08˧4f<  ˧4fRNt t˧4f@@<@T 08˧4f<  ˧4fRNt t˧4f@@<@TU ˧4ft`A˧4f˧4f˧4f$h ˧4f˧4f˧4fA˧4f˧4f˧4f^A.˧4f˧4f˧4f`hpA˧4f˧4f˧4f_A˧4f˧4f˧4fwA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fmD "˧4f˧4f˧4f (08@HPX`hpx$˧4f˧4f˧4f08@HPX`hpxM$)˧4f˧4f˧4f}K$(˧4f˧4f˧4fM$C˧4f˧4f˧4f (08@HPXFA˧4f˧4f˧4fC˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4f"!˧4f˧4f˧4f"!˧4f˧4f˧4f"a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f:\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f2\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f*\!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f"\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f$!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f:\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f2\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f*\a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f"\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\ !˧4f˧4f˧4fi!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f˧4f˧4f˧4fbpf!˧4f˧4f˧4f $˧4f˧4f˧4f$˧4f˧4f˧4fx$>˧4f˧4f˧4fz$˧4f˧4f˧4f~$s˧4f˧4f˧4f$˧4f˧4f˧4fA˧4f˧4f˧4fm ˧4f˧4f˧4f$˧4f˧4f˧4f $˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fo).jqK BvZ"/ =Fl&ݡYw`D/9[J6nJ.4",E(TY"h"bCOTaItgf)A|)%P8(\t*[EVhcvűwM4\xk-^ 냣d]: I_d1[QWvofN^=ͣ\8NOD1Z`ܗ}L2G7O> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4<"4 ( $!$&$&؆LL$!$&$&NetBSDlAPaX NetBSDearmv6hf4H H D0P/!p@-@P`C`F&a03/T@pI%#%A-`0`` 0PpU(pGpG@Pq`P03/T@0US $I%\@-lPQMK \!\1 P` 0 R: 8 0S  /S 0SP 00S5 0pp WI2I0@3)1*03/ T@po0pWH2H0@3(1*03/X@ L0d 0 P0 0H%xd8"%H!%%P@-t tt6Pl@dphP L]`POU P @& P@-@⨚O-PR`HH2@Dt@Mt@00Sp $0dP0p@tt@) Y R @Pxp0: S 0`00SЍ@P0`0vw9 0wpS0SMP0 S0 QP   0S; 0   P 000s s0T TP5X0  0|P 0 R0&&U ;5$H0`  BR` pRp RX Xp/&(&@-h0 S& 000/D'pC-؀-`P p0M@ # A '#  A{{z(`P *Ѝp Y@D'&@- M @00@0  'P v Ѝ@-` x1V0zP 0 r@P@TV lPF $$V W@V4  ЍHh0S@ C@0;0;P W 0pW~hVp ?puh0-S T`"@@Dp ,P@0S W L&X'O-5M R  @P| Ѝ p P@D5Xp0S 45 0500P 5PPUP0S50S+ D$`De00CS0@Ȥ Pp  @YT @0 @00CS0 0 U,0 p8h00p Ip`300 R80: S +1p`  pP* R@t U0@@ 0, 043(P$05u00000 R00SQ 0 0 pE  p@ 0T 1(#E0  0P# ||8@ ?P X/@R0S P $\"TA! ,+," 0R@D 0Z0TT$@ p00 R0S pp0PS  0 9( Pl PTH@T c@P@0 ?oR20S 0  0 0R0P @P ll@0S L"P@ P0Rt00!P h'L& H'P'T'L'd'&&`'\'D''t'x'0@-MM@P  +p  ;0U$C dvP TTlۍЍ08 FP ,(0P X L&$\'Q@-@ TSP DDI,7P $ 0P@L&0\'Q@-@ X4P HH*0"P $ 0P@L&;\'@-@f0 ?E&0$/H(0$/(@-: @-56@-0M@-+c;a@-1   0 0 Ѝx@(@-1   0 0 Ѝ(@-1   0 0 ЍH(@-0   0s 0 Ѝ(@-0   0d00 ЍDS(H(<00/@-0   0N0 Ѝ((<00/@-0   0:0 Ѝ(H(@-1  ,0 * 00_ Ѝ( 0@- 00 $0P@JЍP&,0A-PA!q!ᘁ M`V0 |! R0B=00 B  T0L!D!7 Q<A 84100 ЍU P Q= :P 0`00S 0  p~0P      0 3/Q ! 7000@0@0LD0((H(d#={(1K0p@-|@PtP00 R 0p800 p0  B0Sqs (H((0 0 0 /H((@-  @-@-  @-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpd0S 00 m8@@- PЍ" OP Ѝp@-(`Vp80@  03/PPy8003/(Pp@-@P`P 80 (0(3/@ld P fdPЍp(O-3 PMP`(P,`B  0SP0 0K S X0\ 0X0\Y0 P % pHp 81/qp4 D! 4?P p 04  d0S4 p0 0 0 0 "xS0 0 0p0 t 0 %0 0 VU0 5"SR* x0| 0 x0| ! R(P0,`R!*0 AV9 000+1 xpt| 9S0( ЍOp0t 0 p0t x0| 0 YXx0| 00 0S04D0/004 0X IЍ((< E\ NrR/ R 0 0 /P0PL 0L B0R/S/  AA  AA  A A  A A  AA  AA  AA 0S AA@-tBM 0  \ 0  @ ? `(c$P}%B@Ba cHDP}%?L3c`?`RP0!!!! d 4 !`P6:4SV4 V" Bhh `!d4#:4@V4 C" B !d4:4-V4 0# B  d494V4 8p<@ !0?R/0t\0 /n\dX p@494U4 Ѝ@(4Mb(G^ ,EXoS@-PyG- A `00P4 2#&`8` (01/qp $ }㬀夐pUЍ80 $0(3/P 0 `V`PE0S0C0<U0  Z $H( (P&@-XAM P0 401#"8 P0(5/qp$ 2P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `( m@-@L M 0Q   0   vЍ( MO-M0@S M. 8S+ #='0|80S( 000| U" ! !Nx0|0# #G|0 \B& P%<ݍ Ѝ'| 0 Y0 S 0E0WS06  S  S $0S0 600000S60 060 00 6RT R0r0C0C00Q0 0S, ,B< 4N06,P`p0V 0(0$0,0PUp 00(0$00,0 0S $[# 5%^(0S%0 %00   0 |5|,0S l5l%0 0d\|XH5%DY; ?Y07* [ 0 Z` }[0 Z0 t[0 ZP(0, 0 00(0 0@"<00@ 0@ P|Te' O[됶Yj& ?Y0: 0Y300$0吣* ?Y0:W%00S. ,0S#$`V  !40S 4\ ?\0 * [0 ?Z 0L! [%7#  |0$`[㐒3 0 !{0 $ ! s  !m(0, 0 00(0@0 <" p1,0S 04a Q0X$8_0V00, ?V0(*Z 0  Y4Z0 YZ0 Y0000004 00 pZ9V㐺+40 ?V0:Z 0V㐣$0吓) ?V0:uZ5!@<$ 0 0$ P `r9(  ZP&0 (B2t3k  $+@-p PP`@@ ZP Ѝ`3MU@<p@-XP8@T`@D p P<opQ<Pp(A-AP0P$ 0 0 SQ ( $0ܰP h_h d`P, R3HHqU``0``000IPK_ x00CS000 f   0,`0CS0000 (00/U R _8 4`D 0$00 0$ (cO&6(`(LT0 S 0SP/P/S/@- "(q p@-HAHD0040S*0! PPP P`04 0PR@ V04 ^000( P 0PU 4`0PEP P 0P4  P  P0CSRP40P 0  p((P&p(`(p@-P0:  R R1S7WP P 0SWA吡S@ @@  P<\T PL00CS0410& 0`00 SwWPT 0@@00S , P* P   P 0@0CS0\00@  G[̱(4t((&0((cO&`( p@-Pd`d@000 PPPP0P0CS0p(00 Hp(0(`(G-@0` V V?ЍpPP 0崀 尐R`00@`0SoP 0S 0 h0  0?o2S @`sP(l(x(h(P `00CS`0p S00 P0S X0X /X&G-p`ㄒB儢0SS CpP[ U\ XLDV00 0PZ 00CS010a U0Pd 0@Z [  00CS0h10=uPU 0PL1` 00CS070 P0` R0V008P:[ ~g00CS0p00 UV 0 00 0 @00S 0S XHX(L((`(cO&8x(O-- RM `0000100010S @0бq`  0.0P0 0':0J?oT20SS SRO 0S  RZ@T  Z     00 10S@@  0 :P 000CS000 Ѝ S 0P  BR l  @0S Z0 0$L(x(p(X(t((&O`(aA-0P!S`SP@eZ 0KpP0!S 2P JZ 0HHH<00S ,$00C_ߟ&s4(t(A-P@dp`T0S PZ}$ ]F@X(cO&O-`@ ؀P0S p0 T T R R 0pfP Ѝ PP P   P Pp@X(p(x(L(A-p0`!S@PPY 0 @'4  P0!S P Y 0PPP'D00S 4 T@G@Ѝ"ߟ&4(O-@pb00CS01QpW PU>ءTpp0pp00VP"XY  00CS0Hx10 s@p@P0 5 0p0CS010x0 S0 0  X 000 0 0 0@ Yt tT= 0`00h0 P`0W0$0T P 00 &\(((cO&`(x(T((O-PpP0 SPEUP ЍE P 0C0 X0 Ub000PX!  00C0S.20 & 0 0CS0T200 W Z0 P CPEP 000S S  `V% V000mP nX| xt 00C00 0CS0D100 0RWX 0PFiP 0Z0 CPF V(崀VPP0PP00*P ,Xt pplY 00C0m0 P0CS0<00hj00`6(L((cO&`((O-P@`p P`T !. 0PSP 0@^S00\P0S \ [ h*-P @P@+0P00Q& (&^% @-T @0D P 0S( 0C00S 0C0 Ѝ`(ht@Q&L0 R QQP0R/@- `(q G-P`P@ X 0S@ @0S @T@@DT ~pP 0S 0 0 PЍ`(G-@P tp0SX`UPUP 0 @,P @Pq `(X0000@-@U 40aA R    0/(&'`(40000 0h@-6 (&`('O-R蒟@ 刀p0 pWp0#s) 㼢0`?VJV$ V0 00 0S0 =D V i1@s4V0"S00 @∀ FQuO0R0R0RQR0RQ0R0R0ROROQQ4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q0RR0R0R0RQ^V^V-Vk @ 0s000@^V-V00@R V p 1@s@xV0"SR 0.V@0 @R J /Fo@P0 R00R  G@PR 00;V0 00 X@} T0Sx`((&(>q 0@-@00 005P 000 0 00 ,R;R 0S  S   0;SRp`( p@-PD0QS@@R0p`VP 0C`(p@-Pz@P UT, (4$ p 00cO&Q 0Q\S@-Ao/`@-0S*  0@0S! PMpP HPP ;@P 0 S</R/     0 `("RI( Q 0@30/@-`(00@- R 0C30`(A-plA1S0PR a  R R S0` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  KU0圁0CS00 pP`(&G-AP pRpGWR0`0`0` 001S 0100CS0H89 kP00CS0' 0S  [P 0Sp`0 0`0R00 00C0p00  %`p`(G-p0A 0RSXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*Pu``(G-A 0`0P0 P 00CS0-0 p& 0FSNp K1S 0p10EP0CES0`(O-PB`0pS!P UB0S0001XPPPPPD 0Q0CS00KM!1  P[00`F`0ZP/  O P) 0100CS0G'(>P; 0堑0 S- S   PS 00CS00  0堑0CS00  R0Pz`(4cO&A-A`qW ڬQ1ECe R1 0 C0|00XPPZS 00CS00 v 0q0CSQ00 \R `R ``(cO&0O-D0!108P` Ѝ0S/T SPPP  PSiX TIP200CS00 ! `0Q0CS00! P1ȃԣԓ 0 S*"Rʜ0Upppp00P 0r0CS00 Q 1Q !@o!S/ %S pW U 00 0P 0帱0CS000!000\Q00pPR# QUpp0pp00fPb 0q0CS00ik0p 1 1S 0S11a0S S`l   9P5 0a0CS00<>10P!pE S:`00  1S `VEqP ʼ10PE pBR    Pp|000P 0q0CS00 `(YcO&(( q( Q 0@30/@-I`(`01S @-0@!S @LP /'P /`(TY7@-A00 S1 RUWʐ0\00PBQ  00CS00- 000 @P R0 R P Ѝ00!S JP Lm0 Sڴ 0R0CS00000  \00sP 00`((&cO&?A-O0 Q .#p WO ! GrYQWYRTP{ | | | | | | | | | | | | | | | | | | | | | | | | | | |z | | | | | | |j |lPm | | | | | | |q,r | | | |lLx | | | | | | | | |4h |hLiiPkllmHnnToop |0q,rrs wwlLxy |yP0 nR pR lR 00 S P0PP1S *PEPCPP0 nR pR lR 00 S1S 2PP0PPPP0 nR pR lR 00 S1S P!S00ЍP0PP!R "RP  RD 00@, `P P0 nR* pR# lR$ 00 SyP ZPPP0S!S  p0S 1Skt \P0PPPa[ 0100+0,+0 R00@ <PM 0!S 8 P0 nR pR lR 00 S)0S / ckwP0PPQUh /P!G@oG`GooPbVWP 0 nR pR lR 00 S101P0PP0SOP0 nR pR lR 00 Sh)0S) \\ %P0PP0S/P0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Su1S~P |P0PP  P P 0 nR pR lR 00 SQ\P0PP`PR 0nQ pQ lQ 00 S 1PP= 0  ?P1P pP,0S `Vm0VjVPPPVPUH p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SP0 nR pR lR 00 S2S040S402P0PP0S 0l0Cs0S 30 S}1SP 2SqWPP00@ 0S0 0h`Py P0 nR- pR& lR' 00 SY1Sb1S0!S pW0S1S Pc PQ 0S0 1P0PPP`s0 gRG  R: 0 B RM `o@p?M0"S;b$pR1 rR1 U p020 R 0 S< 0U0b0 ' `P$00CS00 P00 S2SP00PP2P02 P P J\0b200CS00U0 !2R00W0#220# 020 nRL pRA lRE PP0 nRE pR> lR? 00 S1S"\(P(&`(qQ& Q&d(cO&q 1@ .E@((("^(Q&>rHp" 0"0" " P0PPmP_p PPZ0S- `V0V PPp0 nR pR lR 00 S/1S888P0PP0SP0 nR pR lR 00 SP0PP QR000P0P0@m `P 00 00  P0 nR+ pR$ lR% 00 S1S0!S d0S1Sr bWW P0S0P0PP1S 2SqX=0S 0l0Cs0S 30 S0 P0010CS 0nQ( pQ! lQ" 00 S3 00SL6L` `ǻS@p*L0"SZ`{ 0  P0 nR pR lR 00 ST0\S P0PP0SPRP0 nR pR lR 00 S2P gm2SP0PP 6P(  X-@- 00" ЍЍ/'d(-0^S0]S0]S S]S[S .0As0S>30   \  R]\0G-霁`Pp0 SS'PG(!RJppU``0``0,0r@P.tKؿ0 ,(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A 7J L0 0pS G 0(d((cO&`(px(p@-!0 PJ@p P@01S?0A0S S n@P P0P 00S`0`00 P0A l0X 00徽0ahP`0J@, ( $(d(L(P('cO&O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00值P@ 0A0CS0p10H 0P \RI0P 0 S 010S P/ 00P S)  R [ U   @P0AJ奾 n00CS0L00} \0`00Pp8 P((E(`(((&cO&A-@`@0@P X0@ p>P" 0 R00R000 1BQI@ @X刹@pI0"S,@gR000((>O-@cMpS唳唣00 0GS T`SXsTP0PP00嵻PI( $ 00C0-0&SM0 L\  DQ<Y0 0C@p \  0刻P 0Il hd00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW  B@ \  /P AQ 0 T Tp p pp  P p BR   @e0 P0CS0,00 0 r((`(cO&O-M!@^0P0ߍP40S 0 Q0 000(0pP@Pd p0 S pSx 00 0(0Y01 Y  $ 墺P$H |x  B R`30    BR 300S 0 0 uG 0(@P#Qb 0bppG XxhY 00 0KP\MH屼( $呿 z00C0S0 Y( Y 1  -P1 -H呼 qZ1  B  BR l100S 0   G @ Q 000 "2 0 0(0,P1 0 0CS000SUW#00 T00S 0 Q F@ 0 0Sx(((cO&`(4O--p *ᬡA0Q0C` M01 00C S00`Pt :  P Ѝ5 /P!` 00000`P00CS000  [  }0S00CS0x00` P  Ph(t((l((`(O-RB0M00bsp 0sbЍܑ0ԁS 1 7  000P@ 0.#⩟ɐ Y Gt10S 0p0000000CS0D41< $ \$ \ 0 0#0L\ 0C000@000000 0C LN (p( Q&t(((((`(A- `P0 0Cs 0p 0 h0 d   B 0CR0@pT y_@(t( Q&p(G-@p0 PR` 0 P(S%0  d '6P 0 ,塽(+(cO&@-(F0 卽'(&O-eGM0PS@pM$Q403/P ܴGݍЍ0: S F00W +h P8:F?0P0: S 0SP0: S 0S 0S 0/S&P70p0p@P- eP 0#v PvO+ 0P ]<#P]sP f/1HP/+HP @0P,I [)H Z& U9.0. 0LPT:.0. 0@P@D!0Q\ PT1RP o R00S$ 0ST 0: SPPO 3  0\DG=00 04K PDG=00J0SP/ Hq.XG 8X⃼00CS0p Pp  pYW TrX0 X p00CS0 0 0S PP 0 d咻 R;c 00(@p & (&.&&;I\\?0\\?X X0p@-@P@@DDT` U H H0Rp@\\?ppX 0Xp@-@P@@DDT` U HH Qp@\\?ppX X0p@-0P0@44T` U 8 80Rp@\\?ppX 0Xp@-0P0@44T` U 88 Qp@\\}?ppX X0p@-PPP@TTT` U X X0Rp@\\c?ppX 0Xp@-PPP@TTT` U XX Qp@\\H?ppX0@-t pX0pt0\@ ^0@\\3?X @-0ptX pt \@ ^ @\\?5S %R R S R SSh -^L^S R 0/0/0000(O--QMTu @ `u @ 0 @0L0@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$'\ TF0 !00`V0SE 00刐0L0S{ ,0D0000400800$0S00( $0(B?@=$pp6,0S 4 @?C000d$0D0p0H0qVUUU 5O-@a!80S ,PP" f/cpW  ЍOe-<0Sp|倡倱-@P 8B@U-4B@2B0SL H"50CS Т\\\\⦒ $~ ᝒ00L0S \0.S0S .@0S40S 勸/ <0?oQ20S X v040 Ѝ(`_>JG-pQ74P0EL0 P0S%00D0H0P0` Pt0  EpYX5T H0J0P 0 89P c5X0 s0X00 00dt |  ` `R`S Y D( ?R004(0'R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z  000Ѝ1@GP,HHHHHHHHHHHHHHH ,@HHHHHHHH̨HHH,@HHHHHHHH@ЧTH\dHpب $H80PPL0 P 0PPH0LP PTPGX0s0X0 0PPLPTPHP=0 00PPLPTPHPX040LPP00PPT0LP P0`P\0&0\P`0"0d0``0<0080 `000DPh0lP0DPhPl0 004@p儶l0 h000  L00S   n && H(L($($0\ 0S \YP(& 0L0S/0 000/@-0M0S 0 00!Mpxp5Ѝd0d@ `0R@X0 0B?/ 0Ѝ@(((  ((P `00CS`0p S00 P0S X0X /X>&: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !Xյ@P10S D10S- 010'p # ⺵@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B?8 0ኵT00S ((( H(L(D(T( ( ($(s@- P@@P `QU00S @HT DЍp0t  Q \0 \0@.T )P@%U`(h(p@-P@Tp0 0C0  ,B @G-@0MH,3(30S`V0Ѝ0 0C0| 0XPS !,0S 20Sn  4 "; $pK x ׬0 0 pٴL20S 88Ѵ ((ʹ$20S  $Ŵ0 : SL( 1r"6000 0@0<01"$0㱴10S10S41 100H 10S|10S : S0: S t`w818q 0Rp(1 B?7 0 u'Q wp{ 4 paP^ 4X00S h( (((3( 8(<(C@(<(H(L(D(T( ( ($(1O-0S,0@010S 10S40 001q 1000PS ЍO\a0TQ q0P 0 #`0S,p,,QPPU& Ѝ  B 10` |0  ,R4   V 0S[     (((D(Q&T($Q&h(010G-S,0@010S 10S40 000 0000PUG`,},p2눠PUG m0 0C0 W dp0S,4  `YpP T`(((D(T(Q&0G-@0T,@0@SP 00S40 00@p0`0夀S㤐@VG -0 0C0 W ,$p0 00 S p0S,4  Fp` (((D(Q&@- M @ p ЍT P 0@  QQ  00T ^P S  (&0p@-0PS``/@P 6P P@Aլ@P48 I"PӲpL("Q C-CM@u/ `: :PĐT *F 0}pPPCߍw ? P@:w0S ?@4P?oP@&@-; ;հ`& 000/t(@-;0 )ð&@- M.0P ! 00A00P!0 0$u pk  Ѝ "$ 0P @000 h0h pX   DH"$  (0t(%  84 O--\e@PQM pPp p;0St  p@P 0S 9P   垲t00CS02.p1pЍ0S P PPpPX ⹩)<$ Q840l0p0 ! f0 X Г00CS0 p YX 0 P 0S  x励PP X0: S  P<P P  X0: SBPX  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (<pPဩJ`0S 㞛 ሲ # P= >Pe.  R (VYP O0 ¯S ,!0 0 A '! A{{ z0 ɱp)00@0 $P @p l!P ]:0S  X0;X0XP P F:0-S  PVPtpW  H徰Mp Y@t(!@&&& Jhf vs@-@ `P[P0P UCusЍpU 96\@ge0 TP4%"@)(Q&8"G%@-Q~M0pSM 0`  0 `P 9`! p~,P 98!l1@~܍Ѝ00 `P9 ~,@Pʔ9 ~,P0`  0 `cP W ` (Q  X00 00LPh9 0$ $1(Q&mvV!00CS0 #0 /O-D`LMp 000tTt$tt000 0000SV04`0p Q 0SI\#P90#0V 0030p Q  #gP0 080d#0V00<30 #PP80#030002PP80"0D0 0LЍp(0: S |0 S%l P000`P3)0-V'V|ЩVrX2PUT  ?;20M1PP S0 0 00W0qp}80S0 0V00R V 0V 0d1\!00X!00@@D!S9~<0V 10S0C ^:ˠˠ\:PV0 ~,0 e~\P0 P ;  0 1\U0Y 00V T0<(Q&(h(xU&4Q&N00 "# Tq " #>Ǭ܍4ЍT 聟0S =! ! !0`# #(# 㧼0S1p1 00.0@!n >0H!041 04q 000`$1尐(00C0 V   P 0( 0 ,0$ .$ 0 x >  000 0 0 `#2 #N(# QTxU&(&((`E(,7N(>p (ph(PE((Q&C-LRLb0HBS0000 Ѝ(( 00 0S  2 r0S |1 M 0S 娽pP (0: S)0w p10S10S P!.P  00 0S q4a 1 00 0S000p000 S(00(000 P@0S !000S x0v/P 0+0t0.P 0X孫(Q&h((((((((xU&((`E(PE(A-MM4 ┻PB4 #+H ∻P64"+bR$0@S 0@̂0S2b+p /P| /Pw 0 t S( -xN+tL+p2Tr0h0CS``C+@+P>+L<+H:+DH+P4.P0@0@)+ 2 ލЍ +0S  R  sS SS YS~P+yS+0q儁*x*H +P8.P 0SD @.P4 &(1P *0S +@(*CPP c3#P0@0@**(+(Q&(L((I$h(@-sp @@0 (@-@6p00 (@p@-MPᚹp@00S  0C00 `ᄹp 0: S 0`S NS Ѝp@C-MpPЍa0H03/P0 03/P`phA]P@ 0AS0@0 a3/PE0 0.P)3P/P aP0/S5P# A0 0006@ ]0p (0(03/ T㡷\ P(p (t (u ((&&+(O-MPЍhe0H03/P0 03/PP,5p0S 5ڷP 0%'40SD]7P 0(03/ T5P 0AS0@0 a3/Ph4C00.DP 44 C(P40S  ◸P 00  ⌸P 0R S "`Qd 03p Qt 0pP\P H=SP3` Qd 30/S[P " A  00  LP0SU 0S "`Qd 02p Qt 00S "SB 0H 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100`"Qd P  t1 ,^ T RP (10 P I @ 9/0S 0S 0S 000Y\0C00+4S 0S 0((tU&?(p@((p (0E((t (((D(D(u ((((((|U&(G-Q@zP@ЍT  T 0 &H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/EP 00 @0S 0! 00PP@ ᮵i>P0 l0坥 X0 0S JPY P(T(((p (((((T0@-0S^P P 00H03/P@((0O-MMDp$0b PP0@4@~z=0 C5zᮬ 4n6 ᒬv PF@$<P>4S(4R0(4p l$hR\00 X0S 0(4} 00H 0KލЍ0q(m(((U&U&1(Z/O-p@M W 0DP 0S08 0<000SPP0C080pG0S 0`S * 0R 08 0 x x/  P8 $@0 X2@ @?IQ*p$@0 ,0嘰 R ZP` dЍTT ؔ  ` `@X(T(`(\(Rs@-Ѝp@ 0@`PQ-$08  hP$0 (0@-@MPPᐫ00800S =J" Ѝ0(G-z@M`Q M Y #P OP 0P 0P=! SR J(@ݍ Ѝ⬬PJ#8| = $ HL0RP J(DP 0PQȄJ#8 ,MG- AP 000qPU+`00CS0opU 0 0S U 0  P 0 SP P0SP 0S0 0 S P ((T&& 0 0 S00@-@R00000S0@000S `ÓP LP40P(((( g(p@-PP 0Sp `ᚓ@Pd M@P0/S0080f R P@@@@p(h0 RX R  H R/< R/ $R/Q/ ((( (l0A-0S X0XP@0P`PpT R S* 0@((cO&G--c@ 0(MS 0SzB0@(Ѝ0 0P50C S=!!!!$!!!!!!p20S 0X0 00!P 0 ! " PPP  0!$!$! 0!㓭 X P!(4 : SB  S<  S)  S08 0T! 0 J ,!$1$1@P@ 0 S  S0  S04=! 0400S -ЁЂ ;Ѓ" 040+04 ^P!0H 00  ((#?[ (op@-8M@  HP0`P`┐U0$ $ @ 0P8ЍpA-t1hM0@S ThЍA4 `Z(;="(<p@'1WpP0 0000p084 40CSH$0r"60"$Ә0( Θ4 CR+x Ř hЍB>'P弘S+<  r(cO Sg h@-@XM="p:(ڏ0 XЍ7@-@PppP Q Ѝ0 0 bN Ѝ0@\N0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq0@-C0S&P*00 ,  SΌ!0W0@0BS0B0b 0 0 00Ό0@0 P*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 Br^00 Cr@ T A Cr@T   \a0Cs R  @-0C\@0# S#:0CBPBb 0 ^ 02W"!0C S*040@-@T@@  (A-P0q0`Q VA-QQ@@TQ S AA茖J:TP0 dd7?@ 0:S@ 0S000 @@ .(&&&/s@- `} P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* &#P00PG- 0S"`P 0P  p T@R 00T0pT0S ,@Pp=PP #?S(|s@-@PP0@l C300Ѝp0  R R00`᲏@P 0 `F $00(@-  GL&0 Rr @-/xU&@-005L$(2L /L ,L&O-pဠ倰 9@ 0P0 p`0, Y/   `V _O-@-/lM`I!봯P$jPP 0p p|/||_00 `?`/pP?L?A0s 8/S XB\    CRX 0F>tzP񟗳530353333353555533335333333333333333333333333333l5x5335535533333333304333344$5333360533043@53H53`533333333L33X3d33333333334D4L4T4l4L4t4|4434?<P p,PM>J=0 -R,Q0 000;l= =p, 4hP^PPU @ UP@g t嬓`P jP "PiX PcpPX\ 4P ¢\50S  o (P  ᒔP@5嘵00Kp:% 0p B;X%04 L50pzR񟗺Ch>h>h>h>h>h>h>h>h>h>h>h>CCh>h>CCh>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h=h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>h>AAh>BBh>h>h>BBBBCh>h>h>C,CHCh>\CpCCh>h>h>h>h>h>t=|===h>=h>h>=>>(>h><>P>l>h>H?P?l?????h>A2嘃iPgꬃP2P_ x- 2P U 2P PP3P 82 J P2 P E(3" A 2@P < 2P 7 1\ 22\P,-20A 00㨁圑  R [ aR eBp Q P?@?@?@?@?@?@?@?$?@?0?8? !00000 00|[1~PZ P1Z  @1Y  0Y Xx 0010L01Pe X(m(L((\Q&&xU&&(DE(|((U&((U&(((SU&U&U&U&U&U& (\T&B5(`_ IET&:(&n((U&k((,\Q& g5 (pE(((`((((((|U&(@ .( }L( Gmp&& 0.(T&&(XQ& HG0@#d屑L#t孑|G$0   1W Ì1P0 ( 0,<W7 L1V 2(1\ =P0V0' R<P"x12PU 1U  1T 1 1S1_PS2PR <2R  L2Q  \2Q  l2p x222 22"2+S0p02007 Bbr0e0?o S c00CS0 㒑# R003XR0 B{Sv008300R 0 d0S3# S*SSʤS|0Vy PK000Sm30VK`F4}PMP20000S D4 P0P  /(l0P/`0p@-0 PL@LPP@0@KP' ዐ3((&(mA-`  @PA?\. \ *\1  Q R+ ![\SPQU !\@@]^1!Lo \P/P00SP PS QR S0*S S 0PS 0 P0^ p-W p]WW UU @U  (p@-0@0 /SN00N P\(pPQP`Q*LC T030 00Q*pQcq@-1MP MAaq;P/P  0P0Sۍ Ѝ.S@T|`l @ @( T ;ZjO-cM M33 "@p`3]PW,0 00S 00 0 0aP{ 00 ;R SY @0 0;T* R  DY<5 cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 儅 0@&P\P    @>(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0S dd0S X 0 0Q0 ( ҎKp( &C-`PMM RP s\SP RW P0S #  P0S 2\SP R1 PgQ PQ' SQ GQ   0 0@pQ sQ00000Q0 R @@@ۍЍ00 P t㘇@P p єP ; 0 $iՉp(2cA-`P 0StVpl@PP P`P 80 PP p@ @@ @p(X0A-@0LPL`LpT  S& 0@p(cO&L1p@- RE jDTA ,PU; P8 \Q Q 0T + d04#1P  0S/  00P0S/  0P0  @0/S000 0DPpR0 p(( (;X0A-j40@TPp 00S 00S0 00/S @Tt0o堎PL0D0S sP040 p(((x2A-0@SP' 0`.S0.S0S/S 0faP 0 Q CR S.R  S.R0S/S S 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p ;00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0(&A-Q@pW :<00S u@(((U&U&U&7@-@@Q@0A@P!!0\S q  10@  Ѝ0 @G-鴑M@T- `P!ApT |0S! @T l@PO 0L0 0QB -P4]" 0`! Aލ00!!QP  { P    P] $ 0\0 D Zp(  ((GU&   81G- `V@0P XpY  @P) P! P AZ _ @P`Y P +P< !@((Zd0A- @T`pH PAT. P w@((Qqp@-@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSB 3b 30 0pp P <  - R0 R:00R:/A-0A Rh1\pP.@0MTaMQ 0  C0/S' 0 !  .P3ڍЍ *\0@C ?\0@C ಀ 0pC00C 0 0  P 0` T P 04 $ (& p@-`0Sp@e\ 1e #@ P+000p 0@- 000S  /H(0-p00@^SQ 0Q00PH( Qp@-!0PS   pPd @t Lm @@T@p00@kU&@-P`p@P  P 0|Eh0` l@ Ѝ0 0P 0AQ$ 0 VxU&`H(A-`PPЍ8"a :0J840K0CS 2  `40 01 +  d] (lV <tQ @ |qp}  A=/ 0$  4 -BL2P " 1P* 0(5P/S00*040(84K0@SKP 0 040q;;00004(4 :(40/S04084(49(p k$T( \(C-j@EM0@S(!L 0\ ` @ 3 30QJ(t S7000-00 s++  10>L  Rp0<x P J;p0@ P J01  = 0tpP Jx<@TYE   wXM  w} 0 OpP J} 3P NP$PP P P 0$p pt s0cR `3PH(q0Qk qZ ( 0@-PMM@ ` =X X 0Pn U+@0  $ $ ,  ݍЍ0$ H(p@-@C PP hp@*A-0p-S0S) MPP%N} 0NЍ0` S0 BP@P,0U ]P` _& -@-0@P   /Ѝ@Ѝ/p(p@-@ATp@0 R P4YP ` `P`pp(-P@- 00|0 x0 t000 h@0S XY00L0L < ,k$ Y Ѝ@ Ѝ/((((&( p@-x̏@PlhPP XڍP p͏000S  p,"p(_(5 -P7@- 000@ 0 000 P0S xZY00l0l hk XT|D 8_0 DY Ѝ0@Ѝ/(((((&( &$q@- I|Q&@-M@P" 0/SVSP|QSP ᡐp \✐p 0RP 0RP @ލM"brE\ 000/x(@- |f&@-q`@,MT xx~pAPD(00CS0@ᆎ@@a Pp= @Y@DOoB0S@,Ѝ0P: S eP 0S  v Q X! P000e@ 0At@ T~0 @00CS0;0 x(&&& O-PQAMR @ <R =R @ |R@ 0&S@ 0=S@y  0+S'@p 0-S(@i )e&c#a@ ^(&\(X(P( D("!0@- @(R!0s@-0P`0V0`0@S P 0R@P@  OP@0S00S 0ST P000 R  Ѝp@(l(hV&r!1 !@-L ^ĞܞpDX4d(TL @@~$ \1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !!!!O-`ps딀P @%RA &R X*5! 1[00   PP@@ Ѝ@(!p@- 8M@ T` 0  P@8Ѝp @P R 0 0 0PS@V P @0 F1P@$ P@ }T@(qp@-@P0)Sp@(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D T T! wz! q0  0@@P! d0  @P[VR'T  `@P, @   @("!!qO-p`M8P젟찟8!@ 40 X@0DS '00S^^* PU @ 0 U 0DS00SY Ѝ` pUU @(\C-`p  0BS00@SP! @ 00 TQP@@ Ѝ@(G-`dP0@S! p0 000PP@@(@-@$MP A1`PL0P  IR NRpp 0PPEP@@0@S ( N1$Ѝ@("PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0P@ 0,O01 XV&`V&X(l(@P/- 0/SSS00`(@-@PMލ0/S X刉p ⃉p 0RP 0RPE\ p@-`\E0@cP 30D0p@q0p00"SP Vpuq`(6"p@-T` RpH0@Q 8 PP  0pp@`(U&M"O-pW,S 0S)P Fs C000000000CS020S @T  5R 1RT/Znh2hb0d00@/SpG/pHHDPR0S 0/p0CS0p@0@ppW000000pA0P00 r00/ Q tQ00CS0P10S 00CS00W0@0 pR0S/S0@D00s0@0W0 P  R*0000t/S0S  P 00CS0p@P0@pK0S 00CS000@?0@00`((|(J"M"XV&X(`V&TE\ A-`p00@0P 00CS000S @ 0P0CS0X00S 1X @06 R0S U$0$p>N%(|(hV&`(cOG-p2B`M6&0@T"gR@P$ 0SM .S00.S0 00/SSC10  PPB| ePpZ% ``VTJPP@ ^` [.` E0E)mLum@`0-S0S0@T@@RP.⪇P0: SVP >PЍhV&Q"t(IT""`(a"m"E\ ~"@-5$0Q @ P @`(M""p@-L@Q50P000S LTPP 0S{s@@L 101DM00CS00 L 0 L0p}rRt("`("tW&"G-pPp@R` V101 dPp ]Pp `R\TQ @0Ti \0DsQS񟗀긲LLLL XLLLLLLLL$LLL,L4L<@00CS00 rL 0@ 0 @T0S 00CS00 [L 0 0SX00CS00 FL 0 (L 1% 01 @0Q  0BPA0@D@@@ @ @ @ @ @\@tW&k"A-@ ` PR 0R 0S SKp0S0 R fL0S  _LU  ILTTLq xNLd Td@00CS00 K 0 AK\W&l(( xW&! pW& @-0S- Ql(@-@(0Q Ll(@-x0@T   @@@@ @刄@00S 4060S Ѝl(T(hV&-$0@- R    (-@-   0p@-(-@-0@0 H@-@  =@-@-   3@-@--@-00 " ЍЍ/@-@ Ѝ@-@-  ЍЍ/ L 0S0 @-4 4K,S0 / l #(0/(p@-@PPPP  p` `P p` `ps@-P30P d0d`6 N 0X0@T PLD0 0@ M@Ѝpt(hV&B ((s@-`P0@S'G<0`T%kg{{'jfk[P[x ]06S 00S T兴Ѝpm @0t0S0T.S N@($Pq 0    /(@-@TЍ0Ѝ0CSPPPPPpp  000 P 0 4@ 00 0@-@M PU PP 0p M+P   PPP 0p 8 0  Ѝ0 n0 0(U&7U&@-@P 0S0S 3P 00 0 Ѝ(G-`0S q0P00<#@\T0PQS$@&$00CS010S -Ѝ00S P Uco8  R ])P00CS00S U@0S‚@ UḂP嵂@(|(($C-s@P`^PM( UPG+릐) QdPx  0T((x((((((((((U2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU H^0S 2 R$0S20S TE@yP10S EE10S  pb%0P 000S ~<~0 p000CS0(00S O'$ЍhV&($|(C-@?mM0 04@L0?_00?0,@0T@ &`@`PჀ0L0d00@Td0p@0o hP0l@T 00 /P0l (00`0S(&`0$S$ 0H0>60S |>0S(0S$00H0( $01C$0T>0S(0S ph@4nT@$xT L07S 7S7 =0S800SC -000`000,0 0 0p,0P |=&0S)7S&00S 0 0ST= <  =, ~p P 4 -J<-0, R , 0, x$P 00 0<<0S V0 0`+@Fd.P   @I( 0 ( Q$0S@=<|;q/DhPU`PkUH0k PUX00CS00 zD 0 ;[DBT 00CS00 dD 0@@Z`P E00CS00 LD 0@E @PT 00CS00 4D 0@E @P ?P @P07<:0P 6nPP@LP: RT00T0( $0P0S `-V`-V P0E0R9pPP( \ B( $ 1$0 L(0ST0077S 0Cs0S0  )SS @70s0S/@P 0 Q AqQ0(0S0,0 0S  8 @  ,00,00D080080,8@040P8@P8 7L 00Rm0, B=(0ST0077WShG$0'000$000 7 0'0'0 0((07$ 10103/$4 (7 DT7T' 7L' CP0S I< 6 6 D RN 8 0 I $B&00CS0 Ii60S ɋP 60S&,0}S6p6$6` h4 I50,0,  0 00 0D0, |"0E$0,0SK0$ |5 50S QD5,0S p|t:4%0<50S ?0 @ 0 A?PPEX<0 0<0(0 0C0$000D0004 <\N00CS0t40S HP% 40SJ)X0S\NVH< 44 3  3 3/4D3)0093 4 0S '|0R\#CX#0LChI00S0ڨM 0 #0C0000NH< 3TC  2 2 (04 02 X0S"00CS0 l2 R    0L2H0S#mߍ9H20S 08"SS2 @0< P0L@?H020D0D0S 1 D0S2 1$ D0S  t1D0s1 R# 0S1   B  D0S D0S7SD@ 0 10S 079@,0S0  |;,0Sh@Q C0,0$0L 0D@T,0Sp0 t0z00 0)H^Eq(p((l(l(hV&\(($T(t(|((pW&THW&t((8 .