//T 8080 1l1S 040//T 0 601/Tp@-PT T0 601@0003/(60lQ00opT{A-pt`P#@@@ @L0 @ S@P0/@(0,   AR SD1 WCP00C{0 /@-P0 @"6 0<  $0000P0*@eTp@-@Q@ x0`"6 0h Q0000X00X0 0$ 0Hp$p@?TG-0hMS~ 1P!0 & q`됀@@,   XY 0X0 1j@P@  ,Q,#NjhЍ YY 0DY0 hЍGj|0S  @ Z;#@P   i@cT0@@ @hpdRd #A@Px yj@\JT0@@ 0R0T0S.@#@@T{O-p@`x2Pt"0tM & 000L @  I L Rh00 4 Xr 0W#000  ` @P R8m XwLPTdRd #AQ@!@1l%  jPOL @000(CT GT p RdR@1d@#  iP. @ `D!L"$ L\ "P R ((d ( 2/H@D8I(Zr 000 tЍT{G-PH!D1 60q0`}A@ 0@ # | R    X0S  Y0S@ 0@  L0  S  0@ T@  BQSD1  @T Q cY 0^@uT{p@-@p p0 601 R R p@ Ph p04W Up 0PT_{0_p@-@pP0Ep@@{p@-@pP9p@4{A-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @ሺ@W{p@-d0PQ0A TT 0SlA@OoBU $p@T@T|A-q`0S3@ThJ0VT@ PQ,0TS@   R P!+n0@@ 01S`@0PjhhO01S Pb``ֆw0AwTD_|A-P0` VP@P@ x0x0qP"l1S X\@H0@`l1̀S0003/D1;D1@ET{UQp@-4Pp@$0S@@5pT|@-@ $T@ {0|T,sr/p@-Pl0@"6 0\ \ a $J 0$0Bp@T{A-`A0` F@PpPP840101@0@$le 1810<10D1K<@1=`1\1Dl1S000( 0 03/P @ 0oP \PЍ00   b0PP0C0 {T+p@-PP0 601P003/@@dpTO-쑟p3`!1 ر 60P@ @` .1 Q$ L0S1 8pL0SP@T:L`p[V#51 0S [ R@P D [  S P 6@< /#@ X@&T @|tf@dT L0S8@l1S 0 03/@T\?{G-`,$(4 6 0Q4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;mP h3R `3Vl 9>C1CV %@3Vm 0 $p 07/pp{ 0 $ppr0o 2 Rk0S Y`v2V, 1\0CVNh||2V" 0CV 0TR 0 009C0s,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>SxD1S 0 008|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0T`t0Uft_t u wt@{pt tttut 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`@PU VBP0P0 0`p@-@P ރP 0SBՃ000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP j0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0SM  0000`P  BR1 " 0010 0000S000p_O-`QI@p0 S> S 0S4 000 0R*PP P%PEUP i R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [ ,_0PQP/@P - Q^00@S0\3 | X0P/-0^  0CS0\3  |p@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P /-[  \ ݓ@- @ [0  P p Q  Q\L1P!  S[ @ [ @@蛓@@at Ӏp@-`d0@31[  10 PU 8዇0 /@9p@p@-`d0@31[  10 PU 8l0 @p@p@-0@1[  10 PU 0O Q@p@O-DM0P0<0p`<@ @00<0,(p$P PP P`(*<@0 0 0<4,(p$P PP P@`y(DЍ|_7@-@00P000U  Ѝ0@& Ѝ0@-@H$0S 40 S   0 |A-Pᔀ Mf@T fP$ q\TPP` d  5 p0S Ѝ@`|_hr0S/Ä`VA-tp@h0P`V U0PD 0 p@{fPr``| h000@-@AM,P SLA dQ d, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01"PLaPU 0S 3/P j g0$L1H/@-PAM@zU 0SAߍ@, `P Aߍ ``3pP` 70PS 0S , 5d0 L1S0Sp0LQ:03/PU`P   $nHO-MRQB 0,P|ߍO&Q 0S 0 S 0 00L\0$00(0*%벜`P% pߍ00;3@00T 00PS, (0S)pW& 0( S"0$ 00S0 000,0p 0P0 S030#[0Sw  00SC@000=08S 0 0`0223 - P_R0 P 0T000X0@0\00XK 8P0p01 `00' 'QJ  f0S QE b ~f ) 0X 8p> "2 2" 2" 2" -8pᬙTPU000 W >0 =00 =C00Ks 0 0  )0 0 H)00P0001P0100 )00 *0)00 0{)00 +0t)p,˛0S 02($ p΀΀@-8.=0+=0$ ;=@0 5=|@|V,Vp@-` P00P0T0@Tp@D0D.=P0SX@$0S 3/,P|l\?@|p@-h T00T0\0@Tp@L0L 0?0c =P0SX@ 0S 3/,P|l\?gfff0p@-X00@ X  $Rx01X0S 3/P0S P 0S00@ 08 04 0c0p0S 3/,Pl|O-LMD@pl 0R!  0 00,@(p$  `|% 0! 0  D 40@,@(p$  @`h% 0! 0   40,@(p$  @`S%0 000! 0   4,@(p$  @`>% 0!\1P 0@ 0<840@,@(p$ P(% 0!1 0@ 0840,@(p$ P% 0!00 0  0@84,@(p$ P$D0 S @dPd`dpU:T +LЍOP 0"S !@LЍ_}D V__}$P00 !XP/ P/ R/X|l@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P 00%ӕ/_Qp@-@!@3PPP@p0S @-3 6d_p@-P@eP`  H0S p@/p@G-P0P @NP D0S G/p`W 1 !P @TSjPF舐Y B BR !  FjP @W1!V``@- @0P @;p@-PP@p@ u10`S% S S  p@S S_10\ FS! S S 嫖|xS S p@T0P L\ 1 p@ p@O p@__.__L_ __&_I_A-`p@0@TP0SX@0S 3/,PlA-PQpT0@T0 R X@`0S0S  3/,`l,0(0 0#1P! P #/t>,/0@ S /@-$0 @ϻPЍ\G-MⰠ P`p ` @$c0P00SS00-ЍS0 000000@?o2P0SQ $0S S S h 0QQP<0H 80(0$000?}\_,?(?C-釟M|@P` pNp0p $  R0` b2 020202HX00ߍ}Vp@-1@SHP囕L0S0L0 CHLkP UpH@0100p@ ǏCUH  L00L0H0P @0` 嵏T^ p@X0\ /_} 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-$M`0@TLPp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P 0S 3/ 10@l} 0O-DM`'p!< CS P00 0,p(`$  `!3 ?0080 040`,p(`$  !83 ?0 0<0 040,p(`$  !000 0 'Ȣ!0 0 04,p(`$ !0 000'tŸ! 0  0 04,p(`$ ! 0'!2Ÿ 0(0 0 040,p(`$ o!0 000!1 0100 0 4,p(`$ X!0 000!T1 0700 0 4,p(`$ A! 1 0I0 08 0哌NP 0 P@< 册  0|P &R+3'! P<0l  <0$,0DЍO}_^^0?8V,?(?VV0!V,/\_A-@`(pP$!$ Af}P 0 0S/p@-X0PP Lɍ@P 0 H@Q000 0p}@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` 嚍PP0L00H@40 400;\00T0X0}G-0MZj0\ 0pWЍ@L\ T 0E0 0 SP@T 0H0 0E0 0 D p@` `FV`!  =`pG@0_ _M_P/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ0/0\/ APQ /p@-@TPPP@pp$00$/$0S0$0/ 0S00/@-@p@-$PUp@Qp@@-@0 ( 00@Kp@-@q0 0P0 p!R 9100 u_} RA-@P;bS`:pc@P PU0P SA-@P;bS`:p_@P PUl0(PPp@-P GP@ V0@pp@-@PPlTp00 00FS0^ 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 w^0@DJ0000CS0000`VTT`p}O-pPU' `V':S`F' 0$ @P 2V2(0 0C(000(( 0 ` 6P(@PHV@` [@P 0 0l 000 000HLfH0H0`0000+ ]0O-rMP`@0 ``(`0 0`S`F 80000U Vn0  ( R(|pPEWY80 fXp000<)0" 3SH L0SP0\ 0fX, <Pp 0% 3SH0L RP \0  <  0CSS10U 1 !?I0PI00<,00 BX 1U  1+Ip@Pp@ppWm 0j 3SH0L0ScU 0< pP7Ѝ<pP U)0& X븀V0008000T   #RH L R!X B/o" RX0@0C0pfV0 X 1S  0  00HAQ00@0Wp!S  \000P`V PU @P@-P   Ѝ@-0000P7 ЍP/@-rPQp@-t ⺏`P@Pp0 0` U P_@-@P@Ѝ@-  0S  Ѝ0bSG-@9p`PP2 0 0 0  I,b0W`!V`! V `!0 a\0pGI0000CS0000@TWW@xP}O-PR``Ap0PPPM 0@P 2 (`200V [ ^@P P Ѝ00pJWp!fW{  W 1+#  \ @PZP`F R[ 000R000 p}A-0@S" `;(0 S8ʸS C< 0CPHPZP (00 AQ(0000PP 0 ?0W@ [OpP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP e[pA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` `0 QPp000, vVQ@&U #0SPpGW0pUv  :  0 $ P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S000 0 00HLcH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! Z__@-R Ѝ@-L ЍO-0P0tj RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 o0000H 0CS00C R0 0000 Y00C0P0PX 0 YDPB ` Y00C0 00 &000b00r_G-0P ⅌p@P: ;  0 0  000HLYbH0H0`堀VhYPP P  0  0 00HL8bH0H0`KYy@_/-/-/-//-/-/-/@-@b`-@-A-PUp1p!0@W`DS W c cd_PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  ]DXP  XWPp  X`G-4pPPP8 `9@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T !U @ 00040"0P 0  0SI20@T D@DT@0P= Y1V> 1CV VO `@54TC@@ @T @H00@"0` @T,`1@00C?o270 T:0 `T `V4 `V1 SMT` `P @ 0 Io@0@T@#C  b4@@iiip@-@PPPU@` W`Pp Bp@- P`8@|<0P p|@0PppPp@- p_0Pd00S P00pDP<@z~80 @f0D_EFp@-P`0` 0@ 0AT 0S`0S@ 00 0pFEA-@Ppv B, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0`P@@A-P@pC0`,P~VU  AcQG-41p!,10RC*Q`= S PP<*P00 /R0S /TPPo@ i$`Do@ |➁0PP 0,`8$0 Pa{<{@<2$_@P?E_@-@P po00@-@<2l7 0S \0LS   ,P 0RoX@DJoEFp@- 0@0CS`P 040,PP_oRU vpp@?p@-@P 0S 80 31R00 pp@-P40@AT ,TPrp@E@-0 00 0~P Ѝ0A-0SPp` xK@dTPP (0S @? 00 0@PF0@- @P ,0S@uT p ɉЍЍ@V@-@ P$0 0[  GЍs@-` @P)P,0S(0S@ 00S |0 31R@巉4T <00S 冉Ѝp@Ѝp@@07@- k@P@P$0sT@ 0$0(0S > Ѝ0O-@PDM TP^DЍOtQ @A@AP1  @d @88B|4q@0 a H(00<0,$@ @@ @R0 00!00'>< 00,($@@ @< 0\! 0 P0< 0 ,($@@ @*uF PP DЍEFKV__p@-@P8m0 ᒐ@P mp0@-`PP )@BT_P ЍPPp ShQ P0XS   @00C@0C `V40040<V"@FEA-p MaP 3/@P@P 0 (00 0<1R 0@ Ѝ0 @P  Չ0 PQ"03̀1 0yv@BP 0 @0@ 0QPQX   803/@P   P光_DRSPFFE@-00 0 Ѝ@@G-p`0 M 0*@P☉@P  Ѝ0 (00 01R 0 f@ D H03/@P% PhaJP cUZ0~@@000 P @o  j@ FT  .P G`P 00 0SV @x0!0R:H@@1PPS0P1@01@Q900  P_EF@- 0000 00gЍ@A-Mp yP@$`'X``P$P @@$(0V0(0  0"@P  ~@(0T0C(0  ЍW` #@0 0@-@MP ‰P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0@-@ 0)@x>O-Aؐؠ`PUV yx00n뜰0H0P\@P `N@@ p @@Dƨ $`0 ,0 {U \}O-TMP4L0p0L 00RZ(Y`|    "200 \20\2x0S@|0x@3080|00(05<0X008 P z4S @|  $7 +LxTЍ00 ?o2Y0S 9@40SN  <0R0 YFTD0S0ST00à R0S  6|0 3  8 Pa0@0H0Z|0 L 000L0,08L0S 0cs 0`(0 000D4 R8000S3# RQ. $ 0  0 R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6@00 $H@ 0S@@ [fY90 T 3 0{b W p00K *G@C0`H01`80 D)$06D0@0S0叧0$ 0H`\p:XP#:0 P000L L"4040T 00 0C0000 00C00 R0000C0 0SK ,0p`L(00(08pXTY,`C|00001`P LR   Y;( 10R04 D0x 3/0@S000Y1;ò10PL02Y[xY Y p{p [ 0 0 RppR@@TKd K`0[00S  @@4 x04/'@(@#@ @0x0ꘄ\^VI0O-@`'~0q@! !@-@pp@p P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,00d0 0!T!0    !/Hzhzlz@-@Q Ѝ0l  R:` <P#!, i` @!P 00@H 0TD@D0<0RH0G-RpP`0=  ( 08`w  0R<8 P/D @R+ @ BPS@P PׯPP  0H@L 40B300\00T0X00 +W00 uDX0ST0S@L@T@P#_G-`Rp 0 PV T0SPLPT0XP0?w@P  :DUP`(0 0(0@Q`Q@PU70_A-@R0 wp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PB_A-`@PpTXUZ 0000 0RX 0SUG 01QT0S0T0f@U8  R0#&  3SHL0SP0\00<0CR1Q 0C 00080 080@P@0P00@pL@AtR_@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@rQ/T RT 0 0Sbp@-@QL0LPpS00S0T@@0Q 0 00000 p@D!R R0P00p@-PL@Q``U`QV 80v0S0C0000800C80Q 0S L`L0SP0  RpT0pPEL`j_@-@@0S87@-@P1 < @0D0 Ѝ0A-0Xp@P` U[<S !P  P71 S010S0PR 5蠄A-4$P 4p0?RL1S(@8P ,1S 0,1010:01 01`A@P 00000111010044P0P041418181@1@1D1D1H1H1c00 P <00111100!1.01 0.000003/P&f``& 1R 101m@-L@Q0L00P0T0PL0SO-(ppP U [  s@`(5@P U U /PP  H@L BÌ\PTX0(D 000P - G-_@-P `@P   AЍp7@-P@000T Ѝ0+00@s@-X0,`0 ( P@,  l0@00U Ѝpl@-BP0P@-9P/ R/@- @@x@诶A-P`X0@0X0ЍV,@p :l@000W T =l@#@X0, 0X0ms@-P`Q Ql0@00V yЍp1l 00S/XG夶7@-@00P^000U  Ѝ0@[ Ѝ00BSp@-P@`lwPP  $0S0$S0ĕ`p_p@- 0PS`(M  Qw@P- (Ѝp0  ,u@P0V" 0;;0@P R 0  R ! Bx@P  VT `0.0X` `@V@@_XGA-PM`p@r@P 400000 0>@qЍ7@-P)r@P a@q Ѝ0p@-`PV M  V00 R0S@"  q@P0UV ;0@0    s@P Nqq Ѝp@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1010 S;305<0@ T C$ xr= rr $ Wr Sr 00$00,Ѝs@-`Poq@P19@ 00003/@pЍps@-`PTq@P 00403/@pЍp@-pP' c@0P0  ;sP ЍT@ 0 S 1H05 AtPV00  7t_0p@-M00000P0` H@P #0@P PpP pލp@-p PP`IM  r@P0 0000 0@P # 0@P PpP oIߍ@-pP* c@0P0  rP Ѝ RT@ 0PR 0 sPV00  s_p@-0M@P` ' 000 00 00 0 0`4,00002PP #0PP 0Ѝp@-P4M`p jr@P&043,0$0 S0 0 @P$0S 0@ P T @ [s@4Ѝ @P_O-PPlM%  (+r@PnB00S@i8;(8DuP- ( 80,00< (0 @, Q00(0H2 , 000 o@PG0DT@0` S;# p0 @ts0S@( 10@" Hq@P 0冲*S`   @X0 S$0 00  H0P #0@?oV20S@ P TV0`D@ =olЍX0S- 0HL@P H0 Hd0r@P`0`0S 8(,08< SP00@ S00S p $ HA@P P000ɚ;6e_@-@0M 0P 0# ܍@-@0M 0P 0#܍G- pW`P_R/R-U@PP 0L00 H@$ B# \PT0X0Y P*q`P i:W@ W ` 0 R $R ÕP`0311  U`pV 0 0F0ER8f000  R` R__O-MP 0L 4qM Q6 Q(@A:S` R. 4  0$0 8^4 Q Z R7Q=@20SF WP? S P5:8@` p@P @0V RUSЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* [ tT00#T0S  T 0 0$; | {hNU T00S 0@ 0PR0K@@_XGӀA-`MpP m@P 0 0 Ѝ000! @xm0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` oP3`$00 (ЍpO-DM`  m@P0P S;# p0 ts0S 0 P0,m0U@DЍ o0Pⅲ! 8p0P ,0 <0p0PP_-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppO-P0㄰U`!R `VP R@ R R ppG'qZY08/067@-@00P000U  Ѝ0@ Ѝ00R0 0S  0Q 8 _ @- @-p@-@0`PVp@0 `兮ὭCp@p@-@P0S 1`0D0]H]@0L0@0pp@-@P P ]@P'Q@-@}{-p@-@TpP0P R  RpPp@ R   R4&k Q  101p_@-C-@MP]` 0` P 1 p`00@]?]@] ?]l]0S PЍ`]`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @0(00M  XЍpj__p@-P@e Pp00Fp@-@f 000S0S P A-@pP`V Ǭp5Qp0S 0`V-`x` 0S  0S 0SD夬@cA0ެ6P A΀$@-@5p@-0@SP 0S%Q0S 0S PPP0@Pp0S@`&00d jKP p谄_@-@P,J80 S 08  @< @~΀p@-@PpP7 0  p@p(0 S 000$p@-@P 400C40Z p@jp@-@`P׬լ 0 ` ͬp@1M/  \@-  0S 0S00i)/_A-@`pPP 00S0p O-3l@PiīS0S 0S4 3t| {a`V/d```V8Z@0SX`(V p圫(0S 00S 8 R4 S 00S ɫ `&a<08p80彫WtzQpG p&uW`pe    u  B 0 Rᖫ 0 R  4R 8 R D( R`V  1Q   R  @ 0  0 k4i0 @  % $iZ   e(pW0pW  8p  8p0S 0 0@0000002P0ph$`V000 ;_΀\?$΀ V0S p@-0S pP@1` 0 循 0S /O-PM0S@i@0%@e@`0@0  啠p S50`PR 0,0X000`[4$@P @T ,FaPNN0@ሠs@00@0(N@B00@0$0 00D0, @0^@P N\ ST0 0$pcaN@00@0Ѝ @O-pDM@0%@(@0@0P0# 40`P @ T0,00`[4-$@P { '@00@0DЍn0S&@ !^@P`V/=@KN 0R %)@001 0P @`0S $ğ$ 4$0$0@0@01`0D0YHY@0L0@0@0 DDk4@00@0 `@P 00S p@0@ 0  0Su/0O-DMP` '(00lBlrl!0` 0 ,`  84$ pP60(00 ' 00 !0` 0 ,` 84$ P0(00 ' 00,`! 0  840P$ 0 '(00 !,` 0  840P$ P0 (00! 0 ,` 0 040$ P0(00 00!0 ,`0 040$ P Ꭹ&`$@^ 00`@岕P ,fDЍ_V0@-00PSVP`. P0 C  SK010SG @P0S S S @ Ѝ @0R 0 0@0 @0R00 @0R00p0S S S *@@0@ D@@*00S @*@간O-M`00CS@|#0Q0pK$@T 0 Rs $Q Y0 ! ng@P ' 0[T^g(@T R 0P 0p P pY000/ ;-h Y';0} 0000 p0  j  j g  4  B4 :f00Y$@?K0  B^Ѝ@(@P/ VO-@S4MP` 0S 5R0 SppSpWX%C+1#0 000<5!05 O0 0S⣝pP _2   0 01QM 00%; 0S4*# pp 000YT[0 g n@0 L00H@Pp4000 0J00p\0T X 0f[= JH 4Ѝ fP (0SeH pp$  (3( 0,,6*0044l$ 0 00e[ 0SP 0S0S @ p  X@ @ @0 0@0 ]P P" 03/@ eTz  P @0 ,00!0C00!, 0 (00  C@ 0 ( T q 1R0B S8BX P<0S=/ pPH!@0Wp  1Q@0@0  P  03/@ 0 P7}{ 10 10S, )S9z0S S~($d9D?_ __P P// R0@-@d 0  000R  0 /0@-cMPa/Tg@Pcߍ0R@-@ Eg0S R0a/@-@0  R 0  /0@-R@cM P cߍ0a/*hP3,P0S p@-@`P4?Ot 1]P\ps@-P` !@P @-JЍp00 _00 _s@-P`d@P0 @DdЍp@-+IP00%IA-@`p PY@P <N 1W]@\@-P` p @P0 @I Ѝ0@-00 Ѝ _0@-00 Ѝ _s@-P`2d@P @cЍpA-@`p\PN 1\@=\T @@-P` pb @P0 @tI Ѝ0@-00 Ѝ _0@-00 Ѝ _s@-P`c@P @cЍpA-@p`7 P@Ph 1\@/@-P` p @P0 @ I Ѝ0@-00 Ѝ _0@-00 Ѝ _s@-P`c@P @/cЍp@o `P/@-4bd_ 0(V8(00e8`O-QM0 | @ЍЍOQe0R 0 0p hW01h0#0@T_WPUY b\P\PPE0Pb|/P@T d2`VPLb0 @ [030#Z0S@x 235Ph  0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%0U  &H & 'L ')(  fPͣU0S' 00S 0/ m0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#Pl8@GGG0P R0~x/G- P@ U `ἀD`00@0$V0:Ppg 01St堣0 H0L 0 H0P0L T 0P0 T %R0XP5\p5M`Pl0pz__8G0P @-P8P/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz/P 0%%#3/8| `0R 2"-D | 1# H LH RH P LR P Gp@-`P@TQx^0S<@@ @DX  S d A F0SpP!p_Q^_Ȅ8_x>_@-P7310! 