&tW&\W&xW& %x((!\( %B h 0/(0 /(0 /(0/( 0  /(P@-@&P<80PP cR   >%(0 S0/(0@-0M0/0@02P {P 0: Sl  S` PЍ0~{P0 : S" PP(` *P%p@-Px@x`M$P)00S "0`n00``00G!`"$Ѝp(t(@-`@P$o&0S0S 0C0BS00 000(//A-PM)@ⱊ @(`D0p@H8PLP, pP  0APЍ tW&f%A-@P`y=pWU tK! 007'(p|((O-pWC R``%` P0S:S2QEА @0S,W@  @0T/S/00`0 00S00P R:R0:SPPP&@DOu!S"XV&`V&(@-@MP/p "P㨐J  0 @ T7yzpD 1  0pWZ0S 0 bT0S 0S 0 SPzp @]! h`P T T T  @0 @@(T >0DS~ 0 (>@- P@MRqH1p000 5`$!pWZU x"@?U `?T?U<@ 04AS 00CS00 ? 0* 00CS00 v? 0 ЍU ??U P000~J00CS0L00S <??0,(%%% tW&%(|(%%%p@-P@@Pp 0S%SpP @dp@-P8@Pp 0RPp@- D0D0S RP P\ 0V&(G-`P@唀0吐00p 0S0 S0S00icPP|U00CS0$00SG5p((V&|(G-@Pp0`0帐0 Q :RQ :QR``R %Ru 9$PPP0T:Sp0  4@0/PSu`P('%V&A-`P倀000p 0Sp00Jc@T`|V00CS000SA((|(0A-pPS R+`a@T"W p000<v0 @0 0  ^00CS0H00S `P `@((|(p@-P$@Pp0P0@@-L@000@00 b00CS000S@i((|(O-PM/`@ 0P @@@ (ZxP00š0 0S 0S 000y#   P@ :P @cP< R R R 0S 0   # R00 m P B0000S - Q p" R[0 RL"00p@0  Pp[ X 2@\ 0=0p0ЍQ 0S/Q0S[q "P  P x"P R  R  (wP0 Q<Q 7 0@De P Q  zP@0000S R  p  BR 9D R5 Y3 s(%V&((pW&ߟ%%`V&%|(O-@`pM2%PP2*0S*[ 000`"0  p0Rz0#| 0Z8 RhB<01 P=PЍbPEUP,Xd,,,,,,,,,,lt|,p  `@Q V  00X!W QPYXV E1 0 0 W0S& 0s1TP P*W 00SY0 [  P 0S\xXT 0s  P a=T&t((tW& &H((V&p@-`P0000S S@BH000 00 00000CS0p00Spp@X(|(0@-p@M0 0000T0P>00G 00CS000S 9Ѝ0(hV&|(@-aP 0SHO-`-pP@pM$P0cS    @6pP` vPP VP@ ) RrYcS" U;ܢ[!P VP  R񟗆 0R PU`D;%U 4; bP& ;;[ 00S A00CS00 J; 0 0@ T Ѝ;/2PVd!     [ZU!Z;;uPU;U~aU U UUK;0 f@000[&_&q&t(cO8& &&&&tW&&(F&&ֽ&&'1'O- $MHBHR K08@,2 `pV. VV:V#  V /V# AQ`  1`F Qddddddd$ L p+Q R Ta[000000S ?@PtUP@ @ +T ~ [ /R0/Sp$ЍUX 0 BR r R  BR    BR  x s `V&L(X(hV&IA-(A0S 0PS0 0aqP0S00 P000^00CS00S fP 0SRh`hp0P RP000o^000CS00S AL((|(P(s@-0!S1Ѝp*S@SP``00P Q0C RP00C S@` `Z@Y0S00S=STT00 D0 R 0AD1U0 0S 0STV&\(|(A-dp`0PS@  R R00PH @L(O-s@0M00S00 00,`000Т00<000000C s<`0 00@000$00CS$0C0S00CS0(20S P6rP(0Z00(PFr P ](P 1X0 DC{0@0CS0t10S _Ѝ0SJ$P 0[0. [`+ V , R9@ 0C\A/@`F 0SX  BR r R  B ~   B `FAQV  R@ @L(`V&(dV&|((X(1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xqQBP  `V' Q`:00Q@  @% Y0S" SLP GP@?P P: DoQP @@` L((P(W&7A-XPX@X`P0p00\0p0CS00S nL((|(@-C@W>0@ ЍL(@-Qp@0` 0S*00DP@`P@0`SP Ѝ `P0@P0`S@0S0O-@p'O- P@M0?S*SL [SA0^S!S00x|\5]P> [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xpPS@ R0B$x r RP R  \$Ѝ$pPX:$P 0U0/Sl 00EpP $0S/00E0S``0` xqQP /000S  V/00D x0s0SR00Q: 0 R @?|0P . B/o.Q" R  0P V 0 wU$L(E\ V |(0 q Q0@-0 @QC\0CC/x~^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0SL P $$$Y0$000CS0L00S 0S 0P 0L((|(p@-@ PTp 0@ @@L(G-p @0s0 ST@D0P ̀`V z`RxpP VP V V@ S`` S =RR QU  U0P @0G-p@ Mo oF0P 8a000e U00SW-00E@`PIPE@T Ѝ00CS0@X(O- R@@0`-SPM S! C RHHHHHHHHx?So @Sy 00C Sh>0 0 U`60S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P6솟p覟ԖW@A0S 0f0CS00  P6FBЍx6P6l6_0000Q00S 6 pR&V(0S 0 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 R L 0ppUppW~|0m R  R9 V} WHs 83 BR  BR j ~  B Rs `2 BR  BR  ~  BR   f ~ `   0S q QAQAQ   Q50  ' ~ AQUd Ra 4q B R `V~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00|(\(X(L(hV&P((TV&(W&O--$M000 06 0=``rdVdp0  P600`G6 @ V 0@P 00@S0(00 60P@   R@@0% T A*% R *R@R Z  JRG xA@TZ   + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S1 0@80,  [0  0+ Z R CR 0S0[0F0[0 0@S30S 0@0 00J S񟗸 <t t `3 BR  BR  ~  BR  ~  K R  BR ~0 0  BR ~0 0 ,Rw[B0 mT@ 000ST @Z$ЍT TL aQ00CS0)0 儁000I0 : P 0C A 000 1 1 0AN0000T0 0:LP 0 004@[@R p R0 Rp Rp B\T   R0SL(X(X(`V&hV&A'\(O-0M  P0 4400̴̔0@ 0~Q  0 pd匤0@Q Q#:Q =Q Q Q     BR  卷P AA  p A P񟗁x%"%%%"",$##X 0S@ЍQ Q@Q =R 0p(0  BR  pw w p    BR  u  q u  BR   ` ( R  0BQRQ B  X  BR  v p}< v 0Sq Q AQ~@AQ  RX ~     ?@@ M  7@P)  ~R&=Q0S! 00   @(W&L(`V&X(l(G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S000`0`0CS0!0 0@p   0   0  R 0r00j 0p hV&L(`V&X(XV&l(h( @-0l@T`V&O-XAX`0$M`F:0PEPE000PCP$Ѝ0000L(`V&X(l(qO- aXP q0@ 0 R    0X00P X 20P E00C0 Ѝ0S L H.008  @D0000D L(dV&X(`V&xW&cOY'b'O-@ 쒟rP0  DR400 R`| R    0T0d2P`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C0`FT000@ D00C0CS0 000000C00000000dV&L(X(`V&C-PpM@`᠐ 0嘀00000p000CS00 p0@ @5Ѝ00pL(`V&X(XV&A-Pp@-A00CS00 [- 0 ` V-00CS00 D- 0 ` V`-00CS00 '- 0`tW&oU@-|'@-|'00S/ RV&T0QH0 0Scq o/P0//x(V&0    B /x(A-P夀0@000p `R$  0 `0T @ `  0 0C  S000SA(V&x(|(0A-P` @0p0W0 P 0X S S0 000 00 0h0 $P   00T Q00CS0 00SAV&(LW&x(|(A-4b4B0 Qcr 0S Z,X,r0S@0PP0/peP2b000r0Sc00CS00  0S 0X0#S ZeP  ReP, 0 00P0 P   PERP S   BR 00E0CS0000`0L00S W,80+`QV&x(\W&xW&'hV&pW&@-L@00CS00  [p00CS0@Rx(@-T T@08     00000 0$00x(V&A-P`@000# dV |`0Pژ#p0PS  D0  0000CS0 00SA(T0V&x(|(@-4ap00MP0d@P eP(0: S$0 0  pdP  8pPd0 000 tdd#TldL00CS0,00S Ѝ(''''(|(A-h@Q0P0`0 PHpP<0`00CS000SAo(x(V&|(p@-`P@00P0"P O 0S00xO0X 0000CS0p$00Spp@@$V&(x(|(0/V&p@-@,`,P0SpSTpMV&((p@-P@0SpV&(p@-@Pp P0Ppا"0@pV& 0 R/ V& @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0 (5rO V&A-R0S20SP`AR p P"jcppbPpW* 1N cp !$"HP c 0P ?&&&c qP cp*P  kHp,P kc P cpP  QHpP !00i&f&c&`(T( V&,4(hV&9P(b((0S/p@-@PP1PDHAKP0a 0(00R 0S"0D@505#0s  0C?o2^0SP㱕pHP OP p0S *00CS0p\00Spp@ Ao PQP((5rO(((|(p@-@\P0P00 M@00CS0p00Spp@(|(O-@`TM R0 TЍO)ؐY. PPY   p0 SPs   0S0P0S PP PQ 00SЀ0S@TЍ0S{22 F!0R+  p  !R -  ")p 00X" s) p0 sR ,H0p) 00CS0(0p W )e Z 00CS0(0 00CS0(0 | 00CS0(0  Ѐ YZ(000w ) #40  ) )P S#4sN  0 Z0p@ gp  (Jzp0㓉(ЀHp0r( V&5rO)))e&)/)4)C)@- 0 SS0C 0.^\Q0 p@  C/o "P R pO-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S @@1@YZT X@d1 r9 002#00S 0S 0p?Sp  $P T"@` F Po P I \0@00SJ R Q !" R @ V&I)h)(X)x)G-$a$|0S Qq0l0@S @ 'А㼠0Sʰ00CS00 g' 0 (0 R  0 S !'( t(5rO)))C)tW&A-pP`A$P00Sʄ10P 0S hjPp pPP gP`W@ P$1@@A'PV QPU, 00SJ x'0 q'`00CS0 &0S 0 0 00S0 S 0 0`$p$))t()(5rO *rtW&40@-@T  FP@@d(h)8 P  /Q 0SZ//(G-Qp0SPS@00SoZaP000M: 0@C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠i@ 0 ZJ@Ꙃ! P00B R @((|(hV&@-`!@S1p@!P \$Tx1@WV2 h1N0SP U 0S0`_V $1QDpL!tl"i"060S% b"_"\"Vq$n$U 0S P ^`^P PPFWT  0  ЍVT(t(L((hV& V&(z '08 N R S  0S  P WhV&O-pR0M|B0P p` 30S0S ЍP$$0P000@0 0#T):U 0S0 10S  160S  0UGE RE C100CS0l10S 0S 0 2"  \ P 0Q R0 @|. \ ~ Lo ^ \ Q  P 000 QPW@~ Lo ^ \ 0(((T(hV&pW&|( G-pPJ@P DP1N0St `GC@d_T @`_$CprJ F`㜠@0S0S 0S0S<`@Y 0 X 000 FhV& V&j((A-@Py P PT0Q 0S olP@ pP@ ZP@o|06 R0S@@Q`` 0pG  0 0 Sk*t( hV&tW&O-@Sc$M2 PT  %P )P lnQ pQT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP p㴲jY  \   0`P 0S00Y 0STP n'$260Sh0`00\  \ 0?o2? TW J'\0#Q 0 !X R6  p"P0S 0S00 0 RZP S  R 040TpP/o" R 0 S0C0 9 p0SYX X YPPV1*(5*K**(t(hV&p@-@\``Q000 R 0S <1Ap NI!0S 0 00D1  S  Bo00P0R p` R\ p`` R00 0S00CS0000S Yp( V&C((5rO|(D1@-Q80@S fZ#P`q0SP00CS00 " 0 $0Ap iH.=!0#PpP000T00CS0@00S  Ѝ()) C)tW& V&((|(@-w @ 00 t(@-@ l @ p@-`@0 0 p 0Qp\ PU"00p(W*O- 0@LbLPDDDr0U0S  U"0PE0P ЍS S =S\ 'S " C 0CSL\\[l]\\]]\$0!PU0 R$ \S0 \0 0S0 @ P   0@ P0#P"0!0 P  0  @}00 S$0)0 !"0T 0@ 1 }SP0  :0@"00  (*o*y*V&**2*<*A-@dcdsdMTZ 0SW0S^`___d_^^____ `aa```X^`````aa__ R0S  "%#00CS 0S2h""\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8 Pd Pa P^ P[ PX PU @,(*5*****$<***** **N******gB*** &p@-@P@`TpUPU 0S G@& p@-Pt`t0PP6 R@N0S@2@@0S. @D0    p 0 p(hV&A-0P@`Tp R@ 0N@T P 0S@@!ZW\0HU 000000V0@ T(hV& V&@-@ ʃp P0  Ѝ@MF0Ѝ+O-P 0qM00S 1a б100 0000 S  @PЍ0SG 0 RS/Q 8 C`ZP 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S-@?0 @00CS00  0 ( `0SH0 @_00(((,((+XV&X(#+pW&`V&A-M`&P8q8A0S U60V0C?o20S 1Up0^0# 0P!1U00V0S^0SP60S .0S PP PЍP ^X8 0P0C?o20(hV&pW&xW&LW&2+(0S/p@-P000PX@P00CS000S TpP@T` `@V0`0T0@0u0S V00T00p@(|(hV&p@-l@0P00XP E00CS0 Rp@u00S L('|(p@-P@cPUrmp@- APXz+@-vBPQz+@-@>ЍA-@0PS`~Up~0000 p 000CS0h00S 0p00000PC0P0CS000S XV&(|(P @-(rW 00C00/+XV&00  0 00   /XV&X(p@-@tPt`0000S0 000D0 00CS0p,00Spp@00B(XV&X(|(@-D@ 00040 00CS000S@(X(|(G-qA0@0000I?o2 V0SPkPP) 00=0 000E000PS V 00CS0l00SGU E P 0(` 0`PP(XV&X(|(T 000@0A00CS0/00S/&(XV&|(p@-PPP`@ P T @D@p00C0C0pXV&X(p@-(P(`@@Dw00C0pXV&X(( A00C 00 0C0/XV&X(-A-@P(MHp@`DpPVP u dT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@=0 P 9p+O--@ 0,M t T@0*`P3P0S pV@ rV00 dV000T <P }!3P  l#llC p VP w0\Q"\Sr 0S! VPi R Q X BR (  "p JQO Q   ܣP hףP W p P|X  BR    fP  BR 0@! P R   0 00 l1 ! `TApW    p AqJ0 0Z*0S    @P+,Ѝ eP `oXPJ Wp X <  BR 5  0+(t(+,7XV&`V&X(A-PB`Pk̂000UpU00CS020S 20@T[UU  r0@0w 00 C@@x 00 C@0@0  0Dr000w  B0x  B0 00 Cr0P 0w 00 CPx 00 CP0P0t0E 0O`A01 H(`ЍP(= 1 000 0 0A^20@ 0QS$ 000gPP mgp@00CS0H00S UX0A < U(|(t(+tW&_,,(&,%,E,O-f@ PTsMP`P=@s0SB030@TCUP3Y  U 0 貟@ ytfX   X 0SB01 x`ЍSVP aV HVP@ 0S,Y0S UPP;  p 0/S9S W:r)00CpßS P 0 y' : \Up@L 0  @0(KqpT0  p SplTPc@0S{O{0vSp pw{ti 0 ᴻ 0P_q,xt(,m ,tW&-5-, ,,,,,H(- BR00/0S0/@0S/ R /0@-00@00C S  RR R1\0* Ѝ--000C S0S//QX0 0@- ^ @P U@R000/hV&p@-`@`P6N0Spv@TpSSSWS@S P p@ hV&@(*p-G-pP@R`Q7 @T`r0S 0 i `V@A00CS00  0 @aq匁 Q  R  F@TPP,aHqH0 R R 0@TP@00CS00  0 Q GP @1@ST@Q@`Q 4PGB`V0 8hV&-! .-tW&T--..-- 00\#P0@-hV& . .0S/p@-@PPEPp@==A-@1Sc`p@DPU 0@P00` P_\(G-@P0LaL00 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0{P 0T0cP0 oP0S TPT40@@T0SG\(x( . .hV&A-P B00`0QՖ 0S 00S0S006X pW㻼P ᷼P6p60S0S60F N0 B/oS60"N00S R 0 0-S0F0 1 Q0CSRC0SQ 0S! P0   000S 0 0^0 PA. R   R0 0\(hV&4.(PG- @@P0S`p0C 0 XZ0OA0C R 0 0CS0@00S t0S <B.\(S.(|(P0 @-\@000D00S 00CS000S G(\(|(000C S/ @-9P 0 \(G-0p RP 0S6Q 0S!0@ C?`B10 !<,m``@ `e0i `` -R \ -Q0S 0`@T0:SE 0R@/T/:Y  @`4@T0:S   @`%@? `0 :\00Y00  T@0 CB!0 4$@ Ѝ..i.p.xW& P@-HD0P  Q 000CH Ѝ.\(l(!@-$0S Q,0S-\\ -\\ P0 ^:P0S0\HP^0_@:T($\(..p@-H@HP080Sp0u`0CS0` 800C80LW&X( 0R @-@T 1;0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @LW& 0S/xqQS  0s0 S/00 00 0S/00/04 00 0=S0/S 000 0@-0LW&/p@-`R`@PP t0 0Ppd0 Pp0-S0S0 0pV ($00080@pH(D(/LW&O-RM0p0p R pl"l2lb @d 0SXy XR00CS0`2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B Ry @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { h KmV&4XV&`V&X(LW&0-0@ P RLM00- P0l l "$U0L 0T<0< A 001 0 LW&///40/@-@$M 0T 0P0Sp`@T*vpPT @T8PLP @0 P $Ѝ@XV&`V&( 0.0l000S p@-XP@T T D0T@p8040@p 0/LW&( B0@(V&(@-0@(p@-d@dP\Pp P 00008  P8 p@V&LW&G-DR0@T @ B 0S 0 @ 0r8 0 00CS00 `)V*V V v va G ` 0F S꜒ؓ , V@0000 @\V. |V ;V&P @0 ;P @0 I@0P PpAx&P@0 :@0o|P@0 1@0@0@02p P  00P000K 0 LW&V&x(|(G-pc0@0 T T+P,0S)㰀" |PP @̸ n@@`P  0R}P @FDA@@T 0 LW&p@-`0$P P e 0R$, (@R   RP8Pj    Q  00000S@p 0 BRp@ U080@ pLW&Z0@-y0 000LW&@-@oPp@- @fP P @0 000p` P @`@`LW& O-鰑`P0  Pᔱ@APp0 CR00S00 s0@X ',10S @%X U _@P@W W- V- O0@PpGWPV oVP 000 0V p0S 000LW&4G-PJM0 5@0 0 04 P00400D$0f[`P  0S B7  40  |4 T[t$0000 `SH4 ` P,4$ ($00CS0! 0S$@PU3 0RPPS p00SP Pv &30S l3p@p3p0pH00 0S  0 v`PPA P5 \P p'200pg PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 Pb@0000 X@ "00CS0N001@@PsH n@m1000S 10 A0 SGl!|V@0  0 @00C0,000_60 000CS010S 00 0 0 0 02 P B1 0R z0u`@0PEPUZJߍ5}00CS0`R {00LW&t(`V&(V&|(XV&X(00O-ԟԯM0ϟ0 Q02202280?_@? 000"`00/20S@0Sʶ@ 2P갦ПȦ,l̩@x ,/Q00S .00CS0.0.Q00S 00C00000P`210S3xPVTP"P_ SPMpMxU0@#SGꐢСĥh$̥ء  p00@ Sr0pG A0@Sr7pGa0@SQrWpG[Lpw0 S00C0t00" P *'P 0p@W00@S p p p p p pq00@0pGSq0pG`0@?o? @2;R0Sp $ [\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp00s0 S0 0C0~0 0ĕ@00C0pW'*00C00'60'3?00 r R~   B  ĕ?pAp00s0 S00C0~00•00C@0W$*00C00'90'6?00 r R  B ~  ĕ  B 0'3?00 r R~   B  w$00C00'<0'9?00 r R~   B  ĕA0'6?00q Q~A•W?p00C00'?0'0@SP P1P0U1 UP>X,UP/>P0 |P000P$@9 0ЍP0 ,  0P$ 0&P00 0<P_ >P &P000p0p0((0 @ -P 0(0  p 00 HLW&V&X(XV&x(|(0100051B1]1H(D(`V&(&(i1%`V&z1 {P B@ < } p l {S  D  B p/#P0p*}P0$  @@   ? }P0 N0 p 0G$  @ Hp0H! , s@ BR #@jx!0  = BR@ Ĥ0R@0Wj%S` :S/ #S0[ 0 p>0C Q s@ BR @:W0 0 @ R)  B 0(0:F!p0ᜲ ՓP H02!R1S p0HS2@p0 pXp|  0X2 ` !p,!!k00S Go}S㫲[| p'P023Q w0 00"0 `!a$0 0 @ B "  0$2  `!G-`̠̀0@T@@0PU @ 0S 0 0  B/o"L`0p 0S 0 W 0 0 0+LW&@-/P0@-2aM0$ 0 J10< 010@0|1|0000TPI@1| 1Q @@00 dp 0S $Q. 4QG Q ,4  8000<  ,Z000 0 0 0 0 0 S00aߍ0  p0 `0 H0 D0 H00SRTS,0 0t(hV&l(LW&`V&x( 1 G-Vp0 00 P" 000P6LLLLLLLLȻL0$00p@[P 0 R 0`     x0@0S 0 00% P0, RPX 000@ 00 00 R, R崷P4 A00300 0000    BR   00n` P 0000 CR Sm 0 P P` ~ ``xs 0 0008 @0C 0 F009`0 Sp]P \0 R   L000`0S0 R Ӻ0 0P 0 R000$ 0  oP 0@S P 000b `@` 0P00`M P0 000000S$ T 0S |0@000@00S0P0S0S 000@Ѝ0$00pVLW&17PW&hV&A-Q@`Q` @ p0 P0 0X@p 0P R$@@`,R ( W% R"pk0 `4 kP )/Ґ`P 0 08 00C0%04`Ѝ Q  0Se0 00 00 @ 0LW&V&11 A-P@0 P. 000`P p@``@@yP 0`0 U000 PPe``0SU )PLW&hV&1p@-@|PP 0 @MP P 00000Sp ½ppLW&2 P/0S/80 P/0S Q/0(p@-@ `P<00`Pp@-`CP卽 PP  %BЍp @PB+(%"   tC$ 0P/(RQ%DBBPp@-@ PA P k`A. <Ap2A-P`@XpT@Q00C0V PA-@(p@-X@X`0P0000 -00CS0p00Spp@ݼ((|(p@-PH0@TpU@`V PA`(@-@h 0 S000C T DtAP zA,03O@dA T @0@@XW&gfff(p@-`@0 Sڌ S  SAPPT VApԹ0S 0 S ?APƹ0S (H(p@-P @60Pp @  0p(@0@-@ P  Q ,@"A0( 0 P/ R/(C-@sP0 U00000@0CMS񟗧(l` @@P @2@n嬼  AV @ @Uh20S T h`H"H@@P(2V0S' `@p@" Bp8P@4P 1 /m 0: S@!00`x!`h!x `V'qP4P o- 04޻ V U0S00  vP U- 0h@00CS000S Ѝ @{h K@T  NPʸ`F@+- 0X((hV& H3 2|(3p@-@PPP U0p - xy@p`U @pU , 005]3}3pO-`PppW@p  70Ù`ȐȠȰ0S UT  %O!   0@  U  T 0S@@ `U tW&P |,Z 34p@-P  @?pp R  ?pp ?pp ?pp  ?pp(3p@-@PpD0 0RPPp03/t?Pp(O-@M0 @ 000Pp`@A ]`2@ 儲|U  0Sp"p2 0Sd2X" Ѝ@0SD2 R@00CS 0SP P , 剺"?PmP pT ?0SR PMt0000 S|L1 0R  >p)} B R$ v+ ` >P g0S  >P  >X0SP 00CS0X00S T0 0 0P_(H(W&tW&pW&D(2(2|(O-`0@D#DSM@@s` `00 -p 0V 0@D<TRG 0p0sS vS V`p0+S -S ѹ P2 ሢQx PR: U/P    [%PT 0 K@0SA0cЍVW p p01      r  %5S >p* $ 0>p0* _Y0 !pW fP00S0S宩P0ST00ShjT00 D 8 .&3@ .D(H(33,4tW&d4D4 44A-PQU 00CSQHq1QL R@ 0r`0CS00 `01L00<S0S  0qL0S 0CS>S0SSxd R 00CS0N0 - ,S4p@-@0TP R R R& 1S# 0 еPpR!Q QT " "D0600S0T0S 00S0e((|(hV&@-0P00 NP0  彌 Ѝ4(QA-@ 00CS00 P `ppp F?U U P@U00CS00 ` 4A-@`ptPt@0000S 00S .(p`V@40`00CS000SA(((|(L0P  A?Q Q R:///(@- b@0pSM10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 ̴p0 0S" UEokp$ W`RUN0@D>T000 0Ŵ00 < Pt0N R  DTR 60SЍQ Q2 1 @D@(T(hV&p(PO-P@p 唯P `ᎯP 副P 0PEpSUpUX@@)` PPp`Ppl44bPPEpU]X P$d$t$ 0E0 10ST@ T@P@UT @Pcs1 R 00ST|y@ TL@P@UT ,@,s,Q0S 00S lX@@T`X `Ȣ娲pGY P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP (PP oLPP1 ` d0S_ 0E T0 S R0T00 !@1 R i& U@ ^00CS010S 5Pz`PP@ᘀPq0S 000A&T 700CS0t00S @@T00% L?4u4tW&( 4y555k (cO>W pW&55|(G-PP ?p0@`吐 D0S 00S Eo0D0@000CS00S еpW@UG(((|(p@-H@P02`S@20CSpᑲV02p(,0T0SP/0S//(C-p@`1010r!Q0@S10C1 ЍqXPU X2尿RPጸ%룿P 0S ᦿ((@ 0P/!!R /(p@-8P\2Sp@xur\Bp(0-OM 01`"R !R X"R   1 1d"1!d2S 4oIPp14 4fIP P!0400]IP(14  K @T0dH;`0P4 U @T 0S .P00CS0 !!B:̱0$0(0,0000D>S 000$ y9;9"N!031((t(( 0@-`"dx(p@-L@'P_ PPp0B/U00pp@-T@TP0 0P0 $0 0000CS0p00Spp@虴(\W&|(A-p`@PU 90PPEU` XDı0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 0 000CS0h00S 8sDP`0000 0C0H((|(p@-@P@0SH00Spp@00CS00  \W&0\W&0\W&@-@P$Ѝ5-@-   Ѝ Ѝ/-@- 0  ЍЍ/\W& -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`OP$ 0S! h剦0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 5\W&0R\W&@-@@\W&@-0rS560G-@0 p0R(0帀P0=00僅=``F@V@p@DR000 S=S B`` R`ť` @G(P`V&X(XV&0@- 4@ 00C00 0 0ЍX(&60P P PR /0@-PP@^ ^ R0L00/A-鸀' 0S RQ'p`@PU pWp0 \ 0S 0S   3/P@P00t(0SeA-@&PˢU p`pp0S'SSP@DAL'̄PP(  EA5.6I6F6 % A-P0`Sp@    3/@PP@X "W p0@=SPUP00 00CS00  0 00CS00 w 0 T ` tW& [O-A0Sp 00P̀ 0`V S 07h@PU* ЍY   R Q ʁ g <0aP`0 lX(t(P(@ 0R S=R/=R/A-Pp0S=SRpGp'㽩h0h`!0aU@`T 0S  APU``@X(t(@-1`0@S @  PPV 0 `X! K dS  `C Ѝ@J!@q   R <0 2/0`6! 0R , R  c0a00 0000@!L @UP U0 ^00CS0\00S ЍY0#L 00P P hV&P6(X(|(@-@P= `&P pTpP Gpp0  BR = T  `\ Ѝ00@0c6-GMP00 0DP00$0 0  Gߍt(p@-6X@P0` @0U<m 0U`00 0p@X(6{6p*-!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝ\(6p((hV&@(p@-@`TP000T 00CS0p,00Spp@@(|(7@-P@T@ PP0 P00p Ѝ0 xP 0 @ޜ00000 00P(X(6A-Pp` 0  0@TPUA@ 0@00`t( @-:@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =@@(O-p@`0QrSP W 100S V'>nP pPW`0I?o2V0S Dp`VD10@T0  ЍOe @0P=S7 P( PW0 00 0  啯`U 0 X  ЍU0 00 U 00S ,W ?P,PPPP[t(66@-` pj@P@ Ѝ0  R@ PR000 00S x0000    0 @@DT@00S (|(A-`pĀ@TP0U0    0 R R   0 02/0 00 0000X(HW&hV&A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V Y@6t(PP@- [ a6C-ԑp000P0`-S㬁@TQ g@ 0@00`0CS0`10S Ѝ @P=កP 0 @0 0  0 00 000000  RP 00 00=S l0T 10=S010C0 PPP(X(HW&hV&|(  X(p@-@PTpw@p@-˷P@`P \íNP@ xP@ IP@P(P0 P pX 76t(00@/ 0S0@/s@-@Ὺ0 0-P`ᶪ0S 0"S U1r0!l%*0S`0Tz000 @0C?o2R0SЍp7(&7@-M@ @3P ލ83P@D0 SQH0PP0@-M@ 3P ލ3P@D 0RPH0PP0@-M@ 2P ލ2P0RP 0RPA-@`3P13@ 0SC P2UA 2PPPp2PJ! 0RA@- 0-RS# 0S0 00t  Ѝ0SX0 0P0S00 040,ܤP$$x70@-0P!S@M0SPЍ0P{ 0SxPUo U U Po U d2P? S2PPEUR\ltT|TTTTT8H O  P  P  P  P  P  P P p0St00@-2T @10(S0)S 00qop@-@`P(P} 0Sz00CStx8Pd0ToopPP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(Eb80S0!SPpp(S0)S0S pp@-@P卣PPE燣P.U)  t    0op=Pp0 \0!S0P p(S0)S0S +p$677@-y0.7pW&@-$0$0 00  (pW&8@- @ R1P\0* (Ѝ8O-P@,MIU0pE `-R lRF 8R -R| P@@P 2 000J @P  Ape pGW` PpW ````F %RX bPPx8pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\@p @P h姪dlㅪX1D哢@P ;@@P0S0Sp@  . Y0Q 堪 RP!|0*QP` R.pu`  lTT{.w (&% V Sg 888cOtW&1 S880@-DM`0   0@@DPU#m.@0 G~    0P x, pp LdDЍ0=[|P "k((.l9W&,%.*p-q99r*p@-Ѫ00S 0x 0t 0vl0l l@0   PU L@L0L D0D P p Ppx(x(((LW&(W&tW&\W&pW&xW&p@-@㴠0@xI 0 0@0PU@000h@0\ PB0S00CS0400S Jp@j@C(TV&(hV&((|(P/p@-@PTp000@p@-@Pl s@-0@T 00` `PU Ѝp(s:@-p0PU@` Ѝ 0'R"R0@@ `@0 0S @00ǣ @w@`(V:0O--tdP0`4P @1,M01%xP#6p3PEAULPE@0鋟 s 00P@`V0 S 0S\V $SxS@00CS00  0$ P%V0%S@S00CS00  0`90*S>`0.S0@*S4@YHg<`$@0xY0WY BYR +%Yv AY* X0I S#D"T#######E0IS0Q[  $0'S"S!Z 0S 00吪{[v& t  iTP  GP T! ^d\s00v t 0 | &::4:V:(& @(tW&"(:\\0LS4"<"$""," ""!!!!!!!!!!!!!!'\ \\ "\ 0 \M 0\? \-@ÕÅe0\fnrtvabXP \X P  \  P\  xޠ!s v  t 0 0 p{ X0 , 0v < Lսt  lͽ0 R0 0D@000  B+ 1H 01֤ +t v0 t  t꿡0$0$ [ 0t 0wNVBT,Ѝ3 峤嗜0C- 0`qMP` Pp @P 0 0p@PC 0p W ) PuY <YmP0P( 0ES P G 00S00H l^YPH0?S0 -S00H0,Ѝ$:;@&@,@4@`@@ P@-  WW@@@-0@0 0 \XPX`Q   0Ѝp@00  P A:4A;AO-Mp:LvP0ԑԡԁ0 @P1 0S. =9vPP00  ?cc[pכP 00 \a8i[L̛P 00 4śP !c 0$00SЍl[峛P 0 0o[婛P 00 墛P b 0(0 `Q 0 SᐛP00CS b0 0 0S;PATA:ZAaAgA0K00M00P0D0 0C0D080;800,0/(#Q00<00,,8 8 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@A0@-0$ 0d8 Ѝ@-@4N000@-@4F000@-@(0(S00 0(0,0Ѝ`t p@-@w'PP8<@ HPD\`U\`, 8V'`n'V0,0p@-@48- 0,0@-@48 0,0&bj @-8I @Z( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8 @0<<@00,0@-$ (P U ЍtnA@-u(PUnt wA@-j(PzUot Ap@-0MP`0@-S00(00P0 0  P0P  (Q\   R4 0F03/ЍpL*;A@A-Pp`@Q`-VPQ<P 000 0 `/P-V 000p0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp<=>?p@-$@P0S @00PpH(7@-l@PU Xs Ѝ0HP0h(ea0H(>  Q+ 00CS0@- u M0| 0-0 0BQq0^@Q ^ 40 ? 0 C  / /P(H(,@O-M`pA    Q TP  XP tPW `PU  PDoT<†pS Z Y X W@  U PCT<p S @[  Z Y XW   PT7pP  X W P T;%S( < S. &S)  S$ 6 CTy"  W(  * /49>T`P($F$V0S:Ѝ`JS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 d 0s @PpЁ0SU ]t[T   Q  s0녑0t  Ps U>t<P pCCCC DDDFCD1BzC%D:,DCZBbBaBhBgBpBoBvB}BBBBBBBBBBBBYBBBBBBCC CCCCCC(C'C0C7C?CNCMCUC\C[CdCkCsCrC9B-B5BCCCCCCCC5D@- T:D&@-,0, P 0 0 DX(SD&Ds@-@`000 #S@uP0S  0Q00S 0 QЍp AE0S/#Sp@-@,P$p0P 00pX(S庖@-PRP@ p`=p 0R" Ѝ裛0"S0SO 00SS  00@O(&p@-d@P0S 0S 0SS 888 U   S$Pph(VL @-@QxPQ aP  X0    P      Ѝ@ @ЍEMh(0@-@PPM 0SLD00Ѝ000 0qP0 0 M(1MO-Pp`llM 0S ;$ ,i P 0S  ߍP/1 Q 0S x@s?0   P P@ P@0ST WpU: 0S  PS 09/PV/` 0 `h(GM]MU~MM@-岚0S S S8 4 ЍW S$ Ѝ'[N NMN0/7@-lP$ R\zP;@ H$0S p (rP fP Ѝ0h(N`(NOp@-@P 0S D0PS 0P0 K 0R0pOO@-4PD@D D`DpD0S/00 HROYO&D@-TSPL0 p@-0"SPЍgOh(wO@-T8PL0 p@0"SPЍOh(O@-@PPM 0S00*`/`0 6P$ /Qp0` `0 0&PT 0`2# 0 0P!00 00Ѝ M(h(OC-@0M  R2!<#( xd, lT0 `D8 T44 H$#4R0" ,$"4S "4S !4S !4S !P0S t!T0S XpLal匑P8W0 $ЍCւ0S? a r 0  0 0US- !S 13 0U SS0C SFFFFFFFFFFFS 0U  e0 l`pPO(&E^P PPP"P)PO0P 9PBPKPTP]PfPoPwPq% PP% O-(Q ,@Q 0QxtP Ѝ4QPTjPQ@d80S,00 80<0S#<0P@SPP@LP1 QB"=B`p㼑弡弱8W0aSq R / <0R 'P)0< S P0pS:`(唓Q (卓Q @P0S0 BS `a 0ph R R* \*a  `0(S0<PPPPPP0  P," R,7 P 0 <`N#>0 /r Q* R 0`=jM P R 0 `/!Rw j(  ,1S jD f/j␖01P P%Di `(h(RRVEW}}RWEV R,S[SS4((&A-P@`,Pp5S$ Pv $0f0Q hEM%R 0R00000( h(`(S(p@-0@P  P$p@N 0@- 0S, Ph(@-P  (O-@-: PkCM M00 p*8P 8OP008800SP : DlP  r@00t ͱ0hS ۑP,X <("O(0 0 $ P  P:HHἂY9 0  $0P$0S 5$02 婑P,唙唩$ [ 0S$00 $ P$00  P$00  P$00$0 @ wP丟$& $ XP($0S  S;ƑZ0;s 00 0P$ 1\  d@  Y= 0SX8 0 S(0(0 0<P ) 2P  ) P00 $0fP$0S ++RP0  0$ t P 00 $0KP$0T0 8 P 00 $0;P$0`0  P 00 $0+P$0X0 ސ P 00 $0P$0\0 ΐP tɐP 0 0$0 P$0d0 4帐P  50 $0P$07 姐 P 50 $0P$07 嗐 P @50 $0P$07 r |凐 P 50 $0P$07o b @w P 00 $0P$0x0_ R g P 00 $0P$0|0O B80 aHy0S0S _0Y: Y0 l*2 0TPSH )H 2 0S0> 0 0S @pCލ Ѝ30"0 00 00S D 0B  RQ<0 +(P04\  BB! - 0S 0 0SO 0Cs RSTY0OTY0O0OZ0OTY0O0OY0O0O0O0OTY 嵯 0 0 R0 00S 0 J0  d2000"0$0 0 0 $0P |,@$0!S $"0$0$ 2 N 0S P E 0$S v: 0 S Pl 0 0$S & 0S[y 0 Sq PP  0$Sh ώE h(SOO1MwHSd(d-dTT(;TJT#T^(c(gTtTTTT"TTTTTTTUU2URU(M0I(&sUUs@-`0PU V  PՃ@P hЍp`PD! 005M0@ӯV0IUh<$00S @-00W&p@-@5S4 0PSP p@WPp 0S 5S 1S I|Pp5S T \Pp< HPp(( PpIh((NUedArdAVs@- 1 AP(000( ;ge V( 4 5S P~0S z0S 005S  P0P (5S `ЍpT TkPH`0bPWEVh(fd*Vmd;VW&x^(gdLV@-@P f/=@( 0 DW&\(md0P:/ 0#-3@-P P P 0S S@@ ጕP@Ѝ0@ Ѝ/&p@-4@4PQ6p@`    @W&\\@-t@t0MQh  `P0cS CS SS 4嶮sS00ۍ0`(Aj"\\@-\@\0MQP  HP 0nS yS0 $哮00ۍ`(vk]=]0@-MM@` PP 00YSP ,uۍЍ0OPL]\]n] 0 l4((&@-@M0 XP ۍ|]W@-$ $0 ЍK4((&4(@-YMM@p ip\YލЍ<0< S <f%Pژ10YS<0<0rdA]]]@-*0gj zgzz'z'&z'z{zgzzz { CiЍ5]7@-P0@ 0$S0S m0S7 TQ,BQQ, QIL10S 8@0 ᦋ0000! Ѝ0C0AS dcccDdccc dc8dccccceKZebeLe geee%zeeeeA-@Pp(D[<<`8SAv 0 `ee0/p/0p@-  R( R((,,004488<<DDPPTTX\@X\Pp Rp@PUt @ 0T0p  Q CQCQ}C(@-@t40Pt08Ef/hWEV0H @-P \PY@ PWEV(80@-0@S K08f/@,(0 \ P0//@- L0 Dp<<Q8@8P(` R 0a$f&[f\X&P7@-@ P 0PPP 0p 0 ,A(P0 Ѝ0h(vd> R0@?o2P0Ss@- `P@P ݆P0 ׆P0 |цP00U`ȆP080DPD p0 $AЍp_"sfX#h(ud>0@-PM wdP@` p DA 0 4%00+ +Ѝ0h(zd@vfffs@-@ `p oA0  0 0`P   0   0  h0  P0  8Ѝph(td@ffff fg>gfggg( p@-@PM`P  p  ( ىV V dPЍp (dCH( p 0@ 0h(}d(@gߟ~d(g h0@-PM @ CCP 8@4P 0p0 @Ѝ0hh({dЀ>C-P0@p!a嘁,M00 ]p0S@dd@@  p  <@eP qP pP $0Q `0S*@P @@`QU!W rU 0C R00t` 0S,Ѝ00* *  P@8 .&Dhh(|dGhVhhdz 8hhO--PMM )@VP3040}=xSxs$0(,0$ %p L.4@,`@8V "0(000SڍЍ!# С!7H! (@`FP Bp @@PdR8ppV @0: S \"\\D040}=$0$0(@,@0@0  p ,4p`V1(000(S}0P:*  0P3@@^p  U눁刑刡T ! x I`!R0$@(6P(p? (G`F@ @p  0Q` 4 ;$]qp 02`p , P \P rWh(wdhh$ixd i*i@i&ciiii(&(i67A-PM ' @AP D AP $1?A  0`0PS 30"S U1r0%*V&  0p0S  0"Rsp>PdPd `尀pp0 8>0ЍijHj`jzjjjh(yd>jC-p` PM Q> P 03/ЍCQ@@ R; 1p >\X&jh(  0@- >h(>P7@- P@T寃P D媃P804 p Ѝ0vkh(wdP7@- a4P@, jp Ѝ0h(d@j@-[(0   Uk&O-,M00@Q`pP0000 0$0X,Ѝ @P  3pC>$ P  $p $0 S TP@㰐尠$0S"  0 00SW   0 S 0 @0Dyl! & ` lp@-@PPV1P' 0P, 8>0P H =0P 0P 0Pp@輣p@ 0xh@dbp@?U@@奣Pptcidyaralrbmngnts5g 9 lP0 P-  #B%B$14!8<p)p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @p)0"!#/P/)A-PT0p(,`B@>,0T@@DA??@@@p)?0@-<@< (20,20ȀP0  P*0 002p)> 0R//G-`0(,Bp  Pᨀ E@PPW ,20CS(20CS Gu0p)ssp@-@`42SM%^ d E@ 82<"] 0 (2,"VЍp@QO嚢<"82El@B`卢,"(2H07X"\4Ѝp@1p)Y&ssst(t2tRttt)us@-P`ᐆ  "0SЍp00S@0"S1Ds@-,MS$y00 $ 0 0I au&A-`0x @TʴB<P Ϡ#p 0d  ? ~qp  RЍA L` 0S`@D@,1 ЍY&w xp)@-`  ppPp@0h Ѝ!$LR@ @dQRQ @"'xUp)Exp@-4@P0S( ᣄ0B1pp)O--ʇߍ@ hQS/2SrW#, p` 0 ಟ00  0`p6W0 002Rp`"z p p< T"QP20H"gՀ9 0(_ 1 RS Q0S!Q10!J Gp12S  ?01P' !Qt10p8!1?l0,12S02S 0 0S>0)S Z0)S  "Q  R  Q !Pa600 0e0<  6 0S<(p)1{nw:{ I{Y&f{u{{{~{|}{${{ ||4|UV|||q|z2||@-tM4rW@Pp@lЍ@P(0P`  B1 @  $SЍ@ 1 1 0P(1 11< 01 1 ?011< 0`w1 Pr1 @?0Ѝ@jp)x }&}5}F}Z}m}~}}}}}O--蒓Y`:X& "!R &/ .0 1  Y 32 $4(5, Y \   Q R ` H2,0L2000&0S, 1S) D, W000P0  00SW0!14!8!<!14!8!<W0,p0`\T (`0 S( 21S$ / .0040 81 <W , S  PW 32 $4(5, W0\,0000P`$p 0 0$000P fS 0 S00$000P P LWT $0P0 | 0S pc 0S 0s X2 0 RS  $0@DoO@((0 F 4 0 8 0%4 0%80 %< 00p P0 @2S` RU 0`BPX 0 1<Ap 0PP,2`0C 00PPM(2p? 00`PP pp0`Fa ??`1`<A` 0PP,2`0C 00PP(200PP? `Fa?`?`` 0S\ 2S@X @TVJ041S p)x}} )#~ )~ ~)H~l~~~~~~C-LBp42MgS4jP,r,b42S 0PCU42S 0S QPԁԑ 42RSgP:B42S^1!$1(1,ЍC0S dSp t04rdW2S 0`~p 0kP"R S0SЍC@D\ 0ЍCSP 0Ѝp)~P)~%V~:x@-0@M0@ pp`Ppߍ\ z0  0P \ zt02S 0S " ` PDR!SR г0Pz"p)0@-Xa0 0LAP d2S8 P(O!p! 2SP0U  $pt"3 Rp\EU$p%0 00P d2SP GP@ Ѝ0P0!!1 Y&p)mdAV)> ))A-@T2 @PFvP AvP  p@: PE ,0S ,><<(00S<(00@1 $g[P'0FSʆ`P0S -S@= OP00 @@P,0S ,܍ЍA0 ;OP u8800  0 R00S' ,10PAPQPa400C0 QC^/y0S0Sy0S0S C 0S C CC$0#p t PS<(0 / PC))   vk 0/*)0/*)0/*)-@-$@  a r&G-P`py@0S   0S X U `Y 0S 0S ;y ;Ѝ*) )$q7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-   C-@M Mq` @Pݍ Ѝl!rop@P=0LLD@rOP,0: S0RP0 00"PPP81: S`P% S  R  r"PPp *PPPU r\PP @P*)V g*) v@-6P 000, ,O$Ѝ  Oۗ.)0@-4S 3/ x*)@-x0 @( 0$x{x@l*)@-ux@^xwkx@@-p PL`@@0 7/P0 S Ѝ ^00t/)O--:M6M@  @  @ P0 0)PH @)`PMF 0S=f vY 0R R0 p 0 0X@OlpT 0S" P%5 QuP吅eU \ 0P?P0HHw@ލЍ03/0P0  |PP@p ` 0S0SW SW hP0:0O.: ; p` H p# j 40@0Z0C @ `V)` 0  0 0!000`0`00 Z!   00 +0 0P0 0S `WrP Z @P ZH Yp Z\0S< e So Sl pWp 0S 0S( @W 000 !0zM0S# 0S,aQ_00CS0"7@ T 00CS0!- P @YT Y@DOoB 0Q   @OoB` 0 @0  0 0 SNT/)&(&vk0@-M 03s0|c00@Sd 0SmPP RePP d 00Uh `Ѝ0S 70S 1@ W &0S\0S\  0/.@ A\0Sp 0@u0 @kp 0S0S @\0St  @"  @0Shb @D <P@ @0 @ `0x P|"%   T    P  @@``; 0 @` G H D/)/)/)əϙߙ:\Ě.IG-0@  0P 0S< 0  Q*p  PPxi  g 0`P Tu !URQ ,T l s0 p H0 0W40p UP > u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0KpP  DP 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`|-0, 3$.0 (/0,8 001 42 00$4 `0Cl00 QP  `Ѝ   0P P y`P1S1S1US1S 3S3S3US3S, L D`P0`$ `03 0(3 1 31300`0k00 QP    R 0P`00S !14!8!<<0!14!8!<@040  0k40  QP , E 0PA0O A0  P 45 ࡟ 0R  , eYXpW P0E5n 07#;;S`TXD $ R,0T T0,0T0 RCnD0P 2L0#1\0\0Q 0P 0L0 0#00P 0L0Pdd@p̛$@EJ RRaArrAaUm؜7Px@-p@`P P00 P0k 00QP   Ѝ 0P< !@ !0 P0j 00QP 4 X0P$m7@-@P L0 R0!0!0%^l00l0 ~p00p0 Ѝ0^ P ^3# ~\ L ~H00L 4H ,PP0008,8%G-XP p` HP 3 Ѝ00$H 0jQP D" X0 X0 P.MO-@,M0p@l@$0`P P " pP  $XPh3q$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p 0 0,Ѝ8(y L0 Q$2 q(@,"  P "  @P*"*  P0P S "!"0  0P@P $3 `ɞ P r0 r// /8O-`P@M䱟䡟0P0S Ѝ p W 0G s 0C0A s 0 0 q s w qpp d\P0P@ 0 `P 0 00 P 0 00` P0A s0 ` P pP0 0 P` P Vڟ :j| rR0/0@- PBU02S0P^0A-p`|Pz@P  PpP P0R*"R0R0ՠ%O-0p` P\PPX Ѝ$P  qQ 0 0Q\@T(2 R@0 PQ SC0 BTX t0D s   0 TX Q  0 0 n x P [ P J BPTQ2P PE*lՠO-X`0pM@PP`Ѝ n0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/BP o  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"0# 0g0 QP 0 P.ݡO-@`Pp㤡失P0S00S <q.p@q8WO$0S  0S 0S,0 ( 0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0&, ^x@-?`XP\@#@3P@T@TpW @@T`L0)O-P@H@M18 00TP0S<0T D0S Ѝ1@ 00 `p0Ds#p w0 0 0f QP GP 0X:0 0 0f QP PLH  P<0T 0B/)O-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:꼢B/)@- @/px0%B?kP0S a0FS `C dmp@@0T Ѝ?  C0/)0 PK %//)O--` 1aMV  0. SP0 S@0P`(0<@@0$0 00@,D0$ R! X0p1#r380#8  ,0e80, QP r0P@0`(0<`@0$0 00` p0C##   \PW  q240pGDD04 SD00S   408 2400 0,0e80, QP (100  RR R0(100@0D0 p0D0G >\ "T*P2  (1 0(11 J    0 0B0 @0Paߍ0@ S100S  S:I@(1  0I0@;+ 7k P(10(10@0 00 0Sa 0@ J /o<0(0"s R`$ 00P `, 0l0(0 0$00 0<0S<0! 0C<0 0< 㓲#P0P 0 P P :P R:x U 0`$00`P1Sh L U50$00`P^(<\Q U`V  $   P`$ PK/Tk `0p!P0hgQ P P0S*0`Q`  0' U$0 0 `H0i P H0 00  P@`  Q . A0  L L  @G?LL0CS \Q*V L0!st!0<80t10Vx1 , m$000(00UTX0$ V0 0  T$0H 0$00L0 00  @Vt 0 S1S IpQx1PPt!hR T80P PPL0sPPt!30It1@tQUP0U*0" 00 0p x1S TP@ 0I 0000@x1d`+gPP 1t!R1 8$PP 1@A03 s0Ps (0RZ U 0`$00`PR1 SR`fP0S 0S Tw[R P0S02S 0S0S 02ST] TXt! ;pQP @PP 00I@P sT B t1HH 8P$P PPPPPPL0Is0PP@x1K@I$`fP=PU `t1VS P@ ta``L0Is``@P !SP `PPO 0 1t10t1#40L0s]?000w10PP4@ K/TRjPP05P1U U0@Ih00h0tP0U*0RPd0x1ST0x!(P %4xQP0%8%\0 P0PEd0U03:T(y P Pt!dx1Zb" :0 0t12P0P`, 4 040PI!2S0P0 S0 U 0 P$0[00$000  @ D00S8 0 ,0b80, QP40 R80 PI 5P0e/)Ipw%0)E\ ФTS*Bp*XoҥC-P0@2SdaPX pP=, ЍP1 /K/iD00 8QP0Q:" 0PS00  Q puxPh`P 80"8 R 00 05 !${/)4Q ܦp@-@5%SQ% 5 %SPR UUQQp  0Q Q0/)A-lP`5p@ @ 0% Ņ~@ŕ\/)O-POMp0P> b5S5夢05ET0  dP05 ET `T 5d 05 !dP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0@a JQP d d0P Eh0K/0h0 h0 @!o@,qr0d  01(Eh  j g  g,10,1#40L0sK?000/1001001#40>000310 00 000T0 C`(%,5QP Hd Sd0P{ /)Jl4)+; S@-@ P 0 5/)0/4)0/4)0/4)-@-$@  P &G-P`ph@0S \ 0S XS ?U `HY 0S 0S h 7Ѝ4) )$q7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  YC-@M Mq` @$Pݍ Ѝl!rp@P=0LLD@rO P,0: S0RP0 00PPP81: S`P% S  R  r'PPpYPPPU r PP @P4)V g4) v@- &P 000, ,?$Ѝ  ?ۗ8)0@-4S 3/ 4)@-g0 @( 0$^gg@4)@-g@>NQgNgg@O-PMM`@pPtP0 P: S3/%jP 0rS g00P 0#0@0@>@ U  bP  ;P PU zg00@23MP@ S @V``帰张 `P60: S)^0"y>P@PT-P V+ S R"P-P U T@\ SP@`-\P@ `U@<PXp%t!0#PU00`00 *> p@P  Pf0Sx`X VPPth0 PLPP W80% ܍Ѝ} FF F@0/p/p@-P@ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P b_\DDV@@PHHJLLPPTTXX\~`\`0p Qp` CeP0@ S p@-0@"!Rc0p@-@PpA-0@PJ04S->C->C?X9>:>C?n:>CF 0? AC>}C>GmFEnFE~GX J.X R  $$((,S>,}S>GmFHHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqx+1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R,:2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P@ `$P`P600@AO-HMQM $#0@2`0F/ Ϡ _ 0YQ%P(,PDr 04P,`P `(0, 0S_(0,PۍЍ10S&  1pVW03?00?s0?0P 0 0(0, 0S_S(0,P0```00@@Q"R0  P c50 00 @Є0 03/`)  0 0 0 0  000 0C @50|* 095h0k40S %0 0t;)9)<) <),:)$<):)(:)@-P@p`AMM(0$L 0 P@ 73U0:t0 R0*d $@>0P 40  P,, #AލЍ` 9)mmOY 7@-0 Ѝ0@-\M`PpX @ ^0H0T0 `'!D0DP Rp9RLt4Pm\ЍX<)PA-`:L`p`P#3RP3R#\@A9)O-M`@ ) P0E: 0 0@40P$? 0 362Ԓ2Q p{ q Br sQ0<30<420S0 sH2pQ 04  0R  @P-( 0941ȱ r0 4 Y: 10S0<00D0`+2 `0Ѝ 0 41 020S 20S 0J` `$110010S p1p1000 ppmT9),:)HY&;) <)<)O-@PGMM X `\pS:0 5 R"0tSb 0S! 000S_Dy00 1000u 0{5 H0\00`0Q4p0Qdth " 8"0S/ | L000 0Pt HP% 4$0000S y0  0O.P3GލЍ.P3 09"0K 0 ; @p  0 0S s$  P1 $" i.P Ѐ䢟 L000[0 H  t 00`02  0J0  0004r00STP2r0"0H000H0H 0p 0 S 0 RC 3#004 S 0040P!yi 0L  0L 00  c  0 0~L000C00 S J8   0 0001   ps0000 l0 s!0vs  0_ 00S mmO9)<)(h9)HY&|QAH<)`74:)Yk9)4T  G-P`E@pXpAZ x10S l10S 00 0L P4ЍG!@PEU< 1 RP0H 0  P !`' H0S"00S U  0S 3x0S GprpЍGVX3-P H0 ЍU9)9)9)3h9)HY&mmO9G^t4:)0/p@-LP@088200@ 00 %/0@0 Zp9)00S/p/,:) 00S/,:) 00S/ ,:)P000R0S /O-`@$"P0 SMf0SD S0_졟ď080T C/ S ! R 0C00 0@]ἰ? 0oUp\5`!S 0 00Ϯ0 ?@U '  ϬR 7 R  0- \5S0 0/070/0 0 Ѝ P L R  H00 04009)9)9)Tҭ PO-0`P:1 R0* 0됑吡0 pP3Qx 0 V0A:0 J@/<#\%@ 1R  0 ?>#‚ @ 0J` @ 0`<0@0S   0 .0x@0 qJ1!0x 0hJ000(00S9)0p9)9)T\<)<)O-hCM0 R S ! R0* 0(Y 0:3 `0   4Jp/<#\\%p2R  0 ?>#‚ Ppx 0J`0 C c00d0Ppc C c a$5bS JQ,040(0ÿ 08I,10SC 180X @p0!X (u! RKK/W08:‰ W2p P| XG 08p,80<00<0S<00<0ЍG GG G`G  W  R0 K R Rp9)P9)T<)<)<)H:)$<) <)G-1P 0p` fI0  070@ 0S 0 0 80PS `P` 8UH0ZP000PSPT`4TQ$,$ (,`(PP89)sp9)<)@-@8P 080p9)G-P`0pS100 B?DS P@P 0@8@Pt1 ?H`10pA0 G   000 0 0 Z` `1 `#"p(,0(pV Zp`0PQ(dV0S\1@@ 0XP\   0^P0d000 A<)9)D<)P<)@<)<<)L<)P0p@- P?@H800P 0 _!SRpD<)P<)ޮp@-X`0SpL0LP@1D@A0S000pP<)<<)L<) 00 /\<)O-H0MSP` M 003/ ލ Ѝ40 pP䣟00 +0H00@0 t0 /  S 0V 0&H0X0t3!0S& d30SfS t0  " 0  0励00Z0 02\+ 2R720t0S22 Q o   Zh"$/$+PH"42 R{! {  ! t R1 +졟W000e1 Q5 10000S1H  B/oQ" RK h!B0   +BLD)P: !P R, P s 10S0Q 10S 03/     0P  0p`V0 )9)<)<) <)k4:):H0:)0O-S0P0 0㘄RM`#V@M(, : SH \p(5R<R  P  RSV !0 ,V0 PB?F0`s0 0S0 0000 0Ze 85w @5D0LT 0 b32 RP U`P80 00S 00`PPƯ RF 0 0G  0 #30t ?:#b 0PU p0Y0Ph0SM  UiV a08001(P Y 03/ RލЍ}0 1TP+U000H R00S 0 0G n*GM'PR0@S P\r T0  P<)9)H:)4:):H0:)@@-@{!SP80< S0 80<  D zUp@-@@PU DoQ P XP$0 Q0: pp9)@0@-P@80\U< S0 80< 00p@-P@ 0U0p81 R0p8@0P0S 0SpʿP0Sp 00S Lt0S 0T0S(-p@,g9)pd:)<)` F x9) @-p@`MWP 1  P  sp`V' q 00S0H0S 0 0 $,00Stt, T?)00Ѝ@L&P0S 00`ЍmmOSg 9)9)<)p:)p;)4:)0@-@PM \" )Q Q0 $0ASЍ000ꧯO-P5,Mp0 /@P`0 T00: SR) 0Ḱ0 D倡 R09:` V `3 V `!P@P(0S @P(0`S @P0!0*0 0S:R 030  `(`\Ő 0\"  ? 夣 ? '0刳 S0Sp30m Sm `3 R #R Dr83 R R( 3  R0\ 0㵯  Pq 1 000`?010S) 0A0 0000 p 0@0S 0Ylh# W *$p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 ]P  ,Ѝ<)9)Ww@-_Q _봰&s@-@P `0S 0S 0 SЍp&O-EM` MP0S 0S PpP P 0SPލ Ѝ000S  wP b0S 0S 0S A0Sb 0Sxp 0SdW0SP0S 0S0 0$d sS80!"70  0 " " 0D@!8!? 0 0J 0Jd!! 0yJ0 hpPX0SR "04 0 R0  0"> 0, ß0S9)(0, 40A"@8?S%#pR [0" |0S lhbPUt @0S HDb@PUn ,0SP@PPDP\H0S  `$Cn* l%xl%|0S l9l60p00S0P0(% 0,0UA:000S 0S P H1 H0S 0S,0S nP  E%P   000(=PP 0SPP P PP P9)=G`wϱ4Uzֲ 5\c A)IdzV  O-H0@Sp`M W0R0: 0P 0 H"p`6<"0 S0 X20SW kЍP 䱟䑟  BR 0S#/  !.V  R.. P x!`T  R0 H  yP  @@" 8 < P8 <`P0H P 0 2$: RP `  ^ V UV U ɽ=)ٴ9);)9)̻9)4:)"9)00S/p/,:)00S/0/,:) 00S/,:)O-M,Mp% @"<:$Z 0 0`SCZ ` p%P# 0`VP!00 0؍,Ѝ0 ( P  X0`VPh0S  0` [\ P  _0S, 44M $; [+Z054%00! ?0S S00:00/0S 0 S00 :0V00#03  R00S :0S;  0p 6h: 0S RT gP 0@4[< S04`?0: :R00n0 B?=QP%90S  0  0 0 T 0/P0 90S, 8M@P$0  ZP00 0 S_8Q<80S8 0 V0;R02*h0S/ 8((d0 #0 (P K`80S (00 0(00h 0`  @((l#70S 0h0!7'(5SZ/V U:'<V  3 #P  RISQ; !0D 8 U0$000(p g0 U(7PP0}X 0Z~uP] 8'000w0pP"P6'~Pk"sh0S0P%Q_!1Q 0PQ^100 U0 EPP P00t @?1#R 10S0B0 P  Z$0S 10000S l50S $0S 00 P0|t ?Fy$Q  40S $0S   Qc 04 0 S0 0 0 0000 0L$000 0 #600S,40S P4 PP  z@ p t 3RpRLtRPXd00H00SS1 0S l30S* \P00  0(+$P 2 +2 0\00Q&&:0 @000S428P040Qd/<05#fP8`P`U`00S 00p@30PpL\$\5S0Q%0# PD ?0 :J$40S40E SE 4 `V0`@0x@S b d0, E0 _0030SC 30S? 0 S( 3 S? T!. 0 / s\@T`  Ϡ5  0S  Fs0 S\000 T @T`VT0? @`1020兑A0^ 1QS  0\J <0P0 8@㒿 bI0 00Y 0?* 0  000VT !pW ` @p \W@ V00!03S%Q@1:0Q@0a p0 @ 00  P F0 TS YQ! 00 B `P Q00*  B H`T<)9)T;)k9)9)<)<)<),:)<);)&9)9)U (8:)AW=){O-` @ 0Mp̰̐ 0 0  BRЍ PP U QP g` {{@ pQ RP Q @p =)9)̻0/O-plMX H0P`X0D1D0@1@ <1 0,0SlЍ0S d0,@6D0 @00@԰ 0D Rp`T0!:<P 0 AQpR Q\tR ` R @P܂9)9);) =)&,:)<) 0000@/00S/p/,:)00S/0/,:) 00S/J,:)O-9M`PV`@@M90S 0P )S0*`00#0.倉Y x6DpP 0 WP H)D P<9p`0S 0S )P00 8 #R0밸p0,S00000G8 001?1#0"v    0P@plrhja00C0Z ~G100S 0y CP 0sQ0 S$ 0S x'L0X0PL7|`z:0,S00000 7 001?1&p)0pp00ppP*0S  `Pg 0 1`_pTP[ @p` xp 80< 0 80< 0@0C0ş 0 00R.*0S  P  0" RVލЍ0S 80< 080H5 0< S 4c0 00$001 aP 0S 80< 0804 0< S c0 00$S! Br ` cyp q]P 80< 0 80< e00C0@(80P<.\SP# .P #PXPP3P`080<C@3 Q035;:,pW P0Sp\\/&0AS񟗮ꐍDS3 0020S04000aP x2 J#R0 200MP028 0 05#R0mQ" 0S0S@ 0/Pp  : S000 !0 #R0 Q   0lFQF?\!\  ,10 S$ Db#R0 š!ʡ0S  0R 1 0 0U0p0P``000C0WPpv ! <)$<)9) <)E\ /4:)HT,:)_kѷ9)޸9)9)$7_itO-MM@0AS񟗀ĐTdTh3 dP T7 t|@& <}P $7 00n@0  6hP 60S 60̆V6 X  E0h06`$00嘦100V3:6 Rpttt0S.`@aViPVoݍЍ( &P"P   5m 0S a @ FL1 050 @[00@(0S Shhu`%p@(P* 4 0  B, ! _50SW 00(000_/0q 0S ap(0GS@0(SF jpQ(Ag,xyDd4p0(S9@0W78U,0 S1 #0 R( S000000W!"!#4Wl/ px3  (  _/& $ ,0 S1 #0 R S)R ) *V { { x0 S( R , D"2 pR)@ W(,`0@' aV!W#Wl p d aV @0 (0S $ 0 s00Q P0S"0`10S x10!a!00C0!U P0 }00000C0!" pm0S@0 0 0C0 00@ꟹ4:)ѹ <)<<)L<);)9)<)T&<);)@9)Tt,:)9)z0/O-ؒ؂PԢ1EPMQ@Tߍ0S  d`@EDAF@D40 pp`Ȼ00@   B 0    S$"[ "[ "[S[ P0:000S 1a  1R R@0 S 00"P P100C84P X B X !  Q ph0RbT0 jQ\tR c` 8h00!P^ p00& }000<<)L<);)&9)9)9);)h9)к7Q<),:)QO-0p(4弰 ` @$M?r=P \P  ? ̳ ? 0 B30S30W SW 0 S 3 S p9@ 002 P00 00CSFTY! P 80R0L003030 000? =` a2! Q,S Q0B*2x20S =P9 PDB P$ЍS   APw?00 1>!W 00S>>0Q#b ! RQ 3 T0 0 S`0?000 ?<S  R.. 0" !00S0H0S 0 04040c/0 $" 80QT $0 0$0404 L3 0  ^\ {0{< 0壵Pp19)T<)T<)<),:)U :)(:);)9)9)00S/0/,:)O-plMX dAt2t0pB0,0SlЍXR0S  d0,`=0  `ٹ000P㸀@ᇡ 0D RpT07:`1 ARpR\tR`Xd00X00@SH<Ģ`V %P 10S  0ָ@PZP 00S  00S  RQ {{00 x40R! 0 P  H 08T9)9);)B&8:)<)9)j3ȻлO--oMM@P00  @0t2|?0SX0S $5SX0SYLPZX0S $XnS X Rg ?`0V\2 PT20! X" \" Bp@1\"T000B`X$dPڀ0A^000h21`l2\B1d2>V2d20C:=SLq QT20B  0S 0 L$5T> *4>%(>0S KH0 0S0$5  B11  !`0P00B1- 00 S$ $|0S$  봀 -0⃀Ḁ$1BP`R!B@ LPP  f| 8PN 08S  <P| *堀<<0S 0 0/X0bA?:d<5A?T0 =80T0.H0? ;0VHQ RX0`0@ <0?8 84<ϡP b8{ S X,0 Sh?^ <PC <;0S < A>+<B<  C2P:"  <0\ 0 0009J*|:7p:0S ]Z0 0؍ߍ0800~8``!.Q  R  `0" ti0S @d,p : 0@ @@ p呷00 ,y+1#\Q  0 T ?䘟 -?0lhS90x Sx 80S 0(S 3S |0S 0 080S 8 0S<(0 00( 0X $8D80/˃2#\%R  `  0 ?d h pB2 `b7"<6+?D "@ D @ 08L<PLRP$ͱ 7`V=S؈<0D 2L0VpC p,00C S=Sx&/zS   +1#\Q  0分h ?gY `680S <jP#50h (60S K0%\Q\u5P50 S5550/˃2#\%R  `  0 ?d h pB2 `b7"<6n.@9 9먐 :90  0 498000$5S `0l63  03080D ` D @ /@ K9)T<)X:)9)<)H:) %=eQ$<);)';)&T<)˼P:)T:) <)<)X<)8 <)99)V:)9)(:),:)(<)4:)9) <)ͽU R$2 $"2, lS`2<,0?0Q0^0/G$5Sl2,`0hppWS $%S0! !$rx | x h |l  h p lt p ` L3td  b` d @0P3 !@0 R  "0 0000 0 0P1  b2*$2020S 520 0X20S _H  vP2t"ST<"0STT8 eP xP2 H 0"bST2"TST<8 0 0@30S2D#S<\<0d#S\*0P CP 0#S\2#S*\<<ce\0 0 p0S $S00pW`D$S\2<,0?d$0S0\0000p `T 2R`嵟X 0V $S`0?0$2S`2<,0?00p`Y7 0$%S0\000S7呫!%\pW`t嵏X7 0%S 0\000S7呫! pWO-P`@DDT(p  W @⣲rwG-A0 5 Pq0#R%%r`!00 0SP 1Ų0a&*|at1h10S 0 0U/03Q0S6 WA 5*< 5000S 0 0@TPGUGBPt0Up Pd0 0S L P<0 0S 9)9)Y&:)(:),:)þ|4:)0/$=)0/$=)0/$=)-@-$@  # ߌ㑰&G-P`p;@0S , 0S X# U `Y 0S б0S Z; ZЍ$=) )$q7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  )C-@M Mq` @Pݍ Ѝl!rp@P=0LLD@rOP,0: S0RP0 00PPP81: S`P% S  R  rPPp)PPPU r{PP @P$=)V g4=) v@-P 000, ,$Ѝ  ۗ4A)0@-4S 3/ $=)@-:0 @( 0$.::@蠧$=)@-:@!!:::@0/P/00@-0@S  @9) 1Q0@?o2P  R9 -P0 P0S 00SS0 000 000x PP  P R0 T XL PQL H 0 0/TTT8 D:),:)<)<)<)T 8t0 p000 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/<)P:)T8 T 8T:)p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0TH3H3L3u/L3P3P3T3T3H Dh p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3  EEP  4K44K44h 4 5- 5d0Bd00000P5P5H5H5=CH5h H5S>S>p@0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//<)O-4`@MT 唴qy+|] :ltl0_ 0 @P @Ѝp\ZP 0S0 40S40S  ?b2: s0P0t Pp \2P3#0S #S7| P p0S d-0 CS kD*0S `0\%R##\%\5"0C?o"20Lph0 S 0X24/R%Pd '(2 ? 1:010SA, A!,Ÿ0#\ P  0 R ? 0SR0S 0ȡh  0S 0|\%Rt!\%P l10S%\|XQ% L!0 0@! 0 *r  0S 0 0 0@0@ SPhpJp0p 0 0U* 0R A[L:)ا0<)o:)<)<)9)0\:)OD:)n,:)9)8 <)T<)ӿ<)X<)9)(:)P:)T:)<)*@O-@9*@0MM08x`QP 7 ލЍ80S :P}7 p 0: S T XP@888X04HSP 0)00S  00 7 7 8   - (8@ "p8 [WppTpPpT7WL $2P 7@T ႾP  ƥyH8P 00啭 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p(hp2S )1P )1P ).U4PZN-`Y 4[ 0S0;<관X| V.+05  1 0,P %Q$ f Q춝C ?-0jP`u 2S<4$040404X02P#W20AT2@02 0r0G0 0 0l /H  ?p0l3& 8 S20#"20#205P` 2Sd#0P\@Q=S00P 5@ ) 2RT0 S @x0S !C 5*< 5u 3 30S 0 0@20S 0o|3 0 S@ T 10Sd"d2QXe 0D_3 @ 夂=C2t,00000 @DO#ʁ0N$0 @@S葟0S0S0=S0S p)80009 p 0L%000P%X30,.4q  *  10S FC0 0<)<:)@:)0k\:)9)0=)9)h9)X<)',<)0<) +4_T+oJT2Z9)u"k9\H:)4X:){(<)H  <)?$<)<)L:):)(:)_<)9);) 8:)-H<)9)D<)<<)@<)L<)P<)T<)<)9) <),:)4:)=S%0S& <0 p0P%<<00*X30_ 0 00S 0 00S5 0 >0S XPLq 5*N> 0:#: 56 p1h $10S 0 000S(4P0q0* 1H 10S nk0 00<cQdkP 0`r<0* p2( $20S NK0 00S0L%r0L%r0H00q" P 000cH00SP8P$s* 4320S 0`# 0 00L40q"  400cL00SPs* 330S 0$ 0 0t4pW. 4E ^  \pWR 0SPt*j 4T40S 0$ 0 0t0Q,%R0%45S R! lg004E0S|PP*: `5l50S 0% 0 00(0Si xQ$ >0Sx < 0(%0S^,P* 6@50S fc0<& 0 08%<5HSR$  H00850<S6SP*6|60S 850& 0 0@%D5LSR$ t L00@50DS%Pp*7470S  0' 0 0 7 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*[880S 0) 0 0T PYd P4TQڨ0QXڌ U 0 0S Py*(9Z\90S }0) 0 00S3 6 pN0S0QQ*P #0 0Sl iP`z*p:($:0S NK0* 0 0 AN0S ;N0S  5N0S0+ Q^ NQ L #N0SQLd N0S{v<Q N0S N0S  N0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*vp<$<0S 0, 0 0<0S <0S(L*X<<0S 0 ]h G< < PRL PM\= 0S@ 囦PL \ ` _0pd娭@PUWʸ- 0 ?001>0v.P6  :0,P!0>P<) 3D^ S;L.00 0 S 05|>> >>pWP>ppY@>@$00PEUP8HLd  BL 0b03",P P Y) T?0S   p?8 H4L0d P B b"30 E?0S   0`00p] P?ݥ ޥ\6PP ^0D& 5000460S 1S  +P  6 6 @K Q N U @ 0`P @@ 048 ,5P l50S p>lP 0 0 B ``0  0 04 8 P 씟 $0S_mP`0 4?s0 S 0Sc\Pd0 4?s0S `p0SfDKPg0 4?s0V:QQ  /Q R 0Sd0Pe000N 4000 Py c0ScPd0 0 0ipL0S 00 0 0 00$  K0S 0 0 000  0K0S 0  0000 0  0lK0S ``v0`#40  0  0`qK0S 0@000  0 1 1Q1Q,+ 0S ;A 5< 0 !00|!@0t!0 pCSq #0p R0 !40Bs00WP `@f0PUP0Qo R E/ !0!Y pG  ]T<)w9)@:)+H:)0<)h<)<)LBAL9)1)Fvڶ 9);)6<)8<)9)4<) 4x00S q: S  S :C / S : S 0P/@-媥,:)9)1A-0`S lh *@ VT L10S@10S0劥(1 10ST00S yp@r\00CS0ẵpP U 00CS0ᰵ P PYU YU0 P0  0 0 SNU9)0\:) <)O9)]:)X&(&@-HP  $* PxЍ9)bO-p,1 p$1p 100 lP0 pp^P 0P  ppPPP( @ HPT`00 WT *V &p pXP @@ 00`<)\<)9)v<)h<)<)O-@-1$M0P Ϡ,"4`H   0兙 P p 0 @v ,,娤P$ U a 0 mpP$Ѝ?0 0 ?   \ P 0s 00?QR0 0#Ϡ?'0 8hp0P!`0<),<)\O-- M0P8`А:Pp/2#V [ 0 Ѝ 0|7@[ ЍO ?   P  ? 0@p0<)9)\A-P`U@ ,1 UP0 PP0 0T3`p+0 L@D0T@S    8HĒL d  B 0b<3l@"z0 S  0P00`0@TЍ0<)  :)9),:) <) 0S/A-@p d`V F0 fP2Qf00 SR P00@00 0` PЍ9)C) <)<)@-0P0@T@T5d pL `l0p `̠V W @00 0 0 0P00@@000 Ѝ9)<)0p@-`P@XMX  t+ `P @XЍp0@-S H0@S  BT00S H{H0044,P009)G S[p@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT9)<),:)\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,TPC-<40S 0$0,DP$440S0 40S, T0SB 3`3 30S@=S= wS*n330S 0P 0W`dSTS宝Ps娝PUU00Q A P 0S ??@b$剝ᇝP`"hR0"00S7 lr002Pb0S) x50S) 0R0E>0*X4 2920S _\0 00SOFYP10S CF 1XQ d1*\1 P10S 300 0P10S D"F 01P 0*000S 0 000S d0$ 0 媠k (0唱 ЍC萱 Ѝ$<)4:) <)<):)<)L:)9)9)0<)<)(:),:)h<)<)<)4`<)\<).KP:)q<)T:)9)C)O-PPMp80S#C \/ " / Q @aV``  [ΑYP <d \P  ?8 , ? ~0 (2r0S0` S` 0!S 3S  0? 0!0! !0!S`0 0 0` U\/0ϬL3 80S30Ð0C03` 0S300CÀQ"0 0P*00S (`$ ` `Ѝ kS  $0 0C$040S 4 $ P@ P V9)9);)TT<)<)<),:)U 9):)(:)A-Pph0``ATR 㐙@P<L0S @ '1p0A4<)80 0 1S/ 0S/4<)\0 5< ÒH0\ Ò3S\ Ò3S\///9)^FPO-0(P,0@4p8`. P P0P` 0S 0 S   000 00 00S 0 S L0 w0    p p9)C)8<)Q/0/O-@8`堠 眰P8Q ЍP p Q0p8pQቐሀ@8\`0S  d P P/100s P000sB00s @-`0S< (   o/0! 2/B1   P"/ @- `0S    00/1000/0B10B1/101/ @-`0Sh L 0 $ 00/1000/0B10B1/101/ @-b)G-p$Q  l$Ph!Rr lR`Π|S p  $@Z!T P*B\  @@Q ! L@Q% LX R @T @ pW   PP AO-RMPhb  i@P D@4 iPpߍP(  pp'0S <08 (00,0 000040!04 04$0D0(0 P XyVph :p 0 % D$j 8Vj ,Rj  Nj Jj 岯p 嬯p  y% yp 8p?pq8SPr 0  *0*0@0  0* *d@edA+4EQcwzd@A-PCMMPp`;8 p@P  P0;PU 0 2 "0 CލЍO-PMM`@pP#P0 P: S3/(P 0rS L&00P 0#0@0@`U@ U  8!P  P PU )&00@23MP@ S @V``帰张Ϯ`P60: S)^0"(P@PTܮP V+ S R"sP-P ǘU 墮Te@\ SIP@`-\AP@ `UPXp%t!0#ᴫPU00`00  @P  ⑮P%0S'`X MPPt|h0 wPLrPP dW80% ܍Ѝ} FF F@00S/p/,:)00S/0/,:)O-pl1`d10P0ɯ 0 X 03#ˠ121@ R` 00P As 00lRQà00S! A% 0%p3sp(0 RXl000R X0 0pp<P006<)9)C)9) 4<)4:) 00S/,:)O--pM 0`P@ᐱ0V000Ѝ000/U0p00 0 000P00S l00 ?r000 0 P0ao(00 0`00@P(0 R3 ,S 4 4\0P 0S0Pw00S 1  B( 000kPm @3 4Ѝ~P|30S01 0? D3@0,043,[0 S,0(P,0h o@P,@, R)0,0, 0R0( 000 [0H( t2 Q,, (P,0!8Pm,00,0pR P10000C!2"30 ,0W7! 1 1S2K T10S# =, 0R?R0(0$0 000$00?000P$00S  P0,00|$0 0 d 0 0, ( 0S     `Pp@+@S9)6<)9)4x`,:)F^^FZ4:)Y<)C) O-!0PQP!Pa`$Ma !S@!!r0 1 `(00 0pI000P 0S @ ^P$DpU PU 000/ 0aP&P0[P  0S %=  SP $P@0$Ѝ9)@S6<)9)8<),9)4:)p@-P0 % .  @Q 0S p# #300# #:>00T0SpP8Pוp9)^F9)$@UR/G-P `$ 0pG@V` 0@@`` V`@&!D( `G-@P 4`Sk Y00000pquP0Y T0T! ## @P?Ѝ_uP :F^^F: p@-@P`    pp@-`P@ ((UX0 3?X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@Pp02#U 1! `R ` J U c9# S!V Q V3  P! I P` 0 c9# S V!Q V3  P 0 P$` U P `` Ѝk2 0A-1àQ`P |0| ||0@Sp࠱ P$` p@QL ࠁ PQ ke p@-@P0080P 4 PR*SpL0L LS@04 <<P0C800S   0hǪ  ,0S/`0@-0@  L[;,T0,0080S 0  &0@DC)۪ ,0@-S ,0, ,,@TP 0@- O--LMPpU`@( %88S0@ @84@D2@D1@DS@D50  0 00P帕 U0#03?