08O-3#SLM  㒢 厢1X#0S @@   D Pp9`@$@`3`c 0@@ @0@0`X000 @@ @@00X Y#3 pB࢟ 0(<0Eg V< "0&5I^ V00 S"0  0 ,QlVp{VW0@`p<"[z 02 À $2;L0 ,00Rp((0_,/_hЄ_@G@_XV쇂̄W\V  @-00PA_W85_000U-P @P\^\ l8p@-@cP0  ᛡpVp@-``BBd X 0$000 0T000V0.:p8T00T0p@qP Wp@-@XP`VV 0"00000 00 t00 0pd_!CeGG-p`DRDX($0 S*C X@P8 q000 S p0S M0$ 0C#2 BS*p@TX@( 0`00WW2003 D D>,Ơ à00 0>P0` |@TX 0#0L0R    zV@dV 00 000$0l0 PSp  p p0l U 倠%廠G8$Tp@-40P (a09#900S? 0 0R9ڜ  I S `P 40083/0` =V0 $$CV 0S 1pp@|Q t  | x x |000900000 0S"aVx0p@ WxS0000 |  @|    , 0C1p@9VTGpG8@Gp@-@P屟Op@Gp@-@妟0  Z]<00 06G PU 0 0Ο0p@/0 şp@Vp@輟n_p@-[  P8 l0Sp p p0l X  @P  0,P Hx E4 PllpA d0ic1p0呜 ˜P00G8@-pM(ppP,`@P" 0 "0V060000S0#T20T20SXqP V 0 0 0 ЍV 0 0 0 @- (pP @ P@P $0 |;`P Ѝ`q0@0O-@0@Dp8<P @ P4` TL@P@0 N;`P Ѝ {P L610 k,@``10@0GA-P`pݛ 0Y@P 0 p 0 0(90AcAG0/8202/@o/ 0R:****,//p@-@|P᜛0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@轛H@-P`pAT 0S *~,P A030#A(0000S  ЍA- P$`@ZV Z Q+ aB 0R010 ` #"<0 S(0 1D 0 (00a@00C@0iU *A> 0R010 0A SHH@-@0Md`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4?%0 00000Ѝ@贚H\?HPp@-]@_L &!Pp@ PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0HH?H20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0Y "!Wm0 0NP D!00000  `D!000$YX)0W0WPPU D!@000t @D!@000g >PU D! 00 0D!@000Q80H@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY P D0s: 1sT @@UL 1R" I  .  @ : #:0 1!D+c  0DNL P T \ QD!(00(0 0PP T H>D!000$`V4D!000Y 3T@0@`$D!000HO-`2P 0$MS ao@pH0S; 1s@1I@K 1R" I  .̡  :L #: 0 1!b 0K P D! @(00(0c$ЍA81T ҿ !D!$00$0R2 @ *0.SY Y+0.S (0000S X 0 0CX:00婿"@ *# =@᜿T X0 0000$ D! 00 0HO-Mp80 0 0S:RP0|b00T @ 0 S`0cV`V``V:HZS MWq O` $@ 0 80)0  *" IV Bt P0(  0P0D00`0D0<T a_ʾW 0 W7 .R4 .R1  ! `1 ЍO 0=0AP0 Q L  L 00 L0 Cᛗ*+;!R 01a@ЍHHH?G-`0 S@Papq nZPp` Qq a弾G蹾0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ_@-0)  0GЍ_@- 0  Ѝ_@-@a`0,($@ p@ @`<08 7DЍ耈_,/p@-@Pp0SpP`0S  ! GQPUQ 0L 0000 0C0p0S  ! Gxp@-@TpP`Pz$ 04R00 0 YG00p耈hp@-` @PT E@ 0 S0S 0R00 0 0 ,000R 0P0@&@ph@-@ޔ0 0C0@hO-`40@SPp0E  0S>Q  0RP?S 0 ! 'G 0 0S 1z⪔100P+tEp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 0 0 9CR:0S 0xhA-@p`PUdd0E0Pp `P00S 0 000$ 000 00PxA-@ `PX00pQQ0S0 R\S  ! 0< 0C0 00C 00 0C0 0pA_p@-@0PS`"00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`Q8O8X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 8U  8 8Cߍ870 <P@@p@@0$ p@W`<0S J@T P$<  H@Pp81X10  hH@P oJ0 0 :800<024 @00D04yG@[J T Xf p0 W|00 06 <@P 7 0 H%,,H0pLXp\ (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* $ I i6 @T($0S C$ /  C;701 P0CVS @@01ڀp41p@H X<T(  UG@P" I0CW Iꔊ _@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@6`F F !p$@ Y0TC0@0 |@ ᣹T0 F T@5$ЍC-P`M0F000Fp00 0\@P t@Ѝ0 C /  C07s0 0pB@6T8 1 !S X p  P000`F 00 p@-@,(0 R @0@,p@-@TP00S@ S @R 000pp@-P8ʑ40@Tp@0S 3/@pA-@`Tp᳑H0PU4 0S  3/@PPp B@-  Q &Q  7FP-/p@-@@P0S0 0S!0Sp00Q!5` 00`00Q \R H  (M< O C0\S46_Y__=_p@-P@@0Sp0400P 0S!!//O-Q48 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00H;_ $Hp@- 0@ 0PP 0p0P00p@-P@ `;APp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P :10P@41O-PMU@  #DPC R& R#     TP 1T R@ 1P@**P W *pW`/oU" R 5 0Ѝ `P  0j*V O-p2`M0 @U Q Q 20S@0000-   R  5P Q P``( c0 P N/0P I/0001$p@ñ`0V  x.`C0 /RI 0S  0 0 ` 0 0S :/0 P 5/0P 0/0000S =P  `pR0"  ! P !PS  0 0 T1P 0 S !" 00 `Sv r 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S .0S00T0.0 X.0T0S P X  Q   P S0S s.X.0 0000000S 0CSg| G 0 00 00C08+  Q~  00x0d0 p0vPm pP\0 00 c03Sa d A.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S .0 00000,00SQ 0N <0< (000000,00(,0(H0(0b0S .P 0p0p00S 0  0UG U- .d岰[/ -TP0S p00Sp吰[ .P 0 pP0  .P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU nS-zX0 0T00 0S 0S0'0-00 0S S0S a- t-0 00000[S009   R S R S0C- 0T00US0S 0S0?0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d !2 000 40@ U=P ?-B 9,\0 p00['`0\pp0`Pt`P 40p  R? ?X ,ꀀx,80Sh50S 1@0,80/P$0 `@R0 r {R`" /U  0X P@0凯  0 S o*000/U  ` `0/P$000N0}P 0X0S 0/U00S 0S*0S 0P0 SC*/U 0  L00/P 00`$0L0 /UZ Z2* 0S/ P) 0 S*/U  `0 00 /P$ X$ R  $0$0{+ 0 0 S:s+?//U  X X 0S PP 0 S */U 000 ` |s/U X X 0S `gP @0 1 . 0 S */U 00/U [ [* 0S IP 0 S *000/U  @ `6/U [ [* 0S x*Ph1 0 S*0/UP #<1 `00g/U[ [* 0S  P  0 S L0g*/U00 000#/U4[V P1?8470 d/C 0 S 00J*/U deꔊXG_ _@____HH____;__GG_______[ * 0S /U X @P860\  dB 0 S */U00[* 0S /U X X 0S P76@ }U0 { /P 0R00Ǘ 0  0   {O* 04 0 00/S#+ 00S0 00 .R  .R0/S0 0 00$+40 0 /R" 0 T0+0 00S* 0 00`pd0  P0p0gP 0  }  { -4 0 0 0 00C0S *wT00 0X  900S00@TP *T@T0 0X00(0S ,0Ѝ*6*Q** R 0CSP S0S *X*0 00000*00 RX R/=0S0 X R i/a>P: X 0S /U[ tP65:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@. P?Pq/ `PPkP(! ,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0)0 0PS x<00U0S R 0S ,0  0 PP )U`V ,0 .``4ЍA- 00S : B0pP`W900@   0S P )@00WP@m.@P t) _& _ 0@-@DMP\, 0\ 0\ 0\P  B 00 05T4@P00DЍ0@ D _A-P`pO@P P 0 P10 A-P`pF@P0 @Ѝ0 G-P`ሀ#pᚄ@0T00/ 0P0T̄剄(P „@ /,PV  6/P 00S0P00P0姄)P07@- 0P @P  V*@ Ѝ0 _p@-P`@`` TP@@ @0 !!|0x0t0l000, !  ! 40 r@Pj> _HzhzlzZ _ _ 0 Cx0Cx0(Cxp@-P`6  &0P0P0P@0 `0 4]0 0@0D呂pIxA-PpH0`V偂@ @Ph`d0l0d0rPP @ 00 N/ V?U 0WI=.$P@I0(Cx 0 (Cx0 (Cx0@-0MS@PV@P@ 0  tVP V@P@ B]&Ѝ00@-@P0VP0S# S  Ѝ0`H @P qp  0P 8`5&VUP0 P (`@0@ R/"A-P`@ ⣁0Q30Dp6@0@ᒁ 0ShˁAqAXAŁ Q TQ1@010xIp@-P%000@ 00d,0$ R @@0@噁@pIx@-@P V0N R$ 0 允@$IxJs@-P`@P !0R!0RЍpA-`p@PPЍT$ P*R0*T @A-sMPx% P P8 P L<@,@3 sr* 0" ">2qp>R P7* 95@7T <Ѝ@2PD `P' PPf D0SO@ 3/@d00Cd0T\7`dPK0 (b90d00d0 @Pa J>厀PU D0SK d00d0€D03/@~d0T0Cd0<t?峀U|p0S2h媀Vd `:=0S # 0!P 8#0 000b0A`8@#p!PP  jPS10SZ L R$[ U U~@000 U # 00 U # 00@u Z #Y #XY쐟0U# # 00 i#0HV P l#00 P0400&V$-"_"_Ӏ@Ӏxp@-P`~\0@T Q   4 p@[" R R @IxG-@(pP3 P000~`@00A  0'00& PP( 0@`000`A`0~WW "0P440TPP !PP 0~0`0V0PW3pW <4<"V ""_"_7@-`0P @P  P 8N?U.0 V? \< Ѝ0x"_O-pP`0M⁩Ё @P Є c P N?U.0 V?A7<p V  lV9V T9[ H9@PP Ѝx#_#_;#_L#_@-@9 @z#_@-$0C00S@Zd0P0S R0 R 0S 0S/00x@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00|Ѝ@- 0 0tЍ@- 0 0lЍ@- 0 0dЍ@- 0 0\Ѝp@-@H0  9PH0 0S010H00A PA00Q00@@@p蘊"0O-DM@00(00p0 -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<K!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,< !,,P0< (@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0+@P+X@P$0`800 @4`0  <F@P 0$S@0S 0R@4  @$!$XPTHЍp@4 $ 0PI P/ _ _@-; 000c0 Ѝ@- 0;0 00Ѝ0 c  0c000@-DM 4@P$P0@,P00004@P 0S00,V 0P  P @DЍ0  ,!@P ,=  0c G0D0 c?@-0S@`@P"(0P @ 0,Q@ 0P000 1/@'ЍpC-pM`(PP 0' @Ѝ 0,Q !!1/@P aQ@@'00@-MA0 0@QЍ0C-pM`'PP 0' @Ѝ 0,Q !!1/@P (R@@'00@-MA0 0@~RЍ0C-SDM@`p.  E_U_`Q@P#00P,@@0|Q4 <P 4P@T WDЍV@ `c ,@P !@0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00Ph4@P @ЍpP`@ @-0 c Ѝ0@-MPP @@0cP r*Ѝ00@-MPP @0cP a*Ѝ00@- 0MP00P0#@3P M*Ѝ0@00@- 00 cZ Ѝ@- 00R Ѝs@-P@0` D@P u@B Ѝp _@-P`&@P 0 p`@t& Ѝs@-P@0` @P J@ Ѝp _s@-P0` D0D0 0@P B@ Ѝp _ _0@-0 c Ѝs@-P`~&@P0 %@*&Ѝp@- 00 Ѝs@-P@0` @P  @ Ѝp _@-P$0` L0L0 0t@P@0 )@ Ѝp _ _0@-000 c Ѝ@-PH0` @P00 0@ Ѝp _@-P` &@P @0@%Ѝp@-00 00 Ѝ@-P` %@P 0 00@%Ѝp@-PD0` D@P@0 @ V Ѝp _@-PH0` .@P00 0@ ? Ѝp _G-M0`@S11\p @T,0s_$ 0s0Sp 0PPp?X!(PPP 0 SP? P0UPP(b0 s` 0 s pUZ0!(003PW  0S  'PP Ѝ 0sP0PP _ _p@-PM`,%@P @0 @0c0 f@$Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S ($'P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` $@P @0  00@`$Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ 5@P!4@Pi #!K@ Ѝp _p@-P@D$0P @ 0<Q-@ 1/@$pp@-PMS$@P0L` 0 0 "@m#ЍpG-PM4$@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  @.#Ѝ@p@-PM#@P0L`` 0 0 @ #Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp#@P 0 @ 0 @@P0 0@0@0S 0 ٝ00.#ЍXG@-,0@31!$ \p@-P`Mt  &@Tb0@&0S00P0@PЍp07@-<P @P@ Ѝ0 _O- ` 0M&J0 S1 0C 0 p #@P 0  @ PT 0S@  0 Z@0"@Ѝ@G- `@ 0p%J0!S B   "@P 0  @ PPV 0S@  08@ "Ѝ@@-@(c$0S( ( (0$ @ dI@-@, ;0c,0$ @R$$ ((0cIĊ0S ( #P QS//p@-@pc 0S0\P 0 =#0Sp Q R$0+'IĊȊԊ0@-@ 0 #@cĊI00CS0/@-@P $ 600C0@ Ċ0M, 0S*00Ѝ/Ċp@-Pp0 0AT 0S P 0SP@p0S00   @ĊA-p䀟3AT  c`PYc0S @000McPU PPhcX0 $3`U3@103 P000 @IĊL031S  R R0SQ 0/A-`@P 0S00p"P P 00 ""V DbP 0$0 bDIȊ0@-0@M@P b b,))"0h 0 \ \0  00  , $0  Ѝ0IĊ*)_WW4?1S/p@-P`tbbAT`b\@Q p0S `` ```@` $CIĊA-p` P0@PP0PpPP$0b 0 0! AhbIĊp@-P@`b0P 0 1S 01  0S 0 0000p@FbIĊ . + (G-PP0S0C04q0S ʰ!0SB !a00^Gb`a3}?@T bV @ $` R   R  R R R A 0S  B 00 0003``}?00G!ĊIԊ@-P0S003@oѠ@-P003@oG-`P@# PpW@ Ѐpa `!@TW% V@ @00@P Wt`a0U 0S  3R  P $@030ĊIԊȊ@-K0@-E@haJp@-00S-@ `P4@P V\ aP#@a@P (Kap@@ @lJA-@t`p`0@00L2aPp `E0S0P0P0`IA-@`p`P|a,@TXIT0S0 R @S    LIG-0 PP;0`0S5P $10S00@S00 T 0S' u ` 0S00`pW`0;00S0C0: 0S [ po`0h0X`LP00K 0 3/`Pp0? lIԊȊ7@-P0P00@1S  DP)T Ѝ0@-@- vRA-@`PPp&VP,H035@A0슂0P R0 5/p@-0@S`L X`0SP P Q  - `0SPE 00@0@@U04 @ V @ 08⓷U@P@ 0R08<⇷0S  B2@ S * p00Sd% 3 @0T"#!yp@,_0@(00PpV@JJ슂H?\?Mb?)_@-@_200CS4a` ⌆v6@00@ l슂p@-@@P0SSpP@-@ P BT@DpP P p@-0 l.@- M_0p P06T@Pp0P00 00""00,p슂̹^F)_Jp@-PX0t p0ATp 0R 0R/P @슂G- P@r nU `ἀD`t00@0$V0:Pp^p01St7_0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P0pL)_S)_슂K0P/- R  0 RP <04Q0 4R/00C-@2 TMc刀pn0S @9500^包^H0   . b?H0<9H0^х 00@SP P0S r^ -P^c0 000P T BP 80S ;40789/0 00CS`3#-`P !0SP `0S h`&^0t p 1S01  0S00T^0U  ^p0 0000A^0DP00]TЍKd)_슂plP0M0Ѝ/O-@`P㨃娓娣Mp 0R0S P001 U V ^]oPP ]B`P00 ! PC' [P X0S "e0S&U V ]]`P00P1S  EP'UQUc \0RS~ЍL 3S00SV 1P ]b]V P GV `P0 0 0oH0 0 U ̈́P}]19]PYH0   . b?+H0Z S;@Jp@-T0P0LS  BBC+ZP űp@aZ 0 ؘH?@J)_O-0M P0 0 K Z P`P 0S8ZY3ZEP p`;|*ZpP5~PĐȠ@PY P,8!t0p 0AZ0 (p 07/pP` Y0t p 1S01  0S00ЍT 50 000h4Y00Y \YYK슂G-04P0ph`PP 0  0 @ ,` 06/`P jYlЍ0S pZY P"0t p0p! AY0 000 FL>Y L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVYS 0S [ YT 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000 00UP48<40=  , L06   03 00SpP * P RP[P2 PV UG@j0@01[D00, 00@0P ;y[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P KSX  X S, 0P0[P0L P P@ 0&@ P -OY 1PZ- 1y 000 20 p@-PP@`e RX00CX03S oPKp O-,M\@`ကP`dpP>0 0%!X0ЍS`!3 =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡@-TV@Gߍ _@-PGM`p0 @P\0 @P 000 @-TV@Gߍ _@-PGM`p0 @P7 @P0@] 000 @ -TV@GߍA-`0 Mp }@P'`00 0@PppU0PV0 `F000pP P@p!00q-TV@ Ѝ _A-`0 Mp E@P'`00 0@PppU0PV0 `F000pP P@p!009-TV@ Ѝ _G-P M @P)0 000 @PV0`W0 pG00 0xP P@!005 -TV@ Ѝp@-PBM`0 @PP0 @P 0  @-TV@Bߍp _p@-PBM`0 @PP0 @P p0 @-TV@Bߍp _p@-PBM`0 @P( @P 0@N0 @ -TV@Bߍpp@-P`!0CS@VPp0Pp 00p@-@PL0 "p@6Lp@-@PK00PP*Lp0@-P0M 0 0P@P0 03/@Ѝ0*_@-000 03/Ѝ*_@-000 03/Ѝ*_@-M0<00  3/@PЍ+_@-M@000  3/@PЍ0+_@-4000 03/@P~ЍL+_0@-0M00 03/@{TP PkK<0 0R 0!KЍ0h+_p@-000 03/Ѝ+_@-000 $03/Ѝ+_@-000 (03/Ѝ+_C-0M p08@P% 0"sr`@ P`#K $^K0 ,03/VP T 0"Y0 3:UЍ`+_@-M@0000  3/@PЍ+_C-M P 0@P @ 0 `J $pK@0403/ 0P Y` X0#3Ѝp`,_@-( "!0 803/Ѝ,,_@-( "!0 <03/ЍH,_@- 000 @03/Ѝd,_@- 000 D03/Ѝ,_0@-P0M 0 0PT@P0 H03/@sЍ0,_0@-P0M 0 0P<@P0 L03/@[Ѝ0,_@- 0 00P03/Ѝ,_0@-T0M0 0 P @P0T03/@6Ѝ0,_-00$M0"!#!0 X03/$Ѝ -_0@-,M\!#!@0 00P @P0\03/@ ,Ѝ0(-_0@-@0M  PP 000`03/@PU 0IT 0{ 0JЍ0D-_@-@000 d03/@PЍ`-_0@-,M080\ 0<0 $0 0P @P0 h03/@,Ѝ0|-_@-M@00l0  3/@PЍ-_0@-@0M PP 0 p03/@PrU 0sIT0 0IЍ0-_@-M 0400 t03/@PNЍ-_-$M0(000,0 00 x03/$Ѝ-_@-000 |03/Ѝ._0@-P0M 0 0P@P0 03/@!Ѝ0$._@- 0 0003/Ѝ@._@-000 03/ Ѝ\._p@-x0M` 00P  00 @P 0 03/0@P Ѝpx._7@-00P00 03/@ Ѝ0._0@-,M!80\ 0<00@0P 00 @P003/@,Ѝ0._@- 0 0003/Ѝ._0@-L0M 00P x@P003/@Ѝ0._@-000 03/ Ѝ/_@-000 03/Ѝ /_@- 000 03/ЍU 0S 7_7_1 011M/ ⶉG-`@ PpY0S 0030S00%0 `#tr=; .`0 00CS00 00CS0@-0@0S(J0 0 DB7_7_7_p@-Q@`pP 0S R0C BS0(0,1 @V p0( ,0Q0@@ Q0Ls 0@ 0 0@-0@0 "D]D@O-TM `@(0|0 00pS0p0 @ "1/0@zS 0000 $0 00( [D00 X 0 SCT00T0%Dl R x0 p000 $00X3p #H3PL0R0 70  0# "00#00000p( 0c,0y 07B, 0SB[CQ0 [3$0800H00<00$0 P9 0 00M 0S- 0\r \dXBXVʀ 0! $ 0    !03/ 0!d!0    ! TЍ8$00 @,3<0S ZHL 0rq R x $0B 㼹$0   pJZ  ([W  Z  R 00崢 000 G40ˡ040$ B, $04 L@W b4LBH PX@Q@0L <8@X#< M$0$HzhzlzO-$pM@0L0?o2D00@ 0Zp0500#40040 80S200#809$0H000  B CX 00SjЍD0S00<00(0`0 0` 0$000P00  01/0 0, 6 ?R 01/0 6?Q 000Si(0S `0S (0( 408 03/({0000 0 00SZoQ00 0S 3/00SD ZC K 0000 00 0 0"P D P C 10Cs0 S0 !p0R00S/o" @ 0Q0EsᔼPᒼ@0SZi0 S 00˟ 0#0S !ϠUN  P b B  , PP/P P/P 0>^0PSP 0PU,0%V Z1 S\0<b0P0 A!:00(0S#0(0AgAX 408  (0(\*40X803/P  0R \2$0S40S  h"R 0$0S  0R \} 0 V,0"&0:808 01<0D0 000<0000 0B 0P $0Se <h<< l0& $0ST P<` 0P0 0彻0S8 00l08 Poo 0bp @4\  0P$0S* 00, PYV`` 0U`V <\ 偷00D0 0000000,00P $0S =h0`@00@PS 000 $0 P0<731|0L0S  0PX0 @00`V,0P0U`PY0 `N@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 I P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ  L0S4 00S @XT0X00S 40S 0| d0  d / ,01/P4g@0Sg$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C T40St 3^P0x >0 PS 0%VZf0H 40U g0T0tPx`F)0 0, RS00V00S000 - 00 EE 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 000X 0##@0 080UDWY 0@ & 0  TP0SfP)۶3 0D0 0p0 ᴹP Ჹ 0<!$0SL3 L00 fX ifw$0S0`0~ Wl9_qOO-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,00`S P00 0 >H0  d0S]?W ,0S 408 03/fPEߍW5@12 0 SpPP) ff`눀X `,0 0e 0p,08P @1 40/0\3/PP 0 0ᵱ$0( 0` @1]V` @1 0S 00<0 ⑸0@`D800 0 0ҸPP "$R( 0XP ⁸^>X H0  0S0000 0S 3/H0  kP d0SeL0+ gH`t>i&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0~P (`,Qee~#d 0`! 