[[[UW㣏@D `0P 045Q ,圕O0 0 ;D 0XR @"!L0<p$08p$0 0H(0 0 `,0`4  0 4$HP 0 PL40  $00 0DP[, 005RSUSP3S` 4$`UQ?V  0j 00 ,040`F000C3: 4`C#,0PQ(0 $ *,80f@P,Ph3Q 0Q+ 0CQ؃ 0P`S $T$PP@ VT@P P0Tp@W !pDP` !T@g0`P`0p?: 0T @ u8< @D0RP P(:v`0 S2$0$0S@p :0 P  S Z 1!A 8 B`40塎40 040 00Q80080p0ȯ0T`0 S2$0$0S@p 0 0 P 80S0 0C800S   0尐`cO@  D e @ LЍ0 0C))LBAWc| NBAW$ 6 G-0,0S0 ZP@$`00qW40S*jЍ!  0W@P   l@PpH$ A-`0@c,0Sl0l ll!Pp Q L0< H 0P@DT@[> 4? C-`0(Pc,0S0 p@ Q |0l x@PEU  0P !  0 P P ЍqO 4Q X0sC-Ђ0@ P@` 0 00 0ᔓ 0P4ЍpC) <)JX0sC-Ђ0@ P@` 0 00 0y 0PЍpC)<){A-0PQ q@`p0P R   T0! U@P 8N4P㜑+\:)C)C)@-,@P,0S ;00C)@-,P ,\  D ЍC)p@-P@&h0h 0 SX0d0R 3?5 @006.4 Q#3SRpp<),:)9)27@-0S S+,Ô2 R0 ELh `Q tp>PC5aQ* Q( H<1P 4,B 5*< 50d30a3210S   0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S ص0 0@ d3S+ CQ+aQ# 0AS"tP y0@a3d3*S|0p00S ᫵0 0@S Ѝ049)C)9)-cH:)(:),:)C)O--0p M"##0@@P 0$0 4 0S !p`s0S 崮0P- # 00"2 qpP)$K;lV tV bV0UpP`+$x ^ `80 (=  0S (00,0 p0#+C$00V0P P W0 ЍWl G  PWP p  Di0 GP0 pP W:P0W 0S00$$0P+Sa PPA 0P +SS PP @ P 0 S 0 00$ 0S(00 S,  $ 8~1p V P 0S 0 00$ 0S(00 S,  $ 8Ypl 0T   < 0 `\x&Y&FkG-p@P` 0P V  0  0  G 00`000O-0` mM$0P@䄟004080 0 pp40S+ mߍbW AW LW x84cW iW0p8G 4@0 0@4: S@ @0(0D08`,0000400(P  P 0! OT| ޢp 0Q= $ 0! $∡匱@P 0V$0 0/S  <<Y* `᪌`0"<5P0<0$K`P %P%< l y 0w <册VD <"$} 0#$0@0P!Sj `VHop 0 n?C0 n?< n/ 0Pp < 0S `0S   B/oQ" R 0S! m0$H 8H]P`0F$0p0I $ pC op:0S ,( PQ S RPQ \T &Y&zd@& 2ϙSO-`-Pp,MP$`` ᗏp@($0S0$020S'$00 P W 00 PSk0  0"#fT AT PT tf@pT$p@,Ѝp00` 0pP ,d ? 0o 000 00 p7 p@0 00`Pqp p V@p@` N&TjY&UG-Pp`l p@<P10S<"  p o0< 9X $$ ip@- `&W00S $$ Xp@ Y``V @fT rT GX`$$  ;p@$Vc&Y&+ @- 0oxA-@P`pP 4\ X6T  @@0 0U  A% A i &@- R0ЍpP`@ 9hP0 0S 0SS0S $$1!BS0S BP @ . (P/00#s01"$#O-`@V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! 0O-P((@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR 3O !00G-(p$ P@v`P 0㙥T$0 0Q P ṉ`Ѝ <PC-p$4 咓`pQ%@ 0Q P Ѝ P404-@-0  Ѝ Ѝ/-@-00@ 0 Ѝ@ Ѝ/-@-P 4(    ٌЍ Ѝ/ O-MPp`@PЍ 壩P P 4S  0H7T0P$ `Q$VP 0S 4S $ X0P4 S $ SG0!!p`000 0 0  @ 0P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڀ 0`  L0 @0  "zPb 00pP0Sp$T`PL O-,MXPp\@P o 2R 4S  0~,Ѝ 0@Q Q0 '  PS[  "S 0X000 00 @ 0PQ4S 0S6  00 000 @0 0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3 1  #  0,$0@S4S 0$R  @0 RS 00 0 000000PV P0P 00000 0  P1p>TU (3FcmG-`pMMPᇆ@P吃ЍTC^t# E@0$4$ 00; нp+p 9 ᎇ@⏝ph @4$$: S R B.D ⃝p4 $4S( ($,40-B. sp E0"dR04<($$4,40$tK>؀C 0 !0E  n00`d$t؀E0   P0`P 0,4S   0p 0Gp 0p pup{ p 0pps P P 0"I Rp5E*pA_ Z0"d@d@  6e@-@P 4B BRP ޜp 8N4  XЍ@lЍd@p@-@PP PP \ p4PS4 P PInA- @pP0TP ` Xp@0 p@@$$ - Q EAQ0 "(  0T 02 /$4 0T1 / $4 0T1 /O--`P@p M7=` ZPЀPP `00000ᐊ똰 V:Ѝ 1*00 0P0~`P1 0 0tP UPq0  &C$$0A@- P@- t`R@`]ЍpP P 4 R 0 H@ .O-Pp_o!R0`@|MR(0S00S "R0oU |ЍP P`U 0SIQF (0QSB!RS R9"R S R0A +00S00P0#  7/p  7/p 40  m0$80x P P ៥P 's@-`@P0zPЍp 5/p 4 5/p 4 7C-(00pS4`  Ѝ$T@ 0  0 0`Ps 0 0  0 PW0AUO-0 0`P勀p@ᜀ圐吠T Ѝ0  0 P 0 0S 5p k@ 0 @ .A-P@ ` p0 `@TO-Pp$M `@Ȁİ0     Q  p0 p `p R0 X p`00P0  $Ѝ hO-M Q@8`< 0 0 PЍ P P0S*BaPP  00040  0004 pp `040p` 04p  !=0s@-SX`@ P`?o 2R0S  pЍp@ .@- iR sR aR p` ,T]7@-@P ,P"P  5 Ѝ0@ .p@-@T 40`PP,pp@ .iR@-. 0 aR bR LR) sR& tRP 0P0S00 Tp` Ѝ(h0 @ .p@-@ M\P`&P0 0͵0,0S  ņЍp $qA-Q@P M Q   ЍA~␀ p$!!`P h`B~ `PP "z O-$M@P`HP 4uP`$ЍpP 0 0 0 $0Y1,"P0* Q  p0 0?Y S0SXp Y0 p G04 pW 0pp $ P 000 00 lP ᢂ4   \ $  0U,S( 0 P$`4 80\pz $Ĕ{'!#, RP P { T P R*L0Sf 0p] L004 0 000 0PK 4$$  u $ 0$$>p5 ;k00S 0@-@C^M E$օE$$0 0+P+Ѝ0 @tq !ἅ"`#XT 80  @宅P8嫅&Z&*5FXm0$ 8O-PLM@p4  1嬑嬱D0 ህp  0S$ ! R p!LЍfR lRJ  I@1` 0S   P /P  _ 坁蠟 FP؀  叁Z G 0c @  Z  4 ` 0 ` P` p5&$o@ ._ϙ Z&&A-p`(P@P0 p!`P @00 0$0@-@P$0S =@:O-p`$MHLPPDT   V  \ D@=x` @SR00 Q ^00S P UP 4 0 hT0P 0X0$0sP UP000 P1!!U111O@^P 0yPPJ QPT0 0X0$0 00 @R P TP0 \ 0 0@;0 0ZS @R PP0 V00IP  0 0   0R00 0P0@SP@<4$$Ѝh!=O-4MFT`0X\,! 0 40  0-` ` 0 #0 0 1 ,0tWL 0Si     R ` A  [  [00[$000(00$ 0S 0(00 0 S0F 0S0B0 T0  0  0 1%4 0 0$ ( 00 000 0,00p4ЍT0$(` 0"0 00 1!00P$000ppO-M<p` 8EJ@PJV 0S 0 0 0  0@P@000Spd- 0 u J) 0PUT@ P T0 @ 0@P 0T@0 0 00 S0 00 Ѝ F0  0 ? J)P T%V@ Q  R0P Va0 0S 00 0 0 RV Q T0Px  P0 T@ 0000Sp@Ni=P/0S//P/0S/C- `P @ pR Q  0X0 RU@-@,MP@p`rP<E,Ѝ ( p`P0  4=@- XPLLL0 H@@8@8P8`@aT㪀q0 &<R R R @-@R R///// Rp@-0@P! R8d}}}}}}}}}} R\}x}}x}}}x}x}x}x}x}x}x}}pp B R"S@d d\0 T pppppp 1 ppC)O- M0`S@PPЍ0!S R ~8P0p (P\4S 0L0$$8P(((8S }Q QP0 4S ڠ0"S1 @0 ^ <03/p 8 H0 0($fP  0P 0 0 $ P (, PpWEV9DC)O--0P`p,M⌃$0  Op@d30S$` vP 0"   pT AT fT 2@,ЍsT0 0$Xp00 0*0:@Dqp 4 `0}p0ᴐ00004S 00Q-$2!0  R8 +R.R+ R@d!dO\1R R8 0S4m 0S$1 +10` 0`[pupr tpn 0oO@@ *:i"p@@[|GW 8 H0 0 8 Y$ (, `c&i4 (0,WVZ Pp1P0 T X咓#Y: V 0Q  0 v 40P40 (, \   X \ (Q,6V(V,,(X Q&Z@V0`p 0p1  V  0  PZVZ QZ QW Z!! ` p4\ ` 4 "$p0 0S 004 x $ 0$ R40H Lp 001S0 S 00 sr/0±0¡($OpP6x 4$$  Z|Zy\&Z&`wx%VC-P0 @p`$M!!ᜑ P |p*0S00 P 0SP0SM \^H 0T' 10S#!Q` 9.NP. a@ P P ꔔĔܔTCpT T  d,$ЍP`&Z&@-M@Q aP^p0Ѝ@|0 ||xtplh 0 @{P{ q/@ 0Ƞ0 0#30 \S0 P p{ $m0 8 {Ѝ00  pp{1S1S|pЍ@{2\PL  PЍ@{szf|@zi  p@-P M(@,`6#"X0␤P0 0͵0,x{0S r{ /{Ѝp $qp@-M `@ T $D0S@ PU{ 0$$ 0$$0 0  P ,2{ 0 t*{m0 $8X"{T {#H  e ݍp.E0 w=iP `00CS`0p S00 P0S X0X /X3|&C-PYMM 0"0z,"  z 1 #@rTYލЍ  z z Q] z   `0!0x! #P XlLzDz0!0(z$z $ !P0#➣P$ !0#z ym0 $8V {zyz# @Plzhz  G V KQcek wq HG-0p P`@M!` P @zpD20S!mP$}@1 9lP`Pa@ P \@@@@d@l@@uP @ЍPP Bp]PP0S006 P 0S0S \^ 0 Q t y y pᴀ崐崠W y y Q y   p yv&Z& KQceA-HM@Pp4   0`\0`D0 yp T$  P 00S0 TR lRxlHЍTpT8]px&xZ&0 Q /0@-$M` 0 0@P!!dq 4yp$0S00i P 0SC0S@ \^; 0T 00S!  0*a@ P ꬡܡ TtOpT ET   u$Ѝ4&[&00000000 0 0 0 S /-0,M$00 0 00 00 00 00 0 00000000 <,ЍkC-` M @ P   000sS̀p .P0㓗' Fp0lS|p` P0㓆& 2p ЍpW `Vp G-pP8M(@ 0S  x vP8Ѝ70 060050040030020 0100000.00 ,0 P #00R R 0S T `PP0h# AXP p@-PP@M `8@ @ ?`  5/V@@Ѝp A-`P @ p!wPU@ p@-@P(`$ Up p@ A-PP` 4  04000 00:#:900 @0<<@0 喈p@p zЍ ၈ PXnᕈ@@ W*0,WpWᅈ,@-EPE  [PP? [2" CP4 0!xWxx kDP) !0xLx `DP "5DP "t/DP #`)DP m0$ 80S mhP Q   7DPp^,P0T r00Ѝ5N@ .&L[&Qg(&"ϙ9Lxf(16]r|e $@CO--@`pZȚȪM |up :0S ЍOt0FS iSPpC>؀C$dP W <ЍPP W00 9P^pP [P0$$WPP[PP [P (0WP\PH0 AP 0$ }Q 004 0WCP 4P0P 4 P6q  P00 00 0 00[000000S$000(0[P X[0P: fPP <<<Q`P&Q 0$oPP 0`qp R$4< "#qp$0`Ab4 BPb 4`5P `/P @ 5APQ @H /APK @0 SD00H0$ RL0( 0*} !$4P `$$$4P` V[`P! [P (a&t[P )fP+8,0 {Q`P {Q<&?  0`zqptp @P4po  @P   @P  @P   @P  $ @P  X @P q@ @P  ( @P q/   @P r @P 01S 0r/S㲰, s? Ѱ  @P s/ @Pz$$n$4P ePУ| P`PP$$ 0 `0 qpS p0t< APi <p1P < 8D < APY <!P c@PN  ]@PH H W@PB 4< AP $ <8 @P2 8 Y* 0c$ Bp $  P$4 "`#qpt$ X$ R0<"\U8008$0 0(0$0 00(0 40P0,` 0$00P00 T0 X0$$`CqpY$$媃$4P0 00H00L0`$+`0##qp9$$劃$4P` 5@ .&d[&z](1|rx Nz$7f9ULx@C )H0@-@M P  ' 0 0Sgp< <۱ 4Äp$ӱ0Ѝ0'i@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p[ WD Sߍi@,i8!iD@-@  E 0Ѝ1p@-0MS1`0`SMj@ A. H01+P A!⻳AxqP 0`0?oS cP 05P PP(q0 0A. 00`0P A ⎳Aquq0 0A. 00`l0P AX XoA\q000D 0④8qލЍp J)D) PmY`m{s@-?PP /P  O`@TЍpP  00STV + #q@<"0 R !O--M@Pp:p#㮰`P"    WP+ ^WP8WpP ]pWP ]t q=0P0&h 0R0 0 p "( Z=Px 0SuhQr @ Jpgl ] 0 00  R R R[  0PW t [ `2X (oD)W 0f0S, @ hP@ ` pd HQ L 40R !01Sp0S 3/p\ R 8 Xp \ 0S 0@ `܂p Ѝ W9 3@-`V@P@ ЍVPU MP XYpIW P .L@MT }VmWP@- >P ЍXA-MP p'=@P00#p`ЍpP Q ĝ0 rp !0  b>i@-@p @A-P`VpPt00\P@k?0\ f FA-P`VpPV00\P@:M?0\ H F@-( y<P700 ЍPp@-8M@ (Ph<P1! kVP# \0 Q0s0S00\PP"  V@aK$p`8Ѝpl s  [8 PV`GKV: Ci0@-@BM M  Lp 0S 7  /  0(SP(@0S700$0/ 0h (DdP(@0S Bލ Ѝ08o@0o@i0@-MPU@P [P Vl0l l?[ 0 0S ,pgЍ0Ci @-@M    p@oЍi@-M @;P0 x p 0!Q0s0S08 1p`Ѝ: p.Aiis@-`Pp@ @@V;P0 Q@Ph[ P@ L@UP 4 jЍp {oA7@- P@0p\ \֭T(U PH08 DD0<80{U p` Ѝ0A 7@- P@pd d孭0P堭HT P80$ 4_ PU p` Ѝ0Ap@-M`TP0P0ЍpZP@Ux h@Pdu0 Dp<d8 P@ PP Cji,@-$MpTP[00$ЍZ`g@Pp 0 XpL4P@ P`@ p$.js9Nig@-Bm Ѝ8 t0p@-M 000  Pp `g@P `@pt P 0 d`R00S CmikU :mxmPxi  0@-M@PP  p  Ŭdkp@-Pp@`@@ TPD0D Dr!ZQ P奬ipA@-@-M T@9P@0@ @L04 0 p =eЍg  Ai@-M T@9PD0D DD,08 0 p$eЍZj  Ai-0-M $00 P  IЍi,@-@8S P,0, ,,$S p`A00@ S/a0@SW@/A0@S=@/@-&00@- M@ 0( 0 p Ѝigp@-` MP@OSP iY Ѝp Xq    X( PS@EH$p`vi 0@-,M@ P9P0  p,Ѝ0 0R0 s0S 0   0$ XPP  0XS@ H$p`8 dA@-PM \@@4(m {G 4 4 lЍ  S? 8>J@-\ @8Ps0@0Ѝ  p@@  dO -$M;@QPP Im`P00L0P  0  lt0@`Vm``PT0 0XX@ @@@@ulG j03/`d[& X^&'////0 0LL/[&0 0TT/[&0 0\\/[&0 0DD/[&  d00d0/[&p@-@p3P 00p00D S 0A0CS0$P >P 0@p[&@-p0D) 0`P/ R/[&0 O- 4M@@!2T0*  D`:}pď㏪ P(0$!pSڰp D@T PoS@ڀAP`@ p00L\pP` R  P Q R/6 0TS $P\(P  1/P {@0S  |p "SR(0 Sd(\0 2/P W0 [  iD)ɚ;6e<"O-MMPp  Y p`$ pP$ 100$0 y-j  | |plb P |p Q 4jj 'j8 p# Q Zj$S賟X@Tx X00@0 0|PAj@S 0 0ԗ l,0@4@|p 0!d0PH0h 04 40,@p|p ^ 4j`f H0S=I0S:Y`@T 0 3/@: " 렢M0S:00 % p"pM0S  i@ i@03/@~ JmI1PJ/|pNI!1Q!a`"%J` 1 0 d1 |tp 1 `T!1 Di`<#%J^!1 @ t1 x!|1  4iP@Tc 03/@ 03/ݍЍQi^~izo[&i5iIc{D)(ii' en L#O-M@pP  p 喨T O@OPT!储8O `P l P``U T1O0S hDD [gW   qP /Z   hP & ]7P! K0S 0 L0S 0M0S 0 N0SO0`S  PPV h `<"XD)(&@-,MP@fpP jOP`(  p0S h H4P00< <0 $,Ѝ$J)8i(X %@-@ 偒 0 @ԧ7C-@)OPP0 `@ Xppp6U)U GjP pPL dH@@@@ ЍOi k 2Y$J)ds@-@zN@P00ЍpUPTj@P <` Padu $J)As@-@PN@P|0| |)TPTi@P T` ϒP8du( hЍp i x Y$J)AA-@!N`P0 P@TpTiP 僒p8 =400@@Ѝi Y$J)@-@ \T4PP0P PPL 0 S@@00 >00Ѝ Y$J)"&0@-M@8NP3NP .NPp)NP d0P P P P 4PIp 彦Ѝ0 O$J)7i s@-@khHg P L@gHPH`➑ P! ,5gЍp0g@    O-M`@PK OppP"{(  9  ᬔ Zyp% (+( px" <@T t8Pfl2P\f UR T3 Ѝ0 P@a@P9 $@yp ϐft 0R fk)xf vfP ``ftqttt` R#Q\f afmMP8ЍObP\ 0P   Q1   f0! RS wfuf" /f0P R ` V 0P `\p\\p 8i(i# 3  = D vWX &    w z  d Pp@-P`@&LP V  SM`P B`B 00pLTpAp@-MPP00Ѝ`0 00p0@ 0 P R0Pt 0 p 0 `P0G-@(P`00p(   P1r0`*0PU!V0"R0 C"0@0"SЍWD0P4 0 , vp 0 @0@-@P A@ O-`@pP,(0V0S 8_P$P$P 40S 04S 0S(0p(`8P0S$0(PaO-M00q W$000Ѝ`Q Q 00 2PP0P XwU 0cP p,,m=,`4@[T /*@P00 DY0800@00X5}8 "10#Z0 00q 8 _@ 0YPpG@T 0CS0 0r xC0X0^ :T 0CS00xC0 xRaDPW@DADP7@Dt@S q00@Dt@ TSS0Z`P@`Th l㡣 SKP@U8 @ 0 0 0`0P1   A-X Pp@`P00>90Py 0 p 0 `P0O-P`,Mp@ P 0Y: P X 0  0P` 000   0d **PT0T TT0H 0p@@,U ЍiC#S# ]#i#@-@(M!  0P p< <4 p(ЍP\ #i#@- M t@9*Pq`0` `\ mpL 0@ 0dp,؜ Ѝ# ]#iC#i#A-M< Prp!幜0000P "` # 0(0Xp0@`$`<0[P8100 0(00080 (p'囜 P0 0 0   :R@p00C⬀0 0p0 $P00ݍ@ T0S Pd0 0 0 P0(##i8&$#(&$0@-0Mx @pd dBLl0PP  041p 60Ѝ(6$I$i]$b&m$A-@BM`(  XpP 0 P P PP  8 ! ll pz l R\lmU#0P 6qp 6S30S |y\0`P 6_p 6SP@30S <g\ 0P 6Mp 3Q? Y\I0P 6?p 2Q8K\8 n /p 0S0 [8 $pu p p p 0@ TxPpD2Q <\Bߍ10S \10S \ \0  `0000p[PU0``0` Rڬx1000 0:S R HP8[`p$PQ [V pWP ,[:[H0S L[ u[~[j[`0Q [ a[8i(i%F%iM%D)W%`%j%) u%%i8iii%}%%%k(&#%%%T%%0@-@PAZ-Z fO-`MM@ 4/0P4 lPgE7EPX7U'S 0`@ 0 @`F( 0RtPx['Vʀ9 0x9 0p9p 0l90h90d90`9Z(@ !!0P j  ?B0CSU 0     -B$ B8##!``F 0^k 8EIcCP S@BA`pP80P0 a, Z!0@"0$0$0S= 8Z0 P0B'S 0؍Ѝ 7R  0CR.B B7R  ǟ#110BS00 2")B B,#!% `7R.B<7.B3"" N-B B00Q0w*S SS 2SK S` 0S- R< )StS0C'S񟗐|#t#" ##t#t#t#t#t#t#t#t#t##t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#$#,#4#<#D#L#T#\#d#l#0S 0 t t0Y0$ 0 B$ @^ R `%SpY눅刕pW>Y lR0 0 Y`L0S< Y0S `p000 Y5H3娀XP0  @ Yp` Y0S V70$S1LY0S p|Y`wYpLY&!1wp`Fv0`(,04Y"( 1p, sgqwpWTYV'0Si  d (( BY3IP  #P|# xßx Pt# T.Y`L 3I@#S0S < Y0S8   Y3SY0S+  Yrp쒟 `0V V"  " 0XV)X0S 4X$Xp Y1᳐! 0F `(0Z1`( p'' 1u (( X1I!P  $P! P! hX``J  ^S| x!Stlhd`\XTPLHD@<0i&&O &&&o&g$-'lJ)' $D),'2'%%  gB;'A#B'O'X'l'b's'P~'''%&%'' |P &P#o''''&'&&&&-&2&=&H&R&Z&b&j&t&y&&&&$&p@-P M@` UQP0 aPp@@BP Ѝpi'@-< @k$P$0$ $6 Ѝ( ]#@-< @U$P$0$ $  Ѝa% ]#0@-MP "Mj@PۍЍ0@P P+ hP@OۍЍ0@h0S0S1iS()(0@-M TPp@@OЍ01  @i8(L(@-T @@$P@0@ @@I \p Ѝ% A]#v(@-T @"$PM<0< <  >p֖Ѝad  ]#( 0 /d&/-@-@ M,00(000 P  Ѝ@Ѝ/P00  @@@@0-@-  -U)U ЍЍ/@-@Ui ) 0S/@-J)-@-  U U ЍЍ/-@-  TT ЍЍ/@-h0M0S@ 0  0000 0 ‗p@@ЍJ)1)@-@gHggp09iŀp)V)h)@-|MPP2P0S 0@P 0 000 0`>p PiP@H 00@4P8PSf`!031 0@-Mt 0o@P \F OLPP @ (@@ 0\P 020Ѝ0d&J)vW@-4@ 0yV Z  rV T&++,#P@-d0 !X|!T@0 6p0\ (0000/~+++Ph0h@-` |!TD0 6p0\ ,00 00/~+++P-4s00#q^0<\ 0000/~+++P 4qs00#\,s0Q00/00~+++PL- 0:# ^4 0Q$0000/~+++PL- 09# ^4 0Q$0000/~+++P 4 <# \,4Q00/00~+++P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00~++--+@- 0 00JSP Ѝ.d&A-P%p`@WЍ P 3MP@ p7@-P@U0  (݂P Ѝ0C`0A-0@nS0oSp@ p5P``TLPP0nS0oS RPPRPP'@-0 TRf0&O-MM<(0<,0O-@}MMȐ⨀p 0 8BRP(b((OXU 2V^0E Ÿ " P`0 *R0SP 1PPR2EPRa0SQ 'pUx  R0SP hR& h%R& X%Q0S;008! P   P00@P  0S ᧰0P @QލЍO% 0 0S 00S P0l  0Q0 0P `p0Ul<ލЍOQP1H. /8 11 J)11102<4%Q p@-P@AQ00opP 0p/K)A-PP 0nS0oS 0P @P0DtIP,WpW`KPP`8IMp@,!@P@K)T4vW@- RO=6&O-@PM ph0`p"P0h"h P0\"5Qp1@2 0CP40%0|0&0 |`P0 +000`&0 0pp00*0`e .cpS crPdPMP* UP? GP e@ PBA BAAtBAALBABAAB 00 0 00 0< 0}x`|P 00  0\|P M| 00 0< 0etw[,0t0Z00x0W 0;;0|0Ѝ8 .&@ .6\46-BMMI^@0 P@A00 \ 0bp0 @0 0/ 0 dN]657@-@P nI0Lo S? 0 帏 Ѝ07@-@A0P@S@-@3C0P@@@-@ @I0S 00S0?  匏Ѝ7@-@xP 4冏0/S  *Ѝ@*Ѝ(7=7V7@-^ P^N8&O-p0000@P`᠐ (,嘰00 Op0@DTq oP\0 {P<Cp{9 O4&8 .l7N@ .6@-M@A>0 0D@00 l0Qap*0S SH #M 00,00 M P9!9a9w9@-@P 40/S  )Ѝ@)Ѝ(7=7V7@- 8PM8&O-p0000@P`᠐ (,嘰00 jOp0@DTq oP\0 zP<巎z9 O4&8 .9N@ .6@-M@A>0 0D@00 l0`p0S SH L 00,00 xmM P9!9a9w9@-@`P 4n0/S  (Ѝ@(Ѝ(7=7V7@-  HM&<O-`0@P(,p娐娠娰0 Np00@DT oP0 ozPP3`z  MA+バON@ .t;&6@-MM0An H 0P0 $@;`p Lw<@-@P 40/S  (Ѝ@(Ѝ(7=7V7@- 7OLm>&O-P@M P0`r"hNp+x2 0S00)0x0& 0 x`1p0 +00*`&0`k g`pY 圍uPfPMP9 9P$ GP g@PMLLLLdMMLMLLLXMM|MUP|0 0|00|0|00|00|00pt`x0 yPMzy|rPw[,0p0Z00t0X 0;;0x0UEE$00|00|000Ѝ@ .>&<6-MMJNP0 @P:00 |0A_p0 ` 0 0N/0 4 000 0@(MKB6>>7@-@P F0Lo S? 0 ֌ Ѝ07@-@>0P@S@-@Q@0P@@@-@ ^F0S 00S0?  媌Ѝ7@-@喡P 4夌0/S  1'Ѝ@,'Ѝ(7=7V7@-剌B@-w40 0,0,0(0(0$00 0MnKC-CCJC&CB@-  @FP 0 R\  \ЍCp@-@ PX0 0(pPP(LP6Kp@&IK)T4O-@H `pH 4?000V Lp60`FVQp 2@FPSSRRRRRRRRRRRRRTRdTpTRRRRTRRlRRRRWRWRWTXRR@XRRRRRRRR(TDTXTTRRTRTRRTRRTWSWWWLXRX$X40S = 4 40S 4 0<007aE08:d$0000000D30@90;g)i04 0I 0(80@008 0wP儋0@B (Q  Q@       "w20  xw0$000 Tw0 000 0w0$800 v0<:00 v08:00 v0@900 v0,000 |v00000 0w0909Rg01ra0$000 0 0tT0,0wM0 0xF00007000+0 40 F Ѝ$e&Dpe&@ .&L)L)L)$?6L)|5 CCCCCDDte&A-RMMI>0PC@P@(0L BH`q刁( `L0\p0KSh0  R< (Lh0WI T0J$0 [( h0^/P  0|PP ` p,@.`0T@ P $0\ $00X 00P00\0|00x00t0 0p00l00d0JRݍЍ L)D6A:DJD@-@P 4 0/S  $Ѝ@$Ѝ(7=7V7 R R @-/SE0@-@MP`p 0o[000 \PPЍ0P0 0 0m\0 O[0P yLs@-`/P0@00 &[P0 DOЍp0/0@-M@P 0 0P0h RP P @@ 0J0Ѝ0(L)BpE(002P0/0@-PCMQ* @41010 0000000 0P \G< 8IUH00Cߍ0Cߍ0@o꠆B>O-M`p8@@PpЍpϿ| D<0D< Dn4<408 h0e,bD0(00x0 @E0h@0Kp PH00@JPF PD I(L)\d[BEO-- M* AP@`pP0FT0<0p0Ѝ 0 3/X0p A0PP 0@ `hK P* 0>I PH D@03/ppP]Ap0PTP@`P꠆BE0/A-PMM`p/7 P@1L# 4NvD0@@ 0@00 0@pbߍPڀ@T ߍA8Hꥆ,L)O-`[ 4MP及@Ꮷ@P :@P`"4Ѝp p 00` 0 +@P j @"@00 p0p0000S X0Sp00000 xp  dP@0 Ryq D0D00X00000I00@ 000<0pL)E E,L)@- IFPG&--0M 00H0 @P (埇q zg ЍGGO-P@M$ 0䰝J0p 0@"b0"@0@@ " Hp2 0BPa g@Peteteteteteee$fteteteTftexg0p00@0p D! 0 ssP7ds IP   , 0 S Q  lMz e!! @IP    0 S Q /z ' Ⓣp 00k+>   Yp x 0S0<S0@pS(@p @Ѝ?B8 .@ .&HGF6GG*HYH^HHHH@-MMCN@800 0@(00 0Xp 塆 0 6G"3G!0G(D:0P( l)G,80P , T"G0LGލЍ4G(GHII I1IOImIAI_I7@-@P  @0Lo S? 0 S Ѝ07@-@G80P@S@-@90P@@@-@ ?0S 00S0?  'Ѝ7@-@P 4!0/S  Ѝ@ Ѝ(7=7V70/p/p@-P@~ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P ~~~DD~@@~HH~LLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@Pf~c~`~]~pA-0@PJ04S->CN~->C?X=~9>:>C8~?n:>CF3~ 0? AC>*~}C>G%~mF!~EnF~E~G~X J.X R  $$((,S>,}}S>G}mF}HHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqxy}1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R,Σ2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ @x 0㑺`0 C c00 d@ @@ 0`B:C0 0 0P!\Qpx 0&n0sS ( (X0xSX d`qVil  00 ЍO G0tS ppЀy XА`yViP,DQ)P)U UUTTPЀ00/1000/0B10B1/101/ AV&O-  dϠ 0@ `Ì0 150S  0d R\[PU[LGp Ѝ$ş P` ` b5B?0L RW@QWbR3ꠂ`<P/R꼂̅,p\ D "r P D!!D!$ "r P "! gA 080P0 U PPpأ  0$5S?00 1>lV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00020SQd 0@ `?5o0"ST0T00  B 0|"PSX000X0*d 0@ `5?M먐ɿ 0F! 1#" 05. ?-0 00C000 xS p10S   dϠ 0@ `Ì0 1&! ! R@N40AҸ80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30DQ)P)U U2VXVuV&xe&Vp@-Pl`0@S     @00Sp0?00Sp0?0pxe&P)t0p@-0@SlkP L00S000000B0F0p4Q)xe&O--MMȵp,y 51N_R0ePS yqሢ儒 ?D 0S\\/~D? 0?D4P p؍ߍ51}QQ 2@ŒD 0L 04;20d04 0@0  00@4T@:T @:T @9T @ 9T @8T @8T@@04s0p0;Q4`0S7w 0죟00 00p 0 0 `  70S X 00S ``a  , 0#\0Q ?,040<090(08? $0mP@Z  0@Dő$ L00 /4;0PrP 0d0@ 0o 07 0r `W5 pZP|S< yq/0/~D22220OD0? 0 04!0hl 0@DE0 L 0/4d;00 0@$ @` 04 <01vPP?\0X0`0d09{0?,0{{{{(0 " @őDL  0?$+4#OPO 0 d 0@ `Ì0( 1uxe&L)DQ)f&h&Ao$Q)P)TO--M M: c>0?0 0 0OD0Dp0S3 80`V/,0P0  0 <L)P)P)(Q)C00#!3x000844$0<0t D0`@`e0|00`XcL5P5 P4`F   ?{8@pD ?t ?DAt00唀 ! o  A   >08$ 05<44R+<11 p84<00x0 08SoPR @P0@? @P:PP0* : @PP(5#R0:P@$0Z`- 0000 a`8! 0/  !.1 >0Z`  b0 R[ Q[" Ϡ  ! 0 0S  BB00㐴P`*02#$ 0 ?}V`1V`#T0`10F 0⪾I  : B@TP 0ἐ]됈  00B1  BZ`0 Y3  B0 S B!I0B ?z0 `9됈 0 BZ` S2 B Q 0S p@;,Xu @P`x1$ F084<ĔCP`0S84<$-0BPQ,`QɑRB1ȁ@L0 0 0000H60S|0` ?L4 0H4 0 06np>'/\#R2\3PPT``0 S  /z,7\5?>C00!#4t x0WP7 (1#T a2!, A3 31 0  ͽP 04 P  0H$4  R$ (  B, @%LV.  R*h ( < ( X ( \ (( E.?.XT+BA.B,-0 HU Pbt8 @40K P\0 ,p B8d i A YZQ!BZ 0X RA{ pW $4?.t{ 4 R?D400P@$04 0H4( 0Āp@2 R 5#< 5$23dr0S+}됺z z'xz {' 000d0 CSQ c6Rc+S`P9 @ z犸 z'(Ȋ0 (08ٲ+S,h9 0  R0:1P000\hP2#00@Q@0 0mp00 R00 &A0 0S_` R9 PP0 t`y6 K  Z⋰>$Q)^FYZYY(Q)YJ0Q)Y&ht@(&Y4Q)BZTP)U & T`ZRP)L)iZDQ)xe&ZP)P)8 P) `00Se 0 #  H 0+V. |00S  L 0=S,g0S 0S0 0! , 0 BϠ2\ ( ^  0 d0/ A! a,3 1 !0夙 1@ pp]KPP04SP0 0R0 S  B S0 8:0,0 0P0 B 0,0S\ԫ p开8ȿ 0ᘥ+" < Q \%x"R!0@$00 @DU`@4Aಱ2( @R,0 `0```0T08(s 0 ` pT3$4[0`0 I9pQ004 帀 P0x0 0Sx0x0t\0\ 0⨁  B`[d HQ   h ` lS2  B±dd 0RL%U,U0   $0 C00 0 0 R R` `  0$5S  l01` p00040S2d00%ST0T00! !0T%SP5bX0`P5`S$0d፼먰 ቼ  $000080` Q +@0@  )P+@ ԰@0-ᴐR㰑 ,  BU (0彰(000T0 10X0岁0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS T00C@dw 0`4 8 0 RT:  $5SʬG $`$`(0V70S ,4 ] d,04  0,4 $匿 00`  VjοL80S   0帀0 X#` x0Hx 0X\%Ϡ  R   d@ 0DĠ  dÌ!1[ @X9\%R dI0SP-|i\`/ `ƌ$  $ l0)`S`0 0$5S  l01` 00090S/dٺ0D*ST0T00! !0h*PSX0b``[dJ먠 F   @౺00080@% 0C400400T$*, Q`?0@$00$0l0`0@hppT:S $S0p0S $S00pW`@R^l倐H*^P00@X8p`0x 1OpZ90JY!@@^l00 @ T: @ᔵA$\Q  @080 $0 ' $0d O@ LL lB;  \ p0SD=0S0 000S.508C =R= 5,\%R   0 d0/ @ `.3,00  50000P0S0> 0,@0P0 X>0S l50S 5>0S   500|:x*0`P>0ScN C>`>0S3030404004 spCVW*<tV. PToV.GV⼽0S  |?0 PS?\5=S,⨽??^ E?ᕸ0 0S 04 X dLĒH 0@ `Ì014 ,$0S0S 04 @ d ,04 0xG 04sGލ ЍlG $0E ip@tSaZO-RMPhb  t@P D}t@4 PpߍP(  [Gppv0S #-<08 (00,0 000040!04 04$0D0(0 P Vph p 0  D 8 ,    Gp Gp t ܼ Fp 8p?pq8SQhPr 0  *0*0@0zc Vv 0* *d@edA+4EQcwzd@A-PCMMPp`;8 fp@P  P0;PWEU 0 2 "0 CލЍ@-@娈P 4s0/S  CЍ@>Ѝ(7=7V7R/lG-P `$ 0p@V` 0 @`` V`@&!D( `G-@P 4`S5 Y00000pquP0Y T0T! ## @P?Ѝ_uP :F^^F: p@-@P`    pp@-`P@ ((UX0 3?X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX0p0\00``P0 0,h , 0S% P 0 rmS aSMSASB0C0b0C SططططиطططظطHSS@U@@sS@ @ @U00 0DT dS$ 09R 峼"P T 0U8$UQUDT P 0  @@@ X 00 l P}r0S00 0 000 00P4ЍK/KRKsKK@-T,@ (3M1&]ALZ0@- @   \ O-@0p |Ph`G0 00000B_I0V W `BF ᴐU)[)P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@pU)0P  C @- qco`/T]^s@-PL@` 0089'V @ qЍpU)U)Z]^s@-PX00S@H0`ă5#040<'V @ qЍp|U)U)U)_]^X10 PS/C-DQ@@MPM`f@a1p P05 0 T:@6S, D6ۍЍC+ 0  Q 0ˍ14 ^ 3?0\ P;0Tٵ 0+ۍЍ|U)U)U)U)U)d]O-XBM `p+PP0"0-q 0F050( 㦪06# R 0 !q0 :0C 0 !q0006&0A06 0  B 00C0( 6V0:` !,`Vp 0d$&?^0 0(  J 0j00 &$&?E00S&L0S% ι0: S(0( d Y0d  &ЍO-SU)]^^'_E_j&@-`a0F0S@&R:p %+PP 0  @1AT@T c- Ѝ P @C1@1 S  `p RE-2106&09-06   B ! ! 00C 00@U)]i_O--@PGM XB? R`$lo k2+ [S!Qq 0BG 0S4N0 S 0008cS05=0:>0ᐊ 090UC 0 $P 0$   BQ 0 0  0pF0L000 60 6<g 0(0n0L d01D0 0S ,0S bP 0S 00S40  0U0i0( XC<000`01$0pp@@U80RH(0 x0S 0S|/0S00 0  0C##L(0a888P ppAPPpuWPp 0R SpG SᦲP@8:`0S $噡L0S d0 P# 0D4#S 0+ 0E&0# H&! B  q!"`H ᠶ60CT 00C0CS\: B XW:Ȗ刁XS: 066(㫱 |n H iTB ` 06 0<6&$X(6XS:0TSL0S d0 cP UHP50S `V=@_ SPSȌ01 210@! !0 ST40##0,V0d$6$[:06 0&4~.-hF 0V4#000040 (-`P0SMVPEPUI 30SA -V p-3PUCL0S \08`0 ㍦ PP1 P# x⽵h37?6|0X0000?096 30BPp`<x-l bP .-`W x␵27?X0000Y?f & 01/6," Q *dh"P P 0 |0jPPP$"r v+'`Pw!h #'P  6!_!PU:< U*!:0U:])0 T)0 xp(L0S]_UhkX0|000D>090& 2|0P&^ ?0&`P2& 0xA0DfS0;00+H0Uᅴ&0#`0H&a B 0 HD'>GߍV@O-RMPhb  k@P DAk@4 PpߍP(  >pp:0S #<08 (00,0 000040!04 04$0D0(0 P Vph ap 0 ɳ DK 8} ,y  u q =p =p j ᠳ =p 8p?pq8S_Pr 0  *0*0@0>Z m 0* *d@edA+4EQcwzd@A-PCMMPp`;8 ]p@P  P0;P<U 0 2 "0 CލЍ@-`労  @PႴ R ?0 \#  R  `jS\F\GL \ 0|||@ ||@||gL| RDKTЍpE%KUJ%FZO%A_ gg@-P L+DDdP<@ 00ZP@00 !$003 $ q W 45v:$ R% G  (!r h h$   Xa XabV1h 0A0 Z$ 0@S%0P0G~ 0h g0@P!01ZH5C: X0 !X00Qj*!?oR 20 P  X0 X00 ZjjjjdkN 'kJNMk(&-pdgTTph}kk`klk.lkkTllll'mlWmvmm/?mm,nmnNnqnnn 8 oo[*o&ogfffkhgUpRRaArrAaEoSooowoooooooi oQ03!PE0QR0Q $1 00S 0S000 X01 00S03 15 1p5 X40 0 X1 d0_ ?80"2嗁`PP (d86?C"2Z$ @02#D0峭 X00D 0080001l0$4s0P0<0#4s0T0,0#4s0X0@0$0 Q  *X" *  H\  0d0|2Q0Hh080 S r0S d08c800 0&%00(0S( X0q"W030#W0 W00S  pR:*`p喥0c0S  `5pY T   b0S X1 t C/oS" R P0 X 00 @ 000$00<00T00,00X00L00p01t01x01 0040 0 1$00(01,0F?03G?03)0 01 01100 04"/@!b$ 04v 08 0#$ #(#< 0 04%`\?h R(0S00d0H 0o0 00 ST -%?   i4p T]   R 0 Q  !R R S 0S 60$610110D @QS*@ CQL000l R X  R   0D0 00B?oQ20S (0 00 25 010P C0024 01000pX40STD#$00 @0l=#<0S 7#0S,0 0#0L0+#?Zp0 ##<0!t0A?0x0 0#40S #Z! # #x h XQ#0#Q" "80S Q@F,0S1   k B*{@-S-xf A 8 /eA@00@- 44@4P\P 0B"" [*-@=B' h*0/p/@- j#!lp&G-`@ P pɪ!>0UP U0 0  P@ GKd0P\0& 0La R 0a U   [*D .q*q0@-xP@ 0M  C4\ 0XXPЍ0 jP 0 024 0 ق[* \*Dq@-0 $0$04}S   1" ЍLq @-@p$M0 0S ` Pe1 00P 0! 0 "))"1 l"3\!3L!@DpQUVPE:$Ѝ!Tqqqqq_ f0@-4M@ 0P0S ,Q 0  R0  7  0$4Ѝ0@!R  (  0$R 0S 0S 0  ( 4Ѝ0@!4Ѝ0[*qqr)r @-:2p` ]*:rH@- 0 R* 0s# p@0h*P `00CS`0p S00 P0S X0X /X"&p@-`ᵪ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hd`0莪Pp <10C <1$0 810S81[*(q&(&&8]*0@--@4MT  A` d hQ  `"R d2RK  d2SA = hk0:{PPS['ΞkHk?[E{7<1 = >풼 * + (+S  PPP  0 @@@ ! zj{ k{[+S[ 4Ѝ00B:k{{'*k{h+S  ?@@-C6?Y@X]*Tr[*qrrrr(q&r^*^*sro@-wi0d2S[*@0@-0S0@d2Sa`2"R2(q&[*@-@ 8!<qH 8!Y{  { ,00X@ 㚙?333333?[*(q&O--pdDdd`2Ms=pl"PT1^RP3 204@@ 0T S S00 0#=0@C;;@0S+  ;[O-0S3/S9+& @0M@PX[=X 0t@  t4  t( $ 0S (8xS`S+?S DS #- z000 NwC *@0|C +) 0C+]00CS00Ma0CST0T0# ⡘ # P 0@P% 0@0 9 90S9 00   =# { # DP 0 O P- r=# ^ # Pn  P 0- 80 # D # |sPdSd X80S 7 # + # ZP;8(<0 8 808408007,07(07$07 0707070707 07070707 #  # *P   @P 470S|'0 0C!0R3t \70S0Sm  + PP@ p 9Η@ ʗ|0@PxQ =0 x得|`@Pp@}@P @P;  0P@0 -d =3 P&P0x{`Pȕ @pP @ VIT z0S%0 0C!0R3 0S0S 0h0.P h0(P b=0000,C 0  R+ 3-D t[3 .\3 0 l0l0`P 48]0F#P00 P\'Yp0[0Wp40QT0aP0!03@H0[0X`0DX0D S#@0S PET R p 1  1 S 01 \Q \p/A!bR000D LB&t3 R     Y   x[   `0`P0S 4D00D0 T0 SL00L0L H0S# ⩖ # P0S  0# ◖ h# Pcݍ Ѝ# ⊖< # № # PPA0S. dP# p # P# c # Ps#=00C\0T| \PPe@`0SXT5000+# P[JAV A` n+l+Hh+&,h+ &1 7o& M (h+Lq&" \GQ\#g+Y҂ 'G^}̃ @(bxDh+h+` ӄE\ Tgfff/cOl#4=BH\@-<00iS03S !9<Ph+l+l0@-h@   L @0 0 s+ȅхs+@-@ P D PUQ"P X ` R D \@@ 0 0 ,$`ЍpDh+Hq&h+څN(&߅A-PLL! E@XQxM` 10S  ~xЍ  iR R R0d P 0000@T0S o@p㼀 T0:ۍЍ`PP@p0 8 @ Y 0  000PU$ h+(&ňԈ8h+0A-0S 3P`|p| U0({@TP`0  RF000S @h+(&߈8h+A-p`P@P pPpDorP 0L0 0C?oR20S  P &<(p@-/0@P 0Pp SRps+@-8O 뛝0S$0$ 0 0tQg+u&$0?S/ @-ZPs+Vq&A-0@0/0000 SPnڨ/0>+b!T0 L< ZP0? 4  r00?s+ܓ+Vu&0@-@0 00@0Ѝs@-@P`P @TZ TT~?0 00?+"+R  + $Ѝp&p@-<$p@ P( @P0P0$pVu& G-1@`pVBMu Qp@0DWBߍ`TV B/ ᪛ 0R ?s0 0 $ b@PQ 0 ?2/ 0(10S 0S Q0000 (hX:0000R%*0S 0 0S 0 000R*Q l\0S D`W0`S g++P+(& 8h+O-l3P0_MS XXTsTC L0D#Ds0+b! L<YP L 8_0?0H @L R"PPD  P A"P&P|u_ߍh+(&`0h+g+h+Vu&ܓ+"s+ߊVq&V Pl+"V05,7+A&Vy&R@- @ 00: SPl+G-@qaP U+ "P00S 0 S00P R GRڀ00S |pP Y XDP Y 0:0S $}8h+g+&qV O-AM M` 0opP@0 @ Aލ ЍO/9/P( 0`!`)rFPQ D D @P ,PD }@T PD s@D `టT Aލ Ѝ ( #A>00C 0  R + x D M@D s`0 R  0 D r ܓ+E\ T&Ћ!C-M Mpp0 /R @`㬐嬀 GRPP 0S P@ۍ Ѝ00 D ?ᾍ`D @P 0V P`V ܓ+p@-0@ @P EP @p@-@!@/ O-3tM0 S ppzl300RS\3 P3P#0L^qDC0#S8 44tЍOa$ P + o k0p`00"@Тв?` _0@ 6W6 ! h`V5VW   @P p0 ?0@!    M?0@ b tЍpI\1P0xSiS?P 00@ 000 0C0T10S 0`S#Y \` v!Xv!h0SS   0800S d00X00%E0P!Nd0 8dL!h+(&>h+0h+g+ߊVq&e&{_s+h+h+ʌ(E(h+D Xy@-AMMP 0pP0 pPd!d @P TTL巂9 < 0}AލЍ QD D< `PpU   U + y p 0P U n  tN 0SB p T0TP 8 =V 8 [E꧍ &ܓ+h+Pl+э&@-+P@-L@0#S 0,!4#S 0#@{!Vq&Vu&0A-@P` 0 P0: 0tpp ?0@$aH00S$` T` R 7eD0&F$ ЀP 0P  ATq+p@-@`PP0S @ 0P0 @/MPI0P 0 0s00p譏O-2lM0`S ||x2XGhP  P L Di `  @(rP 0/*P Q 0?*A Rg@ !!!0 80` 0 08;5h]=h=0-04*48'8<$<H!HLL=== xx||=9^E=E=:^E=ET0AS\sxsrrlsr i Pl 4PE PehT0S\40S PPŻ00 ((,,TTXX\\``+0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,d/20m000%60"d20=S" " \" R `LrVCDS@"@ <U#3 (N 3!0!x30=00 1R 00# |# #X0/80\ /`0d 0 %0L0<040h0T! AQltPttt`t9-0CS   R0 R R 0N\ \0Xx0=0- 9!`Mg+lT+h+(&zkg+Xy&\' &q &֘h3UC- 2 B P000000 MQqM0S a쑟=聟0=P  RP 0AS^wvxwDv\wlw=0=`|0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-RڌL0=ۍЍt0 h0P0`0\0S H,@Pl+Ph+T+k+0h+h+&8h+̙O-AM0U(0 "S j#r0(CA#͡ 5/0(0#R00 #0Q0У dZ0 (0S  F(C#5/0(0,0S3,0P0?0!#0,0@' P#P Aۍ<ЍP(0S #r(0AC#͡5/0(0#r0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  BU 0S 8#R00SR 00S \0l 9P tl<x3  P8P0SPh+T;+h+Xy&&Pl+g+W(&r 0 Pl+V@-@0SSPh+ O-@M00< 04000 0 8 0@bPb  0@ @ H0LP Dp`P* ` R  R  R;  R 0 PL RM  R"  R`60S  PPL60S 0868PU)-$P"k 050S  P% R #P 0 t% R  dd PЍ0HU00L%HHX0S50S  $p40S   PP 0 0 8p"m"  W0 0040S 0 d $ R  81#PU# R  :  0?P Ҋ6 0x  W 0 0 8""\30Sc X \T 0 hI+0#P0 0020S  2PU-20S =(P 0 H HW 0 0 8!!20S 0 $"P|0 00o #10S 403/  !PPZW00 0KX10S00S 0 0 800S 0 4\p 03/PU 4   00p?P Pl+&h+(& h+h++ٚLq&WX Yč+h+-@Y^ V}g+ȑ+ Zd[˛A-1( 0  S !@ 1 1R 4S8 !4|q044@0t\a00S/ P0S  R+* RS-EP- !0 010000 QP 0PT 0$M v P ЍPB+0P;C0P|80S050 00U0 @ 0@0 0Ph+Pl+T;+ٛ8h+&@-cM0S ppllClS0S Yu0S/0#0,,r  R0 2r  0500K Pr5"0C590C990C9000Ph|n x"0S \2d"`2Q090 9j:☦Bލp>`+yA-P@`w<0  pwW O:A`+p@-Mt BPF:  0S P  , P*:0sPP 0@ 0YPS ! 0C R: p  d!  `V$@1@a0 T0 0d Do Ѝ0x+ @-@T T  0Hk  ,(Ѝ@mlA 7(&)P 7P P E/ //\Ei-M M? M+ۍ Ѝ(&4`00CS`0 XX0 X /&O-pQDMDЍO*l@x;`pP W200 RR00u0PS00C00@@ Rp@T+ W-Y* U U    *  q 0.| Y     a.0 G p W8(&v x+ 3<0S/@-@QPM PЍ@ p31Q``X00CSꈥإإإإإإإإإHإإإ@@@"2PЍ@M !0S S/   d0AS&ģԣܣ0 Hr <840h 0SPЍ@謝 [ W S01hS fS501 0400030020?j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q !( xVPЍx+   4ѦWU ';T,4Hkç+ VO-@`pR ,prx,0  /p[ЍX  0Q[ J0S5D  t=Ex0S@ 0 U/poMpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0! 0 d ,$O0 ,   0$0(0!00d00 ,O 0  , 8+C-0P80圐 ,MR/ !!~'MP`,ЍC6`@ @v(0`0$0F) &P@{&L+8+V +O-\M`jP@谟Q% 0rS fP @0  0-000 0 00P    RQ  \ЍS @0 w 0P@+<%5A-8Q夁X@`!1  0AO!pRS5V0 1SV AVS A 0m4VtTPDP@\`XU HA rV8+E@{& (& fo0@-P@0$M00PP0 .p$Ѝ0 R  h,d0 0 1S0y0 000 0pꃷ8+ G-pq` M 8@0D @CT Ѝ0YЍGS" !10  @@0 -p Y 4PP   @@0-p !R uZ tt00CS0@$$$L$X4{( 8+L+ٷ,V~0@-P@04M0@PP0 -pz4Ѝ0P  I,"!  0 Q T0 V40 8Q((ꃷ8+@{&˂p@-`@0M 0(`` 0 <-p5Ѝp R  ,|P10 01SL0 D1S*fJP ؑ!ꃷ8+@{& O-DMhpXP2 0S 0 000 (eP (0((  `Y@PDЍ0(0(0 0$``(0s(  ``$0 ,pDЍO(P 0u(  0C$ S  +u'P`㨡娱唑( r00R0S X 0H0 0,L,`!10< 0( (0(Ps ( /t (U((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! 8+x{&;' C-M⬀p`` ()tW000 0QdP !  Ѝ0000P@P! PP  PP 0,pЍC 0R  (*0W400(00 P(| 0SQP k0 PpK0!00(aP0Stpt1S`K\p\`D0S U > :P그8+x{&;' 0@-P@0,M08PP0 +p,Ѝ0 R  t*0 01SL zZ{e[jKZfke[KK{K+Sꃷ8+  O-MMpdb9D00PS@ LTO cP":*J@ r 䱟Y:0@@0 F+p/o>ٍЍ#t0 0 p  Y  \* t "QPR !$%*1 "! 0T 1S!1T0 0*~T !10 0*r}pg 0k o@ g 0  \8+ *O- JM M`@pPf3 y. 0S%T o 8ᄿ80T  0So0S djPY@LjP,T 4jP $jP0p40 jP0p40 jP jP0p40 jP   j PT  o 8 (804T \ 0So0S 4j P"T  o 8 8 T  k Rno R!P 0:{ajP:TZ 8@80 Ro aBQ*xlp  `080ikklgj    p5p3p1o 8 ჿ 8X L 0S o0S 1P00: <00140k0!S0< 2  x 0G0u9W)  n 8 M 8X | 0S n0S R0* 0%0%00140k0!S0404@Tk0a4aT* n 8 8X 0Sn0S `   40k0!S0 <S01W40Sv  kW01Sk4@T 0G?oT20S0G?oT20S0G?oT20W0Sx NWtJ 0sWp0;p00!'0P.&9008`d `@AapP8 Bx&804@U08080S@00 @ c/4 4 6@ @ %6p8 80 @ @0Y @  1=0 ! `0400<0@0, %pmS !105 "p04qߍ 1PS co p0 ldtD`5p`H $pH0SX ZolH-0A1 Nd! `0 D00@0`q$pm !10`100CS$$1" =B@P qߍOdoob4S \04L4 (04c0(00000L4, pd$p;W,Y RT=00D@ `P0=S #8 R  P 0=Sf "8 R b  dP 0=S "8 R  4qߍO ( T V0@40,@p_VD@90S  1S%X(  PPP `V-d t 0h 0(0 0,003Ap06/00 0HS0,S(` T'&l Xqp l0"S l) 0 SX0T R d00Sb SV S0&$0Cs"  0P T0LP0PT0p#pPWI8+t@{&lP:s ^ºR jep $Hfѻ1Omϼ,1S &o{&?Ž|+ߟܽIL+&000&00' T0&P0.T0hPFl0Sd@@T T T\0P 000@L N0' 0 0 & 0.000h 00؂Q_`@PV\< PPHP P\0p#p WqߍOk0S0 0\00 00x00( 0,p0s@-k@P   x  l ` T H < ,&T .Ut0p@-@PT`f P  p@0<p@dk  +c-M M P $c!PMۍ Ѝ p@-IMM @` PIލЍp  P0 ϻ0 lɻhP 0S 0S0 0S  $P  +@-M @ PDۍ00 R   P  +H-p3MMT@PPXY` eP eP P04eP00S` 3 4P``V ( *Pt2  A` `P_ H2P @eP ,@PP0 0SZU,00P` 0S#qW J1!P AJ PP J1!@ AP\10S P 0xe0u 0\rePPPUlIjWP P 0 VZPoP`ZZE_oR0 P  4S J P t庺10 `Pt  +}k $5Sg BHu&O-@M M`;@j/p" P@@@ p p0Wp0Y:0S @Pm aލ Ѝ0W@P @pd0P 0Z 0 p@ 0V9 H1Z XP iZ.$ EpZP iZ. 20Sa000Z0 0@0V9 0Z +P liZ.p @)0T:ZZP [iZ. p$|dJ edA + @-0`0 0XPP 0@PT XP Ѝp@&0(PP 2ЍpG& O--dM8 4@,0+PP dЍB0P 0  P U  圹T^ Ta Td;``d@000 C\D0, 0S0R0S P(0 @ P 0p@TX*403# 0303`0D0v@ꋟ 0@p$@ZF*,0S 0dT0[SDt  㸃 0Pep  ;H]p{ 8H PG 6c@01 c@00S@De삟`0b@0[UP1B~80S 04 S@$0`0$0 0/ ß00@?0(0S/ j竸z0相0S400%@ ?b D0@ AϠĠ?< 0b0 < 0b {{'0*{0B~l 0 1 0H0pl 0 0h0;P $p  ,`L?4 $;Xp H0 0D0 {{'0{0X P@ ? 0a` 0a0 pB Y@EvW`k07> G0# :g0SO0TS0[4ዤ0&  pL` 0p`Hdp 0$;P[py  0[$;XOpm X0P H@ ?"Ka"` 0Ea0[ĠP$ 0:a0 L$0Sڬ0dSkkዤ< 0 q0 0pHp1  P`4 $;p$  [04X ;$ p }! A y! A{ {'{H0@0 D0@  f! A b! A{ {'0[Ġ0 {`0 0 `0  `D0 Y@ @-f R&G-䐟`DTp  PTD PEE$U@X aP00@aP 0-40 p P @ 3MDPE@D4+N  @-@Q0 0  aP  @0S `#P L0D 0@ 0Ѝ R$m#{&+,p,,,{@-3400S (0 0 pp q++4@+@-@L0@2@00S',0, 0S00&V+++,D+C-pQ@AP@pM0a00 M0 O+ 0<P @0 @0ۍ Ѝ0 000nS% ?S aS@ 0@lpS qS @ l0h C@<0 P@0 @S@+&+$&++d$00S 00S/++A-X`0S L00S 08P8@p0Pp00++++@-RP@tM  d P RQ ğE R@S% h4` R0Pt@D\ <8    Q(P   CR @ 0S $ L6d 3\ P000ßx^;0S@tЍ R Q$P \P! P 00^`\ 1Np$$ l \ VpH 0P P0 P p00$0[^ ! \^ $^``` 0QD p1A$\% lH` CQw A0Q  $QTO 0Q D R QH ]QK p`1A$`VR lH` CR B0 pp\^ $^'! 0QD p1A$\ lH` CQ A0Q^,^ ]^Lpp ^0ؑ?\QQ Qpp,Q ]Q (&$&,ѐ,,,+PA-@@P@T N-@ P`p0Sl塑 d0 @ P,0< 8(0@A{&& + *%,,A-@P@p0S0P0`|0 R d. R 0L 0S @ !P@`T !ꘈ,L++{& ,p{P@-, 0 S,P@-, 0 G,0h P@-, 0 ;,%P@-(@ ,000 ;,+0,+P@-(@ ,000 ),+T,LP@-(@ ,000 ,+x,oP0p@-AM 00@0 0@S, ,1 AލpS> 0S0!C:P 0S0=PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&M04 CK:P,,,,G-MP*, ,4 ލP 0$C,:P @3@/ 7PY30S CSc ?5PP / 3@cs0S0S PU~T30S4 0 P. H30 0,30E> 3 3Q0RQ300?o26&Q20S  2 0P0002@0 0R R00 R P (2<"0P00  22\Q100?o2% Qy10Su 1pP0001ph, $Wa $0 PQ$0S0L$ 4PU Q 0S 0S 0P 0 000 00QQ000?o2%Qx00S  `0 0ZP00080,+  @+++,+,,++,PG-0JMM 00`0 0`S* @1 JލЍS2 0S! 8P 0S0?<PP V0  t1t p1 R0 0S0Q)Zp% 41 @T (1(! 8PZ@#P0͡ a0S @$00 R   R 0D C'l0P04qp %R0@,,,,,+,v0 0 0 0\,0 0 0 0R,"C-KM MPS* x2 Kލ ЍP0\"CT8P @<2@82000(k\P 2 0S@2勎- IP0 caQq0S 0S 00 I3@P -`1@0S pS5PH1 \v0-P 818!00,1 0K0S P+ 00 000T   /o" &l0Q00S 0@0P0 00`0@\,+,(,+  @+++܃,/,,,"++v@-PAMM ) 0 AލЍ@PP0 ` pF xt0p 0hphp0+87P40S 0 `X,_+T+," 0P/TP@-0@N)000 0,+oxPp@-@PoU p pQl0l0 pP `@P00 P )pT+0@- 0+,P@-) $0 00S/0U,++0@- 0\+,Pp@-Q !0?o20@0`Q  P0S 0 H)0S P (00p`@t6P T0 H-P80 4P400 0,,T+ +J+0@- R 05+,0@- H 0Bp+,@-(@(0 = 00S 0 +X,,0@- - 0e+,P00P0SA-$a \(00Ѝ AP0q?oѣ2 PP%P00\ Q 0S嘌000P ,7`0T0 0R0D00$\(  ,,+@++}TH++v0@- 0+,0@- 0+,P00P0SA-@ '00PP.p`]P 0 `0 S   S  G0S00dAPL03P <2 0?o20,+L+H+TP00P0@-S ' 0 ЍP  5P 0Pd00}S`00S T0T݋0HP 40 0, 0( 0,0l++Ak,,,0p@-PP00008@Ppp d6p@YP p@K'R2@ 0S80 000囋,x+s܃,+P00P0@-S )' L0 ЍP 4 ,5P 0  P 0,,@-M P' D1 ЍP0! 5P @1@*P0P`p !0@P*0@!0 S0 0S P P l0 Q0S  L0@ 0P000$0@,+  @++,+@-P& 0 ЍP 0S t 4P 0S0TP0@P ,0 $ 4P,,G-@PpHoᩒ @XP510S1ЍG轊Z0a1Y& t1 Ѝp.ZP+LX@PA 0|S@= 7@P 1 T ЍGBlP*Z aX 0P`0`ZZpʤP0 Z pXH(PPP 0RPPr5|0@0 P0 0080",+,5/#)"A- MP% 2 ЍPO0S!3P 0 1CXP 00|S &7P P 0tW@h1d@~) PP!@4Q.0St 0l R0 0 吢Ѝp00S 0C Br R0" T+FP/0S/0@-@\0%\#0S P   R   0W7 0C20s0W70 0C0(&C-pPM0P@ GPP0P   GP 0 00P10S&" hGP0P 0 U ))) 0 01P1 8nЍ/&P @)`@&P 0PS 1` P):`&P P)^P Z:&PP000S`U'  ˠ0S 00S0 @Rđ.0 崡@  X) `s  0S 00 0 m) 0S S St0 PUt 0`S[)H0PU R),P_D++V +  - BR0 R  P R O-0@!M M P<@8@4@@0D@@@FP4` 0p 0S 0S 40S 0S 6@4j!ݍ Ѝ<P0S ;S@P DP 4P $P  0040S 0S 80S|0 / QP&||&P>|0S |00S(1S( 0O 0 -=0S z_|2P' (1Sh=- L)0S zO1)?P$->N 0 ")00 &FQH />0S-@> pR*` @,|0 RW|8IP<0P |00|SL X|(0S<0>| μZPN _= (> >TSLL,U<<@0S  (1RS  S ;,q 0S 00S K? 尐0P{ 0Sx 0&PA`ᤋ⏜@P@ 0S :NPPTAV :FC@PU h@h0S(1S h0S\ 0< 0 P;$P A%"P  0P!Q/1L1H1D100p P10D1S 0S LAT# 0S PHP @ Qp0 00S 00S P @:0L1%LGTGύQ000(!R_ @@Q a0000Kp9010_/10H]pP W6M0 $ 帝PdPd0S ! 寝es\PTp`HVu  0g_0P0/QP90S PPxg/ⲻ` `K LG00S 0g?/490S00?o 2#PYP0 P70S P 0S%P 0S%t7tG`pWGP@3P)LD70<7P {00@T ? OKP l00@T ? @KP ]00PP [NpF\P<ldb'(P<70S"@h`V$$!&GV&& 0( gvy & `6 P6`V K?00t%1|u`p$!}&X50S L@7D P858%8l& h(%(5Qc&_&px0SPP4VD@X `50S 5 =` E&U 50S 5 -` |5&V D0&&p T冺[40S 50xPDM0:xP0# 0 PG  !P A0$ R 3000@ @p`P@ Pr# @Pp`@4#   0_P[; P P3Q00S G[ [ 80 P$0P? P 0*S ś`Q0-S 幛pQ P0000 /R *R0 ⤛0Q@00000S2 0婛(kP 0, o<0I<0oP 010S}oE yH+++,W_^5(&&IyL+,V 8+!Lo: +++W}z?,++` T+P+"ox@/Ti% &(& 'ZbF1!4a,+,ϙ" _ ;d+H+$7I+n,@B{S+++++P "PP P $P4kp00p0LP \P xP )0x0 "xP$0S S 0SX $0K?CS3 U 0S1 0 Y  0S U [U [ !h"2Sڄ吚"$2Q0S G?00 lH2 9SG@x2 -0SD 30= 000Q00SvzT30 00 Q 00S% 30S0l003v0st3@VZ | |0S30|~|/`+4T R<4<$<<?G<4R P X`4`D! 44L4p\0ǟs \0\0DpPU>  (%PZI0 0t  2t PR MI0"0C?o2? FI"0 "t0AH~0t0t0 R ;R Tt6DP 0t0t0 R RU 0S;0S(0?"( ,0"-p0S ?0-U0-͡P!͡!--R0l 0"R0-͡0 $`P#PPp0Sp0Sx60S#PP 噷%&8000-R0040#- 0 xxD @p@D L HHHPL #P V |` Rx70S t70Sx7tP #2p0S PEU0S gB>  1Q 0!PZQ= 0 Q0 F2#48 48pŸp U00R0SH PtPr  -$P `CPUd f80Sf8 Q a( Q08 TV 9#O1 89R-sr VO-!0pQ3/P|p9@& c9 R09Q2TKX J\I`H#0S-0:| 0R/G0S 徺00x0S x巺0x00S 尺000S 婺00lݍ Ѝ0S 03/|0S |喺0|0Y @p`@Y@p`@s@- P@=P  =P0P hЍp`P  =P 0x FqU 0S S TvP 0S  (=0PP Ѝp@0@-Mh 00MP P10S 0S00 0 Ѝ7 qQa @T0 S 00S 0s 0 :|P 0 S000Br@ T dBP 0|S 00 0S00 0000++ H H+D++5@-P$M`@ C0000000;p$:0P/S:S T:@Ჹ  % H`& 4p0/0EI@P/:@I`P B@叹P $Ѝ@/000`0 ?@PV@`00l0@@DcT@@0&0@0CcS1S@TV U,PP00/@-pF (0@  000eF@+X+@-_F p0@ `00S T0 0Lpp<0000S :BF@+++4X+@-9F@\00S P0 0Hppp8 10 10S F@++4X+ d0@- T00S H0 0@ppM00 101000+++4X++ -X0lM@ yd @=80 00ss( + +l+@-0lM@\0 0 00 0rS sS ld dd XP0 00ss,d $++X+,H9j+l+B@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T00Ѝp00CS0 Sp0 S 0 /6O-- LM|0xp0?W0 d "?p0pW (JEP`PV0W B88 (0,0R< @ 0PZ0S= S0D޽0Y 0   @P*E0S E0#S E|0pS L1 R 0@@0`P5 p`5刵P<!00CS0r0 S(P50S5U <% 00e -0We S00G00S,+ 0S 0 S Z000S800CS0=PP00CS020h `哻-0 @P00CS0 00 0 s`83 ap0SS 00   00BލЍ@d3@<30S VW@@ c030!Ct-30 V S$ " R 5U Q Q$Q V RV"d 00H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U 0   0ZR@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/X+̑ d ,T+++X++++['h+H,,^(&4+-A-` @T 娓 0 ЍAЍ/0p0$ P +x6p, h0h >oB0@S |P 5/+,X+̑ Sh+O-@sFM M`  @A A 0A0$0p30(0$ 0,@R0P S B'0 (E 3 @R0 @,Q(2@@ಟ@aGT  ) 2 Q 0 PD0P2d JGP x"xd d0S 00S D 0@d ¹ $PP d!@0S00?o2 ~P \A0@6Q6 D01@pp xH1pD0(66S0d00 0d0( A 0aPS 嫒P P  0 00S 0 0VOP@ 0 @00@,h 0@Fލ Ѝh+8+,,+o+:Lx+_+"+(<0O-GJMMs~0`VXf600S00p C 9pPnX 660 9]PX[L60 0 040197S\ 6 0S# X6&0S00]%Q0*P! R % BR$5n00E0S P,97S9 p5xn00HT%T0堸0 RS0$000(0000  0 PR 4 4X 0000Y4[n40܀C XSX `400$ 0C h00d00`0\D CvP 4D!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R 30 R0S R3(0s0?008'PP3Xm97S JލЍ000 00S0S   0JpdN8'>PX20 0 0@03 0 P? 2pl 087PL;97Y] Ś 0S [Q0sN0010S ;7='0:7<0?70>7<P0S ,0< 1, EP!1 R  L 0 0ZP 0S 0097S0 x0S [[ZX  ST000 00KX+++p+x+NH+$++,+L++v,+{+cOzp++$Zp+ *A@-2Bp`WLM LЍ@g WpPk  Ppe 0001~1 0S<0 ?!tq(q ( 0R0 0SZ=9Q ='/?@#b!"/p8?0S ?0#S 0(60 8 pp ?0S ?0#S D  pp 90S0 00 0 0LЍP400++T+MbX+tQ0A-Pr@L0 @2T` R ] B P2  Q  ,00EE?AA?1 R$!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 +++4+A-@?.Qp0S `0S 0ssŵ00`P㻵塵00000S t`0S 0ss墴000080vT  -p+++,ZO-2AMp2 M0BS t20S Wt tW tpt W` 4S4pW  $Aލ ЍtWh1P+;004P/S ++4P`*pUp們0| 00g000000000S H1o.41 1 R100CcSppW000S 0o 000000ͤ"tWU00}$<}pPx P0 p0~++,+<+V t+,++",+_A-Q0qS0`00@S Q0TZP rP }0 R 0000@ `ЍPl00}S0s00T 0S$@,%Z L++,++(&,O-쑟Q0AS0`00ԁSp4M Q 1Z`4ЍPF P0.0lP00XP" H@(P$,!020$A$000 0@, X+P 0 @ P 0$0qp`00P0}S0s00W 0S(@<Y AL++,,+!+)-+i|@-,@02 PA,s@-P}d`y P@P <@P (@eЍpC@-@P܃, 0A- 0@0PS0p`0P㬀" _P 0S 0"S0x R S  p`"R"^ 0 00,L++,M",+p@-MM P ) `&PۍЍp@Phv4/S @ )P;0@TP/PE\ 3O-@pP`V1@@P`3:&`E&0P԰0Y/  0T@1PSZ 0 10S 0X0 R >0S*00 010 Ѝ ,+@-U+L0@0 <pp-pP0 0SP0 0C+@Ѝ+ht@ ,P  P @-(Px0000Q/`0000/0S <S0C00S/ S/0C++Y+ +@-0 000& ☚ R Q 0S0000S b0Cs R S 8 8 8 8 8 8 8 8  Ѝ (&$&@-(A`0S0 0 0 0!0_p 0S:S50P0S0 0 000 Gp0S:S5000h `0P0pTI00, 0 $p(=Ѝpd+`+G-@\〠pA`^ P \T1:00"^ ^ N~ W\^ \ @2O-p@t`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V% 0V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&+5,, ,,/A-p`P @yP0  T  `00T  0@ R   `FVx`00CS0  PpTL000`000 0 ST00 &A-pP `Z@0尀T ?VW 00@)ax 0 @P`0 \FjL00D P 0 Ѝ?,?+4P&V`++O-MMP @ 04`0  T3@`T -P 8#8T $ 30S- p Q pWp Gp@(0P00E.002 `-P E"(EPtKލЍ pp0@@T ;@ p@ T.010PS   0$ 0/ 0$ p@Oa(0$S*F>C0S  X$ (0Q`$0SZ=9Q =)/?@#b!"/0 0᥯p7;(0S 7(0#S [0(0AS  T0 0000 0⵰p 0S (0( 0 ᄯp@@q0T4T ⸖kP(<00ot+qX#T+Mb@-@Ѝ@tNp@-P`L@"P@ 0"0P@ 0S 儖p%1 @-PP  Ѝ @-@uP1@-Wup  ЍZP@-PP{0@-PlMQ@00 00 T  40S P ]00 P T0 0t 0 sPIcsPI 30S @@@`  Xw sP &`( P@ 0S  4@P@ y %  P@n %TN T w 2 @0 S7 xb@P l0@P/T2 PT 02 P ܙ00 PU ; % P ͙0 0PU , %P lЍ*/m0S @P@$  %0S @P@ t%T 11@T  0P 0p`V!PP) 000m0 0 0@Q XaP@D+|+++2,&`,++++W}z?,++,,7@-P0 1 Ѝ0Q0S 1 1圝P !(0 CRtA R hS0R L1P 0S0 ,S 0BP 0S 10S 0 0e@ @g0 @0@_0 @Y0 @S0 @M 0 00S 0P,+,+ x++@+++;0h ,,,bT,P,l0,,,x,t,E ,,+00S@-@0M, |$ 0P0S8@v"@0Ѝ0@+-A-0000S 00,S 00 S00S 0  P 103/P H0Q    000000PX,ԡ,,, ,X&,l&,\,_7j% OO0!괢,@-! 0 ! ,@-" 0^밢,,P `00CS`0p S00 P0S X0X /X&C-Pp@  l1s0S `lb }\0S { 0堘`V   Ѝ负,X&, ,@-=!! p( P@ CP =z!w!Ѝr!o!X0/LAY$P 000N,N"(X&&S-90@-0@ M1Ps0S 0S   H@0 0nS )Ѝ0萡,X&,4,D-\MP \g P L00SD0\ \ЍɩPR=VP,X&\*@-@80بT ==7 B먡,puD0@-|AT 0S  0 吨X&,@-< LA/# P  0 ЍX&" @-@0S S S 0\ \ \P \ @P0PA-`@ ?  嘀?p  ?Pt @ㄗP@T*\ЍA<01 !QTUQ s00 lꌃ&~ (G-AMMP`P xB  d2d `2 T2 P  0 04R 0 0  0R  0 S!執1 `YPp@D✡0S1 1 0S000SR&@@T  徧T @R<<1<1s0S + P0]! 1 妧ڧAލЍP0S S  S00<1s0S Җp 0圠0CZ }Z << 0 @괟,,,,,L,d,," X&T,,0@-EM,P eP@P;Eߍ0 ,PP  ~ ly x0 <  ATP1c ;”" X&O-pT3MP@ `<<8pX(# 3 UPE*psR00CS00ጦp00 R0S^P1s0S2 Pp1 Ps0S 0 0 ^%\PP2D2l1s0S  ꌌ0 PVS,1s0S : 0 S 1s0S <1s0S pl1s0S 0〱0h1 ⯦ RHP1P)  X $11s0S V`F'P`ť <1s0S0 i ЍS R   RU\P0 U0q0QLLD:ꐡ,,! d,,,X&,,L,,T,*p@-BM,\@P3L1 D#mj$!31 2PP:`0<1s0S  P00  DABߍp g@`UPp0+(N<!t,d,,,X&P,T,,>p@-BM6,hX@P3X1 P幥0!(1 $ȥ8PP=:`1<1s0S  P0G0 唥 Bߍp @`⏵UP|@~{&<ⴔ,d,,,X&P,T,,>0@-Pp@4M6\ 0PP <<0000<<0 Z V4Ѝ0负,T,0@-@DP4M0 0P88 0>4Ѝ0负,@-M, ,PF A e 0 001  1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍ZX&,A#T,@-(@ $] @V괟,{t zt @-@HTR٤@;p@-@PPpP p0@-AM MPAލ Ѝ0❥P0!b똥PPl1LAd1T@㵤層㯤0!P0u׋塤埤囤+|@唤 gU 0S S 000 5JT嵋   T lBt  10D0 S B/o" R  0CauUlX&o",&tN,@-MP Pppp p3l@PL\܍@Q, HP p܍,0 <  ,,X&0@-MP MP%@i0@SۍЍ0@p8P551d dPPTۍЍ0@@ 5 , ۍЍ0 ,,@-#P xxE P ``P DLЍ@@@Ll1s0S(0Ѝ@ZЍY,_ X&,p@-P MP(P0@Sۍp@85P5p`ሓ@P\ۍp@貒P l! r R< < 57 ,=ۍp ,,#_ X&;C`@-  1I&O-P4M p858p=0~0`P@p0p 5% ڏp0G$t `V V Q 0 P0$404``VSPM 0p$ph6P`k pXh TtTD T<<u44 U! R ! RH vtS)`S FSJ (9S /S 00C7'pa0CS> = > = ? = = x? = = = > = ? ? > = = ? ? P{ES 0SvePS43@\P{ WPe R@Pb 2 P100T2 PᬓPW  妓PS d1PPA d2!00:P2 2 0030SD$2/ $ i$ P %6!,00!0 0 ȡ0,P @  1 T T@0!0!!00PP@ 0  R 0 " l CX&&@ .hN<r> 04Ѝ0H,X&@-`0S@ aP0S 0000q20\ @軅H,M 7@-0Pl000p@h R R  l R  R4w03/ Ѝ0Q PX&&H, p@-,AP1$aS 0SP sAP00pPP0P P0 P P0 t ph0T@T  "  \ p0X&H,C!=> &,&,,0@-1s0S 0P XX&,(0@- 尝@0 ȝꠡ,,,p@-`BM P⽝@0 S0`01s0ST01y0 妍0Pn00x0 ⁝BߍpB/ BR 0┝00P y0001꘡,X&,, 0?o2 0/X&H-AM M r 00000P00챟a1 _Pھ0  SP 0SS WS BSr1 +@ P  Ur0S  1P0 S0Y 1s0S Ԡ0S  Q@ |PY 0@^ST00CS00  S00 P0SWꐡ,TQ ,,X&L,,p@-PH@P@pvP P oP @X&10/@-Io/A-@PP" p00CS"DV V V V V V V V `V @PPP0 P00TA 1 0S P0000 !0S0R 00 < `00CS`0p SX0X /X׌&7@-`AP00C!S90000CS/W W PX 80d" .PI T .0Sg hg Xg `g pg |g |g  ?@d 00 S @. @ C< ⡆0ЍC0ꀈ&=p(&k p@-M P! 0: S0 0 S P@` 000vЍp ㌖p P @TPT0dHS 8$    ,O-0]M-SP M0S 4P ]ލ ЍOv/u]ލ Ѝ@p㤄ᥗP$ 00S0W0S 0S\` \pP@   @pu0: S  SГ0S PP _u )W ]ލ ЍO|P xK0v: S+( `P@` P|  P p  0060 00< 0S0S`-ŕP`$`ӕvH`0S 0 0ổP V ᳕P z{ RyRwቕpPT Px!1Z[ h 0ᇕᾖZỖUip`4 0S!P0!0v0 P: v?b  0S -vHpPvk*P-RM 0S Hp<v,&vWi,[ :Oe{ &0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@ !P `HP00S D00S  40 .H"SZM,X,,&@-GJ/@-~Pp@-P@h{p 000/`,p@-@P0-S@@p ?IP0Tpp0p@-0@S`@MP0@ B P@ЍpPU PJ }0P0갈&`,VBf( @-@P @/00S@T `,@-@P$00SЍ@ Ѝ`,A- `pP@P000 PP0 0 @-@P P0P00S@ `,A-P`MaqX= 0S: WP1 @@?T.   `00@ C @ H00 *S ?0P?gZP10GG>P e `ЍfB 0@- 0 -R  UR +R  P> Q>|0:S >t0@cS .S bS S@0,S@pS wS 8O 4 O 3vP Z@PV@PR@P@0 0  @R0wMPMP MP MP hP ] gD,,,IJ,NDvD,BDDDD&,DD,DDD(&DDDD 0p/ᜱ,@- p 01SP0|  Qppoh ЍR @0!0P0< 0zQ 0T! Wꜱ,m D,D 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @P꼧 ԧ ( d #-?&? r  )? ' ? ? , $? ?  &?* / ?! ?  ? &?* <1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P p!lq? `P`ĕ ?`ll@@`@@ꜱ,0p@-P@P QT4@pTT@DQ`V F@T0t0S <@ꜱ,@-l@PXPHP <00S,P,,&,$&@-l@PXPHP <00S,P,ز,,&,$& Q p0/ᜱ,P7@-m Ѝ0P@LP @ $GP r0ll 0`T! _PP <0X!$0T(00PD,D,@-,@:P5Pв,4&00P0bA @SP//D%A-RPp `@X@@Ѝ`BP@`@P,  PP@@8,A-P` @P  ppPd P@P  4@rT  AIuIIIIIp@-Pl@P T"PpDPpp@U p@PpI5z O-MM`p 0@P ⶇP0: SXRvqX  }OP  Vw@P> tލЍ R R R00 P P@ P @P PP 0"SU T 0S0C0 6/ ?OP 0mS P_I(&II&IP P / o8,0@-PM@  ( 0 BЍ0A-@Pp4` R 0S up@I@-P , @` 0P FЍp8,@-`@ (8R808Ѝ 8 0 CS  8 0C 88,@,p@-PQ@`0 0S S 0U P 0U duVpP0S l` Zu$0SpD8 Pup@  p@GuRp&IIcOI $0 (((( 80( /8,& 0( (( 0( /8,&C-@㸀`p0S Ѝ @tP0S0S P 0 ( ((089 PP00Ꜳ,8,7@-D@P@@00S Ѝ0 =P8,s@-PP@X:`8 R8 R8SЍp 0 80 S088 8 0 8 00S0888,Ȥ,0p@-A M008S/ 0  0S R(0 (SP8`000 0C?UR B( 0 8 80C 80 CS Ѝp 0P8,Ȥ,p@-P@M8`0 0 0 00C?UR  0 R 00C8dЍp f0P0_0S0 08,Ȥ,@-@8 R 0M 0 ( 00R0 8 80 8M880S Ѝ0CR80S * 0S78088,Ȥ,p@-p@XU J8PE`V` D0( p8Soppp8,&(080S @-/8,p@-D@0S PX% 8P 0( pp8,&p@-P`@p Q0(0p0CR0R: $0( gp008,&7@-@~@P@P  AP Ѝ00P$ /8,0S/0G-0PS`p@U!@0 00pP@@@ X P00nn @ P00,P R/M-@-4@$P(0,0P  $8 8,&O--@7@G0pPS`M(X/ (R008(X8# 0S0S gP0S08R00(XʨuP &PЍ0808XU08PXP,ЍO$8S$ &0 S PpP0@S   d , Ⱦ (  eP 048048nPP0480488080 S[Y0488S0S S 8S0S S 048804880S{ 8048v048g0480P48i0488S 0S S8S^0S S[NL8SU0S SQ048c04880 S[80 S AU80;0880$48XX1X3`( DR( B( ( WH`X  2sP`iKhH80S 48PS8P m088S 80 Zt2"8Q WD 0\48 D(<8RqDPp4@>P 0480 QZ`Z ` 1弁4 50 0 0 K Z@ iS0S` 0 :Pl bPi OPf 0  0{P P BiU 0EcS\  8  4 $  l  \ h p  h 8 < d P T @ d @ 0 h t `  0 $ h 8 0pF.V WppVdP ePO`>, 0Spc 0SP0@_V0 ,0Sm V V000#=V00S pL W P+V@  V !VQ00-VQ00  @0#0lP P 0 a0CS000 p.P  3000P 0Sa0@S @IP{00 0S WWP \ 1i,00@0S 0) t-]3P 0S.P +  a0FS000 +P +0 /-S/PVV0FS񟗘 l  X z 2*V @V !Vy|70Ss07S|0W90k 70Sf07Sc {07S^ p0#t'  /10@Sp @ph07SyF P 0S S60S `PP p0S860Sp#0CSP  =P 0 TeP0 S 8&0!R0*?0e60S  eP0 S %0!R0*?0J !R00 !ı>t50S!R0q !R0 0!ı+ ( 5" 5!R00 !ı40S!R0I!R0 0!ı !R0x*?0\40S @40S (P0 S 030S x0 S 0 & u~ 8 f!SR0p0 !00pV0S0 !0<00 eSd0C0<0S 0d !0<0<O9P02P0,+)0S 0!ı2 v4T$0o620S 0S @ 2 D 1 H 1 P 1000!R0 0!ı10010 00!R0 0!ı3 0< P0000!R0 0!ıj P P<0*,JJ,Jx,&O,,, ,D,T, A@&J5K-K$,XKeKtK JKK,KKT,|*KKK,KL&HJKL,,Ȥ,,& ,800S pRlPwP3 *P R/  0_0+2!5?P!R0 0!ıP& +P P !R0l1l1|0h?P!R0 0!ıP !R0110!R0 0!ı?P I}P>qp ,2 !R0 0!ı?P`!R0 0!ıP ~2PPiP 0P0,P;`(P 00,00  , 30SW$UH8# J0 p`P V V ?U!0> `Pt V Vq "0 `Pd V Va  "](40S %<`PP V V.