0  D1 SD1P P0  S 00(`,S Xj jt$[(0 T0,0X0040 u%X `X 80` 0S4`080c%8`rP @ x% 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000]d[ `x0 A !d` B[x0x0   ۳> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`000 d `0 0`0`0 \0`0S"X# d (`,0C6`ïxd0` x0P 05/PBdU 0xP`0dx0X m@0PD0  $0P(0 R \0S  R ״ ᢴ `40S  $  <0 0 ST ὴ ᛴ ״0 S\ 101T0S@` T0S gc$l9_9_L#@-0 000! Ѝ 0  /A-@0MPb ἷ,0F00 00vЍqOA-@0MPb ᣷,0F00 00]ЍqOO-$@ @` pLM 00 0 00 0 0@ 0AOoBBLЍ06 ?\0c@@c|13100 000 ` 0`pc O0S@宷cQ(T ᚵ1 0@  @& (  6, ?(#<@$8s 0(@P8 R  qT 0@ 0 0k̳ᛳس`G-@0(MP3 聓0bFa@Ѝ @7 0;T0 0T0; E0000 0$@ b62< RW1Q00Wrp @0((ЍO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+pb0 @20>00 0  .p0 P(0 S00 ,404P1~pp p,00 00pG<010801 1!&WK8 |1 0(0` 000 :#: 000 8 0 屎 ,XE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H < 04 H\l9_x>L#PnXp@-@P:0 p@:G-P`$0@p3/@PZ@00@800 4/@P 40T00S vmVx P P$03/@P P 0Sf P @0S|00S@0SP 00L0D 8/PP H0U00S @9@ 0W4 V4 P 0S t P 0P l 0S0S PP 0S P P b<0 P0Ѝ0P PPSSA-`Pp@ T ;W 5AO-P @`TU  !T 0 0 06/@ ЍG-销@0H?oP20p`PS V TXTYGO-DM,00000l h 0 @P QPሠ$0 3/@PF`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Ux X880 R R<`VS <`0S0S VV8=<P @84DЍ8pW0S@; x0S@7 U l0 0Rl0  @P*   03/@P0 @t 4/ 0tPp @P 000,0p 0@ 0 t4/@L00SF0 80S @@400 @ 0 t4/@P40S,80 0,0B 0<0 0p0@000l0P0 0 #P`@p 8p40<`S0 `p@4P Tt o<0 0p0 000l0@080 0,000V9`@ 0  4/@P`t0 @ 4/ 0Ptp+0@t@P000p00l0` 0,0 0@ 0t4/@Po00 00g 0R S@`@ 0 t4/PB@VS@RA-P `@0pZ0S 0RW 0KT0S A0@0@-P @ \ 00 0O-pM0<0P0H00P0 8`@DL 0{@P& W0V04 P0Y04  0 ЍO  ^P0S UP @Ѝ /A-@` Pp?P W $0 Aj<@- 00 00! 0!""##$$ ᐾ@-s77Qp@-@ Q  8PPpp@p9_Qp@-@ @Q\0@$0@0$0ppPE7$@7Tp\0$00$0$@Qp@-@ @Q  ppP+7 0"e7 0"p@-Q@pP @Q @p7d 0$ 0S (0, 0@@D7d 0$ 0S (00, @@p 0S/S 0 / E/0S//0S-/@-9_//@- G-`@0S 00s  r Pl 0 r 0 pW S S W  P UȀ-  //@-0  @-   +^  W^o    ]h]/@- ]@- 0   ^  3^o    ]D]@- ]@-@M9^P-^P/@-0]p@-@P]@p]  ? Ra0 ? /0S S S00 /$0@-h0p09_9_:_\\]?]]A-`p@ PP @A=: <900   P1 @0<3@0<O-@`Mw0;*}.0゠d 0{P"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H" @ ` 0P2 S n2@`{?  !2@T`0!!:#@T`0!!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @ß0< 弟 ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@ұQ<0S00$00V (`嘀?`aV $'0#$+4zP W8P< * 㲱%!  (⏹$0 F V (00100 @ D@-0@00$00၉Pp@-@P`R/RPP`䯯 0Pp@-@ (0!( :@ @-0@k0!80@(A-P?@ `!tpR( W\00\0  WX00X0%0S`00S 3/050(A-@`PP p(׸(p@-0@pPr(ۦ@(Tp@-0PS@p 30x 0000ѷ\*`S(0 $A&⦸(0@+ Ѝ@׈=_=_0/G-P`t@4(U 1P0儸呦0SGd(0S0p SڬP嬐UPP jO(03/ ( Z#Z P &ZT00C0Z $002('p@-@PPpp@p@-@P'00P 00$00jAp@ (O-M00pQ  (@`TB  0  : 0 3Kt 0U0Ѝ0 @00D0 0(ڝ 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  ᰷p`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/cE/⨰p20S%0 700嶸`P1 TT *600 0!00 @`070%f 0R88@9S}E/a@%P` & }`%0$0> 0S`: 0⍣`P3`%@T  00%T{ xT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp -ʛ!%6000!0 0pP Pt` l}(0S00 3/Pw0%  (ЍG0 (p(P  Wpt UPT<$',P * 8SЍR 0030#  P0l 0$0 "ǃ Q0* 0 (a =_=_=_ >_@>_O-@ᄠ?t`pP Q4$0SU`V` $ Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU/A-@PnKkKG-`pn@A0P ኴ`PO00k)[$01$av0  Ꭸ 0 ረ屢  0 7t6$ x00Cx00S  . th$壢cTqK 0!400eK$ K->_>_?_A-@|`8 Px X0 0 1@01?::0 5:1<,Q@p``  0"Wp0Gt0A 0A-P@᠀妪0 )P`tp#lJdP K#䐪 ᯳##᫪00?_ ̅G-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC جPTP1#pA?_O-M`8, FtF, R 0SS  !< FZ Y cF PZ)8ἐ0(, P, P@嘁FU Ox0P0Cx00S  .  =廝$2FV⨔PP$  $"F 0 4QsF$x0 P0Cx00S  . W 吝$F+@`ت0 SX0000Dѥ Rw嘔Pt?_hX̅?_?_?_A-@`@EPp吀0T*0QU P \P0VP (FU Ak@脌A-0MP00p 00!t0  00 |@T`x00Ѝ0SP* g (v 8F000 v*, v (⛣`lV 00 0@G-PpSE@᠐0U:ET 0aV X ϧP T  0 Pဒ@ꄌ?_G-@pPE@ T:toE@aV X 0埧P^,]E@T@@᫓ꄌp@-PD@DP0Sp@0EE0Q 0S @ꄌ,@_A-@PD DeP 4PP  D`PPpU:AEQ  R 00 00 0P S $]ꄌ̅6@_Y@_h_\_|@_<1L0S/0@-@(QM D P  > ᘣ P P .DЍ0  P R PU 03/P Q P (P̅@_@_ A_;A_bA_O-M 0Php9l`V7 `l`@`p0 0mT*  |60008000<0@@$0 00(,800<0 _ {@  Vl00Cl0  @Ѝ  01@O-@p04PC܀0U:4DT ሒ Ѝ0aV! R 季 [P 0WSIZY T ᙣ喣  P@ꄌA_p@-@l=PdT`0$4SS @pDD$@P P 0@9>_>_̅ 0`( "4`#/O-M (90000 02PPs00  4+40#400$4"4 8#x#<00p4 8 40 80 < 0 0`$4"40#4 0 0$4"4 0#4 0 04 8 4 0 8 00 $4"48#8=S1=#*408#8 S&:3[ W0!<30C(r* 00r!0CR0C Z V @lP0@[' H|ЍA 0P4 8 c 40 8 00 $4"40#4 00$4"40#400000$PP 4!404"4074 1 P.PT+TX(X\%\`"`ddhhllppt1tQ00 0rP1 M0rPl1HP1 \PH!4"4!14"4!14"41 $0$Q 0RP (ۑ0 s s  8  s(PP0T8  p?P 0 ,00P6ERA_PMA_A_$B_gB_O-Xp@wuM} X0p`#00 0?PP+0P X%0P P" R R0tX8⑂&  H3, T 00S 3P5{uߍPX X3 : ,4L HZ\PGS {3 0aPEl}`X P L0 l:0 ,qPP  e0#t Pp 0⇓ 1 ୫PpX $& 0ہ& Xׁ  0 P70!*" r r(0, 0 0S 1!3S$ 6~?.0S S*Q #?0000. [ A00 Z Xr P 6XP.  Q#?0000Q 00 yr Xur PhX0 qR 000X0008fPd B_B_C_;C_oC_C_C_D_7E_iE_T0Tp@- 60@4@P P0S@@DpȪA-@Pf/pI<(00`S3 #01 1@ ##:!#0<,8  !q00 q0 H0<0 0008|0X``00``k8 (0 0<0`0,0$0@000(040,0AȪE_WEVG-1( @"6 0ȍPP 0S00G z꤀s $0 BR0 08 pRvW00 BR`!`1P௩0W  '*ᦩ00C0ȪA-` P &0)`|@P@ |p. UT00T0  UP00P0%0SX0 ]@YDPr@P᣼JȪG-`<1@-0@ ($P@FȪDNF_0!L0 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 pwP$ pO-p@ 6 0o RQc 0Q0000C000 Sc0 0`S 0n`S @PP HZ%ZeX!4!  0 E1`  . 9 0`S:#::cSP!P10S  gP  0S00 Ѝ0S 0S00 ,0 Q #F_@KDK\p@-l` d0 j@H0P*04,PU  0@jpx>@K\DK0 60S#3//0 R@#0 Q /R0h0//L^0( #&0  R /nE/00S/კG-`g0 00000PE@P< 0 @@@@;p ۹P@TT ,n͹Y ЍG T1# W@PW01H !WP0 [CP @Ѝ4!  \ / E: I$G_$0 0!0 00 /Hzhzlz0S  0 00/p@-|0pPd3@1`000/(0, 6Q 0/(0, S @@Vp@-@0 00R 0(0,000@p@-P`;@P @ `T`0S $0CS@ R(08 8@@p@p@-PU @`00p`h0PppG_p@-@pPpPp@p@-@P`d0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $sUŸp0@p@-40@SP 4?3\0,0S S 00 008@Tp`0 6/@@p@-@P` r塠 0P6 #::0t $00000@0`0: 0pG_A-Pp@3A`1`00 0S60S50S 0S E`LP Q 50S0 xv050@,Y@-@BD0S MP$@@-@50S0500S @A- pPPF9@0(0@P<1``00ex@vPl KPPPPPPPPlPlB< 00 0`S 0 , `o 0@6PЍ87Y@G_H_@-(@,000S S 0 TDP 0S Ѝ@LЍ-\M0000Q 0S 3/\Ѝ G-`1@p31`00 e 0RP[50Sxu0550Io멒B R  00 0S#P< 0 0 0  P0 0000&6Q  R  R   0 0  lpPP #P 0SPU  P P  0O-DM!0p`hA0 <0 0,p(`$  @P<5^<0 SE 40p0 ,01  00!0 0D0000'>0(` 0$ ^<040p0 ,00!0 0O0 0 0(`$ ^<040p0 ,00!H0U@ 0  0(`$ @]DЍG_p|5Y4Y2YO-QdM@0 | PdЍdЍOQ]Q0 00000`0 PPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H  k X  P `J@ GrpT @DP@O-造Mx@P` p0` D00l ?,1 0(10$10 1H00X,Y 1?o2P0SЍ@h9YC-M 0P`` @|p0 P 00 00 0 0@Y?o2P0S  BP Ѝpp@-@P-@T $@DT\dTpP 60S(@0 (0 0IP@WH_8YA-0pP@TU,`T`1 ᶜ@DP0H_D0S/0@-0 H ЍA-@dp`P0S$0C(@@ R (0S $0CS `PA@H_p@-@P T-p\P Y@*<0@ @o$ } p@G_LKt荂@-<0DT 0 !0  !0@- ! 0 !A-@`XpPU 00`0S 0U0  03/X?荂p@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#2127@T q 0"0#!"4Ѝ00 030 ^Zb`P0S @D R 2x# P1  PT  C\0 : ;0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ :07>?00A0Q01 0˕P00 R : :  P( U 0S40S <81  00000C0( @D0P0*[>(  2 80S 40S 0 @PU 0 @PP220:00lp\ 7/U P @p03/LKlG_@ZXA-P4&,a @T @DT@T $@DTAU0S 0SIF@0S&$008P0(00S MpP ZG<{080v00=(@@LKO-@$Mp,00@T P8b8@DT$ЍL <0RVSM (]固0 0 0 妺 H0P: Ua000PPPEA0 0 0 劺W  0R H/  0 S$ 0S,Z0 0 0 eP0 0 @T @DS00 6P5Hoᨂ0 pQLa :/0X0 y@MbA-@p `PBM 2SJ@ @(@0 0@S  ⑅02 100 0 0P`5Bߍ6Y@-0  Q:0 0(0 0QS Q   Ѝ[6Y00@-AM@0 0 0 0P00! ! 0@呙 CW >0W >C 0CW H4ЍO$8$(0 S008(0 Sx007W 0Wn 0S 00`7W:> W^ 0S  ~`l7W  ;CW0CW5C 7C0C87WA H4ЍO6W` 97W >C0CW/`䖟 W 6W'`VfX! 0 W0@P0X  &0`W`ppZxP$V  V L,6W! 17W 6W[ 000 RV 5pW $pGW`5W 00A ? 0S0Sx%0 R01 5:S 000k i ` XX  ᳯ `>P ᫯P `~00m FA f 0S9 4 R6`P0400 R0S 0 S `00  0x  ` 0 (00pW $pG`Ps  0S R0P  WS R (PU $PEU`4pt000IW  P040 ^ 0 B R`+0 E0 0A0CS…Q%X1 `P,0(S(0SP P`` 7`*T 0S S "000(pY1X*,1`{@?P 01 1z P 0S 0 00( , 0 !(00,00z060w000s8000S080l<00S<0e0@0b@0 0D0wt@HpB@~B f@pB\?X?zB@LKoB@|B@oB@xG_G_fB@{B@}f|fvtgBBfBwBpH_@B/P/@- 0`( "4`# Ѝ0M0000# Ѝ/JI/Q02 //00@-0^PN^000@A\" \ @@T00 ^< ^  800000 00 000\ @-L\ 0 AS/P 0000S000/AP/G-Q@1 P`@A0pS S0P@S S S @S S 0SYS 0SQNP 0!.00<0$   ,(p,NP|0 00!<30 $ 0,(p80NPg0 00!700'>< $ 0,(p80NPQ0 00!0>`0,(p$ `80< MP? ; 0!<0$   ,(pMPg 0!p00<0 ,(p$  M0PU    '.y` ,(p$0 @ 0`< MPB >P1S ~?S?11~oS1O@naNYbY0J_;J_lLhYtJ_dYKdkY|eYO-LM@c N`d` P@R: l t~ 0@Da<00,(@$  `D0`MP <]LЍ 0!<0$ 0D0   ,(HMP 0!00D0$    ,(6MP 0!L0>`0P,($ P @0D #MP hlYbY0J_;J_TfY@-@P+: 厭 =@ ϥdYp@-@PY` Q    0p@W   RP PP  :0 <0x 8RR00R0S 0S/ 2:dkYdYA-`pS ㅥPTP@ p 90V`` BbY$hYp@-@Php0p@/A-M`~Px@ppTЍAx V3yP c~v@K@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@bYbYbYdYbYbYbYgYgYl 0@o/bYA-P`paCaaq v3$aab ⷼb)T!0  4 0!` 0$10V!0 $0 p䐟00S0 SW 壹pP0Q:0PSp`W !ፆ`2$AЍ0䆀K K_KK_@-@l@0A- P @0L ^U 0S f~`p_@hpT ၻ 0S0@A8l0S P ~M@bYp@-@`@P"@P 0 YpK@-Q@MP@`pPP@ \ V  @Ѝ0<S %0! >@0A- P` @0L ^U 0S ~p@ကT l0S ⨄PX0 ⵻ 0S0@A~@bYKO-p0M#08PQX 6^0Q@t XhLP  03/@UNTdh=P   03/@ENTTG-P  03/70S  P~ `yPPPtGP  0# 3/0@gS8'SSX `V@` P qEV~@OpЦW p>@X0`C`Ѝ< <0^ PQ_0SCD +P `pX` Vڐ P☼@P0`FD@ P 7@ <~pX` ` #Vڐ Pp@P`F@D?@< غi3@7f3@Dc3Pa3k%Sl $ Rt (`Pf@W (0 00000 0جY@ (T P0S$@P4 <P <p@0$3/@@P 0S-@ <PP@ 3|`|0<M03/@P |`@ j@"0<#S 80#S %'B BS #S #S#W6 0 0 0` 0g@P* (V"S  S"S "S's |"Sx"p"S l$'a S `M BS[ BS30P P@0S-@ P[ p @0  4/@ NT0 0 (@04/@#00#  GpxW#0T00S @qoP/  03/@x[  ƒ 0གྷ;{ S#B%B}e Sb O!"'S s[ SX *.l+2@(2@&iȀǀɀ@zixiKxi bYiiiii{iFi@ui niii@ɀIii7iiiG-Pp~~`w@|T l0 S 50S0 0೉P80 :ᅸ~`@bYK0  (K0 嗹KA-p`P'@P 00S0L  #PP #@  'K_RK_0 嶣gYeYT 埣,gYp@-P@l40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@- 4@QPM `=1h0Q o0CQ 0Q 3QK `Ѝ3Q 3Q 1}0Q0 00P0 0`P0@S?` SRp @㒛? p`P @ቛ3Q 0CQ 0Q 0CQ00l2Q 0Q XI`0!  Q SS  @#!@  ! ! !1 ! ! ! ! ! ! !! !! !!,!1<13" 4`t3 1 `1 3 1#>0880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @ښqP 0?S@ Ѝ@tS``iui vi iiiG-l Qp`PM P1Q-@UV8Ҵ!0 00 00@P ލ@X6T @aP  0R 뻶DPP1@ ֶ 0Q Dhx@P W14  O41i iK_C-qM@`P)  03/P(NU# 0S  o kPp@0S   m  0SЍ/PpP K Gɀx0/p@-`Q@P R 0 0 0 c$7p000SP0PP00p`*R 7PJ$0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  ~lR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PPp0@-@0M0S0儳@P  UЍ0ϖoK_p@-Ph@ហ1 01  hp@觠@-p0$M03`A0AS P R R R1  %/@ #MRY R G@ B000 S( )04 0 #RH L0S0P  b# 0 001   01^000000000 0 00000 005@P #T@$Ѝ3  d&0P0C@0@ 001 0 S#0 < 04"48#80CS=10 001   \110000000081000 006@P @j0  0H   C Rw0C0000P( 0 (00(00   0T0 0 0 @P| Qx 5@u2@7@K_33@-3A0@S AS S :<2@S 3/4P@-O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20`Hc2Y HYRpUHp0 0pW0\70PPY0ϗ0 00 ~ ~pP0p@-P`@Tp &P  P @A-0PXMP- 00 0XЍA/`@p ~1#`1014"410 0CH00UL 800(080@`, 0 0 0 03/XЍ荂@-@MpPx`z0 00`zP 0 |PЍ0 "|@oK_\00@-:PL@0 R 00 C0.APAAꫪs_ p@-PQ@M 0 7040060000 $0T l00p0 200P000 %U 0 000#0PR,R02p0LRlP0HP` (06/0  G >DЍp耖!L_DYY̮Y荂[L_p@-@0|0DZDBx0003/H*RUHdHHRQp0S  0 嬖20C2dR荂40SD/Q/D00S/   ! """ K_00@-0PS0 O T  RQ7@-\70L QALQ 0,aL\(00L S A@LT 0aL\  0C70C020 ^0S?.S,S :S/ 0C70C@-@ 0R R% RB Q}0 L} R C}   ^           R R  R  R P!} D3          /L_L_L_L_@-`Pە@HD  `P/`%0, 0) " P 00 0 | |0 024`S 0 0B0@202HTT ᦕЍp`@-@HP  a`P/` "@P 00CS 004`S  0 2H0C2&zЍp`H</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Spt4Pp3" p@;1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00Sr603 P p7Ppp@1PpL2!4<01p0 " $"S $2p@p@E8"Rp0S 0 0 8OPvpi1iii2i(#iX8i(iL_ 2 @-$2@0$20 P$20$2/(2S /@-$2@ 0$2 P$20$2G-@ᐔpP(ᰀH(20(2p02P0H02+(Z p@2S,`Yp`V v H(20C(2,2S0S,2?02HW Q p 3/`P  0S0S0 0"p@-@Hj,2&jPU R,U 0S,2?02(20C(2HU @2S 3/(2Sap 0S0S0 0"PpA-@` Pp0H   CR0C0000T7@@#RH L0S0P  9@0(00(00SO@P  y0  $' ! "$ &$ "$ (?Q0@ a060L_@-0S 0 P0 P Ѝ $"$# &  $ "$  $"$# & myc0C-M 03` 0 SPdp0弐cS0 ᫹00004PY 0@DC5( 0 0Yv 0 00S:0 3  00P  嘀0P<<00  0:0(PhY(0, O0@,@(0hc I/oP"0#2 D)D NPP p0D#DH# $H)3  0 0XP0 > PPU p0D#DH$H pzq Ÿ Io     3:#:SC1T Th & 1T (0Sf0 U00C S.0 S   0:0d1T?T  PP  y !p 1T,  T 0T0@  '0T00S 0@0000@000 0 R x  P3Ѝ G[L_d 5L݆P(1O-0 QDMA00(0M?0`p0<< 0 0a 0,$   0 0a,( P @< #9DЍV_K_YYA-@`pP0S 0Q  6/P Pp@-@P#0S| |0 @Pp@-@ ;@86@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P 0S| |0 P@pC-@4 `lMPGd540"p  8PPpC 0t hl 65;  & ;0040 0忯P0p0 000lЍ$p@-@PT0SPPp`YT0P`P0CT0@-4@P c8ȟ8p@-6@ @& @0@03/POP TOPx00Cx0x0PS L0S 3/H03/p0Cx0wA-`pP 03/@gT3@ @0 8/@ST x00x0LA-@p@TAl?0S @ 0QU`0S꬀g)P`8(G-\@P`p@TG00S0 $9/@8(p@-PL@P0  R 80<000@0,0$0(080$0H0p 0YYpYYpYp@-@ P0@0p@880/A-@`pu@TP 0S @ 3f (P0U 8(07@-@00NT P |P@03/0P |@ Ѝ04Yp@-@TP/0T00  0T00yH0p@/8(0@-@M 00 XP |P@03/0WQ |P403/Ѝ0o\࠳ࠣSp^ 0(0Xp\`6P|p @0X@\`60T`!C`@400o @$ @`y08V_\?4  0 :  <08 ,p$` `H*40AP 0@00 ,p($` `P<08 7*DЍtV_YtYY0 @R/p@-P!A` ! 0RpC-aMPpՂ@Aᶯ0p 0` i0 0000P@``000*%PᵂЍZ- 0S0!Q\ S0!0 BS   " ď0 S 0 / \P:/p@-|0P@`T   @PHrp GU00 000P`0@ďV_0 0R  0S/0 R/  0Q/-   QO-` @ 0  SR00N\ : 0P PUP 0 @0S 0#0JR㊁PPU @Y. 0 0S$PH 0 0SP *P  pW 0R  Z 1Pp[Pp@- 0 BRPNP0@ ` T00Q@:T:@ #pQ p R\:p0-S>"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PR{ T @(@ЍU Eg Dg0Y`* sR `FU T`T BS` 0 ` @  snP@0Y@P  0 0S f0  `0pS`P ޙ\@U *PQ pI Q`FBo B10P0 00 00TPÏʁďW_V_p@-@Q`P 0 g0P @pnPTp0SpPO-P0M`Q@0  HpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUff0 S0 0 T٘VV 00 0PO P4PpP:W_A-P@k`P p   B(mP TO  mP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@[Q U  BR  \R\Q> 0 Sl!0 SD) 0S0S0 0 S0Q00 R Q RSR 0Q `U P0P0 RPPQ AQ  0 eW_W_ďW_W_0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ ~0P@  pďA-@`pp UQ( `0PX 0 0`0d0(0 0 0P0000 0ď ZZZ Z0Sp@-@Pp0P 0pp/p@-Q R 0000Q R0PpP@D$X\ 0  P 000P:hP`P` @TpP@ 0 00}ďW_l X_ЏX_X_A-Pp`@#)C"PP000q10S0@@`p@-P@0`S   00E(P}0S p@$1/1M/  G-`pP 0@T UK 0 PAG*!0R"1S RP  jP P  jP 0SU P 3/P @ P 0 P GG/0 ud0  pdA-PS`p 0S @1W0 S00 0 3/@P 03/W@ e8@uS9@0S @-3/9X_ B 0P//p@-@P0@UPP :^N3A"Up Ep@O@`@@40 0 P/@-@M \ \S R   ?joЍ@-@P 0P P 00000 00SA-p@W 0S `ʘP0P 0|00/@-0P00U-0  Ѝ@: 0$`poe)W`0S   R0 0 8sl03/;0S0C0$唔@TP\?ZDX_@-@(F|A-P @T@A0p 08Dt80S``X# (1LL0C(1H)\!