`!0PIp$% x(`)0 !R04 0S40գ?0/0 $0 S00C0 5 !R05 0S(50գ?0/0 @%00 X5 h50iS .0 tK50S080/00S/ᜲ,p@-@P/!pO-S`MPp8`5`@ pP Z:T00)1 0T S@D0X0@D@Ѝ0 0 0S00P0S 1 0BS0 Q 0R RR R0S 0T@1 00P R*05P0    cP d[0J0CꜲ,0   /G-pȀWY+p S@0ZPPP @ ZPPE0S`0S P B0 0R R@0`KM-@p M@Up00PCu RT0Ѝ` `?$>P ?0 `P?=P@p@-@R `P a0P@@@@ P 0p7@-P@Pe0;SP0;S0@?@T AT `00SBC Ѝ0D00SCB0mS$00P##  0 ,,L,A-@P`pTF  p\@Q=QQP gP3 @P% @@@T AT T e00SBC00SCB0!@00CQ# 0 DP|dP fPdP Q gR  R R0  0S0 E0 i,,L,@- @ @̻, @-4P@6,̻,K @-'P@),л,LG-P2@T @ЍvPP& P0`v@`pP 0@qpa xvv?V Y a0I0 P 0S0MS0+S0GS 0US 0US 0UES0UnS0UdS`X0F`p 0 @vT cT eT G@P 0U~ x@T@ 9@P 0Uc  +@P 0U P+,ػ,?Lp@-p@`PPE<@,A<0IV@ ``:<D mP p+p̻,?L 0 ̻, 0 ̻,@-l@ P P  0S P Ѝ̻,Po/@- 6+ Ѝ A-`QpP P P@P%U0P 0 P l @`T @P 6/P`|LIL@-~|0p p0h hhP 0X X@0L L8P0@4 4 d&\&LT LL LLLLLLC-<1M0SI ,10SE 10S@ P` p CPUiP@ Pe@ЍP@ 0@Sd@ 0DSd@ Td@ 0DSd@dT`P PEU@ꌤ,,,C-@`$M0PSS000 @ R S#\R# :R RDQ Pp eP 0H3/0S@00$ЍP/@-&p ' !*`Ѝ00S @  d*\0PT T ' 8Yqp M H,M>M`MO-@D`SP>PPPpᤠ夰0F R ЍWpV R  0Ye0Pp@ U  PPUP@QpP RpPH&I&p@-@QP 0S R SppQ0 QA QR P/@ PRP/7@-PQ @P 0T Ѝ0@B Ѝ00@-M M+ srp@  = PP ' 000Ѝ0T, ,400S/@-$@P P@H,T,@-@P  T,P/ @-p@u''0@-M@'sPs00S@{)PaP DP OP AP n)dP oPi|0t00SЍ0 {s0LP 00qps00@(H,MM& NO-,M0S p0S |0@S R P 4W ea {@ P 00 P``P\P# LP  P`` 0S PPP40SWPT PQ ((@(#`P3P00P0P0 tP0P0 ?P X `( O^0 cЍrP"& 20S P TP   @( YP rPY |2 ppd T2 ^D2p@20WF0R,2P 0S !P (sP11P T@9&0S )/ 1X P DP Pd1 ]L10S K] 010 (0 zqp 000Sp 0 16P  0 R  [ R 0+c 0P: l X &T,P,A N5,dN , 8N0,X,4,L,,D,\,,@&p,,4&NP@- 0@T,00@-P i'@ ,N5A-P`XpVkPU@JTlkP0, 0 T,@-P@ @0 T, 0 T, 0 T,p@-P@3@P Pp@6pp@-@$`*P)PpVU p@ Pp PpA-@Q`Pp q\\UlG-M@`P̠@PUЍppP\60TP \4p0Si T,@-V 00S  ЍxT,0 R/%R%Q sQ00@-(@0SP004,NNG-`d d@p00CS0 Tpp PP 000 P U 0D IS  rW/\p@P@- 0PNA-@0 0pR`@0S00 R0S@00c`P0S U  aP@00H&I&O-MpJG`@ P1!Q[ Z@9P[@P* 00p00 0 ЍPP P I /PT0T VP>$P  VP00pWpH&I&O@-@Bp_PPP Ѝ@蘆@@@G`H0H 0P0Ἷs[ ၆@m[ Ѝ9_"}k A-P@Ѝ0S `pPPPZ@P D00< 0`叿W oP?[oV ˂@-  ЍIG-p@`P@ 0S P@0S0# CV* UR@ R %S #SP i@# C V* WR   R %S #S 0P &VI@T,P,C-EMPPEߍ@ 0@qp `,SoPڬ嬐P ` P:T0S EP @  {0pSJ`P  P@Ꜳ,,A-dX1@0SGe @1RpP? ,4Q 1P````P=0p000 0`00ᮾeZ밀P@pW WpTZW PY0SHZЍ tW?Z@,5O OI&H&O4O{@@-  R@@P0P j@pF`PZ@ZZ Ѝ,P 8#`PPP t0 Y P YU X ` vv`nP ᛅX@@P@T 000h0Q@P@`@၅0SpY@,,OK5@O N0C-`V8@P} P0 P ЍCb#e`bpP PP@ P0 p倽7Y5Y@0YT  ЍC6 Ѝ,oOyO-M oP  @oЍ0@-@P0MSP r@GTT nP @Ѝ0@T@0: S S*@(T,H&X&@-M@nP͡0 00Ѝ0@-M0P@~ nPh0 R\P0 R\ tu p0St00Ѝ0T,(, ,/"@-@P P0@/R@-@ (0@0T#0@h,@-_ 40 R\00S@"@8,$,h00S /pp@-qp #qpP@ TUpp蔱,@-P#P03#0 R/  8,O-a$M0S@uPp0S\0SP@iP@q@100CSj$ЍPp@ 0St#P{u00 } @0 00R  0唐唀00 000 0 0 0000P0 0000Gi P h,d,Ȥ,,,,O-M##PU DP,200e#PPp1x20S ,P`2PU T Y&Y @ `"U2 2002 vt " R!!      1 0GZ 0Z "+qp@`X  #P#PA"P "qp 410S "P ЍO0 00 0 ЍOpU vtQ 00Sr00!20 0Q+*@`5vtP`ꀤ,,,,&&O,8,,0,h,,8,,H00S <0P/000S $0@///8,,,,'G-(pP@,`lP"V $10S1`V``ut 00S000T T0 00*+`+000Y Jw*0Xs@PY ЍG"V V &ꀤ,h,8,,,O-M`P P @P! ЍO!qp@PV00SЍO0A"P0 00@XЍ "pP@PT!p 0^~!qp0 @Pꔱ,,,A-p`k!qpP@VЍAv_!0  0@6Ѝp@-@4P0SPpNqp @ꀤ,0P  P/ሞ&0P  P/ሞ&@-P@p@-@PptP0S 0 0HS @ 00C0UUp@U  B 0T,&P,0/P,G-`Pq@T  P7 Y* UO}UT$8B@Dy0 "0UP00040000 (@0@000S 8 000@   0ꈞ&P,P/P // / /00//0////0/0/p@-@4PPP U4Pp4/O-M P؃d @Pt@@  0 )@P 0   )TP0@=TS@> 0 (@P*ЍT <ЍOh O-@P4M(0X0 ,0ut@ P4Ѝ40SV400 ?QN)(@PP,400 0op P8v   s[0- Efp` P P@Ps3v V}t `AV@P,0S1 \3pW1 pA4(@300X306 0$ `P  R $0 S S# P P `[Ɵ`V:P `T@_A[ l20S  P0 (0 S +  %PN20S 0 @ 10S [A= P Pa p 4ЍO V P0k 0P@ R L10 Pp``@P,1` p!pW 0 0@P_ V V@P P P P P@Put 0 0@P_p2 0S V V0 0 0S p@P }`0 8,,,,,,,,,,@-@ UP  (0 R  000Ѝ舽,O-` !0CP0@ S 0 ST# 0 Q$DpkC P$6 4 4 5 4 4 4 6 4 6 eS  100C000@PT SQ  p 0  p@@p0@@t 00 0@l@p@`@p@T@pQ 0xS QSDSp P1So BS0< C^R`! 00 0K0S@@@pR C&R7 `6 `6 7 `6 `6 7 `6 `6 `6 `6 `6 `6 `6 `6 `6 8 `6 P7 8 `6 `6 7 7 `6 `6 7 `6 `6 `6 `6 `6 7 `6 7 7 `6 `6 7 0@@ 0000 0000 0LS 0 0 000 0000 0 0 `0000 R      R +T,`,&L 4P PO-`PAM@MI`pؕUp!`-*(p)*0,p<00$*pQp |pPhuR `SpPM!0 0 0TP0  TP  TP ,00 ,PbAލЍ TPg TPY0`=V+ !V( <V 0F^S0`͕ 0͕0,$S$I>V =R+`0 =R-`04 % 0S =R0<V +V -V !V00S00=V0C?o2 P00S 0P000P000PR ` 0 S+#Sp 0R\S 000SD 0`SL =#PV*0P+Se)`0P0& <Ÿ<30 R R R000#=R00S000=S 밡就&0000 S0`S $ 0 Q 0 0 0Ppd`0UP0`0[0Sv pv0P~ |qLLȞ&T,Y&5&_PPPP Q$:QPP[QjQP$0 RP  /p,0 14/p,0 Q/P/အ&@-:04 ,    00,, , ,G-P㌐剀L@}LPT`ppP MT M  !  M M @`匀p,A-8p@0PS` 0P0aP p,@-@$ 0 @zp,P 0 R   /t,p00S/p@-`@mͯPPPpP 0S8@pPp  ,p,CUT@-@P00Pl0 0  ;D0'<'8'4'0'00]Tp,)nTT ,,$,0,<,P/0/p,p@-0P@0PP!S 0.PPPPPPPPPQQPQ'L'H'''Pp P 0Q000p, ,,$,C-霁P0@SpM`5p`pp1 00!0Sm0@ 0  @P a00CS8 `PU8 0 Ѝ 0P     U  R Q   R l@S `P 0R  |PxP,,l,,p,&&|,,0P$0 00S000/,|,,,p@-L@P`0S0000p01S 0'Pp,Pp@-`0 p@X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C&@`P 0SY000|  0p  0d  0@@Pi 1CP Ꜳ,p,,,$,,O-dC0M0dwvP1S4& 1S7 Q 0A# RpY( Q 000 00P20S P P1S  000 0ap1U 0S B 0 S1C10610S6X@ 1R.sr0nS `0 0`Sx & M`0FY$ 1R%Ѝ  ` 0hP 0 }0IQ0 0Pʼ Uz% 0R 0Q|` @ 谄P1U PEyP  0p,l,,, ,Ȥ,,A-`00pSP HP ` P 780@L@ 0@0TЍ,p,Ȥ,@- 0d2 0P ЍA-`p@@PGE$1S 0P $@@ꌽ,7@-T6k.sq 00P6 "B06PU pE|BP0 PЁ  ЍC 3P Ѝ,T,,@-P ,0 0R  T,Ul0@-0`  ^ @^TSa04S '0s05S #T,,0@- @P0 QA6R 00,G-rpP@P P`PA`Ap6W @,00S/G- M`pF@吠吐qpp6W @ Ѝ 0 : PU8P P 0 PE,cO,55U@-000mS Ѝ 0 Q0 =@P 0 S#  PPP0`0 S = Q0 R pV`PPp 9Ap00ꀤ,0@-!@MQ0P) P P0Ѝ000S~@PP AfP@Ѝ0@!D00S<Ѝ0@ 0,00 ,DUD,fU&zUUU 0 H,<07@- R P(0(@?@0 Ѝ0&,@B,@-P M# @0.S 00S Ѝ 0S 00 00S000 l ҤP0@  0R 000@0,0U&UU,UUV<07@- R P(0(@?@l0 Ѝ0&Ȥ,@B,@-P M# @0.S 00S Ѝ 0S 00 00S0006 l iP0@  0R 000@0,0*&*VBV,XVUtV@-@PP  @ ЍV@-@PrP  @ ЍV0Sp@- Sp00S p@t ꧿l0pLo`.P p@qpP@ 0p@ |,V,,P07@- S S~l0 Ѝ0"XP@T0PP ?@} Ѝ0@?0 00 P&T&VP/L0@-0@S T00 $0$ @4,\,0,V P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PP? Ѝ04@P,0  0 10N @&<&h,D&, 0/0/,P/P @P/M@-@| pl}0PxSPLHD@<8@㞾Y&W W#WLWWWWXPXX@-0@dS?@S 1 CR&C. 0ЍA C#Rp| | { { | { { @| { { { { H| P| { X| { `| h| { { { p| { { { { { { { { { { { { x|  0Q1 / Ѝ@k Cr Q R񟗺| { { { { { { { | { |        @/P @Xt,XXO--PXdMp0`0V@'*0 RB @0`00C S ? r 0V00C/  0?W@[ E0!R1PT*0 R 0,SU\0T P0EPE1!0C@ 0Ѝ`@U ,&&C-PMP M 0-@oݍ ЍC` @?90Sڐp吐\!$;0PSR`*9MP0P ; @@ݍ Ѝ j9갢&Y,Y&(Y P@-  0S 0 0ЍP  R `ЍL P008 408000000000I&H&8Y\Y@-PM 0  0 x0  @ld P 0S>000D ;0Ѝ,0P 7'5,,fYP @P/t 0 /~Y(,P/00S]W,0/@-@0S,0/@-,@0S0 0N00Ѝ,Y0/@-,@0S0 0<00Ѝ|,Y0/400S/(00S/@-qp@p,T,P@- 00@ ^S00S00 Ѝ0  &Yp@-P0M % @!`P@@0,S  T0S 0 ,R 0p 0D0SX 0Ѝp40@0000$  @h,d,nsZZ;7ZP@-P A) ЍRS,DSSS C1 CR9 0Ce C R          E CS -S0S1rSdSWS ^S wS     0v0  E000 0 FK N R WR Q S-00 0  T,TZoZ800S ,00S 0P//,d,h,$0P/0 0 0C/,,h,@-PU  @ Ѝp`@oлPppQ 00S0\Q0S 0S@V mP 00$Q00Z,@-0 S 0*( (! Ѝ * Z,Z@-u@ 8 ,ZP/0S/P 0  //ooP /@-b fU 0LP/, 0@-L   Ѝ,Z@-`MP@0-S0p00Cp S T 00ЍU TP PTU $PT00W`ZZO-P$M cLP 00S S03/0L0$ЍcL0 @P``s 0 R @@-PM >$P P # 0@s03@  ZMRaDY@Tb0SV+P0P0<0 P 0+S%P :Ǻ:9P/Pz@0nP0Sn@z@-P00 0+P0P0PF2 aIY   0 0 @ =RP    B  dj000000 CR $ d < < < < 0U?o 200S 3/PV U Y RR00SL@30 S 0\P%00S ,4,\,E[ [Z@-@PM @PUp`0@ j[ЍU  _  B U R~  K 00 CR 꼎 ( ( ( ( h U0S U3/U@pq 0 W_00SWSW 00S000IU= U U 0?o20 0U. U U V `Q``Q`V  `R``R`0ESU U U / 0S0 hjPS Ue 0  @0 _000W Vt[[[ \[[L,s@-P`@000C S0 ` 0 Br ^ ST00ЍpT00V (`S 00Z 000S/P/,4,@-X 'P H0H@ 0S0S  0  03/$@%\4,& 80S/S/ 0CS/$긢&O-@0M8a R S= 0S 00 ЍpW-$` !ኸ!PP AAQ-P $ UQ@0  U Z@@Oo0 B Rp 0 0S X 0긢&@-PP0Vn&/@-0M <20S0妊P 2     'M1 0S@ 10@@0Ѝ0! R0; "$01 S 10S 10Sx1 X11S'  M2 L!2 R@ 1 10P ! R  R @000L0 @000S T0 0S T \0!P P 1 10S 1ٷb0St ^0#Sp @(,,,,,,,&,&P,@-,,@- 4 Ѝ@-PA9`{@x@@׷p0 `N Ѝ>@-9P ,5 Ѝfn8,G- @$pP` 0ᄴ !&0 y@@ό 0p\0030#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 BLЍMb@B40@-0@@T  LP  0  &L,L,@-@0@ &0$R/ $L,p@-0S 0P; 0 qp@PP ` $ut P0@P0100@_V0` 1?V `V p ` @P p0$0 0(00`0$00(0 080< Y0s000 Y0 OP 0  |qp`0800 0~Pi xC 00#  dPP P(Ѝ8s0S ,30S 0S(0S 0(0v0(0Pp* W0[Dqp0f=0@3r00 5PtBt 00 0(0j0S 0S F020SW@ 2@@DX0 0 i0Wq!|s!@TJ0SIW1@0@T00|s D0p@qp m00S 00S zW 00000  0 0`1PP─ 0S 00SJ UH]E qp QP 0S 00SP0 x,nn8,,,,, o@-(۵$ 00000S@ ,(,@-(ʵ$ 00000S@d ,(,㝨@-髭8㶵, 000Q00S@ ,(,@-@P 㠵x0x0Sd㖵㓵P@菵㌵㉵ㆵヵ ,d 1A-@TPP1 pG뾬 he>?=_㳩 0@ `Pp0S0S 0d 0?00 80 ,00SA,d L,Ȥ,,L,,G-pl0P` Ҩ @ .P 0S 0S S,A-` pP@ᰨ#0Up0P ᡨv#p@-HP@T 80   p 0 #(!((H&,O-(RAMM,`(V Alp P ;0S0 000AލЍ0!S  -PA>04S S S0X0S  0 [Q0F0S 0 C1 Q ? 0   ^R000 Q\ S$R 0C0 O0P0000\\   0C R 0 CH&_,O-pQpPpMW M ۍ Ѝ@pcPGTp\3\C  TTDs (PY PU@ 3T oS p*P@DT2gP@ ᱧᮧ @@ 0 o$X 9'| GR@ 3'T@"0S 000⋧P ;04P ST@ . Pp 0Q 1T SP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S P? S0p0000.,H&&,(&oA-o_0@-@ỮP崮P |寮P l媮P \奮P ;P;H&8o>oEoKo5@-@P ?P P P(@aQo^owoO-1M0SY A0 ЍO0`<10H0 0p `xw.@PЍ00S  0 >00S  0P@P  ĥ0 000 y % % 0S@P,,o,,0@- PPPP^0S @T 0 @ ,H&0@- PPPP^0S @T 0 L@ ,H&0/,0/,00S -/,@-JP !:P:P,@-0,//@-L@ p0 P S0PЍ,Q \R0* /\S \ \0 %*0000/@-@P ?%000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P Ǥˤ`Q  %$` PЍpA-p`P@T@  A-P`"F$@p kQP ,0 0(000`PЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-P`p?P@P$ ?0P0T0S@ s@-0P00`a0C@S@ ( ( 0 ( d ( ( ( ( ( ( ( l  ( ( t ( | ( ( 8  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 Qg \ [@Q`V1!0 @g[0F?o[\20S7 @`^V`00]QQ! ]Q0[Qp.GqQ 5 p`0W]Y0`QV0 0 g\Vp0[W` W nW \W`Rp0 V0--oop7@-0P| @R RP L L D\ D   Ѝ0@H @(&--(pG-1`MQ@P㈡``0pW0 pp.PK P1 H1 000 (f\W R T R 00P@0  p0 [R .BqQ  [TS[Q@]R  00000T[@T[T@  ST  SR(0 R Ѝ---Epp -00@-00M/SP M $S, +S00, 0 0 9S$\S @P0 0 f0IS0@S0 W00ۍ Ѝ00@00 S00@--p[pO-@ MTЍ0tS bS rS aS @{S000`Vp F` 0S0QU 0W0 0ͪP 0 PUP @0@ `0 0e2pP", ---pO--`?M @}Q ;Q <,0 d \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4P <40 @ R @XT;0S008+85p  Xd  R @   R @` @ R @S 0R @ Rt AT- 1p @ 9)0 4" X 0P00)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$0,4 @00T@S0 8 0@090>: 009 Q00A0 0C S0 00, 4 P8(0 t\QG THP R,4 R $H, 4 00P@0) 00A  0哾0+ 00 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 0P0 @  y\R0)0\ P0 Ar R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS00 0 0 q@0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQ L4@S 4$0 S$4 0S$ 4p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0   ppp=bp2p"0 0$ $p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0庪 ⶪpjp000p WH 0S  ]p Ua $ RppXP  0$ 0     呻!1 !  0ƪ0 $p$(⾪ $ p$p|! ,(&,--pp`&*upMqcqqt u-  utc,qqqAr,r{sjrrr2s_ssstMt&tt--q0 0 (\<0< 0 L[a00܍<ЍG-@`@Zp圀P䘐U@T00S Jl0h0CX0 0S0 0  P,--Ku -\ -p -l -p@-P @%000P @p輰&@-@ 0  @0輰&0p@-P`PUpb"@P 00CS01p ᥉1p0 1-_G-p`dBd 0S2 SQ S$PUVP(00S S \ *"P$0, `0000 00!؁PQ$00P0T00, <PP (00S(0 #R nR0V ,0020#00$0,0$0"1 P( T0R #R nR   PH \T000(0V0(00PP P 0\$T 0\$w 0(0V0(00 000TPr-_ zQ-Hv@-@X0  0S 0S00CS01p Xڈ0 o-G-(DMX0`SpM00S 0S _3#X0X0\030 `00d0XSXP 00CS00p X塈X "pP0 p_0 X PލЍP2 l0p0S 20{1P 0j1P yp4S y20p0p4S \PP J0P d00\0K1P|p0`0d0S00d0000S 00Sf [2P00 2 02v_00S +a+a P0 e_+0aJ+0aa P2J_b 0p!~ P*2\PP /@ P\c 0 p,p 1\0pp!1 0`PS(00 PX5000.|0\`0P l000S S0P@ 0 P00 00 lC(00(04-Nv&UX-P- X-rv{vvvv"v"_@-P ^ ЍvP@- ЍP ^ Ѝv@-P0 ^ Ѝv0@-\P@MP  0#0 #Ѝ0X -@-`MQqM0S000@03 0@娨0S  0^ 0 0S S ` 0el@P *0 7 P/ 0e00ڍЍ\ -D-H->_@-@P   0S|O^`p0 R `   50P S t 4^ЍЀ\ -vNpG-Ap0吁0`PU , R:(,50(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0   X} 0 \ -(&A-@P p0R`*W00 8} 0P P 0O-/MO00PЍ080?PU 0PH0\\e R7 0Sd?0 C0R 0i Pi PS4 0 PS>0@oP 0 R >0R*0 0HP0S40P 0 R D>0R4>0 0S> 0RR0S0S4 0 S=0@oP 0=0C>S񟗐l P P P P P P  P P p  P P P P P H P  P P P P P P P P P P P P P P P P   l 0 P P X   P P  P  P x L    P P    P  L0 R: L `0p0080S << 800 [04 0c<0S H0STP80S4PU 0`  E%P080 A E4 {0T P$ 0  004 0 0  0:40z 0 :0RḚ <00s k0P 0S i0S 0h( !/P2S 0 H` 0S0`V: Y$Z W00@ 9@0S } 0\  H0$hP x0 H$0廤$ [P9`0V:D %$& #` 00C 0 0P0 8 0R: `8  0 c `[ ;p {x8P0  R:d`dd8K \`((1 S:` 0   07!R7 800 g04 0b<0S diPk0800 D0$YP80S g04 0b<0S  80S0p4  H`P <000F400<0吆04 b<0S zV 0400<0H6 800 0V04 0lb<0S buL0 R: L / `0pZ00pY R  Q l5 50Z4000  P 04`Z Z 0Z 000 G 000 00 V ,Z0 0RP  0 0 0 PQ@ `VpX 0  `G0P  ßH`pL(L<Hp(L<(0000S c04 0a<0S ` P/ 000Q00 0  0`Vp P\   `VXp0  `Pa 80S0s "+p0 :Z04 0+40P0 0}+P 0S 00P80S0s$"$+p 4 0`+40P Y+P P R0x5\0`pL<0p<s80Sp4Xm P!p 0`R@l0#0Va*00000S(0!0  (0Z0  0;H0  0 1 R60P& 0 01-\ - -,D--4 -(&İ&yBht@^% H->o9w ww-wt -   & - -$ (1 0X`4H`pL(<Hp(<x0h0<0 0R0((Q 0{Q  ,  -p@-@P`Tp0wS {S sS 0p *P 0 D 0#<000p00007< <0 0B15s?0 0@Ib -0-01S ^00oS^ P0\ S0S Q0S R P0S0S00QR . -0@-  `Ğ\ @ T\    %R     -.A-\A0 5S <0S 300,!<}P a q 0U&%0 ! R8  (P  h0  ,P  _0  4PP ʊALJ00\P lP @ C00, =PaS.! @ -&e< -p@-@0` RT  bt哊d lP`PT p ]vP000ST+ @&&uw -ws@-P  P'9@P-0?S0S@P` ƨp Ѝp/TP@KP 0S S K@꺠0S00VO www@-鋠 w&@-0@<TQ T00 0001S R0Slp@TX` T@0$ @H4T(8  @, -x#x&.*x6x?xRx\x@-A A y&7@-@PU  }0S 0@T G00 Ѝ0A0"S p`@-@P  p VЍRyp@-P PP P$UvP P1QA P tx1S(ʰ1 A P sxP "00P1 RF40S 3/Pd PP d P,Ѝ0R0 Z[ 0SpW 0~ 3/px P 0`A P s sd `;xnd0010A^90 b"P 00P000xPdP <P >P qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00PH -&_.RS(&.я$& 001/H -P0 R0//H -O-p`*@PP [ ! 0P @ Ѝ0300 0\"<P 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @H -P/D0 R/0@-A1 P c@< H -O-Bp0 ;iW ]f0p 000R Ѝ`$Z 0S lP  V00010P@P 0S 00@ Z 00 lP U0S U0 00` Z0S nlP U U 0 0 00U0 P0HS0SPPQl 00Tl0S Ol+C P UPU h0X!0Cs0S 43 000 PEU\ -VUUU(& @O--$MPZSQ0T @ 0 $T`= <0X0 0S 0h Ieᛄ@k kk0P@0@ 00t0000. 0DSDU 0 E 0U00ө?0U0 CR C 0ER 0 0ekY 2 e0  BLoS Pp} PC ! PZ P P#0STkpD E~fPE@ @2e/e,,e@P00 2P? P AP7 0JSI1000 C 0 E0Tf0@pP1Pp1 W 0p00@0p00@pW E@D3fPEXvpGT@D¹0 X@P H݃P@U@§0S 0 B0|T0S 00 0 0H$ЍON0XS \ -! |$6(&&A-lP`Pp `j@j@0T `P@ P %P\ -@-P@Mp 0`T` P@@Ѝ0 00 0 0`p @:Pu ,@P + |&\ -Pp@-@TP0Ps D` R :P 0S@@A@p|&\ -@-@t>\ -0h\ -0h\ --@-0 0 Ѝ Ѝ/-@-00  Ѝ Ѝ/-@-  ~ ЍЍ/@- Ѝ @-@ p@-P@`M ,0 0(v0 00`Ѝp@- Ѝ O--0M P` HpLj jUs\0 0`XN 0rfYPc 0S` T00S\ ᔂ@PPT00PXP@ 0sHਏȀ0 0W 6p dPUWpV`JЦo`0 S 0`J0 0nPF 0 00`9P\0 0X0 0T00P0X =Z  o m`6th`f`Ѝ@00Y00S 0S +T00P@#@3@pt2oP 0 ~o뜰,DCXb[b _=| 0 E0GnXP`DC`%P-   ‹H0S$ |P 90Sm Y0] )Pf 4BPaD' D* ,B^($ЍP@RV;B{P@ 5A`P'='P'\20S dAp0$A P,;{ X $P 0)AT )P P  AP  p2PP0 +Q !Xp 07'WpT+pAT3 |@p 0T3:X#  0APQ  R@4Q p0Q  R@ AP`Vp003/P,00  h0S  R l 10!@$f-r-c- 0@-M M+@(lD+(8DB+(cDB+.D(4@PP B/@PP 0 ` @@@@@ @@@@'Pލ Ѝ0B(?g [' -MM+ 0D+L C+ (D+0C ?P  >ۍЍg [' 0@-@M w1@@ #P @  pP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3'P/\P+X@P'@P# 0Py ݃9y  0S 0_ Z'P @P4o0m&)u*00$f-r-an y ..@-@M 0@@ ?c#P* )@s  pmP 00*!R00$Q +*@P  S0S 0` 'P%(.*Ѝ$f-r-O-`M!0[#*0S ` 0B00 SS@@@'~p @(0 S0 0`0@~ 0 S:BPP@ B 0p00Q %Sg0S iSD %S* dS $A$0T !PsS$200P 0 倠ಠ@Z4!@ P %Q0@ 0S0 aR7 cR 03/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S  0! S 0 @S$SS0P @U:U 0 nB(&7@-@ PU U! s00 Ѝ0llaP X =!L y psU( 0$[e- "     7@-@QP T40400 S  0  Ѝ0@T4e-|W->7@-@ PU ! 5sK00 Ѝ0PP | sd00S L 0H[꓉0 ,q|W-   d-U  &s@-8Q`@ 8gUwk ]bd]+b` ] b3 b]4wc 0 A i@Pxxx.3k}P >R>\\ ᥁hwЍp. & O--* {M`Pp I|0 Cp@(6 F 0S  P R = 0S  댵P br|P ]r:p@T PcXV @=QL0B? 0I7)P  I@P  @00婃P夃Pa; P  h\; ;0S ;`P ; 0<u00v4$"0{ߍ[*3 ,'0z"!׋؋ 031,0p0,0L,0   L 0P60 0p0z?"!!03  PW p WU l @2 0S l2P e>0S$P0  VT 0  <SR 1P xq 1 R @U$2 @lPU L ,Pz?0WC(0P 0[0 R0SQ Bq0S=!P 0[u{0SP @u l 00TP@@ $2 @@ : e-P&ptbtK f@|W-e-z \ cO \k Y-n N  lk-N   S0@-0,MP0 00 0\PPP@P DD凴@0Q ,側7,Ѝ0@̃ T&& |W- -O-iMs?!0L^YP 00iߍOЍ/Lx`P81P ,!,0i%`P z[p P@P)PY- U0P 0G0GSW030#[0S 00pP@ PQp00%_|W- |  [-O--p(MT@X  pp|`V 0 @Q'U`  \PPyP@P <H E0lPU 0'SP0U*S!/ P0 0cvX/0 0P y0@: 0H: {P10Z K sZp`PUQQ C2S022SP0220C2   S`` ~~t0000 0PDAU  @0 0 PA ``r 0`R  ZU 0 0C?oV20S  0*0(P6 00Zp @P  0A0* 0l! P'4cQs00F  ASz .^~YE^tV PYskR(ЍO Ѝ/ . !C & ht@.&4F 0@-CMl1PP 0S .QZ@P 4=Cߍ0 P=  - -G-p@ 堐堀PB`AT:00Z W ,/Z 000 |ZP EQ 0 ;\@M (&A-`Pp p@  ,pU=  P{ @ -A-P3x@0xopl ==0S DQ0Q.S+P @$ $< < -E\ -@-M 00PDP 5  = 0PDP '  = \ p@ ( ] < ~ P Ux@E%  <```p @~%PPЍ < <`!i-%i- -8i(- O--MQ 呱厱D@Pcdd0S wV:=80$d 0w-B$0B. y sE y0`Q>d0 ~<@400ew0 ,P40,   TTr3@W R?0 2p0/6sp x#|3 R0:P$P  P @0a X; @P   P@; 1sS1lSD;"00`&a`P XP@;~@P,;*0x*0wrk~P\8 0\8TY0 yV *0z*0}\8t*0|Z\:VT* Q0:$DR@* , Q9ʟP \ʟW艟^ 0/HU>H B0C   8PT  8TDY l0X649 @p A\)Z0p 0HA+rp H0S[, ,)A0K  @P @0 H0@H0Arp AA`LVp@fv ႁ! H~H p x+P l0 *\6S 0 >44 @P 15$ &#   [7S    l7 P~L7'AYA|\@P l@P 7P'TP\804'8\8P$G 8:8' WP0&08P 8H:8 4WP00 60&S\880\8P 8x:80S X&8P 8i:8 gWP000S\80\8P0S\80\8@n08E010 ~f|P |P ||P l|P |P H|P 8|P0:4X:4SU 0 PM 0$AtP @6ϣ4SP  0@?S @P 9 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   [0S1 pP 2@T [ᏮWxHHp#0l0S T 0S `"8j3S3 V\ #C?00N?C0C YC`0  0@F0@`r2P;A?1p@`x080C4r@,0,P$p\T0S $?tY0X6W5S  !JoXbjXF0S@0 <$Y4!S< " 0 t0 Vo if |W- & r(&t&   -tk-L T X V  ----s-"\ --  (| -  i -  H L I g r ~      ! -& 0  -  &  7 "   ; X c --r  2 0X6S/ -P 0/(| A-鿏P@,MpS{P3S0 `0 0` :00 0`@0`00Fo/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@*WߍL S [ @-p`CM|@zPlP#d0RXPP @ W<0080 `0(PCߍ h l-[-l  m-@-@ @Hf-@-0  0 P @0@ H280 /P $  VЍl- Y-d-& 0@-0@XMP70  0@ P x x0xP t0E@20/Q   LL V2 0/R@, ,@VЍ0 - l-Y-Hf-k-& b-@-MTPkz@P  7 7ލ0 00S@\0\ \y@P L0 (0< bV0, ]V[- k-Z-b-W-l- l- @-bCMX6S NP \8lP'XT20S H(2\6S 8#2020"-V(^2PPr 10 :4S / zw\@aU x10 l:4!SO *00 0 Bax^||+2@P) _1l T\QTNDK0S 4!4D,!,@0S  8  4C/P2\6S -*U -hCߍ 0 B -!\ s-  - " -   -  ! I L -; -S ` cOW -d    w  0@-P@ T\ ! 0C @TR 0\  @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/0 \ P0//!01000/ 00#0//O-`$MPA@T p p.P00 0S 0S0S$Ѝ@-@MP Mp! *0 `p Wd5\\ SS=S 8 d3R 0 ,0 ڍ ЍTTj ~ G-Pp0@0Mw'PP ]|`ĐĠ0 R 2 PЍ 0L03/P  0 v놁0 v  HG,0S P HW5 HS5` f- p@-P`40@0S 0 p@'>p@-0MQ!0`L0 3/P< 0t@T 4/@0 0 v 0v 0HT,0S H 5,0 H5T `H5 H4Hp0S0CH ,$H V'Ѝp f- & ! S P P00 S wS, R ,0S R : 8 80R:P#3///@-M`p@ fPPЍkPP ewPTP0 pP@$U@@NT @ @yd0 @P   0S/p@-P@ 0000p@O-p@P|M YP+`P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 100,`00S.0 0P1<00 40`pP <@D<,@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0,0$ 0 ,0 س @-Z P 0P 0Pp PQ` QTPQH "P <080P/,/(//D|xLp@-8@Q 0@P@DPp .Pp&p@-P@P  3 {300pp践@-  p&@- { p&G-`PzM@PN/y 30  p0S1 0S@zߍX(P# a-P@l0 1h0$1d0(1`0,1>1S$ Fo P j?l%0`J?Rz0S z0SAT FP ruP @`Ep̠( LpJ$޿ ڿ s '$0]:Y x4 P 3SR L `y \y0p0? p0`P 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@ P P =P  ,0!4!PŸF0#p}m2P  @000@0"MQ@0@N?@@T@0S z?0 C,0!4!P刀0#0!p J xT Ix00I? 0011F10100 d84p1P8( s1S%4p ∠0!l 0Ag 0b ,0!!0#P ]0 P ,0!!P0#I0h pPu  lm,m;mGm}Dfm-QNEFXsm  (&  'Q` Dq@-@M`p @@ 00pЍ PP  l@@ 00pAD<@P 7/P3|& @-0 0P Ѝ䬽 @-0 0PЍ@ O-aM,MQ0=@PP6 ,t`P - |&tPP- Vl"dT5+"81Lb-+b01`JlP@``VaV+" 1+b1&-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`FsP 0000!9`P 00S 3/p003/NaV $P 00S 3/p $aV P p0 PP pxb.;9/ 0 PPpxP;".5/0 #X R1   0 00 0{P`lqllV b +PPY  DqwPQy_+"c0bX+?"PPi5sP# 0sP +sP &sP !sP sP UxT 30  /0P (z` V |) r-Jpk-  sf!  ɋ 00C-$[?pP M`A@P00 P > C 0 1/PP0@0 @P@00003/Ѝ003/$Q O-PUMM.tx`@4Piv.zevQ`4C f$>RpWp$[ Z T   70.07 00P00@\#Pz∗40([Z4S =T7h400C287\4=1 W =7h400C26\4=1 0 00  000000pp  Z0440l40s -14s[w0 00 00000 0z~pp 0440J40s -1tPw003 E "F/5@ UݍЍP =2 (XL=1຀P0Nc ⺀ h \  pw00$?00[000ӧ?&N?`/'#T4`(04@ TL40S N?/$$X4pWL4 0}10  A . ". .04 1p$ ,01(.8,40001A  B6`$1 (11S)104 $q,0(8,4q0$1Sy 00 t  P0o^m ,ؒ@p1# 0H$100$4;B2P p>{d{ k$10 ,$! ,0: 0G80C0(1}1S 0}1$1S!> ,! 6$40`040$f-.&L YW &r-pk-[-(f- |W-[ ^PP  (00/0@o//BO-@P MMAE0*!Rp0)Q`U0 $0 L  P  Pp ,~*(0$0 fL$(pP p4\,^ ܍Ѝp D4k.80Spp0 @0 4p0SW00y , Rv  000x;8,9/Pc 0  x08,;  JM  e_ q w   | m۶ | XW- r- ?- ^a0p@-`M2 RЍ!,^0P @40 PP@xp0 ;87/P  PB-- $0@-"@!P0(@-@-$@2S 02-O- PPPBVpPP   `PP dP@Ft$र@`V* ЍD xP P    R0SP pPBND(&J@-@00 sP Q P 0)Ѝ蠳 C-`PJMM```p 8%o@4PTaHP`VP8 Yo`GFWI UkP 0 000!00P < 8<1P#<@XNo<0S0 0< 8`PU 40,0= 01@01A0000 d@@@@,Q@0S6 0S'8JݍЍATP0 8 RT<0$!QQ@0P 0 003/@#S0 S(0S 0S8n(0S003/@#S@pk- ع P& 0S/p@-@P` !a(0SQ 003/@Qp@ R 0@-@`pP4M0S4Ѝ0 0L03/P 0@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o  0@o/b 0 11/-10/=jp@-@4P0 `'1111p-O-P@p`АРа0/ C  !0  Pm00S   0S 0P1SR0B `p@P X 00,0` 00000 Ѝ-  0@-P@M/.m1, 00 0d0@00 0T0@@@@1 0 000@,P,uߍ0 -O-P`@p4M 0SpOP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  &0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAP50 \A0Q     TTAU @@-w; O--hBMX1ST2X\1S42\X1S \QUЍ0C`1`1S]`6a10XP \1 XX1! 0`1V# 1xC0C:IbP 0 S 0.S  !& p `pZ"XP 8[0X0`0 0&X"gl\P \!]l000: SX1 t0 0\1`0@]0 X1 ` SX1 (0( 0 e%-& -\ h V @-M M`ePJoۍ Ѝ]P@p PP6+% P*+Ps% P*+m% P*!P"OV p@-M~&z@u(G`P3 e<0 0V` P (3( ze;[ <l@P Czލp_D ad-} @- D@01SP@ 0S 0   -  O--pM @c0  0`࢟ X $p` 0 0P0S*P X%]P0P 0 a0CS0Sߍ, oP U 2`0:08U0SP` R Sa0a 0 0y p 060 s [ 0+ T 0p 00 0  0S 0 S @0N0t00 00S 0  0f0P 0 0h!0R@0O  0 O  R*? 01BUa0 ,$| ?- d@edAP-# Dq -p@-@P}P p@ pC-pPAK L1h90 < 'R h)0 S 0<1LPDTPaH_LP ^U `1DP1 ^U `1TP1 ^UP1 `1^U`1L0H `B@ ЍC (0(0h9h900-},} ; }}@-M@ GP0:CoЍ@-| 0S lP \0 T0T 0PP0BL004 80<B( Ѝ Ѝe- l-[-& k- Z-b-@-p@Mp)t90 0 0T00.00 0Y"p $0t !Ѝ-T}@-H5@,$ On@H+ -?@-P @ Ɇ R ,!0$@2Ѝ0@ Ѝ/  @-0  04 P L0L L@ z0< <@ Bs0 $@BЍl- Y-& k-b--3M M T?P0  4eP eo3ݍ ЍV ]F4-3M M ?P3ݍ ЍV 00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PDA@00( (0P,A(f-l- l-X-[-(  k-Z-b-@-0  0 P <08 0440A000 0 AЍ[-* k-X-Z-b-0$ 0!S/ /-0$ 0 S/ /-00 0 S$0 10 1/--11<0@ Q !@-0 " !/-0 10 1/-@-M_/.h, 0l0d 060 P000@ 0W@,(ߍ& -0D D /Q/QQ Q/-&@-@0@ 0 0XPЍ1 @- @0S00l-E p@-tM]lPN @!  P@`@00 0P0x9/>܍pX -4t-g k @-P@ |Q0P  uQЍe--@-   Ѝ Ѝ/-@-\0X0@P D  Ѝ@Ѝ/᷵t   -@-\0X0@P D  Ѝ@Ѝ/᷵    t @-4P P P   @-@W\P@ Com@-0@ dP$0  P00c-[-Z-@-0@cP$0  P00d-k-b-QA-@@1@#PP1P#Ttpt` \P t u^X<U<44VAV.d-@-@&P  h  Ѝ+ & 0@-EM`;P@   =P0000U ($$0x:@Eߍ04t-o-ɂp@-\M+TA  [41^X P0!x ? )g<!0 00 000H0 0 0 PP`R02!gUx:` JR?X (~ ((JߍpR -4t- e g & X @-@P !0`RxzcP WPP t 1P` xZ? T E)01N@0PM@T 3V Ѝ-F e&@-@< !0@- 0 Ѝ0@- 0 Ѝ@-0@M00  0Ѝp@-P<@0/SpQ bPp@&@- 0P[-l-O-$M@p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ  xW- e- l-Y- *O--,M`zZ$<@qr[pPe $<P@deT10S@ 6YZPPEUN X1X!XXd$0 0  @K$0 VSS00R00S :Z 0 C HC$H<0$    0)$ 0VRR  P # 2R @D e@ Q Z `P$ <@,Ѝ  \}  A-`pPU@P!e ePP 6/|AypO-@ M$;`P0 Ѝp0P0 `0VSS00T00S$;-@- 00Ѝ Ѝ/l -@- 00Ѝ Ѝ/l A-`l3@PMMP\ `K`ep6@ FVT0'(3T$$c3TT& t 0So 0CS+PDS0)  0b 0S9 0S r0S 0S QN@,P% 0 `0 P@oH2@P 000C?o270 o0`5(D(0SލЍ!7S`P1Q! @F?@Fod!H1PT0 D 0M$'  0S 0S| q0Sx 0Su QN@P  00 @P_F? Q. QFNmo nW ;  8t- J (f-l- &  -&h  kl-W-   -MM P  3P  ۍЍ -MM P  P  jۍЍ s@-hP' `PcP D%`h0S (    m @JP Kp@TT:ЍpE\ * x0|+R/ @-d|+\0X}T0PyL0HuD0@q<08m40-E t-M C $k , T, D@ l, q O--0t(0M000PS`@p0  p00 % 80s"3 0W(h,@lQ@3p, (0l@O` P3`R0000ЍV0V*8q 8 0L03/P 2HR b0 0 0 00<08`,02 ,0( 8W@D( 0  4 .W0(0p( , 04 !WP23W 4b0` 0P0,000SPH0 M L00SI0SM000i h0,0 j0 B0 000 000  X0 70 00000PX 00 808/kP0 PhQPQ Q(0*0:` pXih ,0a P0S l^ 0$0h0 0(0  0*:8` p}6 0-- f- --  C-F`0pSPtM^hP0SLP0 S P0SP0SO0SGO0SHO0SIO0SJO0StO0S\O0SaO0S000$ R$000 "0& W40SV4 QQ00Q00Q00S 4 tЍC( PO0SWBW?,: p: : : P Qb Q(70 b 4004 0U0 tЍ3003 0U0300 0$3 0U0 0hS 0(` 0 0 SH 0P` 0SH 0P` 0SH0\000 SH0`000S$H0d0S  0dP 00 8" 2, lP0 2z R>0 'H0L0  H0L0 H0L0 H0L0  H0L0 hH0L0  PH0L0@ 8H0L0= tЍC!SH00000P pG d 9/ 000(0=0--~C > $k q   c- f- l, T, , N  O lA   $ + 4 ; G O W \ D@ C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``?0 0pp07/@-M0@ 03/P 0 004000 003/ލ@-`,MHP  @0 0 0PP@00 RS THP pW UP00P00P0,Ѝ @T@0/W/0  0H P00P0(&50@-$M@D0X 1 0P 00 00,0PH0Dd$Ѝ0 O-%,M@PU \IXq pPDp@P`44 ,pVV !R "2 V pP P`!V$Ub$U p 0 W0 00 00 0% 0MnPP >,Ѝ- }e $~p , C-40PS,M80S,ЍS S S !S S v@P `p䐟`!`X 0 000 00x 000 0 00 0 0M`PPp ~x/ A . O-P@0p(AMP U   唂  `1#0 !(p0#UP 4ZP 00 P PP v0H0P0C[@k=0 ` @0AB1A0  0x!Q0C' @p0  P!G0- P0  (!=0DP`TLP@!@3@MLT -`WT@D@`0@@< 0 0K-W0 0@`0P 0ت.h 00@` P0DAߍ #"0P0RPP c-Dq--  O--\5M0Q,0`1!700P+{ { {{8(@(<4 WQ< r-|3 < O-RUMP ,0 )((R     B B BQ B` B  0V븰 0@,0@Y@p0 0(0 @@@@@ p@@0`PkUߍ06' 0C. pD`≐, oU00*80s@-0<0@SH04 `PQV09yQ?V090V00:b!Ѝp@z0S/A-P@0\03/0 "0 0 0!0C?o2PP- p0!P! 0 `PPp !@` B"/,000>000T0 01P0100AF! B B " ,10CW O-P@OM H(?Uq0!g2W@@Dp,00`Oߍ W,0T00C0 [W0J$0 `Pd4 Xğ[@P ğ,0@T00C0p0NC2WH0 0$ 0 R|ᐳW# 00 H03/0{T00 {{တ0 9/P#%#& 00t80x 3/0lPp T̍X 0 0202700 F00@@ 0a VK0W p 14t;p PP00P00X00 3/088q00}X 0L03/l 0 , t T x X h H 0TpX 007/P !` 1Rd 0  0!v!D W p0 B*D!2 B"*1ᴑ0C100C0 aTpWpvpW T00 03/`P 0tk-8~~> ~7 1 0D 2+04`Y8 3P0a 0` 0d0  p D00C*D!2 B"*10C1010` 0S0100C0D !V ,0 80TL0X 3/PrA-Pp`@f!P0 p00S p W*p S`P !@ B"A* vST0 01`0(`10q0000W Q 0S/ LP0 5/P 8 <0 @ L0 :P00P:4p Q:  BZ:Aߍ L`0 6/Pd 8 <0` @]0`4000V 00 V0  R U 00 U 00  RA 0 , M0,  MPp@ $0P0(0 p @0`Q+ 0 $ M0$ `@MpPwP` P p`@6+0` O--@AM f-c-  O-Pp4M0`\03/0 @T @@T@   ( P(R 0$ß( X0Y0 >00120 01T e0n 0 0]C0CCR |2|"||gQ€0E0 0d2@0\2J00P00D@@@P,(n(@4Ѝ<1 @1pp0,00Ž0Ph 0@ S[00S2[ ZJP P400S/ 3/+嗓)08q P , (0UNP(0, ZH D00;0(70( pP P@ ( 0,(00T,000(0( H@ Q .-W ? H <0  8lp |3 E r--V @-@P0NP/UP0S0V O-pMCxb:TUtX4{ 00 rs ,b0  * 05 P  00@0 B )R RP 0Q R Q 0TR000US0a0Ѝ0S@0  llPT00U00@0 \%41R7 (R3 !R/ R-R I 0` ` 0R 0R`[YoFT00U00V E @P0 /S`Sp`` [YuT00U0,`0 P.-'/-] .-T8 T/- 8T2-XW-V G--0MS@p`ЍP X0p`60@ R 0GS \ 0K@@MS\ 0CS\SS\0X0+R0S 00000S O--OM M#0 P$00$(00 0@0P(0P0@D0y0P,0  0H03/80 0<000!6 0R 0  0,3/ 0Ps`` r S04 X&40L&X(U\40a`0s0v000 0 &(p`0 :,`pWX0h05R0lp0~h @ `pV Suh 7`U Tmh /PUgh )VU 00 0<PT,m64204P0dP`080S<00O>0=C0H04 0J$x_(U 0S  T0Pm0 000H0P0 F0}PT0S x$LP 0S4 `Q00Q0S 0L0 aA3/P Ȑ 0&003/f0F0P ! E  0 J1( $0Y(00$0 S(0 0R0$(@0D 000@ RD 0S8X#a`v 0"'0(ؾ000!ꀒ   0\Jx 0 h0  0NJ 04 0EJȐ 0 0l010h t0hpF++  V [`*pV 0 T=lU 00 0hT2l0 @T,lT0P0%0 Q030#Q0S ,0 A, 2Firp 0$&(?0 0PL 3/0!L P`Q.V'P S(0 0K$0 Y(00B83 0 P0 h0  :TP4 ,0000 #0p&U- 0S*  H0Lk0 040PL0 F0PLH0P 5JPHЍDA0 HjH0L0 0S! 0S:Q00`Q0S 0L0 aA3/Pc 0`崐`V0 0%`V@Uqp; 0W`%@K003/%BPL00P1$ 0R( Q $ ( [ $(P  R \0[0P$0 S(00@90 0P8 3/0!8 PPg0%UQ`Y喾PC0S 0c ! < 80 5H80< 1!E 0 )H 1!PHP0[000000[000 0: f-f k c-  % 0@-@M0@L0 3/P" ! !SQ 0 0 SS@Ѝp@-`MMMP;` 2@P L r MލЍp{dЀ@-@P DIP 4IP $ IoV \  p@-0@ 8M! 0`P@@ 0 P8ЍpH0PUJ  00 0 P0CoA-L1MMPK 4Q0P *1SB$A T )1S ݍЍ Q 0 1/P@` 0S0L0 3/P ,0pW0xP 0pxp;H 7/P H~`r-N-@- 0P XW-@- 0/RS ЍR/S S/S0  s$ & N-@- Ѝ@-  Ѝi @-PP@3M@`P  u6p0S  6T  T @LXP  0R߿M@ Ѝ|W- e- cO&@-0  Ѝ @-P Ѝ Ѝ@-M@  ,  & <܍ 0@-MP@x  r   @T@p@T  <ߍ0 @-Y ЍA-pP?`"@P P  K0! 0PP bЍ0$D  N-p@-@P4Sp@Tp$ @PpGDpN- G-pt`DTP ^GPP@ 0 0~PP$0R04!N- A-TP4SA p`4ܽ@ 4 0  DN-A-@4S0tp4TU TU T`040 @0 4N- @-@0 Ѝ@ @-@`@ qoЍ    @-o@-o@-o 0P/N-0@-PM  0PPt E@ 0PPLDP08P0P 00Ѝ0@|xK R-X @-]@A-A0J?`V=p$X"0 fPPЍ p> C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$ar-$0pQ@-4嚻サ #"T R0//@-(@T@Ѝ0 #0 0003/@PwkS/@-|M)PP@" @a1!@p@P  +0@T@pT 0 @p|ЍT0| dp0p p!~P P s  l-l V u  R- ~  XW-  /@- C@@ w ///@-0@Q0T@o?0 \ 0P000@-@4M0  < @P 0=S<!>A@ > @&T@  P 0 h2P L 2<  Y9t v*[_OO D |W-Y R ` 1s@-1P@.PN/1\`\ 1  L L P D 2 00.eЍp|W-9{ @-0M02000`00Pp0c@P @T 1\ 1T1H 1 <P1 1 Ѝ Q:; 0@- P -C-`CM P@ `GP pܐ܀0 `0`"0S1 1 Cߍ5S  |vp pP\ ``X0S  @S1, 1]- \-;Cy-!! 2! A! f! ! :Ip@-P@%1 1  p4t-17@-@P卸@剸 0 Ѝ0@! p@-P@ָP 1P1   p! 7Up@-P@1⧲1(1 P1 1 p! U@-㪸@! G-@M,pGT+R@`r夒T5 TH To20$0@TPp"pp0`pDBpP0Sh Sb  @F 0` 0P@KP 2MVPP ލP 9P !080 0(P x!0p1X 0 , ';, 0L-0 ; ᶺXO?$1L0b,`,0!0P PN?00P0@5 )@E5 0 0 0F& 000 p @ܱT& S-! 4t-\-]-Cy-$f-! " |W-o" 7:" 9.. J A-P$p4@P a-@T ) ι#"P( 0  P  0姾0 P ɿ@,oЍW\\xt P吾< 0 " "|W-" R# b# [" " # H# h//O-0:{4pn@T Ѝ@T@T' ^% L U [Y  [ XY P{ UPE P P$@ @$0"/Dz-O-4Mp(tZ,@fP @ P %R!0ͱV0 0h@0 V0 _@1!PP0@P@0 0 000 0 T000 Q0#02S4Ѝ;0 0Z   R% S   0 @    0@ PV0V0 @1!PP0@P@ RN RK RH  R ࠡ࠳ $,( [Q$[4TT [ 0Z0@PV0V0 ?1!PP0@@P 0 T00T Q Q 0   ~+0@-4MP!! 0  P PP@4Ѝ0@/@-@ @Ÿp# p@-P@/gHP `@ HQ0P P `Ra BQQ pQQ 0@S:p @-H]0RH #@-0@-P@04MSu!1P4Ѝ0 P*   P +0R0#@"*S Q 0RLz-0p@-@ ^T00PUPU' \$ST Zp 2@Q.^U@P@ @$ $ 0 00C 0p0 # }p@-,@PC0P ;pA-@H`HPpFT00ԗ@"T01 PS (S- 00S@- /(S-S-C-麋XP(p,`0@( 0 XWaV|V T0    ЍАYĐY R  U:0V @ '@T0  # # |  @-@P 0  wB喷@蓷Z )# 0@-0@S~0d Ts0"S  @0<00R( T40 (S-Dz-Hz-G-錑P0`SRp@Q 0Q02@1;1':X 4npB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $>p Q 0S T v 0@1 00 00T"1Lz-zp@-P@mP000p1O-0@Sp`P 0 PQQQS SK0UȰС0r 0 $R 0 0"60(Q $d>p0, 1QX#  E vQ 0'0  R [ R @R H0H HvA R# Ѝ 0W1Q:P (S-$ 8# p@-P@P0Ss!U E p(0"E0P4 305050 0(2#p(S-Dz-Hz-40@-0@SYDP0@Е(S-A-Q`0@SG!V V p0耟 ST  4V(Ѝ0XPP P4p00 0@0B`p0T hL p= P04 `^0'p(0,0P((S-Hz-Dz- rZ$ |1A-0`Sp@P0 PQQD R<0 A 2r 0 !Rv?000 RU  (0$0X3,000 1Q\RP 0 00  W1Q:P0(S-K@- @V00S T $已@Ѝ7@sO-X0MSM2"a@\0@S2"`0Sb2"d0S2p"h0Sx2T"tH 0SL困8 80R[ , I0pQSPPSPW @w@ɹ`P- @ \00`0d .0h X 똱;S/ʌ|!|@0kP@_oRݍЍ RQ8 R ï0:S 000a 1 0 0 0 0C0 ;0CS||ՀPpb$ V# z$ $ $ $ $ $ "$ % .% E% V%  % % V(&a% y% ^% 4p@-\P@0S Q0 >q   R@CpLz-O--BM MpX\0X@P 0` ;`( pP|X0 P t@Bލ ЍQ  0 0d!21`u0 00!$0`4X00 $00 0v0; S Px唺P +RQ 0P \Q S0Rʧ0S R6 S 1 S S"0S000000 0000003P 0S  u 0 R$ ? ! 0$ S0S 0$ `edA% O-$6#Sp 0 :P` ;+[0:p0 d00\ `0h0|0 0Xv000 P$`P`l0 (04HZ000 00 00p;p$ @-`X0Sg0 [>\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP U &0U Ѝb$ X# z$ $ $ $ {O- 0TM,00P(00$00 40 0{{p{{@00@vP40ZZTЍ@`DP S S H0!401R < 80980< 1#0@4 PD0 0LR0HL0H0L ,[` `@D,\  0 pS `Sq0Sp+R ʘ10R02p1;1':Z x(00PCQWQSWQ 0S0W0S0G?o2P0S p2Ȱ`(,0,0(Q $@:p$0 S  0S G $v00p1 0$ 0 0 0S  0"ıU0S 0$ P0G"1Lz-zO-M00D@TЍpP`Ра@D0SW@ 0   0 0 `1/Y  S      Q R  0@0 00Q0 0`p1/P Tz-pA-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A-㜯P@`p1S 3/P P`VUd0P儯T0P0S@000S4000S(0000ApPz-Tz-p p@-@4`4P0Sp@豱10S 3/@Tz-Pz-0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 P   `‚ 0S0P000X 00//00/00/00/10/Q@-@@ 0A0003/P@$2 @  C-B`0pSPGM;0`10SX10 S P10ShI10S B10S4;10S410S00$ R"000< R&0pG d8 9/ 00 (0` ɭ0 tU)( 羭10SWp ش  L Q 00000 0Q70 *Gߍ0000 0A7000 00 0Sl0 0/70 Q0 T-~ 5c- f- G-Pp 0MS 1ߍ0L08 3/P H0 8 L00S4A 0S>0 0 0 0000P@T 4/@@1 0 6` 06 0`hA0 R Z/0 00T h0:/P h00S0V0S Z?0Z?V F 3 ; ?0!CZ? fhA0 010@0` MT- f-% O-PMҬ0@ά0` P8 Ǭ`(b0 M00 0j6p!0@0 0]6!00p@埬 a@Jy巪/@g㐬 0 \!X凬 @p0 4!4}(!(p 0`P0 R  PЍ 0p!\0i `~ `|OT0 0-p @ Y NT R ` @ c- f-  % T-% % 1U-L & A-@0P\03/ p`W@@P@ŭP80BW  \W0 V  .  ! 0 n/ 0 00$ 1 t    ]/  CX  0SJCT D0D DD904D@qT-  ̱ & yD& s@-P,`@姮01ЍpT-p@-00M0P,03/ , [0@ , S:000 00 00 0 p` ٥0A0Oo0Ѝp0 ( O--@M4(P PЍ tP 0   &:<  : `@V0H03/0`SPpHPpA0 0, PP 0t, S d2p2]? 00A`00000800`$囨l0S e(00 L0P 3/P XPPTpP\p0 S8尬P[ 80 S (- 0( S001x40P ≡0L0 3/00 P0O--hS 0UM8 :P40@pD 崧P ᯧ`P Uߍᣧ0P,0 P UѨϨ,30 00S 0RD 80S:(1SK1400J ,!LH!0."\0A 4<#H@; $j忥<弥< 0@PɥPg%11@T "2B ,04 P0S 3/P|20 SU@0%0cD0ps `2R剥;%1Y N (~ ,H!!LPH@0#pPpT@jP ,p (@ (0(00@ @040 @v (   0 k (0 b(40P1:1!22 @0 000000 0000 00㒢pp DaD0S#, 5Q7[T Y ,w kPz-Tz- o&  mn& D& G-p/0JMM`@ 0 ppSPP+5kP) h0S% d0l"` !`\ p/O70P T 0CT *0C/Q 00 P4@0m+ P:4?0  nP+0: S `V4>00 PJ>00C0/S04! + S ʼP+  P*%P 0/S`0oo`bS 'p' & 0 PV+tv P*+p P*żPG4@ûC4@]ΆJލЍE\ &  V @-X)@-M @P(0 : ㋻@P ျ P  ꔻ0#((R 3? sQSЍ O--M pP#@P` WP`(0Ph!Ѝ R  V0P:0*  OpP劢 P W`0   堦' & & G-|Mo `P`P PP<^+m@P@R 0 ɬ@ UK@P +JJ.0㬬+J J.0T㝬TX 㖬PP~D4 ፬PPu$ +J0J.}PPe+J J;` fPPN+Jtpll40 0J>C P 0 .GP UT 8ލǻP@Y+JTJƻPPp0J."@+@ P h lJ>PR & ' ' ' ' +' & T' ' `' s'  ' ' ' && * ' 5' >'  H' /00/00/00/00/0@-0@4M#|0$P 0S,P\  P0T0760 P咢 T@P i4Ѝ0 f-c-U-O-AAd2M(0!0PB(0 0000m 80sS0`p(00$00 0?00$0 s 0$W `5 0,T%P500@%`r 0,0W,5 #A5P00 0`000 00庢W D`4D 0S_ @X%SYeP X:000` @@`W@0S 80< 03/P0p80<P MЍpv'80s @0D 0 0Q:8`0S}0L0` $3/P$ & [P Tp|Gork 0$ Wt 83H3 y0 D Q%0C?o2000;00H03/W0@0 a& 0X  0 W+ 1!`00;000Q!{  (P R`p,2;0H082Lp0,!<1H0A``,P R0$ 00 00S q,P V[0꒘ 40d,P* 40Sp t, Sp ,008q ^ Q  Q0 0 0 p0, 哒)000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`Upp f- |U( c- (&kTr- V G-QM{0`Swpp0 0 0 P  "  *"  0@T0P S"TPu@&x"P@0@@,0ST幠X@0(@"@!#㯠,"P@&0 001 0R*!00' XP(!0P@0p00+0@080s 0=0 | 0 T XXЍPU PP@@P $g0!X@( 0 h00X@0W0 400t0S00ᨴ00P0 00?X@(0l `@l5 @8q 3/P f-a_\( ff(  U( Dqr( c( k( 0@-)M@n0p \*3 + ,P 0 X(M*X F- 0 F  .0 0 Ѝ0!0P8q0 S+P ,ПP X&O 4c-Dqȁ( (V-A-@  "(0Mz.( 0P`Q2X1200500@10n? 001$ ,01000 1@`800 P$p 0PUp 0S0p\'Pp,P(FA(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0( ȁ | O-P`pp400W(ZWp "!GpPP p 0  0 @p0-Q 0S  00,0 $0T0 0X00@G$, R+R P Q  *P 8qT00PR0  R RP  P Z0000 ЍpO-l2M04p@$oP`ᅠPP 0 Sz22@|]? 01Ax00 00"@llkዡx0ST(ᥠPPM p(P01ᑙ!P嚠0P(0A x 0`R b ",0 x  B ;- 7- 0 008P0h lξ(0, 040x0?o21000Ѝ0ᚾᗾmr-< d O-p@ᤁ夑夡,M0 S0 0000 /00㑟0S,Ѝ/S  /00`pPU0(!`P p呈!PP PP%0(` 1`, ,0 `400,08`⡛0100/ (P 0 0 P.`$f-V{O-pP@\M4 `儰,0 SpU  0  Q $0S  0 0$ pWP8\ЍO*.,S P0:0pQ ",^T ^ 08 #0`0000Y (0S`e ` 0 R{H03/p`0 [ 80s P\0!0000SPU0"U00[P 0RP  0 &p0 P  !€ P 0$U$p0p[P0P0[yp P 0PQp0[t?[00S& !P0 :p0 00 0RP& 0 1!2 S  P0p X 0S'  0R 0&0  !0SP0 0PU pСZ050Z0* Z%Q Qp  0S S00 0Q0000 00000000 \Ѝp0 0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0S 1 `R ($ 8'P` $ 1'P 0 Q0``T R T  R X `( 0S0L0( 3/P <00S D0SS000(( } L0( 3/P 80<00S (0, S004 Q00 `( }[0\vAQv0[[r8qnP U c`p8|Yʜ0 :0 L[p㜀, SS 8q 0PUp0pu R 0S  0 ,%p 0  ! 0 tk-r-f-V  O--`M,p@4 00PVY ppPT Pp0Z:`PU`J6ERUA 6&(00#h R 0  80s0`F`pHU p /*h0S 00  80spHY pPp *h0l0 0L03/, 00Y:pPp۝p0塜0P80p5ЍO:p0H03/,0$ 08RPP0$P(<00WX:< R/*pp,0PP UP`0$0$ PS(0n$(0$ 1! 0 Sk@DS d0S 0 `p8P0V]:40S00004000,0(X{$0( 0c2#$ + 08`@ <00< R:pp8`Fp0< p 00<<( `8q ,0,( 0L03/0 00 0`VV0$0$ S(0$(0$ 1!P p0h  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0Pu0H03/pq0@08P0D00[s*p0 0 `<080s^00[ <0 0RU4p0 @ RD0 0 H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00  000 0W 08 X# 1!7400000Pm۶( ]( tk-0 04 Q000p <0P80s}00z } h0Sz l Yv* 0L03/Pg !0 儐X09/P] 40000$0$00(0 0 0 R( 0  0H3/P. X$ 003/p3 0 L03/  $0( 0S ""(0$ 1!24000040000@0$00(0 0 0 0  0H3/P<00`0<0w 0R40$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S P0 P  R0P0y40000@0$00(0 0 0 0  0H3/P P80sa 00^ Q Y 0 SV 0 R80X T,3/00T00X0 0\0 $0`0(0d0,00S 8/ L0 3/P @D0 RP RP{ 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ>Pp`,0 0U=:8  0 0S$ p0p0$  SWpᾙ`P p P0j"RVp YV Yg:PpW00 U0#Sy ՚p`Ѝ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0P00  8 rp08Hp0!8p 40X 00 0S 0P*p ` &80s0 L0 3/P 08400H0, 00,0+$0T00X0pPv 00 80sh p z&Pmp@-@P(M(0S(`,`0P00 0F0  0(PP`PⶔP,(!(P(Ѝp000},(0,`(P.d RU-O-hpM)1$AS TP T(!0 "PPPЍ0 @0> C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!RP C$ 00S H @3/Xz$HLP`U X["1/"P, (05, (0;P0L0 3/P 00S 0SPX003/PX0PH03/ 0! P5/P%$%$)@0 Q0pDYI@/Q P, (01/(0, Q 2"k#X$Є  02PP  0, Hp0  @D@0 ᄐY80Y> PPmוe,0S | 0P p@H H 8LP (08/P `  ` @(08P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000%r-$f- p4080 L \ Pz-l < 4Q V ) Ȅ( 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PWV`4Ѝ R00S 0 //O-X`P@ < b"0800 c#  p 002Z#  0 S R( 0S% p  q' R Q0 2;#T 0 < k+800 c"p0p00S    V$0!0R!/S01/(W-!0 /(W-$1p@-S@ x1SP $003/p@#x1 P$1 0SO-@0`PKMM0((0DpH0S >I @"0 0<0o- %#{ 娻 KP@T8p]? 00 0 0U0000@00 @@@@0,nppK܍Ѝ(9᱑(0S*< o #80a&@@L O-`0@PMMhh,00p 0S ( 0R> 9 H" 00 0 <0.%#@~40kP`0V,p]? 0000000 0 0U000000 00p`ލЍ,Z,0S*< #0,0A#X0S000C0C0000S0 0,0A$P(W-L @-@-9"0  !<$10(10,1P001.@-@%"0 0! 0O-4M`@(0T`X\d0hpP 5"\ @ @,0;/,0P R7P Pp2CF !p W 2 ! 0 " ( 00 0傐`Sː(04ЍO/P/4ЍZ:p@-@Q-pP 0 P40 P <0`p@lPPג80 P<ђ,0 P(˒00 p&) ' ) )*+p@-PMX`@Ṓ  V   $!@) J) ?ABC@-PAMH`@  dV((####$0D`qK0 @0S    8`V@ 0 P 0pAߍ(0S p #@,0S H @@00S ( @ ]& .*) /1J) 20@-AMP@0Q*$4%%%%&&4&L&塑   q0`N 0S (0S    ,`V HAߍ}   q0`N 0S (0S    ,`VP] $0PT 0 PN0 PH0 P\B0 PH<0 P46 0 ! & N)    60S O-@MU M.Pm 00x R# R0p]娥娅qt8`  0@0S D` P, `  &PC  D  pW00(0S%$B00,0S$$B0000S$$B0+ 0 p0B/Pp᭠x 07#0=00S!0 B.x 00 0=40S! B0 ᝉ80S! Bx 07#0;! H! B00(0B/pWxX 00  @8 PQ+< 0 \x S0L@T܍ Ѝ/8x-H-wU) p) ) ) ) ) ) ) ) sf_ ) = ) ) ) ) ) ) * * C-`RGMP@8 C"U0S1 ` ` 딣0p⇞ 0S    `,pYV "n$ @ʎ8`峎 u0`0"  "ᆑ2ލ@堎 0   0S  "⤎ `PV ㋎ 0  "1 S ` { 0N0S @0S@g 2ލG<0040!00"@0n$ 0DL03/00 Dp p q r0S !0 fHD` 0S "] "Yp8`Y0a x 0QW 8 <0RN  0 7 0@ ".+@ 0  c R0Up 0"  9* 5J* <L+ &  U* % [* i* wq* -% @-x @+0 @0p0們dO  @܍{* @-D @000(0,0000kd:  @Ǎꐯ* p@-|A`0PsJM]/   0 1SB45<5555҇Jߍp@0P 0 0PP@ڎo(PVU@@ 0 (0 0(0 00@0(?P(?4`,P,`0PP`&3560p@-aPM,0$0Ps@]/   0(⣊$1 SP6666777777P 1P$bPЍp 0 ,X,0S$0:`@VTPP 0 0&0 000 00P0O0?P0?P`@!n@<`@4` @`@&(W-O-P`0PZ>`\P``Pd0?o2d0p`hPolPp00 S0p0t0?o2t0 0 PEr-FGIJKp@-1@M S>X;;;8<L<l<=(=L=p=0 00 P0 PPG 0/S  >!0$@@ 0/S  ލp1?o21QUx1N0",!@<1(0@`1?o21P 1?o2 1 1S 1SaIOVTPP 0 0 00 00P0=P= 1S 1Sp`JO 1S 1SP`KO 1S 1SoN  r-!"#O-4MbPp@~X  IJUXZY (>d>>>8??? @P@ l bP <0 @ L@4Ѝ<Pp/1`SPe# "1S "N !C @ b  0PPp 1`SPe 0 l1S  1S0P! @ b< 1S 1S$1! @ b 1S 1S(1   b@ 1S 1S,1  @ b| 1S 1S01D  @ b< (W-5܄  f- 0O-@PQWM0u1 $0` 0VϢ40Sq 4000S4l`V$P |X003/$}1S}apx `400:"+Q:  Q 5 ($0XwY/X({0.}1{.{ K#)1 0 &,1+ S+ f+ C0S@- 0@S !1R000 i0S/h-\20S O-@`Pr]MP2BM T]ߍ0 L0@ 3/P/ P0,X[) 0S& (>(a >I1P/S <(ⅅ0(0 00yb0SvU `P  (G  D 0S `P $ 0 SX2vU Z xY $1 0V!7 ( 0  0X!pH1@!Q$1S  0Q p $ 'p 00!15:% p ޏP p Q 0, ($!p p $ ʏP] 00 8a4Q101S/SPt--- 0  KC,0h 0 t0@W 47 `4|44 VH0 <0G, ,,Lpk-L (W-0@-PDM@T P08 @\ 0@  Dd  0 0DЍ00S(W-0@-@DMP/ P0, P\ 0P  0T   R X  s0S0000000 0DЍ000S(W-p@-@Q`P@M<㎂@P   T0 0SP@Ѝp@Ȅ0 @00 D09U@Ѝp(W-17@-@SWcdddee4e Ѝ0! |P4P P<<0 P0<0 P0<0 P0<04P P<0 S, 0<0 P<0 S@  0"{080#{0,0${000č̍ݍԍ@-@PD /x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍpač@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $屯<  <Uኺ 70$pP 0|! 5|Ѝ0r-@-80@SP`4Mc00 0P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0 | +-  0p@-PQ0M0@$ 0x`0 6/8 `Px1猃x1a1S0C€10Ѝp5- p@-@P 0P  ʉPp0S@}p P 巉Pp0S 4! B! P  墉Pp0S hވP R 0L ㎉ 4剉PppG- \W- g- cku- - O-uM Mp, Z-H0cS_ C70SSzB0S ԁPBԒ0SzIJB0S z2 P     P x2@    PP2 HD     P0x0001 @@K @P @ PHPP< ,h@ ,D@31K 01R010|100P Pd0*}p@  P8$yk} 0S10$1S10 0Suݍ ЍBPaH;Pk4Pj1S |!R |㧧P &(W-t-- C 0 1/0P $1$00 HL Q>r-80S @-0  / 9Pm - G-`@Pጐ匠X0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`@8  T P $Q[G$00S U 0 |1 08Ѝp)P ᜭP P Q K ᵺ P ር Э OP (W-A-M|P8 Z U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `p- XM@0 803/PDG 0`a'!!` 0 3/P"#"#00 03/p 0` L03/̬ 6Vp` 0SXpH 0!|1 01! 0<0S P L3/0L00 3/P @0D t0Rv`p0L00 3/P @0D t0R 4 d00`RP  w00p 0Sw`܄(W- 9^ - O-RMPhb  @P D@4 ;PPpߍP(  嗖pp 0S _|<08 (00,0 000040!04 04$0D0(0 P _Vph jp 0 A  DP 8P ,P  P P Qp Kp Z   p 8p?pq8SڍPr 0  *0*0@0嶲  0* *d@edA+4EQcwzd@A-PCMMPp`;8 )p@P  P0;PᓔU 0 2 "0 CލЍ /O-T  0  1!P 0 ࠱ \0-0  \࠱X pͱ0000 @00R00000 \ 000(R0#02S<Ѝ^ 00$00 S00) 0R $X' S   P 0  `0 T0T  0 2 1!P 0 ࠱0 0S0 84p< P ,40 WR,[7\ \ [" 0 S000T0T  0  1!P 0 ࠱0\ 00\ RpR0؀0@-4MP!! 0  P PP@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`  Pp|< Pd0 2! !14 80 00 PpW008W-pp0@-0@T\3#%:/o"\ R0 d 0\ Q    $ ( ,   @ꀇA-0P@pUP3#:/o"P RP`0SmnzW@000000P8W-O-]MMp 0@ 606TR3#W:_oRRPUP  YD R R IR0 "1 0 0` !R31Q { @w#-#-@0S D0S## #@ 0#2;.`P 0 pR 0S }]ލЍ@ D@E@0Sа $x  ǒp, (,0Q^ $0Q {0P0  0$ #+ 0Z;  0~  ,⟒00( S:|0 ┒P. 0000Y/ Y@ YD0S0 L1.\0D@P(!) T  0P0 ؠ0,à\P00 & 0R  Pd0\0\ h 0R T tPS@ POp:. yd|d{dЀ(&G. - ?- )  0$\ (00S l S  S00/Q 0P//0S 0S P/!R@-404 44R )r0@/`. (- 80R*@-0M@"P0 0! 0! P0Ѝ/A-h`P0SU@ @Tp@  P@<` pW@8W-@-S@P ' dP y Ѝ<P y`P (PP )0P` P P(  P` Dx|Ppp.WPP 0SP` P kP @0`0@0u. |. . . . . . @0@-M   Pڔv 庀P p@tPvP{Ѝ0{V0S 0 (f. 4xOO0@-M 0r 0@S|( gz0PXxx0L @8'8  P 0  Ѝ5rDq- @-@s0SЍ@-@M rT0  CR$00SЍvA-pP@0ST 0S` @P4P7 #P.0'% D0S(0 D (3v0{S  0 ( 0 0{ D@00#@#000@4(0 0 0{,d@. . . W/ / / N/ 4/ k/ T// p@-@P} # #0S S x00 00$00(00,00p@-`00MOQЍ S 00W@0u #0$P (0Vp  P0W D W  00W0S U0ąA-P@\^ 0  `04pX T ku0p04 4`X \^  R  0  `04pX ^S@-`lM8PpV0 00! ! 0 ( (PV$8 80R:V u@#RD$ͱv@PV008Pw0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0z/ A-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* OvPW000 0 0004P 08000 <0S $0R 0$ A 8< Q\00tk- \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ pw0 @-@ 0S PO--UM M00 5%50S5%  PG}PP Uލ Ѝ5 :0|%@|PHu@P T@r0 $08<0(40PP yrPD 0 ` pX0,DRP 000  0SXPD0(00040(0<00a@08`0S XU 0 D  t0U0Q0SpPX X X0S Xƻ X» t` t0P,0 XP(00W80400<0tXP0 000$0,0S <X{PcXuPP @Cv 0S$00)Z1 (1 @-1 Q`0@d1@Q`q4Ѝa0 (1 >p@-xP@0S0S DLR00T0SRD0  p"@ pLW--08S^/-- p@-@ 0(  P0R0PS 00Si AppC-@NMMP`< Ѐu@ @@0 ` `@;@ ҢPPD ⦂p@=  NލЍ:. ydG-xM` @pᜠ堐1P@J!0@P 0S PU 0 R<\1\!\\H00S 00" !PP0 0S0L0H 3/P HL 0RPPT $0RP 00  x@ 04/@xЍZ Z Yd   ៱ZY < d @ ^Tr1  (1 ?- )  A-P`@7P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 0tk-O-`p@BM MP/0;@( pP@0 Z@*0j 0#;$  =d P!14"S; WMxo@ U01U01Bލ Ѝ 0CiP 0 00 0d RZ0 0J$,$0 0xk 0RZ 0oS 1 SR 1S  RS1S1S `2B@?↏0Q *0STE 0"0S@0S@@jP9 Pn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 03  00N LURX@-04MHpL` L1L!LLPi@P* T00 0R0 !?020 20P000204 pj@4Ѝ 0S" $0Q00 L03/P P P003/a0 (1 >A-P2uSvw_10000“b\œ@FҁL@$H @A- P@ \T@@ 8ž\ @Tg `Č `Ȍ `̌b` ` p PČpȌ` "0q1aPaa >j00`T08*BLP080}@ T\ 0Sp`82S @4008 q2aq0R @Q2T0S X 22 040TP 2SX1 O-P`\M(@4000PS}1 0\  \^T 0SQppQpW X@\Ѝvfb(0,F0 m1!P00 P PQTP Q8b0 RX3 0pP W P\ T 0pWbV0V0N21 SR 00(040,082S`00!$02( 2S01  $ 0 PBE X2p ̓Q R @QT aB`@ V````Z R2@TP@@ 0S1!b02#38( R,00XL fI 00 (0$0oS4  00"0(4,Ʊ@P4 80  02 S02@0S SP h@D0S 1H0Sp10S 1 S  o00( ,04p\P`` 0SP0` ``2 P B!X,01 2 9?T/l(1 O-`M40P@p0V00P484(44KPV 83ЍP  0} "UR\P R^"4  0S 0Z000[ 00S 0PSVv? 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@2r/40q?0840800s (8  R    T R,08 S000e0D0fPD07V50Xo_P0"Ph0S SP gh 8 @U 0 o?0 R S2 RQ  0^&/ o_S㴒!P% 0 8O ,0 S0000IY0X0\04024 0PZh0S PS agh1B I ')! R0 2<0C00$@" ^(P0T0^X0\0P&h0S SP -gh0T2S2Z 00eP3R"? 01@22]UV 0>20"S0 L    0 HL H0TP LY0H0PS B 0D  1!P0 P0XT \ YY X\ 04"o0Ph0S A<SP fh<PR#3P8H0 ,1H2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0|, R0 V,00Y2 O(1 p2 tk-UO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 P20 4  0 P [P "#"#0 0D00 P 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0ܷ-pO--:0aM M Q@ 00/;`PPaލ Ѝ {p *H6P:0@ r,W 2S 1S<2<"<<0u   &      0S!?⧻t  0 N d T 9 ]PTRUzL&HRQ  0 1Z!*??  @{0Y!)??  0bpP  ]?XT D ,R ]e?X T Pd@ 9\(1 Us@-RU0 @`d0T `Š"; P0H0`04 oЍp2 f (1 2 s@-@P04P00 o0S  `VRUp my0P 003/8_odVdЍp@d- xk (1 p@-@0AMP 003/00; ΚpP   ac`P  xd3yAލpO-p0\M0SQ `DbS@ P0 P0b0@SP0 0HL R   ?  ?/Z[` P `@10d ἐ 09/0P@\Ѝr-G-` p0@PHLR0418S ^ @Z R  0\ X0?Pࠡ࠱000^ 0 G/r->0@-@0M 410810!2a0 P0T0T 7a0 I0PU ! 5/NЍ0r- @- yHy@ Px@- 0 he 4 &@-<@0sx(00pp]0Co0&--$M ?0 0 x$Ѝ0-4M 00 000P4ЍO--pMMU=y " @4y4 Ѐ0 p0 pW(0 0CSpW"R 0pxğpD0S 0s T0SMߍ0S P 0i^40S` #1f`#S006 h拟 A0'a A{{JOdTd@00#fH3` h3R - BP  [ BRڔD3DC"B 8#0 f$#2)` 0 ß RSPS0B 10"000f 0`S$0 (00SZP=9 =:k{,2 A \090   A { Q  0 \SQFA00 0A ;f#;Z0S;#;0@d^4#.P0%U[?;#; 0 #5;B%0 PX!,1@P0'00 RPldP !"%+0An,Šˌ0B%W5 @0S00d ~@0 00ppvY@.A(- --8--`- --Q 3 ,AN4-@~[ & P P!\0  AV A k{I{7{z\0W 0P  8`P<00<@|f0 #@ @-@[@SRG-PP700@ RPąpP:<`X:00X 0P[ @-P@`pP0S -S :S S  000`  0 0P0 ЍU0S00T  1^P(&p@-P`up@  uPvV@70@0pp@-P 4`up@  uPu@p@-M@ "wp$ ЍA-`p@T/  PP *P. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M 5p 3ݍ ЍV p@-P@ @vpPppA-@Pp p` j 0W0 t0WpX U`0\0P P  0h0@ ЍU0 0  yE \M dM lM E\ @-`0tM0F?oP2p@ piv ?vp(u_v@tЍvup h2S$vp D0V#4 - ޥsvh"Yupp@-@0  t0 S " 0PUPUp@B`0 S  0 0S 7`5`0S   0 0S )`'`C-p@PM$MU `0S@PE8  0P600ۍЍX+700S @ Q@BPE@C0 00 p 0S 0#S @UX 5 M M M 0@-MM@ T UtpP@0SdۍЍ0 5 p@-\1@0S`M @@@P`Fp  t0@ p`` P03p  80@ pЍp66 M p@-@PqP  Ss01pP`q  Ds0#1pPp80@-tM0 p@  &spP$s@tЍ0C-QM Mڛ700ۍ Ѝ  Y0 @`V r@pP`@-`Rv00GPp@0ST ]@PT  Q*R@00 S   0 0S0 S *D]P `^^ ? 00000`0 @@P0  Ѝ@-@ @a D6 @-p0M0@M0$|,p Ѝ  [6 M p@-P@ ` 08 l, @U\ ) 0 0 008 , 81pp@" N AN p@-`<1P:<1x1S0p0@Tp 0S  00:00L1p@-S@T1S#d1S.RU9lRUppbV:l{]lbp1Cv]L10CL1L1PSn]0P11Ch]T10CT1T1XS`]0X11CZ]d10Cd1d1hSR]0h1 2,P0C2bVD]bp2,P0Cp27@-@0 PP! H1 0D1<8@8@-  B Ѝ0@< Ѝ0Q@-@    bqP p #00` Ѝ@] Q  40@pЍ@ ЍM m6 @M Q@-@    \qP p 00 Ѝ@- 1S70|\gZP| 0 140@pЍ@ ЍM ~6 M @-@~p t10cSt14 Ѝ@ d 0@ Ѝ4N 0081/@-@`'L0S . P |080H0S S@ 'TN JN @-p!@RM Qt0 p Ѝp1S\N 0@-80@@V@ PQ7@-@  ((+ _ Bpp  Pp Ѝ0@ P 11P+|1@ R  |/'QPEUQ |`00CS`0 X` X0@p 0< Ѝ0@ X0 X Ѝ0M 6 (&&@M p@-PDppp44p@ @Hqp p@tpz 'dN @-@T 0S x@C-`Pb.H0$ :0 0 0100 & 00 0 sD00#4S4& 0>P&0 Pp0P W  g]080P040 Ѝ3? 0S %/%p0p@-8P` J4  :0 tH0 P@p@P@  @Tp@p@-8Q > >0S **}V m 0S 3`0 S   000x1  @  0S T 0P0 S   0xP P x7 P P 0C-MM000@"0lp00P܁+ kP`+pQv07S 0 S W l00\!`1y`Px1 ,ލЍP  P  R쀟쐟PU Vxx x0 S   x0  pP 0 Px1p  P  0S 00 P7 Q Q _Q @ Q@-@  \\x+p07S@X0 S 0VS@WM 7 A-`R@p@M PyP U 700 @ЍA>P"R 0S 0 r>XU$  *vP 0S <0 *d p \ <0Z <V>P  *@ЍAE@Ѝ7 >tQ Q Q O-@PMp4P  -P 00b ЍOxP{ h@P000 @J@T S@P`@` 8  F0 00V``I@ᤓU3#`` ``Vpp#h3x 8118100x1@T+ jPx1@F 81181kQ NQ@ 6Q`4Q`UQpQ xQ nQ   ` 0S 0 @0P 0 X [ F p 0 0S@T81181Ѝ 0 X [  ) p0_P 0`` Q00M0 :0( X! 0e@xP 0S 08  *  0000ST Xx&x0P 0S 0000S0 xQ Q Q Q R R &8 -R >0S p@-0?R02@?P00P8003?00> *0>0Cp/ြp@-p1PSM"`! %@P T 0p1!V T@ 0S TXy8RP @rtAtЍpp>0S \0x1@T l1S R  @>0S@ E`l1S   0 @ P 0  @  B.(0}%p ,)l1S Y Y 8 Y Z NZ 8Z 0 R/ 1/T-/A-@P 1 !  XSpR0 qP 0`0S/000S \ \QP0 S   00S000@00P10 paU0uZ %8 GZ Z P@-|0| ||q@000 R 0S0@0 @ 0U@00uZ 58 Z 0@-@T0\@@^0S\P*\@0\PZ 0Sk R0@-`pMP@@i (0p``FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$P1P!PP.WD14!@81Z`P(@$1! 0S0S0\,0 0 @T0@TP@P0\400 (P p`P,00@,@0S  0 S0 0@@uZ H8 Z Z ʚ;Z @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p, 0B0 0p"#k ЍMb@Bp@-P(`0 PUPUR PU PTP,PP@4P`P4\pQ@ uZ \8 Z P)@-0 l0PT0/uZ s8 Z P@-0 ]0T0/uZ ~8 Z //P@-$0$ $$J#08D0uZ 8 Z A-(MP` 81U0@0$00 -0p@000 0<0S fp(Ѝ8010C>S[@( ( 03(00@000 0<0S80 )p @%uZ 8 YZ p@-XP@P gpPR@p0P@ P00(P,000P400P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p vf00C0QPU 0`0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pb市T0SY 00C01@0S D3/t2t"ttQ(PU0S Pm0S R>0 S ,  003/00400P4P,!0  P0V0U0S6 L0 S* H'P, HLH R# 0|S0   000 00!   U 0 HI0SP'pz)0Sv %`ЍT0n0S 0S s  PEQ 03/UU YQT-uZ 8 Z @-4 0$@ #/p t@Ѝ&@-`0$AMrPpM (f 0p@ e@AލЍF U ڠ# "U  RU@@ C  4,0@0$   ,R8&&-@-   Ѝ Ѝ/p@-MMP@ ` 0⣴Q 0 `ۍЍp>-@-   Ѝ Ѝ/-@-  ЍЍ/-@-   ЍЍ/-@-  ЍЍ/-@-  i ЍЍ/-@-  ЍЍ/-@-  S ЍЍ/-@-  ЍЍ/-@-  = ЍЍ/0/8&0/8&p@-MM p ydp@ P;00 dSV 0@0ۍЍp P0 4Qd8& 0/8&0@jQ8&p@-@PPʯ; @] XQT V00pp8&&MQ@-@P:H@@O@-@p ;dp 7d1S"@Oe@-@M  _  0 ep1$0Ѝip@-PM@` F  ܔ0 Tfep 1@ R! 0 p`Ѝpii$00 H0s P/0 #  ///A->PXMUTV0P0XЍUK700p@ `R{0 PU B0>000 <0:  ,> "PP> *$Z @-@T>@Q/@-@Tg?@0Q/ R0 /RG-@P(M0'0S  ;P P 4P:2`P $0!00 0   $08S0 $00(Ѝ080 00S # `p$P `P |0 P 0iS.S  `Pl4$P 040:S(&O--[M `F/@P 099`0LpP$? Pp6GNp[ߍ0S00:Y 0S 0S_0PP0 $ RP PU0SB 0$FP 0PSP0SPP@T1S<@\1S`1 $gP=\1 S S RP@L1SP1 $UP-L1@COoSB@$TPk!P" `$ [0s 0$P<1P X1 $.P@T1SPö@@00SLATd h1$0P0; @T$ P p$W0P0eL@PD  ` $  0[$0E  P h0 S 9`001P d0cp `0 D000S0 35S S  CR0UX LPS y r R 02 > 0*r81 U48#88 S R p #S 0 S U  R P 0?D0 p 0L0D0}>D0 Pi 000H0@@@8 <"[ J[ i[ {[ 0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-000Q/Px1P/$0/0@-@PM  v  UP 0 0pЍ00 bi~i@- ` R@0$Mp0 PR  RU U 1 # 0PP  R@Tx!@T|00$Ѝ R @!b@-@p !p !p`Ua-88 Q  q8A Ō8   "  0Q5ã0ã0A-`P@P─@Ѝ ԚP\KKP0 q'P pP 꺦8 O-P@.0p"S0W"SpGP Y "`P v700 ЍT V70`0Y\ T00W YT X0#0%: `T X3#: 0\Sf0`xSmS0SD bS S\ Tn C RHIHHH\IHlIHHH|IT0 PT 0 0T 0T 00 0    00 `` 0S& T  G0P`0 NRU`0S  GT P00T0` (&P /0 S S /S/P0/S 0 S S/0/@-`RpP$M 0S0U00/a@P 0 00 0  0S h$ЍU M7P4P, T/00DU X7[ [ O-p PP ЍO=!`P ll ЍOJ@@Y4JbPP  sP? 0QA00 Ѝ ~J@ `@p I0P& 0 @ 0p00@[ = Ԭ @X  OP0S @P38 [ A-@P,p =J` 0e SP,p4J$` PP(0e S$+J0(0$0PPO-  R2  R/ 0,PSP00,0%00 0$0(00XH` p @  daZh0PP ʎJZ d0PP/Z Z P<ЍUx T`P0040 00 0` @4pYbKPP$ 0  yp`j 0S:9P>P`  0hPH |0P`+AP`&|6xvaPPU+ PH6P06H0P"800H0P80H0P7 00H0P70U 6P0Ph2h2S$TPxH0P00rH0P70lU `P 00`P@ P PPSPSpVPpq P |PgqPpP8H0P402H0P30,H, 4P,%H0P20U  0pHP9PjH0P00H0P00PV 0U0F$ h]  @PUm d0@T$(@=,MP` ` ` ; ` ` :` I^ _ O-pЃ`P@8 P eP PgU<1L ЍO&B$0SX0 ,08 ЍO Ѝ8 \ @O-`S0$M; @ 0QpP  80:0<10  0H 0Ap0 0000 000P0 U  * 00$Ѝ&,R -R 8 @ .A-PQH1`Sp51Sp:x1pS> P?@?T?`fd6S?`?hfl6S@h?pft6SAp?|f6SB|?f6SC?X?A??1pP??1pP?X  1P T0 ST-d6,`0Cd6&l6,`0Cl6t6,`0Ct6\?6`0C66,`0C6O-MDM` 0>P/ ؍DЍH0 3&7 00 06<06]  E0v00 0:0030 00% Tp S +8 0 0 00 +0,t0 P#Z1E0B,=P0`d60((@\P4: p@0U,0@04CP0/P,`6hv2d6`2dl6u SMP,h>pvt6u SGp>0&h6l"&l6p6t6p"6680@ p450! ,^00P 00 R @0<   C 0 0  ?  @0 R R R P\R p@1P.P@000SS L3@ P4400  C 0?oP20@0TwP\ n+a 0Q//Q :///G-p0@0P `P Y 0 0 `R:SC3@"X HG>U( HGA-TpW0 )T`@V0 H0HS @sP X X| |00 S DD0P 0RS Lc t? `c c p@-P @Pp=@-000!e @ ,e e p@-@PQp;@ e G-`PM@ P `bp, 0 Eb ````Tb1pW`0쀟pW% ?b @ 0 L@ aT  @PЍ00C>S`"P!@03@000C>S`"P!@03@08 7 8 8 -3@- P 婬p @p@Ѝ0@ Ѝ/R A-@P8p`B0S p/e A-0Pp`@S:0SS 0  RT R0 *`V1S* 'P a 0@DpR: Q f @ e e O-A 0MTP` 0 zy{<@PA<@081 0S  tp 00*PĀ $P P P P P  P xpPp 0S \ @p L61@ R 86p 081#?H00 &&'p H0S% S% p D p L p $ p  pw L0S p0$0M0p H pe t0S@08!Q0x1Z9:p M P= p@ `倾PG0 \dT$k去Px$x p+ QL` p.#p_<t p 0S P Q վZ T  :p  #:p3P^ .PY )PT $PO P PH X00S 2"Q`` Lp  Fp b%P /%P0x1`30  2p X00S1XppW@0h1SP,rSTGp@Qa a! p'%P`V%P ps0S   ph !tpap0S   D pT 08! pKpPE 1 R 0S  P7 Ѝ 0Sp poA Yf Tf TN JN eO cf P N kf @ xf f 95g wO f f f f f f @ f "'f Ef Mf f & f f (g g g \' &q p@-P@pp p@RRA-P`@@pH0s  S  U@ p@@@dW0S  R H R U@ p@JN cf Q/p@-P0U@ST` 00p e:P@+@T:p:g A-P`1pSMAT  p@xЍ `=:PЍA!R 000 0 Hp@ u@apV 0 !'p@b`P  ⦢p0S pxQ0 0 0 #40 PPPHSP  5 0 (A ?g Dg .A >{g 9A Yg pg  @- @0P PST00Q  PDA-PP 0S @0lp0S @@D&00 SU V \@ .S0.S0_S-S!00  ?R"0T0 0D0(&P `00CS`0p S00 P0S X0X /X8&p@-h1@SP9PPE @p By0.SSPP X»P H彻P 4'9P 0  .PPvg p@-@P'Ua 0 |+70 l&70 \!70  L70@/8,0)(&  #@       60  60  60 60 |6p@ M KPg ^ Kg g g g g h h h wh (h /h 6h ;h jCh Hh Qh Zh 0(ƒ -\ lp Q^ ,\ ,@-QMM@pPbWp000 QލЍA. !. d0h p`0SPE@Ep 0S:0@0DQ W eh kh O--4Ml"Ph2 m뀋`( (v@P24Ѝ0S   8P@ 8f 0P@,p,$0,PGY [P,p0[.l2뒿00 P,p, R ᆺP 1, R, R0S p R $B2h0 fP p1,0S0S ,P!  pr @P !!!zh h P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-`P@MpVU:U 0U00E0S00T@D@@V00ЍPWܾ"0$?S 0[ `W R``V?R¾0U  P70 ᶽ.0 IP0 0IV:D X0 0 @UR  ES`O-@`0p 2" Y*QP T W700 Ѝ%P@pG`  l00T W 00  #P     @ \Eo p  ' U/U$4\U0 T WPPT W\%0P00PPpG@`T W PpG`~(&GA C-QM MP<p`8p; @-8pE `95p V=p 74 (5pTG    0 Ep P; EP E/    oQލ Ѝ   t20V00X2 0@E p ( @pP0P@T*p0S4 p`@ᘑT*T 0 4p @ p T @ /r 4pt @ /r   2/4pb @@ 2/ E    .0E/!PJ E/w4pD 0S @00S@%<h4p4000 Q  % HA- @pTPM VuЍR` R 00L0S 0 -0 0p0#0M0 R$ 0V 0  0h h O--4M`@`d00 0ShplP (0S;0  `pp30"4ЍO} 0  ,   yp0,0 ,0SDTg ,Li/p 0"00^,d/4ЍP U0 000!0  v 0 ,`dp000\!p( p PE, 0 S(0SU $0$00 (000 $ 0S *NP @TP@)@P@J`G/0p@-` (M>00>0@SP  '0x Bnp0 0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 x TT0S (Ѝp0 8P 0T0S 0xPT^ A-`|VPPFPP2X@p`Ex,P x倂|"x20 V0  n|2P|R@-`@MpP! ] (Y (rX( 8pyCPU@ T700@ ⋹Ѝi///0@- !M@ 0  *PPЍ0 3"Qp 000)00Bp000@ 0|0Bphl 0 0" 0Bp8 Bpi J ni |i i p@-Q@p A,0x1p@,p@->`FMV 0P0Fߍp@PF/ Ÿ9  0Yrt01 0 `0 HF?BP 0> *0 F?B ii@-@MP4@ $ܴP P@ЍJ Q@-808 80SSL`///i K ?i $00 Hp//@-M @ p000p0@0M00@-P@,M(  O  q PpBp 0 00S p,Ѝ08i(p@-@MP + ` & q  (PFBPЍp:iC-PQSM M3# T0S2"`V2"@p@"0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@嬷120@ 2T@@D@@0@L0 X9   @L0  ӷXH@L0   @L0  XP ỷUPPEPP@ D$r ?p`Sލ Ѝ  ⠷XH@d K ?i ed d  C-0`p"M 0 `` 0`$`op@Ѝ P@ (PP ``  0o@p @`@"6+00V :0 ( P| Ph (H VY 0@T*x0V*600 +@T@$K @-`@DM pP@  ܶ  rp!> U 134  4R2$ @0 ]DЍ0Ui@i'0@-|@QM P ᱶPp |2 0"x2@Ѝ0@-]MM`#F?p@ P@P -R շ00@]ލЍ0S0S S SS wR@T Hqp@V@T@S  CRPS @@ @xpPP -$0 Bp 0S$ H 80Sr S~ S00,0S  R000@0S  R00@ H P 0# Ho!>50H \0@@pY\0S X01S XX0S|0 0 000 0 0p mPg>S S[  ^@]PWxK@PK W CDPA 0> HE@?Tm50S= HM P N0v200S,i@.K i @-40 000 0nЍ8K 2S/2S00/@-@@ڶV002S00/@-@@˶V0002S I/@K G-PM`p (PPhPO(@PR PP`>p<00 ⼍ >pP0S p l?p PU0S Rp =T)@! (n( R?p | PK?p 7/PP @?p &P Ѝ@i i qB@j lBpBfB@G-@p`0 M00PU  =0S9P 0 0 P  RP弡 RV 1!O P    P0 PPP0PU:000y Ѝ@-  > ЍgBp@-0M2S`P@x (VP@0 \(>˵00ލp@ HK B-$M^ *Ѝ! <$Ѝ@-@= n(@k(@-@pp c>p`~B p@-A^ Ts00p``0@D^c"000œ\p@Tp0,p/0/R00@- \!Q0s# R0p@0QRO-M@@0'0@0Ѝ`1Q V00Pp0 , Q :@QpSH B\= \ lP lP U  Z4\[X\T p Q*S0C!&P 0 r0 ̳ 0 @S2T0@cSc@-@ 000~P 0S00Ѝ@-@ 000kP 0S00Ѝ@-@ 000XP 0S3Ѝ@-@\0S w\0\0@-@`q0j`;0`0@-@08T@%0p@-80@P >0S0&0T0ST0x1 RpR 0S TT0Q  080 >0S  p@8j p@-`PK@%Pp00,000S00 /0KpcScO-ᴀĐEM@ p>p 00KC%P`PN d0S  GRW ( Q  R H)Qh 0 00> 0200BS* ѲWW 00 RS00To K4 $`B\` D RW Wd^ h 0 \ FQ 48?$000 FR@( p$ R D RW0S <0S @FT60000<0 @0W0FS 800007 S0@0WW00W  R 8$R  FR0+  8$A 8N8$0 @W& S2 W0=0S< rp ?01Sn ; FTP0l%*p_ 08    FR2   0@08 R  FRv3    0FSk70 @000"0, 0Q `6 ,0d&RE "(0,q0 PW:@QT; 0, 00,S P T(, "r  PW: ART  ,0  00D0C00s W0 0FS900000@Cp:D73S Y 0 FSM007# |730@(1S 0 F0S=00(  j(100@ 0S W02S 0 FS<0 0" Q20@W081 0 Z00 FR P0@ X"0R_ P 00 FRQ S "   S   W 0  ^0 0FSqt0p0p95SF 0 FSe^009%  9E@@6S _pp0FSQ|0000x|6S# @000DKP::Eߍ P !) F P. 0   廰  @  0FR000S w}$   堰0 000p0, Pj cSc25lj ^j 79j j s@-`\@T Ѝp PP\t0S t0t>08  PP (P 40p$D&j L >!M @-PR1!`0@ 0p\ 0? R1 0R00  0M 30 0 0P0 0:0 00P00;0 00~P0060 00aP00 ЍP 0000t 0 00Jpd0 00>p0 000j L rj k 0@-`0i0 MSPp$M W1!pp%8p@0S i |`*i@ >0 P` s81Q50 00pP!P4S ⌯ ۍ$Ѝ k &$>#k 'L 9k @- 0080HPP@ `V@ @T  @P  k00ЍpO-IM Pp]PHLL `PR  @P0 IߍO#0,0#600 0400` 0 rp00,0 PS2 V30a2@0 0 ,0~T8`0 `P w8뮟@PIߍ@m80 Px HVT` 0X`0TY80 4`5P8PQk 2L ]@Vk fk yk O-@pP`Q`,R尰,P2,ES#P㔀U`,@ ,G& P@&, Q 0S, 3& `,P0 Z000!P*x"0 01pP 0$00S0(0  $ g0 j (`0,0(0$s0t0(,8 P@0S 0h0 0h0 l 0304Ѝ 00 !0`Pf @ bZa0`$00S,0 pP@,0$S  S S0t0P4 1S 2S0 0h0p( $(,8 P@0k k O-P0M@040`0`p 0 ''p'X; X8l0S,0S,0儒0嚘 2S,08`0嚘 8d6S,0l0嚘 p"R㄂0,80,0H00`2 S0d6S 5 0Lpߍ0 0 0(p (  0p 0 0 0,p (05 0p (5 0p(,5 0Tp'0z0,,04l0 40upl'0k@0!04,0 40cp]]d k,0 !P !,d ,hS  R0  P 0  ! 0  0 , }R0 RP 0  B0 0 0 !P !0  P 00 0H0 0 0, k k k k l  l @/l `p@-PUp@$00L0pp@- P# M"p@ 0` 0 ` 05p4@ Ѝp ` 05p )X` 0 5p  &00; U1004pO-`@p 0崀SPM$H` *000 0 0 `00`0! 0 `  $4  0 0004H081v tHAЍOe<0 $4 8000,4@0S 4H000s$8040}4 S 00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!P4 00Hg*S:kG{{'{*z8 S zkg{{'{* zx$-4 00ZH0S0SZ h W 0R<0S 0Sp2l2H000s8040 PL24 P828 P$20 #00@0S0i 0.0 0p /0h`  Hz&  P0dh0Ѝ0SP1P1 P0 00(0000S  0R`V dp`ЍOP 0px|ЍO ??Al `l Tf gl l l l l Nm l m s km (m m m rm ym N TL #M A-@PT R0A 0p80  l R 0i0dP 0S <0S $=3  kk 4`0  ` ``0Hp00` 00`8 0  z00 0$00A8 % d0h0m O-RPp`@\M@P; 800 #3P 0 RT000 Wpp h@@L p 0  0@P 0{, &X P0 D\ЍL0S0 0@S@0L0L }II00P 800 |"x2P 0 Rzgjzzz{HT0d0S  $ P $[ <Y, y ! +!C,p! $@(@ A,  0  04  <  @ , D  H  <8pL@P@T@31p` xv ը0wp 0010 pv uE00vI@00pe eP00 0 \`vT g렩04S1SK081X0 <7S: zDm `L m Un n CDn DCln yn  \@-@`P0 h0X T6S @`0 W,    1  ,Ѝp@40  ~n Sq m n p@-P@ $ 0 00L0p@n  p@-PUp00CSp@0@ 7$1  (000L0p@n  7@-P@ x800  B`000H  0<0L008 % Ѝ0@n !o  TA-P`@ 0h 0R0\P3 o081HAp` HP081( A:P -   z -Pd0d ddQ 0d 0 gP4 $<A:o lo uo k L 6 j  T C-p@ PR0  R $ RP608 `0  2i{@ R PP  P0 _ lH\8!<1$?'((700x Ѝ@ 0$o N l0@-@4M814(02P 0S 0 0P 0 0P0   000 0 0 4Ѝ00 wc0  4Ѝ0@o 0p@-8 PR@  f0P   0v,Hp@Ppp@:o lo G-`Mh0p P@81xP( "(1* (> >Q  0*    ЍG  ЍG80   0S 0 0l ß Q 040 PH000s  ipPqp 00 P R  D 0 00$0C40 040800 8갂0S0&PU 0S 0`0h0L 60 PL ЍG)p0I|0 $.  0Sm 0Sj 0Sk$.    0  d0S  0R/.0/N O-0M 00PS㴐 @IT0`Sp 0 pЍ> R*8P 0S D6S<ƚ Hƚ[  S-  @!  Q 0 S:500 0 p0 0 0   0 S 0 0Cs00S0 hS0L00 @!p 0 3 {00 0 hP0 [ 0S?60@ 600 0bp0 0  w`P d 0 S\ 0810i@6P P0S0 0<S<0P0B!0 0 3 {00 0  P 0S6[[0 0S40SD0 XG (PP  $ \xl00 0 P0SS 0KSK?3 05 0${0 [ i0 `4 @cSS  00Cs00Cs0 > $P 0 0  0S  0 Q |3@ 0 R@ S$ D :0<081=0: P0 P3 000 000 0[P00S* P )   p @ 0^600 0<AP0 4y0S * ]P ?  p̢81 000H 0 000 00 \0 S   0d! 0S  0 @(,1  0S S0 lS 0 <0Sg0 00 P0BPY0 2[ + p Lr p p q *q :q Lq Xq Qk cq _q lq sq N q q r q L Tf \Dq q r (r RA-P@`+ 0l A `0R+ 0 D0BSpb ޡ0 Aztr $r O-`Pp 0䘠x1@T ЍT 0S R T0 S> R *+6P  0 H@r G-(M@P`P P0 (ЍGPE SxUNp0@SJ ZGwUC:p1S? U<: gP3U0:! R-  $   WP` 0QU q `q`D=  >U *  DT(Ѝ- 0 ! @ B-L r s @-` MQP\@M  60p000  p 0S TH  ۍЍ 0[`V \@TM L $>p@- P@ P<p@0S0p@ \0Sp0p@L A-0 ;M0M`pp@P @ p0̠0<000C$00(00$0C,00@pV004p8  XXU0`$0 0Q)p ݍ0ЍM M   p@-@P5T  (@x1S0pSq B)02p <)02022p R Rp07@-PX0B @P 0S0>8 Q'Q'+ " B r R "'    ,30 Ѝ0@}.A zgjzzP+S, @ 0d Ѝ0zD%s D p@-@P0( mUph0Spp@D O-@`PU Q Pd0S  0  0 d0=mP0.Q 0S 0P )  080 | 4봀8 R0 , 00C0 %080<0  zP`00 0 00S $0 pW ! 03   0P C @Rʠ 00pwpWL0H0H0pIs N js `l 0/@- 0Sr 0 @Rp@-00p0`PQPE@ `F @d@DLd@p0P @-P01S 0 P04/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScO-`x1 @\MT. 0S pW$   m @PP@0Sh0S d0S4$V Sd0 0S TPP\Ѝ|0d 0|0  0 0Kd0  0 0E090 P p8PP b 0|0 PP$0 00 PP 0  0 d8dXj& ṚPPl ך|0d 0|0Xx-U 0S P 8pP   M U`  P < $R R0 0#  Q  xP h % <   dpP? t0<0t0008dxQY X EP c U 4P RĠZ 0$8 0  h % < V  ?<}@ s M *s Bt t p@-P Bp`m01S i0S e0S a0S  0 @T 0Q0 PSP 0U d0S0h0d0p@ft %M >0d\/ (0 /00 0S/ p@-@T PP@0p2M G-Pp`P@Ѝ0H @P00 4w@P 0P000000 000S&00 t$0 00  0@& 0 Vp0S t00@ 6P  0@R 0 0000@@@M +d 9t t s@-@T`Ѝp`PV08,*:SR h0S LH$` P (0R ,0R   `P +800000( ,0APM0S  0h dd0S  $0R 0h0d`m0SHIt t 0S/0S/   O-MPD0R8<`@H0x!R00ЍpP P0 U@ UP R R R0 2P!4l @PЍO西 p    @@0 0B%  0 s0S SY000000000Cs a@UЍOMM +d 0S/C-P@$M T 0p `x! y%00 0@00 @d@$ЍP/@-@TP@N0S   0Gp@-@PPP =p螏 PX 00p0000S0p@00:S 0S @\S000@:S @-(&P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/H& @-@A0S :^|^  ^ R S \0L:\\ |\ O--CMM`d4!SP I SLEpWH `0P0B@ J P 00p@@ ; 040S0 00,0:= zpP 0 R0 :R00Hd400 0p0PP u0S  # aCލЍ  P ; 000PMPV%0 00@p0PP@0S!+ "0P R $0"$0SG Q@'M@P "`P00 P000 SWB p@DW:SZ @\Sp S Spp0 0T:C  P @D  0SS "Pp0 0@0` Z@S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[ P$0 @D pG H  0S <"0  @p P D$0-p$0 (p0 @E 0S " D0A0 0T* P 0P:SZv-H& @-0  0 Ѝ@-(@ P !0 0-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ y0Pv Ps @   Q0P ލЍ sy0P P 0@P 0 PP U LyP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0S@Z\R    B{:R|R  -(&@-@DЍ@MG-p= @P@ d: Pv 00@^S0S:S^ `00A\S`0S:SQ 0C^ 0@0LT1 0L\TS`ASBC\ EFDFEDDDDDDDEDDDEDEbC|^0 0 0 0 R@AdT P. Pd @0:SS0AR0@A 9 P Pd : A-p= `P@ d PPd0`F% 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P ")P-_ G-Q0S`pԑʯ HPV00c `a  mP00CS0 Pp0 0 S  LW00S(@ ዓP  > , :P  P00SW  X\00S 0 47σ,P R   S@T P R  ` ЍR -m--@0@-0S tP [P--@-@RP08G-p@-P@PPpPp-@-<P  J(0@87STЍ--p@-@ PS P@p p@-P #(0@87STЍ--O-pWP`@P @ Ѝ0S K P 0弒P0T  RT1@ S //////0@-4@0P P-_ O-T@00SPp4b  4 PU00~ P|  lP00CS0G Pp0 0 S0   W00 S MP  P P00SW00 Y00S P P00S  P P P  P  P  P$| :LlPwP Ѝ-mOX0@-0S ;@@0@00DVP0DЍ;P--@-@`0P0`Sp 0`;P P Ѝ P-@-@P08D-p@-P@PPp9Pp-A- P@`pP 0 `00P84SUP@Ѝ-@-$ 000B;P Ѝ-A- P@`pP 0 `00P84SUP@Ѝ-@-$ 000B;P Ѝ-@    /0A-P<<`0@ 㲅0p0D0& SQ4 0@/0PA/A/O-@PD⚐pDpG``b0Y:0z  Z# 0@@D‐ 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Pp    A  0p@-Q@T 0 do$ `n2 0$pAT doP$ n $ 0p0Rp0@-`pTM00`< @P?p0TЍTT0 :py@ l,0@R$0$ 4/00S L&4& -A-P@ 0s P0p`ppGWp0P ```pT @@P -p@-@P?0 ?@0R:@@pP p-p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `wX0 6/ Pn40 5/ 0@ |4/Ѝp-L& P 4\q BU_E } kM l J [G ̄ %ل ބ O-Q<08@0(00IpPR @p,h`,@480T:(t(@#0T(:(t(#0@ (0T:  030H*@`(4 80 D0003#0 `@4 #00c4 0300 `@80@000 4/0SD0p -t u L&  p@-@0`,0DPSp1S@-0D0P/-O-,EBMH`MV`0 0000, ``Jp0,0E0@ 00`o`⨤TLYs Y{ +/pr B>04@ltlH RnY 00$0S 8  ğ0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 `000LL0p4| ,',p6PPD`BލЍ yP P 00PXAB9P񟗈 _<`<`<`<`<`<` _<`4_\_<`<`<`<`|__<`_<`_ `<` `<`4`<`<`<`<`<`<`_<`<`<`<`<`<`_<`(_<_<`<`<`<`p__<`_<`_`<``<`(`  L & G % B L P B: 8 R5 $ 0  R B* (L @P# R B L @P '  (  )  *   0 0埒0  -$00S:@-@y@P-@-PP` U(0SP@P )@T \0@BT0T 4/\ 00'0S 0 (( @Ѝp-L& x vWO-$MPf@K 00[0SPs )P@P 83@030 4/ṿX(0S@k@XEPT[0T@6 0``X1000#03,*[ PePB RP: 0Lw@P6  KLp 0% D2 10Y0E30 1%Q _*0S \T\1)P@ PY 1@導1 ꇑp K@D;Y202 K 0 PEP H1 L05300P[0[PK PPe`P @P0`0 K E K  E@   @嗉%Q 40@PP0'0S 0 P0@$Ѝ*0S @-L&  ޅ -vW@-M@pP,aD(0SWTP )@T: 0@%0 4/Ͼ0#880 ᷈P0U.@P  '0S 0 |( @Ѝn@P %Q|0S0S P  00-L&  vWO-PQpL$M(0SP P^ u@'0S  pP@w$ЍW 0`UP\ U*P* 0`0  `?oo 0c `S @P U 1e*Ō>40U$P00P03S X 200301S%U#2QZ F*0U00S  EQ@P 00P@P0 0#  0|0S0S < @p6,&`0<0 0 p@  y@P! 0   k%U#2QZ J*0U00S  ETLP )@T @0@<0< 4/ý@P/ 005-vWL&- @ @-L0@'0S 0 00 0T Ѝ@Ѝ-vWG////\&/\& p0/(& p0/(& p0 /(& p0/(& p0/(& p0/(& p0/(& p0 /(& p0 /(& p0@/(& p0/(& p0 /(&Q P00Q////////0P/ R//A-`P@p0 P @U*0Q R* /0/&p0 0CSp0 S P0 /p@-P@,`CPp@ Tpv 0A S00//v 0P/!R/P/P/00p00Q/  /(&P/0p00 /(&P/ 0S S//@-@! p0/$& p0/ &7@-@PD@P 80R,PP׋;0  Ѝ0 ! &PQ 0S///& 03P/ E0 AC\ 0ABs0\ r CoS \S / //00S00/Э!& 00S00/dl!4&Ɔ ///@-@Hrs@P u(  @t&)$q-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P @0p@-@ `0PS  \*. Q  R R  ,  p 0 B##(&-qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00x Ѝ0S/1>3 !/0S 000/-0S/A-0p @RP:``S * LP`A 0 PQ0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-@0SP`(0aL T  $ T $ Q0@ 1pC !_0`0sA-0p0@P`MⰂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0T-A-`@0PS<0R"0!31<0S 0R0PP0S! !x000S!!!,p (J0PA , (0 ,P&$& &A-`0 R*S\ ]\ tpPB@T Um OP|Pp& R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00- 8 0 s000/`Q'Q!//(&A-PRp 0@S` * 9JP 0!k PPA-@P`p0 SV1 V00W W0Stt|||ċP 0 B 0  B  B " A A`0 F  B  B " A{  k`PpG  B0  BZ`FPpG|S`FPvA]p@-P@,`͂P@tp Tp訃 Q 00//ᨃ ,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0P`&$& &O-P 0R@M  P&   P 000Ѝ 0@  IP ЍO 0P  S @  0 00<00S*^Q000800R ]R00-R f0 S*]Q -QR\T0]Sh- 0 Sw:0S0086000S8^ 00000 50Sl`0rPr_S ,0Sd40Sa$0S^<0S[(0xW b 0(`c0@`F `@ oUi 00C0d-Q [QR:Q =Q 0pS: U !0R00`S0`000-S]S0`S0`0h4 R*000pBW R:0`S0`00 S<*R9 :R6 ]R300B  S0p pBxP 0w S<0R$ GP    sP  p$0  0$ 峠0S00`` 0R00`S0`000-S]S0`S0`0=  R:0`S0`00 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S- W0`S 0`00S<0W00Z0S Z4 0wGP  pgwp400!0pᲠ40 P0`S 0`0{  P  P @ [m 0]S Q^0s0  0  EB#ЍO܆ &-(&p@- 0@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@(&$& &A- @00P`\UC S:0S004000 p4\U R[U*U .Uy 0S0 S xlP JU @0p W1@p(` 0 S *R \R0)S ) \ W 1L  l0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  Ct % : 0D #OU &02U ! 0  4 000p0^0 0 0 0]0000p0S* *Q2  0  BN  B   B0B  Bu  0S> 0S 001006PX\QV {RS00<0PS<* ,R9 Q 7 810000 'U0 R     0 S *R\Q}Q00 0RR \P 0}S 0<0S 00,000$EoЍ[Uy`-)>{(&A-0@pp`?Q $0As R Sppp@@ppH^QO [Q \Q PUOO{Q |Q720W:0S00500 @0P U1@P(` )0 S*0)S  ) U 1L  0 S:0S00500P 0)SP  0  $  $ RK*0?S{S*C\Q@{SP L$ "!,Q  R  $  U   R  #  ?S m*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^0 0 0P 0]0P0 ~o0W:0S002000 <Q >Q qx9PP iS &[N L]{S0 PSp* ,Rm  1000< U0 R  !   50 S*}Q00f 0RL}QF \ 0  B_  B   B0S  BC   B0F  B 0  B;  B  B " A 0000S 00000-(&0S G- `M† PQPEcuPL@P 6U: pPp P P$ @pxp廀0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D z000Q R:0S005000 S=:  c 0A0CP  N00Xo p0 P>3S, 9S $S S <0R pQ00< 00u04|04040 -  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:0_0P 08 BB0U0 RB@ Q U B!U 1 EU, ^ 0C\!1LX0RU!U! 0>Q% Q% QS 00 080Se 0S  0H 0@0 @0x00 0  0S FDЍ0R 10C/TUU-x,Ee,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0bP`&$& &0p@-0PSQ@ʡ@8QD@ p<0S P pL0@0t@@P(00Ppp@&$& &O--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T 4P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'(&h O-P`p4@Q{ V Ѝ>3S% *S" SY SH SR `P SX SX 0 P =S[ S SG S03S S S6 "SY SF S 0H S &Sx.S$ *S S0s0S80 S xpPr80 0@r0s0Sx[X00>@4@505 P`F`FV0@0>@>0> ^0C0>@01>3 Sw 0O-4M\0@0(0X000 001( 0  |000_V_U0^00 0,e,v_V0;0  R" ( ZP $0 00`,G0P,vu00_PU0PSPU R  S0 04Ѝ(&O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0 X7  IS~ S F S 0>#0DϠ2@ 0u800 0 lX I0  0bP  0p @0P  0PTP 0PP@ pP@0<800p 0 3X G 0 PE >#P   0#W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  ? P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'(&h O-pP4@0s0 W Ѝ>Q. 0Q`$ Qh QS Qa pP Qn QY  0WP0 @Qs Q Q[ Q6Q QF Q@ "Qy Qf QQ g Q &Qy!.Q0 *Q QqQ8Q y p Pr8 /rqQy SY> EQ\QpGpGPu > j  > >c V >  > QMO--,M , *4 d0*0 0* (0 @ tw  0 `  0R   w0 Ra  R [ PZ   R    ``R  0 P0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pdX0w u r R ` pS0!u  vR q   _V_U P  ` 30v0_V` P R  R5   0$ 0PZ& 0$  v0 S 0 v0`  :` 0Pvu _PU PRPU0S 000S00,Ѝ(&O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ2@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--,M , *4 d0*0 0* (0 @ Xu  0 `  0R   u0 Ra  R [ PZ   R    ``R  0 P0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pHX0w u r R ` p70!u  vR q   _V_U P  ` 0v0_V` P R  R5   0$ 0PZ& 0$  t0 S 0 t0`  :` 0Pvu _PU PRPU0S 000S00,Ѝ(&O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ2@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  bP0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'(&h O--lM $PQ0W @$QR ``O     Q 0R S g  Z2,Q~ 4 Ry 80S0u SHPA@@@$P(P