@LHL 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/Hzhzlz@-0p@-P<@ 0 PR0u00p@@LHL40+ 6p@-40@P@`L0S0L00x3P0tP80S`P@T列4p073/L@LHLLL@-40,@640@0DL0P0@@@Lp@-P@E0P 000P J40pP X0 `d0  `d Q0`5d 5 p0@-@@p P  PP 40L@040,0 GP,00,0(0S  3/$Z(10(1 P8&g3  =C 8"<0@TV 0 Z8g`0S   R 0 0  0S0C00$@P  IV4 @  P  P  P 圅7`EW p  PLLP<0S0P0$QՒpP 07PP 0 H0p嘈1叓(0S  3/ #`P ᅈtT0S sD1#2!12TЍ0S , ^Z @8ef P000V  @C@p P Z 8If`T7 T T`,PU00G~,gPP00<3`0@Y_iX_LO-`TMP|pPq 0P0%3 0@PAMZ @A20x@PT0L0S 'P 0S 0S40@ 31 4 H0P DP $`(Hp0UQ4PP AP [ Z RZT 0 0 0 P @@ P4 4 @3h "$  "$4 lHx0 80 0 $`(7 TЍ@-@Pp`0UpW01X㾁V 000 |W"010 g(0Sv`AUpXp㾁CZ_ Z_Ȓ\ P/0 !8 0 0 (  , !/HzhzlzO-QM`p @tЍO\r^oܕ000l00p00t00cx0 0|0lPUU47[@@T@P@ m0@0 ER45034 0@53!"ɉ50,0,@00T1 ~OD0T+ ߉U p0S   0S l\P@0S T `l YPlJPP&Up0S "Si20000Sd DSb D) ᣉ0 0 0(00l0P|0堰S8 [5 x0S2U U UH pPI \ (0 l;/ [ N[30S 2 030(*0 0 |岋P|0 0|040"4 4Z DJZN0000$D1@0@@T^ ~ODZPP@ R  Q^ X$0 $0&0U00000>800 l0lP%|0S" 0S x R " ,  4   R㸰 R԰8 |$ HP|0$ 0|0ɈX$ [$0 DOP  0 l3/ W/H < p1GS ! R``B``00Q  FL0Pp W(0S0P0 Ѝ@WZ_@-P@`pM4 j>  f>2 0G 0 qЍA-@PP`@pD0W ⩃H0L P0 H0L A0 `0<0SP@0P8P0\03@P8 1@P`0PpH0x0AP 0 T Ѝ 000S/0@-@PM4 = 8=2 43H@008 0 00 <P H0SL0S 0 R00/0S  $4 $0X~<Ѝ0` 4[_p@-`@P@THp@0U@H$ #H ep@̔ܔp@- PS`@(M 0S0 @xT!>0000!>0000P @ 0$0^(Ѝp4p@-@0S00̔@-0  @0X0S (( 0 }Ѝ\_ 0 0 C-0PM   0!S1000}Ѝ蠁\ R00ЍC 03 HUdTq@`VT4N  0!S10<000U`:T HЍCdd  "P \0`` 0 0``0`@X0 @S p ` D `0pem}m80fI 0( "ЍC@\_<\_̔ܔ\?|Z@-@MPU 0   0"S2000A}`# R  k 0LS@20 0rA0Q 2X0S  0 0:}(`V s"HcᪿЍ R% 03aA0AS   00  0Rm`H0$! F" R&000X0S p ` `0 pf|000 0S0 0 00RT0X0S p ` (`0 p|ܔ\_<\_\_\?|ZG-P`M,PI ЍG40@BP0 P= ЍGf HpbPP ЍGv|40!  %#21240 0 P 0  Y ⏿0S 0 )O|3"(Ѝ5Z:400204048<0S0H>P4074040 0 0H00&L0PVPhL0 0H00&40740(0L0S U]_@-`S`@RP!>00 @ @N$1 03/@ЍpO-`0Mأp P@P 6 6S 5 I@Ѝ3 T uV@1T2$1 0@4/@`X uT060@i0 0 0 i@&P0!  {@꬀P 6 $1 03/@*T,@ 0 8ЍO̔]_]_]_O-M0( P0`pW0@ ⶀ0PP@ LLi`0d 0 `0d i0#@P 3!  WIK $QI00  {pi004 0 004 {i pW$pW@;~;$  G ((P @P(Z Y!H~ 50R' ${00 0@0 ^PYD !>T00吠唠0PTTSGg ?  0Pg;g 0 0)Fg 0Y0SZ06oᩒ0S&2 0S6_w`R g 0$ 0 0$ g$QP0!vP  F0 0FTڻ F $F<0004 Q0P<<00000(00,018f0 0 00 00 f 0@eЍ(!>0吀唀$1 03/X 6ᬠ  Y  hF dF <00000Z7T^P.̔~^_1^_^_h^_^___^_<__m____G-aqQy@PG豻0&yPf0 0 0 [f0Sw@PA {P 40 ᐐIoᩒ S)5{Y ,f80< 0 80< ({!fX0\ 0 X0\ ,f"00SA@P  4"4X ;C RKe@0D @0 @0D fL̔__-/0@-(0,0@<,00S 0S 3/0000008004000 $ \ R0@~ZyZ8xZP/@-0 Hm@2G-0S@@P 0 S 0 00S@PP 4"4D!;C R tzpV`P 3 zG40S 4(48#8SX zG X`0S d0Sh0SP Z0 X0 KP 4-E!  'E0h0K䔂0O-laMPh00TT d`0c@P 50(-p 0  5   DP 0? 0x#PY@h0`@S3  pD \DЍ00D0 <00⸰E\?__䔂A-8pP`@d1!01@@Ad̔p@-\0  up^0 RP02Ƞ@,Ƞ00   ! 0 p@T 0, 04`_0 Dp@-@`P< 0  p@O-<`Pl2M@0 0 00D2U5P0``3XCy`@P 4l衟< lPP q00PU:RyЍ 0 S/ R 000h  y0S4pP0p 7y @$04/p y@W  y W V hy z` 0S 0 S S Rh  yy @$04/xZ@  y00P Y V hy y`  蔂Mp@-P`PUpx@@8cy @ Dn0LP0pM\`_f`_p@-@0@TpP P帀` ᲀp蔂O-$P2M@0p@ 02/!>540@P吢H0 0@X0vxT DdP< d~`PH00`VMxU 0bh@Sw Yt  $09/ >yЍ 0 X S R 000h  ,y0SDT0 Zx $09/-xY  ,yY U h y ,'y @P 0S 0 X/ Rh  ,x*x $0:/wZ  ,x00`Z U hx ,x @P  x 蔂MO-$M pp@P0 `fP 0倐hS [  $0;/@ x$Ѝ x @ <@MO- qdV Q ʀ !  , !p0Q[@p /.00  0唀0 0$ hFx R #@ !d1000  ! ЍHzhzlzMG-P`U U9 $0pp[@ [0Ud0 P  %B !B$0h(P 0(0$0 00T0w 0< }T`00`00<p蔂M0SnO-0S4M$PP!P@3 P 10S T. 0 0S0U0SvpD00`Vw J4Ѝ`` 0 lP 0h wM0S" 0 S/ Rh0  0w 0S  0R v 0 p$07/vp hw00`/^MA-d0Pxq@M0D 0S S2T1pH1p(@< }U`F00< <0}@Pp~PĀBP PP0S 0S F_PЍ0_0P4f_DA- BM 00S Q Q# Q ЍPሀ`X c`fV @^TPA^TQ^UDp@-,P ("x` @ :r`p4f_ZDZ@-@ `@`D0O-qDM `'(0 0 Q吡<<Q! 0 ,`$ @n0 (00<![ 0  p  ,`$ [0 (00<!pn 0  p  ,`$ G 0! p ,P 0   0`,(p$  P1\0 000E! 0 4`0p,(p$ DЍD4f_LZLO- 0Ppl@LM (0@D00,p$P PP P`<00D0 @<,(p$P PP P 0 00(@00<,(p$PP P@`D LЍf_0P@- S@P0@@P <i 4 (0 0@@PЍXCg_f_g_///0S/!  @-@A00A-@`PpWPV0SA0SW 0003s0#0S0  " \ R0@-#10lS0! @. QBo0PP P. /0S/p@-0@S`P `UFUp .8 #00#00p@  8 #00#00~PE0-M 0# Z#Z ZpZ ZP H>P Z#Z Z[Z ZUZ Z ->P ߍ Z#Z ZkP & ZeP  Z1Z} Z}\  >P Zk#Zn ZJP & ZDP Z` ZZZ ZZ =P ZH#ZK Z'P ZC ZC x=P Z0#Z3 ZZ- Z PZ% Z% =P Z#Z ZPx & ZPr  ZPlZ Z =P` Z"Z ZPU & ZPO Z ZPG Z Z i=P; Z"Z Z Y=P+ Z"Z ZlZ Zd D=P Z"Z ZP & ZP  Z )=P Z"Z ZZ Z =P Zv"Zy ZyZs Z!Zm Zm @<P 4u_Du_Tu_du_tu_u_u_u_u_u_u_u_u_ P0C /-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/v_s_v_P/Q //  00  00  00  00$  (00,  0004  80<0/@-@N@P @ !G-@MPXp @p P` 0@DS @Ѝ@`N@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@&NP000//o/00//p@-@M P@ `@M@T@@N@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ MPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU 0 R/R 0v_0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @-000 0@0 ! 0#2 /UUUU3333 @-[// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00#/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-f0o @-@oQPO-(p@@@, P`T @G.`VPW:/@P WRQp@-@@P@T@ P`Q@$.PPPpQPp@-``` P@.@T`PpQPA-`` p@P.W PU`@@@-0 0(0000 0P 0@ЍZ@-0 0(0000 0P 0@ЍZ@-$0000 0vP ЍZO-`pP-  I@P W  0 0W I@Q @-HR @P,30 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,U @k0@P`TF  00 0S !,! @D ...|.q!!,/pQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  V/Ѝ@-@P $N/@ ( 0"@_O-@0$M(`00p 00P0$00D2 0@00  */ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0`__A-`P@. $QY ?PU(p8 0 8S($)8 c: `.7XPP0Q`pDa(!"$a$"  l.0Uh ЍA@S )@ c8 7 )0(0G-PR2 p@q?p` @g(U: =. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (. 0$ Q0 0$  0$ @H< 0$ @ .  0$ @H< 0$ ?XG @-Z@-@P $-@ ( 0"`_@- @-@@-@P @ (- P 0$$耗_0O-P \M@000 0Pv00 8`$000 : j#R?0V FA\#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@ꄚ_0`( a!"$,a c"/G-P`8 p#T0.@``T%0  Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T\-M Ѝp@-@ P` !LNF! !@ApA-PP@#*p `P @  @Y@P 30@PWP )P o)P!UP@@-MP@@@`@pT:Ѝ Pp0P00 5Gh__00yara0tcid 0 ȭ 0 ȭyara 0 ȭtcid\ 0/\ 0/yara\ 0/tcid0S 0 }/ȭ0S 0 r/ȭyara0S 0 f/ȭtcid@-0p3A+`P @ 0*.P 0@PP Y@P0(ግ Ѝ /p@-@P)0PPptcidp@-@P) 0Ppploob@-@@ @-@@ @-@@ @-@@4 @-@@K @-@@W @-@@R @-@@M @-@@H @-@@C @-@@> @-@@O @-@@` @-@@n @-@@| @-@@ @-@@ @-@@ @-@@| @-@@w p@-@P((0P pP pgntsp@-@`sPw(@0P pP TpatadA-p[P_(X0P `ᕌ@P  P @᧌gntsp@-@RP dP'pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P  p@p@-@P  p@0!P/Ě_@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  LQP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`P@pWY FWl g:W =W *W # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8ЍL3H3 S R 0C# M0   Q S@0S00S > @ @@0 SbW' fW ?R0@SfWQ ` b6b` B@S8a8  C# c,1 c0 0 FW'Pf0?Sp Rm  P  c5S CP2QPU 0  PU H  0  Y=  0 fP0U08  0R4 XS+=W 0  Q  @U 0S Y 0 P  @0  0S @ s $0S,R$00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` ]Pp-@-@`P ]P@ Ѝ/p@-@P E]Pp-@-@`P ]P@ Ѝ/A-@`Pp s]P-@-@`P e]P@ Ѝ/00/̭0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

0М_P/0 SP0//М_C-@P ЍPo0 RQY0 p 0pp`P 0H S00Q dJ p`PxМ__C-@P Ѝ0Y0 p 0`APP 0S00, p9J `PPMМ__0P -?o42 ^0S0 S0 /М_P/0, S@-P0o/М_P ?oH 2\0S 0SP00Q|/М__fP 0 SP0m/М_f@-(0pSM c`@V `0P ăPP 00 0P S ҃Ѝ`0S 0 "R00   6P_P 0 0#/-0 S RS R RP/$0S @-4@pحx(J[媍x@- 0@a(M 0l`S A  YI H P(ЍЀ`, P ' A_P_H_p@- @P!?px @-)06x`_ 00 S  \: P03#/S  \ P0///p@-P0S v4@P R+(=@P tAT݌LPP ;40F?@p$@ح(J[x|p_@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@ p_ /P/ 0R" 0 !SR* R0*/-0  ^: P*0  S */@/ //@ p_P 0R//p_P 0R//p_0P L P ! R0* /0 \0://p_0P L P !  R0* /ɒ0\0://p_0P \ P  !R0 * /-!0 ^0# %/p_0P \ P  !R0 * /-!0 ^0# %/p_P/ 00R!  S //p_0P D P  !  R0* / R0://p_0P D P  ! R0* /R0://p_0P 8 P  !\0/1 //p_0P 8 P  !\0/1 //p_0P < P   ! /!S //p_0P -?o42 ^0S0 S[/p_P/@\   JQ\//p_P/D\  Q/S/Q\//p_@-@pMPW ` `0S$(0S!0+ C 00 0S0xSW  000000SЍ  pPꐝ_0BR"SO- HP`0@ pD TWpp-T@p` +T@`00T 00XS0 A B0C QR@`9U70T PPſ 0  000D ^aD\WDAD\7D U0S0:0QP00\00S 0!0@P0 pY ЍY S F객_0BR"SO-@ ` H0P pE UWpp-UPp` +UP`00U 00XS0 A B0C QRP`>T<0U @@gĿ! 0GbW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0S͝_H-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0 `PO PU# 0S |P@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00R[ }[[G[[Q@- o/@-IM@mpP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 ^P ` 0 0P0 5/P 00_A-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S +P0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@_A-`[pWR SSS P PPP{{P(0SP 0p P V` P PP   PZ_i_T_n_t_{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P {PP@pPH5@P <q0 P`000U  {ꀗ_?p$0S @-w,@ୀp0}S "S @z00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0Sy0h P ,0S(0S  ,bP \P,y[__p@-@P `\0 R@VP⨪ PPPV @pꨞ_O-0bPS00@0匪0Sު ЍO >P@Ъ Ѝ'P pP 0IF0 03008P  00C 0P B@U R\ Q ` V _` P 0SnP 0 03/P  0R#P P __؞_0,S<S5ꈘxh@-@ tp@-P@P 0 0 0p@CG-@P 0R@ pݩPP`-@ 0冡ᆁ!: 8 0冁 0` 00V:000ꨞ_0P 00R@-0P   0/᨞_p@-@P㤩000p@p@-@P ,0R@P㑩@p訞_p@-@P L0R@P`~0S@#*+@˩p訞_p@-@Pk@ὩpA-@P x0R|PVp0S `ᦩVP 09`P pꨞ_p@-@P @0R@ P`2 v@Ⴉp訞_ P /o00"\ R\0\`/᨞_O-@Pi pl2 R0  .PP @jpi@L0S {) PP W00Q=P8L/" h P,U<UU p2P` `- k 8Pȁ ,PP &PU@ Ѝ` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@ꨞ_ୀP 0S0,S  0 G0P -?o<2 ^0S0\ S/᨞_@-@P+ 0R'P`0 @P 0 0 B! 00C0000mk Ѝ@N Ѝ訞_0P/?o( 2\0S/0\ S/ꨞ_0P -?o42 ^0S0 S/᨞_P/ 0R/_0P -?o42 ^0S0 S/_PG-@6 @`TPp P* ᝧ ᚧ0 S @ Ꭷ S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@ev0P@ A /_p@-P('1@P 0P0 0pX_P 0RR @-Io//0Sb G- 0PSGt+ h@PR  pPWW(G0 0"!00 Pa#*<`P%c?P6 0 P0 `0P* P0P$ pGP唀W%10``P R0P&RP0P Wa<`=0P =P/᤟__@-@0P u12XO-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR30괟_A-p`PV@P$uPP  P `PQp@-@@ P`u@P0p  0P@ PTuPQPp@-@PP@PP @p@-@P D0R@00S F @P000ꄟ_P/ 0R /ᄟ_P/ 0R/ᄟ_\ ?o@-H 2^0S0 RQR m 0 /ᄟ_p@-@P D0R@ P@ tPP@p Q ꄟ_0P -?o42 ^0S0 S/ᄟ_P/@-@@T ?o 2^0Syo脟_A-0S6 (P@U2`P& 0$!P( $0S%  N$ 00 RpPꀠ__s@-P@ T R rx`.ЍpADAP`@ 0 06P@00C0@@`A-p `P]r@P V  !V @pkr@-0`SP@p0]S @0 @P  Ѝ P 000$ `P ,0S[_0 /p@-P0@Q m 0 Q000pPpp@-P@P 0 0 0p@7qpA-@P x0R@ ѢbPP` !@ 0q1 0q`0V:000`_@-P000p@-@P ,0R@P㥢@p`_p@-@P ,0R@P㓢@p`_p@-@P L0R@P`ဢ0S@#*@͢p`_p@-@Pmn@ῢpp@-@P`000p@谢p@-@PS@@@⥢pp@-@P @0R@ P`?0S 0@Ap`_A-@P `0 R@pP'0@0S@q 0 0a000} @`_p@-@P <0R@ P`@Np`_A-`PV p@PV T 00O 0Sx0,S00 AA-@P 0RPpġ0 0a A 0!1 0S0C0000A `_0P -?o42 ^0S0 S /`_ 0Sp@-P`@P (0S p@:p/ꄠ_-0!!00!1Q100 000000 0#0, 0#000!R0Q000! 00000p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0}!000p@t000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG- P`pX@0Q0000R0000@ @SA@@ @H :/P  1P@0R000000@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!00000\00!0000000T   0Sp  T`"P P- 3 T!, ,  1000 T R`T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-5`P0@ pD TWpp-T@pP +T@P00T 00XS0 A B0C QR@P(V&0T ``f[ 00D \a0DSW0DA0DS70DV P   S  R 0 @`  X`EXR踠_  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/2  0RR! R/P/0@ 0A0S(*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//1A-M Tp @00S 3/P0`7P V 6/0p `Pލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0`` 0R,0 @0 4/@P T p0  P$ 0 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@J@cp@-P0@Q cPp0< 0 Ppp@-P@AQpPp@-0@APS`0q< Q< <Q< >Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 ) P  Ѝr@t@b@n@@T(PԠ_ܠ____p@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPUb@P  bPb<WP0 Pp 0 03/P P 0S PP|PbPbX 6P P(VP P___p@-@P` 5Ppp@-@P 5Ppp@-@P`E 5Pp@-)벡_011/A-@pP`P ,bPp` P102 P @-@\& P QRS  T00bLQ R S "  T  00 A-% M222 ZY2XϽ7 `$c2q+o;~Z!g?c Ne?jh$녪7uZ5,)FȖ>y+[Ϊ<["pgd,r${ Ie49<  3Q% 30S#* :3#Q% 53#Q% 5Q *cZP)=랿l}zфM뾇gä뱪hsh뺤0  08S$ ' 8됤'T( 2R { @00@0r Ր넩U bp52p9 QG뗫9c @f8sgdiU 뀤uԓ0X"  000R@P4;0!kv[kCheڳ WAq6V P'$Vb1܁Bk1@T(H?,/D? N'3^̀sdwdldWARNING: double match for boot device (%s, %s) boot device: %s iicziicnonei2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!@ 0A @ 0H @ P `@ p @ p@ @ initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller couldn't map registers scoop%s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopzssp_init%s: not configured. can't map bus space couldn't establish power handler zssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846%s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferdefaultSharp Zaurus LCDcouldn't establish power handler w100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) console >@>@(>@@>@X>@p>@>@>@lcdctlioexp_set_backlight%s: this kernel is not support SL-C1000 couldn't register event handler ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ couldn't establish power handler zkbd`[[ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    : pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller couldn't establish power handler %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %cconsKwGb@[^@_@`@`@Ha@8dR8b@ȼSb@dR base 0x%x-0x%x irq %d drq 0x%08x core %d mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus**************J***************f***_***U***Z*gmv******C~Y$&/4~mxo>sI^ 3!!!!!!!6>0x%08xr%d, rrxlsllsrasrror, %s r%d, %s #%dsplrpc [[[[[[[[@[ [P [ [`[[_M[[P [#['[+[@ -[2[P 5[2[:[?[ C[?[G[?[ L[?[P[U[X[U[\[a[d[a[h[a[m[a[pPq[v[{[[p[[pP[v[[=[[=[p [[p 0[[p `[[p p[[P [[P [[P @[[P P[[- [C[[C[ [[[[[[[[ A[A[ [A[[;[[;[[;[0 [[00[[00[[00[[ [[[[[[[["[['[[ -[[ 1[[ 7[[ ;[[ ?[[ C[G[J[N[J[;[ Q[U[ Q[Y[/][`[ob[f[0/'[`[p i[n[p[u[@x[u[}[[@[[[[[[[[[[[[[[[[[[ [[ [[ @[[ `[[ [[ [[ [[ [[ [[ 0[[ P[[ p[[ [[ [[  [[ [[[[ [!['[-[3[-[9[-[?[-[E[I[O[I[ S[I[0W[I[@[[I[P_[I[`c[I[pg[I[k[I[o[I[s[I[w[I[{[I[[I[[[[[ [[0[[@[[P[[`[[p[[[[[[[[[[[[[[[[ [[ [[[[[[ [[0[[@[[P[[[[[[[[ [[[[[[ [[0#[[([[-[[ 2[[07[[<[A[H[A[N[A[T[A[[[`[f[`[k[`[]-thumb insn eqnecsccmiplvsvchilsgeltgtlenvund%s %08x %s%s%s aif, #%d[[[[[[[[[[[[[[[[, #%d#%d ; #0x%x%c%dp[r%d][r%d%s, #0x%03x#%s0x%02x%sr%d!{r%d-r%d}^f%d0.01.02.03.04.05.00.510.0#%s.%c%ddaiadbibedeafdfafafdeaed, #0x%04x0x%04xspsrcpsridie_cxsblsdeppmzp%df%d, c%d, %d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown] Pl@Xl@TnToshstoshnshstnshishstishstsycpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxtmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxundstrtdaWldrtstrbtldrbtstrldrstrbldrbpushpopstmYnWlldmXnWlblimbimbrangeswistrhtdeldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsdpmsrpFmpF2bxmclzdmbkptkmovwdZmovtswpdmoswpbldrexdaldrexdldrexbldrexhstrexdmastrexdstrexbstrexhandSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnmulSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsdrfswfcrfccmfPRghcnfcmfecnfevandNuqwvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddINuqwvtstvsub  "No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxmachdepdebugbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() -1single-skdb-k-dask-auserconf-chalt-b-2-3-4quiet-qverbose-v-xsilent-zw!N_bus_dma_busaddr_to_paddr%s: curaddr %#lxnot in range_bus_dmamap_sync%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botch\\\\\\\\\\\!\\0\H\]\L%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x VAz\\2PVA\\2VA\\2AVA\\3VA\\3 VA\\3pA\\3qA\\3qA\\3qA\\3qA\\3A\\4D \\4D \`\4i \\4`Rf\\4 i \\4qA\\4TrA \\4TtA \\4TtA# \\4TA8 \\4T A@ \\4TAH \\4TPTP \\4T`A [ \\5TE`A e \\5TE`A e \\5TE%V o \\5TEWV ~ \\5TE i \ \5TE $i \ \5TE0$i \ \5TE ,i \ \5TE0,i \ \5TE .i \P \5TE0.i \P \5TEAi \| \5TE!i \ \5TE !i \ \5TE)i \ \5TE )i \ \5TE-i \ \5TE -i \ \5TEAi \ \5TEAi \ \5TEAi \ \5TEA  \\5TE A " \\5TE`A - \\5TEJ`A 9 \D\5TEJ`AG \D\6J`AU \D\6J`Ac \D\6ZK Ar \\6KPA \D\7ApA \D\7AA \D\7A/A \D\7A?A \D\7AA \D\7A/A \D\7A?A \D\7AOA \D\7AA \D\7A/A \D\7A?A \D\7AOA# \D\7AA1 \D\7A@A? \D\8A0AM \D\8ApA[ \D\8ApAi \D\8AAw \D\8AXV \\`A \\XV \\?A \\@XV \\ A \\@X/V \\Processor failed probe - no CPU ID %s%s%s (%s V%s core)r\z\\\\\\\\\\\\\\\\\\\ \\\\%\*\4\;\J\Q\[\a\k\r\}\\unknown CPU (ID = 0x%x)%sHz: %s %s : %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DunknownARM2CPU_ARM2ARM2asCPU_ARM250ARM3CPU_ARM3ARM6CPU_ARM6ARM7CPU_ARM7ARM7TDMICPU_ARM7TDMIARM8CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM250ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15 \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \step A-0step A-1step B-0step B-1step C-0L \U \^ \g \p \ \ \ \ \ \ \ \ \ \ \ \rev 0 \ \ \L \ \^ \L \ \ \ \ \ \ \ \ \ \step B-2L \U \^ \g \ \p \ \ \ \ \ \ \ \ \ \ \L \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \L \^ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \step D-0L \U \^ \p \ \ \ \ \ \ \ \ \ \ \ \ \(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)\-\ \>\O\`\v\\ \ \ \ \ \ \ \ \step B-3step B-4step B-5L \ \ \ \^ \g \ \\\\ \ \ \ \ \ \step Bstep Cstep Dstep Erev 10step G \4\;\ \ \ \ \ \B\I\P\ \ \ \ \step Jstep Kstep Sstep T \\\\\ \ \ \ \ \ \ \ \ \ \ \*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15\\\\ \\\\\ \$\)\.\3\8\=\ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \userkernel@k\@|\@\@\@\\@\\@\:\@K\l\@}\\@\\Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=%08x, Invalid, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x data_abort_handler %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap badaddr_read%s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)  machdepkmpages@````` ```pmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx   dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable %d device bad device not ready area improper i/o error aborted from console error %d succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes) _CK.A\M%s: not supported ERROR TIMEOU DF%s: status=%s wd_flushcachewd_trimk!\!\ \ !\$!\1!\?!\!\ \ \ \ !\$!\1!\?!\X!\, %s: (error not notified%s%s) wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %x $GAFAKA[A^AZAYAXShwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed DMA errordevice faultdevice timeouterrorrequeuechannel resetwd, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcacheIDENTIFY failed !\!\!\%s<%s> SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jd)WARNING: block size %u might not actually work KAGA$GAFAPEATHApAA>A?APRAcouldn't establish power handler hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate wd_standby$GAFAZAZA[A8dRsUȼSTPYAXShaddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASdAoAcADmA cAwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwaitrecalpiomodegeometrysetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq bAĥCCdC8AbAbA}Aatabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqataatastart%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout ata_thread_run%s: unknown type: %x %sunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atabus_thread%s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d,32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusAAdRdRA8dRsUȼSTPdRatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxferxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't establish power handler , " "%s%s%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x)%sat %s function %d%scouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed init failed sdmmcbad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short #(-27<FP d'CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: SpectecSDIO WLAN CardSDW-820writereadextended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz pauseerror waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't change bus clock can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d e @ can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostCardHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) 2\a2\P2\2\ ,2\@Pcan't get SD status: %d  SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenance can't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x d' #(-27<FPunknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d error, retrying ld_sdmmcldKwGA4\ 4\config_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270PXA250Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxaintc pxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dpxagpio: can't map registers pxauart %s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaost: DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicsss: %d slot%s can't attach failed to map MEMCTL pcmciaunable to map register pxa2x0_i2c_intr_sub%s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't map registers couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer sdmmccouldn't attach bus   CW[jM_a8]oXuB,sBapmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM : %s reservedA\A\A\APM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %s : Power Management spec V%d.%dget power status%sunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedPsBtBdRdR}B8dRtBȼStBdRapmdev couldn't establish power handler pcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) , %s%s (manufacturer 0x%04x, product 0x%04x)%s function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! pcmciaJXjj[  "$CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x , %s%s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS 5@V\4U\5T\S\=@V\4U\=T\S\VXS\LR\VQ\P\RI\WI\pP\dO\rI\vI\I\N\M\PM\|L\I\I\L\K\J\I\%s: using CIS quirks for , %sSVECFD605 PCMCIA EtherNet CardNDCEthernetAPCMCIA MBH1030201%  8  @!!@! ! #/ ''w0 g'' c0c b\b\b\HTb\b\zb\b\zc\c\ c\c\ b\%c\,c\3c\,c\:c\Bc\Lc\@Rc\Wc\@xc\c\xc\c\b\c\c\c\lc\b\c\Hc\b\b\c\c\b\ d\d\@IeII%d\*d\I0I0E,c\2d\=d\Cd\@&II  IKd\Sd\,c\Zd\@"I0ad\jd\od\-/xd\d\xd\d\xd\d\xd\d\xd\d\xd\d\xd\e\e\%e\xd\4e\xd\Je\xd\be\pe\")e\e\uE o@o @o @b\e\e\e\e\e\b\b\@& 3BI@e\e\ @(#0can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAEthernetAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETAdapterSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAETHERNETcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0NDCDYNALINKL10Cne_pcmciaof\yf\TBcouldn't establish interrupt configure failed, error=%d %scouldn't establish power handler MEGAHERTZMODEM XJ2288com_pcmcia h\-h\h\h\2'Eh\h\h\h\h\i\i\%i\,i\3i\;i\Hi\;i\%i\h\%i\Qi\ configure failed, error=%d can't subregion I/O space memory mapped mode i/o mapped mode wdcattachunable to establish power handler Digital Mobile Media CD-ROMPCMCIA Portable CD-ROM Drive NinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEPCMCIACD-ROMIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmcian\n\n\n\n\n\n\n\VVwhn\n\n\o\o\$o\9o\@o\9o\Ko\To\n\]o\fo\P8soo P q q sMkltn\n\tt3o\o\ hCo\o\ h&wiinitcouldn't load firmware configure failed, error=%d %s:failed to attach controller couldn't establish power handler SMCSMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC Cardcorega K.K.Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11coregaWL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaFILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~42-# s%s: %d silo overflow%s, %d ibuf flood%s  !)com: unsupported I/O width %d B(BBBBB\BBȼSUdRdevice enable failed timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTNXP UARTDesignWare APB UART, no fifo is_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO : %s txfifo disabled console Could not create workqueue: %d unable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain CLC0C C<C,CCCC%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector %u) couldn't establish power handler %s: not drained 0C C C C8 C Cl C0C CCC C8dRsUȼSTPl Clddk_subrKwGd C]]   +-/, ,Lucent/Prism/Symbol 802.11 controlswisysctl_wi%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed wi_push_packet%s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d wi_write_txrate%s: tx rate %d -> %d (%d) wi_start%s write fid %x failed init failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout wi_rx_intr%s read fid %x failed wi_rssadapt_input%s: null nodewi_tx_intr%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundwi_tx_ex_intrtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%x wi_scan_result: unknown firmware type %u ]<]N]k]]]Ӈ]]$]G] G] ] t] t] t]]]]]]]݈]݈]!]"]LucentSymbolIntersil could not establish softint could not get mac address, attach failed 802.11 address %s %s: using %sUnknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d device enable failed yyyyyne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete THIS is A memory TEST patternwhere did the card go? setup failed 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT ##$atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1 atapiatatimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfCPCCԫCCatardltCC@ tCC@̺CC%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so/libexec/ld.elf_so%s-%s%scompat_utilKwGTC]invalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow]R]Z],&]]R]Z]n@ ]]R]Z]Jڧo]] R]^]a֐]] R]^]Q?}-]] R]^]@ZC˔]s]I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6cryptoaesselected L]] ]l] ̓]<] AES is bustedaes: self-test failed: %s AES self-tests failedaes: %s  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN%s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed    !"#$%&'()*+,-./%s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed 1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }%s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed   !"#$%&'()*+,-./%s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed cryptochachaselectedchacha: self-test failed: %s chacha: %s KwGDà]expand 32-byte kPortable C ChaCha$]<DDD DDDD@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[xchacha_streamexpectedxchacha_stream_xorjUS_&)ûIt~._dyz,(4y:b,ia /A&chacha core 1"3DUfw̻wfUD3"-chacha core 2  J1AY'A;B'{BP}sՊtS.&hchacha]8]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q]]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH@]8]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH@]8]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@@]]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rDdRDȼS>DdRWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! sysmon_wdogsysmonKwGBD]+]software watchdog initialized unable to register software watchdog with sysmon couldn't establish power handler swwdogreboot%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach sysmon_wdogKwGKD]H]  invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) ieee80211_setmode%s: mode %u not supported (caps 0x%x) Unexpected mode %u@P%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full ,    $ 0H`l     $ 0H`l .5%s: %s rates: %s%d%sMbps ieee80211_media_status%s: no 802.11 instance!  , $0H`lieee80211_media_change   $0H`l  $0H`lauto11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!_ieee80211_crypto_delkey%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u ieee80211_crypto_register%s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template ieee80211_crypto_unregisterieee80211_crypto_newkey%s: invalid cipher %u ]]']4]>]%s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s ieee80211_crypto_setkey%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! ieee80211_crypto_encap[%s] no default transmit key (%s) deftxkey %u ieee80211_hdrsize%s: control frameieee80211_crypto_decap%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckipieee80211_hdrsize%s: control frameccmp_setkey%s: Invalid key length %u, expecting %u &]dpDXpDoDnDpDTmDpD[%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEv]rDrDrDsDrDrDrDƄ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize%s: control frame0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-out of buffers with data_len %zu tkip_encap[%s] Discard frame due to countermeasures (%s) tkip_setkey%s: Invalid key length %u, expecting %u [%s] missing ExtIV for TKIP cipher tkip_decap[%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt ]D|D|DzD}DLDăDTKIP0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt ieee80211_hdrsize%s: control frame]DDD4D8DD`DWEP333,*,**F$(Kc & = ieee80211_hdrsize%s: control frame[%s:%s] discard %s frame, frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: %s[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed null nodetoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6D:too short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xdatamulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued WEPPRIVACY offmulticast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xrereassocassocWPARSNshortlong, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d authdisallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s  JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 maccompat_20link-layer statistics and controlslinkIEEE 802.11 WLAN statistics and controlsieee80211ieee80211_sysctl_treetop%s: sysctl_createv failed, rc = %d client/peer stationsnodesdebugieee80211_sysctl_setup%s: sysctl_createv failed (rc = %d) vap%uparentinact_runinact_probeinact_authinact_initdriver_capsbmiss_maxieee80211_sysctl_attach%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done %s[%s] %s replay detected [%s] michael MIC verification failed ieee80211_load_module%s: load the %s module by hand for now. operating mode %ubogus aid %u, max %u_ieee80211_free_node%s %p<%s> in %s table node_reclaim%s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u ieee80211_free_allnodes_locked%s: free all nodes in %s table ieee80211_node_table_cleanup%s %s table %s: %s[%u] still active , ieee80211_reset_scan%s: scan set:%s%u start chan %u ieee80211_next_scan1%s: chan %d->%d ????essibsswepno! %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s _ieee80211_find_nodeieee80211_setup_nodeactivepassiveieee80211_cancel_scan%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULLieee80211_get_rate%s: fixed rate %d (%d.%d Mb/s) not in rate setieee80211_tmp_node%s %p<%s> ieee80211_find_rxnode_withkey%s: add key map entry %p<%s> refcnt %d ieee80211_find_txnode[%s] no node, discard frame (%s) ieee80211_find_node_with_channel%s %p<%s> refcnt %d ieee80211_find_node_with_ssidieee80211_free_node%s: %p<%s> clear key map entryneighborieee80211_create_ibss%s: creating ibss stationshortlong, protectionieee80211_ibss_merge%s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s ieee80211_end_scan%s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %pieee80211_node_delucastkey%s: delete key map entry %p<%s> refcnt %d [%s] power save mode off, %u sta's in ps mode ieee80211_iterate_nodes%s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d ieee80211_node_leave_11g%s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble ieee80211_timeout_stations%s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivity%sstation timed out due to inactivity (refcnt %u)re, QoS[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated ieee80211_node_join_11g%s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s ieee80211_node_table_resetunable to setup initial BSS nodeieee80211_node_table_init%s %s table, inact %u scan$$hhu Penadis[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!ieee80211_encap[%s] no default transmit key (%s) deftxkey %u not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!ieee80211_compute_duration%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuPPPPPPPPPWPA IE too big, %u > %zuPieee80211_send_probereqieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u null nodeieee80211_send_mgmt[%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u ieee80211_mgmt_output[%s] encrypting frame (%s) [%s] send %s on channel %u ieee80211_beacon_alloc%s: cannot get buf; size %u no space for 802.11 header?ieee80211_beacon_update%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued >{4%$$ ]]]]]]]wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl"%c0x%02xieee80211_newstate%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%s(%s)TODS %sFRDS %sDSDS %s(%s->%s) data %s type#%d WEP [IV %.02x KID %u] %dM +%d   0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x        ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparams%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon miss%s wlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtsctsackcf_endcf_end_ackassoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocauthdeauthreserved#13reserved#14reserved#15linkieee80211rssadaptdebugexpavgctlieee80211_rssadapt_sysctl_setup%s: sysctl_createv failed (rc = %d) %s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d -> %d %s: dst %s thresholds %d-byte, T[%d.%d] = %d ]external%hu.%hhu%s:%hhuigmpplinetigmpstatsR[b]G)GGGGUGGGG <<lla_lookup: new lle malloc failed inmltplinetmulticastipsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinternetF)F(F*FCE EE0]EvGEE^rGtyFE E^FFF]F EE0]C؛Z EE0]Z)C؛Z EE0]ZsC؛Z EE0]ZCęE EE0]XEEHEC]F EE0]cF.PPUPP*}PPPineticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutstatsbmcastechodynamic_rt_msg     ICMP: redirect failed to register timeout for route to %s, code %d }E#(Dicmp_errorinetipforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumstatsdad_countanonportalgoavailableselectedreserve(@AAA==A*28;OOOOOOOOOO  ;% ?????HC  .   ip_output%s: refusing to send from invalid address %s (pid %d) inetipmaxfragpacketsipfrenplrip_abortrip_acceptinetrawpcblist\]FT]FD]FaF$\Ft_lastm == NULLtcp_output%s: no template%s: %d < %dsackholeplS tcp_inittcpcbpltcp_new_iss: unreachablesyn_cache_respond%s: impossible (1)%s: impossible (2)synpl @@@@@@@F\GG(G 1DW]e_ace!!rfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlavailableselectedwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localidentdo_loopback_cksumpcblistkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesmaxholesglobalmaxholesglobalholesstatslocal_by_rttdropiss_hashabcaggressivemsltloopbacklocalremoteremote_thresholdvtwentriestcpinettcp6inet6X4G;Gx0G,GG.Gt/GT;G;G2GGG|0G0G 4G2G3G0G1G DG>GAG>G(>GrenoDG>G @G?G(>GnewrenoFGEG @GAGDGcubic""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwudp_abortudp_acceptinetudpchecksumsendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunctiontnG8mGmGpGHlGFN2:BJRZbjr@Hf~%YbxlJJ(src=%s dst=%s tgt=%s)m_pulldown malfunctionicmp6_redirect_input%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_reflect%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d _icmp6_input%s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) inet6icmp6statsrediracceptredirtimeoutnd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknd6_gctimernodeinfoerrppslimitmtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtudynamic_rt_msgicmp6_error%s: ENOBUFS in icmp6_error %d NYIPv6 address: "%s" is not on the network lla_lookup: new lle malloc failed in6_update_ifa1%s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s in6_get_llsol_addr%s: in6_setscope failed in6_join_mcastgroups%s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlin6_if_link_up%s: %s marked tentative in6_if_link_down%s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headerin6_ifattach%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback%s: failed to configure the loopback address on %s (errno=%d) get_ifid%s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal%s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6)^HLGGG:CGEH|EH^GWIxEHtEH("^NIТFpEHlEH^PEHFFp4IEHLEH^<G+CI,lGCZHEHLEH^Z)CZHEHLEH^ZsCZEHLEH^ZgCHLEH^HCp4ILEH^2I?Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %d3!inet6ip6forwardingredirecthlimmaxfragpacketskeepfaithlog_intervalhdrnestlimitdad_countauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyanonportminanonportmaxlowportminlowportmaxauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsstatsuse_defaultzonemcast_pmtuanonportalgoavailableselectedreserveneighborgcthreshmaxdynroutesparam_rt_msgip6_initm_pulldown malfunctionip6_input%s: packet to an unready address %s->%s ip6_get_prevhdr%s: off < sizeof(struct ip6_hdr)ip6_nexthdr%s: m == NULL(@AAA==(A*/1inet6pim6statsregister_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctioncW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aassumption failed: hdr not splitip6_output%s: refusing to send from invalid address %s (pid %d) m_pulldown malfunctioninet6multicastmulticast_kludge ))))))))%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timernd6_init%s: workqueue_create failed (%d) nd6_options%s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt nd6_resolve%s: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest%s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 nd6_na_input%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_ns_output%s: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer%s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_input%s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) nd6_dad_start%s: %s: starting DAD for %s RSRAnd6_rtr_cache%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: src %s is not link-local %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, %s packet %d) &.3;CKS[cksinet6raw6pcbliststatsCI,/I,I01I0I/I@/I,I0/I/I.I8-I.I.I@-IH-I?I-IH/Im_pulldown malfunction  sa6_recoverscope%s: assumption failure (non 0 ID): %s%%%d in6_setscope%s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s 4^U2Y4^U3y4^U14^: Media interface : %s, rev. %d I`I\Ii82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphy) 25^U55^: Media interface : %s, rev. %d II\Ii82553 10/100 media interfaceiophy: Media interface : 3Com internal media interface (IȗIIignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexexphyM V xP6^{ n6^DIȗIIDIXII: Media interface : %s, rev. %d 100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphy) 27^37^R7^q7^7^: Media interface : %s, rev. %d hIIIICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphy) 2}P8^}r8^}8^: Media interface : %s, rev. %d IIIusing Seeq 84220 isolate/reset hack II\ISeeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphy) 2vP9^v}9^v9^v 9^v 9^v 9^n`P9^: Media interface : %s, rev. %d I`I\IDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphy) 2X9t:^: Media interface : %s, rev. %d II\IAm79C901 HomePNA 1.0 interfacepnaphy) 2: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d : Media interface `IȗI\Iukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyxor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zeropI\JIPIJIIIIPIdR%s: emergency X server detach screen %d-%d added (%s, %s emulation) wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted dmux kbdmux %d: console (%s, %s emulation), using %s wsswcouldn't establish power handler wsdisplay at %sloadedwsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDID =( dumb>^JJ`JXJ4JJ !!!c        BBB257#A^bgejzuxwsemul_vt100_output_c0c1%s: ESC in kernel output ignored "JJJJ JJ@JJ8!JJJd!Jvt1000@^&J&JJD:JJD"J"JW\))GhntLAu  "$&((((((((+=????????B`/[>24;20;0cP2$u%s%d\P0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" $F^*F^0F^6F^????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????cwccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not locked*&8+&*&b^xb^od^d^                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ f^f^af^)4g^2]g^g^g^ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠBoldfacecd9660nopl%'-79 &..RRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991APXJJTFDJ8JPNJRRpJCEJSTJNMJJCLJ0PLJ0REXJ@RRpJCEJSTJSLJRRpJCEJSTJSPERJCEJSTJcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] dXCD001%/C%/@%/Eroot_deviceDo^m^Dl^KwG4Jj^ cd9660_strategy: spectag VT_ISOFS, isofs vnode ..Ll^46_8W*_X*_P8X+_P8XX/_P8X0+_P8XL+_P8X,,_P8XH,_P8Xd,_P8X,_P8X,_P8X,_P8X,_P8X(-_P8XD-_P8X`-_P8X|-_P8X-_P8X-_P8X-_P8X-_P8X._P8X$._P8X._P8X /_P8X?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥmsdosnoplmsdosfhplKKloadvnode(): pcbmap returned %d dX`K`XhKDXdeextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld updatefats%s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. .. msdosfs_rename: updating .. in root directory?h6K4K5K5K5K8K5K5K6K6Kmsdosfsmsdosfs_sync: rofs modRRaArrAaUmsdosroot_device`v^KwGp@KVu^   msdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu .... .. hv^46_8W*_0X*_!K+_eK0+_ܣXL+_Xh+_fK+_l\K+_,X+_PgK+_NK+_$SK,_UK,,_ܣXH,_ܣX,_Xd,_X,_hX,_X,_X,_X -_$kK(-_tXD-_@YK`-_ܣX|-_;K-_kK-_YK-_ܣX-_`]K._X$._X@._` K\._ Kx._\X._̥X._QK._XZK._|[K/_X /_\K?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zbind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d BDZ\^`bdfhju_acknfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwKKKKnfskqpollnfskqdetnfs_sillyworker%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initKK|KDX13/nfs send error %d for %s nfsd send error %d nfstimertimer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s  @not respondingnfsrvdescpl^^^؎^̎^^^^p^T^8^^^^^^^r^f^\^R^F^ ?BEF   build > MLENF''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  nfsumntnfsnfsstatsiothreadsbuild > MLENnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%u/nfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for root^@^^KwG8L^ build > MLENnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)@ȑ^46_8W*_X*_P8X+_P8XX/_P8X0+_P8XL+_P8X,,_P8XH,_P8Xd,_P8X,_P8X,_P8X,_P8X,_P8X(-_P8XD-_P8X`-_P8X|-_P8X-_P8X-_P8X-_P8X-_P8X._P8X$._P8X._P8X /_P8XL-_L-_VL._SL$._X@._K\._Kx._\X._]L._ 1L._XL._p]L/_X /_XL*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt4NgN`XhNDXffs_newvnode%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mountingffs_reload%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2MMXMeMMN N %s: options QUOTA2 not enabled%s root_device%s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' ffs_sync%s: rofs mod, fs=%sP^^^ufsKwGM^^\^46_8W*_X*_P8X+_P8XX/_P8X0+_P8XL+_P8X,,_P8XH,_P8Xd,_P8X,_P8X,_P8X,_P8X,_P8X(-_P8XD-_P8X`-_P8X|-_P8X-_P8X-_P8X-_P8X-_P8X._P8X$._P8X._P8X /_P8XNh>N>N %#jx (fixed) uao_putuao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultDNubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object udv_detachudv_attachNNܣN$Nflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmemkmemkvauvm_km_suballoc%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainfltagain2loanzeroloanuopghNMprocuser_va0_disablevmmpeplNNvm_mapuvm_unmap_remove%s: kernel object %p %p uvm_voaddr_release: bad typevmmapbsyvmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressguard_sizethread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %dT^^̹^^emergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! pooldrainfork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slabuvm_page_physload%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.uvm_physseg_unplug%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG  U]rr:r$swap_off%s: swapdev not in listswap_encryptswstrategy%s: vnode type 0x%xuvm_swap_init%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedminirootswapctl: miniroot copy faileddisksortswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiodswap_on%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d done %s: %s is suspended by %s (delegator %s) pmfdebugeventsuspendsuspensoridletransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classdriverbusPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.self%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: giving up done Suspending devices:. %s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueue^^^^ ^^ ^^^systemdrvctl**** RVY\@ӀӀfailed to reserve PID 1 for init(8)procplorg.netbsd.kauth.processexpose_addressprocproc2proc_argswaitlwpwait@@ @@ %s (pid %d) changing logname from %.*s to %s reboot KKK]UKKkorg.netbsd.kauth.processcurprocpaxflagscorenamerlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememoryusememorylockedmaxprocdescriptorssbsizevmemoryusemaxlwpstopforkstopexecstopexitcoreschedcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x rw_vector_enterlocking against myselfrwlock`SS[RhRReader / writer lockcrashme_sysctl_forwarder%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashme_mutex_recursion%s: locked once %s: locked twice %s: initialized crashme_kpreempt_spinout%s: disabled kpreemption crashme_spl_spinout%s: raising ipl to %d %s: raised ipl to %d, s=%d crashmeselfdebug_crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s crashme_remove%s: unable to remove %s from sysctl panicplain old panicnull_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabled!!sigactsksiginfoorg.netbsd.kauth.processAD 0  trapsignaleventswitchpid %d was killed: %s sorry, pid %d was killed: %s sigexit 1sigexit 2pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) sendsig: bad version %d proc_stoptrace)R)R'RWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s/%usoftint%s block/%usoftint_init_cpu: cannot allocate memorynetbioclksersoftint_picklwpwedge:NAME=parsediskdkflashhaltrebootuse one of: %s[a-%c] %s none halt reboot none%s%lluswap dumps on %s%c genericmdmd0nfsroot device (default %s): dump device (default %sb)file system (default %s): ?use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured root  sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesleep@xZR[R[RuRkpause@xZR[R[RuR %pWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU\schedvRvRuRuRA  ( *$/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_lookup%s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content version %d type %d len %d: %d end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings %s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destruction/%d@%dpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone \Rcallout@xZR[R[RuRcalloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system todr_gettime%s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! todr_settimeCannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcntsbsize^^ ^^^%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%ssched4.4BSDnamertts acl_posix1e_mode_to_perm%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %dconfig_devdelete%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachrootlocationev: %s %s at %s in [%s] deviceparentcfgmiscbootstrapautoconfdetachallconfigintrconfigrootconfig_finalize_mountroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namedefaultlocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported swaiting for devices: %s done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-register^5^F^%sconfig_detach: forced detach of %s failed (%d)detached root device %s not configured detaching %s, success.failed.unable to detach instance initinit rollbackfinifini rollback not configured unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected range NULLbufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcpu0%s/%unist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testkernuserurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? corepkg1st%s %s has %d %s siblings: %s GAVE UP %s first in package: %s ureadc: non-positive residureadc: non-positive iovcnt   device-get-propertydevice-enumerate-childrendevswbdevsw_attach%s: block majors exhausted cdevsw_attach%s: character majors exhausted readwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorgeometrytypedisk-infodkopendisk%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%c%s%devcnt,%d/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extentextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not found hashdone: invalid table typehashstat KMGTPE kMGTPE %qu%s%c%sB Bintrlistaffinitynointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipifullWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS ^^^ ^(^0^8^@^P^` ^p^!^,^7^B^M^@X^c^n^y^^^|^^ ^@^kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %p8TTklogmsgbufsizemsgbufThTTdRT8dRhTȼSTdRrunoncepercpu%s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) poolpr_phinpage_check%s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u pr_rmpage%s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocatorpool_init%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s pr_item_linkedlist_get%s: [%s] page emptypool_do_put%s: [%s] page header missingpr_item_bitmap_index%s: [%s] %u >= %upr_item_bitmap_put%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pBjfqTqVX`bCd ݻ*,,,,,,,,,(null)0123456789abcdef0123456789ABCDEF%d[% 4jd.%.*ld] |/-\%s: table is full - %s %s: table is full %s: Skipping crash dump on recursive panic panic: %s autoconfiguration error: mismatching pserialize_read_exit()pserializeexclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificДT̔Tbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehashvmem_rehash_start%s: workqueue_create %d static_bt_inusestatic_bt_count%s/%u%sInvalid IPL: %dxclowxchighcrosscallunicastbroadcastxcallxcall/%uposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_poolTTXTTTLTT(Taiodoneaiost_process_singleton%s: invalid operation code {%x}naio_process: invalid aiost state {%x} aioKwG MHLENm_copy_internal%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]m_pulldown%s: m == NULLm_copypacket%s: no header (m = %p)linktl_DVLEVHEVDVFVFVDVFVEVFVFV,HVEVFVFVEVEV EV(EVFVunix<V_V_=V_XVH[V4VV(RVSVX\V\VRVRVh\Vpsemorg.netbsd.kauth.systemposixsemmaxsemcnt_MVPPPȋPMVPVЋP؋PsemksemKwG$TV_9;=?)'RAAsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %luorg.netbsd.kauth.networksopendfreesoinit1 %d 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_stats<W<Wncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table ..vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultgenericfstypesmagiclinkstimestamp_precision6_8_;_org.netbsd.kauth.systemfailed to attach file system '%s' because it shares the same fstype (%ld) with %s #lf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../machine_archmachinezaurushostnameosreleaseemulkernel_identdomainnameostypeuid%uruidgidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags P _L _H _D _%s: failed to start extattr: error = %d syncing disks... giving up done vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system ?root file system type: %s WARNING: No file system modules have been loaded. Supported file systems: %s no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncdelayfiledelaydirdelaymetadelayinvalid specnode type: %dILLEGAL0&_7&_>&_F&_M&_U&_`&_UNKNOWN&_&_&_&_&_&_&_&_&_&_&_&_&_'_ '_'_'_)'_3'_;'_G'_O'_V'_a'_j'_s'_|'_'_'_'_'_'_'_'_'_'_'_j&_o&_t&_y&_~&_&_&_&_&_ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd) %02x %slrulisthd %p %s: vflushbuf: not dirty, bp %pvflushbuf: dirty syncerACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADVT_NONVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFS@` !.AS]issymlink-target)_)_)_ )_)_)_)_&)_ufs%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %d%d syncwait/LWWȡW ffsnfsmfsmsdoscd9660fdesckernfsafsfstchgfstcntfstlwpvnfullvnodevcachevnode cache hashvcache_reclaim%s: cannot reclaimdead but not cleanvrelel%s: bad ref countvcacheplvdrainvreleholdrelel%s: holdcnt vp %pvcache_make_anon%s: cannot lockvwakeup%s: neg numoutput, vp %p  *,.024vn8*_.X-XL+X X X+XX3X!X؋P'X$&X%Xd%X\X$Xxattr-listsystem.user.security.trusted.xattr-namexattr-val6_$6_6_6_5_5_ 5_5_ 5_5_ 5_5_ 5_5_ 5_5_ t5_5_ `5_l5_ L5_X5_ 85_D5_ $5_05_ 5_5_4_5_4_4_4_4_4_4_4_4_4_4_x4_4_ d4_p4_P4_\4_84_D4_  4_,4_ 4_ 4_ 3_3_ 3_3_ 3_3_ 3_3_ 3_3_ 3_3_!h3_x3_"T3_`3_#@3_L3_$,3_83_%3_$3_&3_3_'2_2_(2_2_)2_2_*2_2_+2_2_,x2_2_-`2_p2_.L2_X2_/82_D2_0 2_02_12_2_ 21_1_31_1_41_1_51_1_61_1_46_*_*_*_+_0+_L+_h+_+_+_+_+_+_,_,,_H,_d,_,_,_,_,_,_ -_(-_D-_`-_|-_-_-_-_-_._$._@._\._x._._._._._/_ /__X`X0XXHXXpXXмS̅X`X0X@XXHX8dRsUȼSTPXмS̅%s at %s (%s) deleted couldn't establish power handler swapraidframecgddkdump%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) fcfs%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dkswap%s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFSA_B_ B_B_%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfsEFI PART%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC (s*K>;E_2IчHE_|nQn- q+E_ZIчHE_|nQn- q+E_SFU0eC쬤E_IчHE_IчHE_-чHE_-чHE_SFH0eC쬾E_S'@ )ѸE_*1@ )ѸE_1x )ѸE_3Dh&E_=rGy=iG}E_|nQn- q+E_%s: wedge named '%s' already exists, manual intervention required %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTmsdosswapffslfsraidframeccdcgdhfsvmkcorevmfsvmwresvntfsext2fszfsfictitiousmdidlefcfsY$Qcouldn't establish power handler %s: cfattach_attach failed mdYY0YYY8dRsUȼSTPdRYYYYdR,YdR2KaaaaaaaaSV Y* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ezyund_set_timer%s: invalid timer type pfilV_LYV_TYV_YV_hYpktqsyncpktqrenqifqlenmaxlendropsLYzerocurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_init%s: workqueue_create failed (%d) rt_updatertentplrttmrplorg.netbsd.kauth.networkrt_timerrt_timer_initrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d %s: %s: can't handle af%hhd (%s) mZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdr%srtfree 2 :qqqroute_purgeifroute_abortroute_acceptroute_output%sroute_enqueue%s: queue full, dropped message rt_addrmsg0%s: unknown command %drtablestatsroute\Z\ZxBZJZ0BZ(BZJZ]Zp]ZhBZ8BZ@BZEZEZHBZPBZ]ZBZXBZ ZEZZ_AZ̒inetarpnd_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintmaxqueuelenstatslog_movementslog_permanent_modifylog_wrong_ifacedebugarp_llinfo_output%s: source can't be determined: dst=%s arpannounce%s: %s not ready ???arp_dad_start%s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: %s: starting DAD for %s arp_dad_timer%s: called with duplicate address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: %s: ARP announcement complete for %s arp_rtrequest%s: arp_setgate failed %s: bad gateway value lookupcreatearpresolve%s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD duplicate address %s from %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarpnZDyZlZin4_cksum%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinputwqinput_create%s: workqueue_create failed (%d) wqinputwqinput_sysctl_setup%s: could not create a sysctl node for %s inputqdropsgpiobus at %s   "')  2;' +B#/49 is-rootmodelssuserTraditional NetBSD: Superusernameorg.netbsd.kauth.genericorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodeorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d KwGбZa_ # # ## 'is-securelevel-abovemodelsbsd44securelevelTraditional NetBSD: Securelevelnameorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodeorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d KwG4Z>c_is-rootorg.netbsd.secmodel.susermodelsbsd44curtainextensionsTraditional NetBSD: Extensionsnameuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d org.netbsd.kauth.processorg.netbsd.kauth.networkextensions_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveorg.netbsd.secmodel.securelevelKwG$Zd_is-rootorg.netbsd.secmodel.suserorg.netbsd.kauth.systemorg.netbsd.kauth.vnodeusermounthardlink_check_uidhardlink_check_gidgenericmodelsbsd44Traditional NetBSD: 4.4BSDnameorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsKwGZg_g_ cryptopffssppsptmatabusdrvctldktapveriexecfwucycomgpioutoppybthubamrlockstatputtersrtdrmbioaltmemtwacpuctlpadzfstprofisvvideodmhdaudiouhsorumpblknpfflashdtviiciscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pfaultwwancacpismbiosefisht3xtempscmdviocongpioirqumcpmioemcfanmemswapconscttyphysconlogptcptslptqmskbdcomofconswdfdmdvndccdcgdsdstcdchuksssesbpftunfiledescaudiovidcconsoleopmsiplofromscrrndproffcomjoymidisequencervcodawsdisplaywskbdwsmouseusbuhidulptscsibusraidugenwsmuxucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxldplcomclockctlirframecirradiokttcpixpcomsysmondmoverioapmdevsscomksymsepcomtslcdtwepxcP'Y| YSYY8UKD iJcomiicldbrgphynsphynsphyterqsphyinphyiophyexphylxtphyicsphysqphydmphypnaphyukphywinewdcatabuswsdisplaywskbdmainbuscpuwdsdmmcpxaippxaintcpxagpiosaostpxadmacpxapcicpxartcpxamciziicscoopzsspw100lcdlcdctlzkbdapmdevzapmpcmcia\k_o_`k_o_dk_o_gk_o_nk_o_tk_o_}k_o_k_o_k_o_k_|o_k_to_k_lo_k_do_k_\o_k_To_k_Lo_k_Do_k_jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGP_W_\___b_g_l_o_s_y_}____________ś_Λ_ԛ_؛________ _unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs  gnts>[A[`@[>[>[_#_#_%s%s%sstring"propstngp %_%llu0x%llx%lli_J[J[rbmnI[XI[H[I[LI[integerpropnmbr(_strtoull%s: invalid base %dstrtoll%s: invalid base %d|_[_[_[_p[_ }[_R[_G[?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnel!Tءbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif*N*%ZVVLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersaveSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchanSIOCS80211CHANNEL%sSIOCS80211hidessidapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragIEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAE MR^e@mty unknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node getmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardZdoruz   @@  @realpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargs  @@unknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupgetmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrps!&/38=D JQ Y^jpw@ @ @# .@realpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableffs4.2BSD%s partition type is not `%s'Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointr J      G [ {     4 Y y    ' L userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s FCJCOCCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood `QsQQQQQ$RLRlRRRR S2SZSzSSS%s: #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: %-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s UGHRBD M@dmCLS1@2plbunspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c|||421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)"&*. ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYW[pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS&')%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machinezaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy (Px#/8^#EMp#NM$h#Zck#t~l#m#a#_#n#Mn#Mo#M*r# \#-Vk#4;8k#EMk#OX r#\]#fw\#q#`#c#̀d#ۀe# b#f##Mf#,Mg#6,s#B̀+t#SM*u#^l,i#~)v#MGv#MFw#%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula!%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalida%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF ‘̑ /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS$+5?HO^ekrzŖ˖ϖזۖ unknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%   "#$%    "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmd%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700modulesbasebase32etccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s Awio%1Lcs%zu%llu - %llu %s, %s/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSIPU_iryȣӣأݣ )5E//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD11/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s%c/dev/r%s%cr%s%c%u%s (%u)fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sghxi5yOuI"Q ye  m!uYunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSɬЬ߬ */48<FLPX\bfq ؽ%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %s%s%sUser answered no to destroy other data, aborting. %s [%s %s]%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------   "#$%@//tmp/usr/var%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s%*s %s%llupartman%s/%s#ȏ#$##rrwlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s%draid/tmp/raid.%d.confwCould not open %s for writing cat <%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sgpt destroy %sout of memory-a !,6 ,gpt %s %s -b %llu %s%s_%lli@%lliNAME=%s/dev/%s/dev/r%sr%sStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsPW\_bglosy}żμԼؼ =!Wţɤ+I"e/Goswindowsefibioslinux-dataappleraidvmcorevmreseredoWȾȾ̾y Ѿܾ  !biosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLSFH0eC쬩SFU0eC쬹Hah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+&|nQn- q+7B|nQn- q+PT=rGy=iG}Xc;Mt?nymWC 3KOOyD<#*=(YbBRuoqr3Dh&\ M}-@Mjy֬ -чH+/-чHDHZIчHbfIчHy}IчH2IчHL6 %?aS'@ )Ѹ*1@ )Ѹ1x )ѸST.qBHo6֯i#/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/%u%s (%u)%s_%lli@%lli/dev/%s/dev/r%sr%s/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal error%d%d%d%d)]a#MI"ݿCqqUE1NetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition )A.8@JZj }usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s| %5lld %-3s  $(, %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA ***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiB-%u %uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x ?%s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu %c\%03o. --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms pollrecvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: unknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)%s%s (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Host UnreachableDestination Port UnreachableDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededFrag reassembly time exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %d HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid maxwait time: %sBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -s%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initsplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogbcdefghijklmnopqrs tuv$w+x0z@yGAMBZCaDfEpFuGHxIJKLMNOPQSTUVWXZ14#6,6|G~S}\cl| !+:?FLTagov|_o _o m m (null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt_new0addingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedqn qn rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deletem m link#%d%.59CLW_dl - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s  protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt lo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK) '-16:Aif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s,5 %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %sAJPX` dBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %sipv4_deladdr%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- i i y y : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloca a : (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B.h$Q n$i t$ z$ $ $ $ $ $ $1 $I $a alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~$5$ )(1$ -01$$$$$$$%% %@%%ГASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiescs_path1X02 bc_base_max2 bc_dim_max2 bc_scale_max2 bc_string_max2 coll_weights_max2 expr_nest_max 2 line_max2  re_dup_max2  posix2_version 2  posix2_c_bind2  posix2_c_dev2  posix2_char_term2 posix2_fort_dev2 posix2_fort_run2 posix2_localedef2 posix2_sw_dev2 posix2_upe2 stream_max2 tzname_max2 atexit_max2Unknown error numberUnknown signal number%m (%s) ;;;L;";(;8.;4;:;$@;F;lL;[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d ,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C025J.0tcr>q Tunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist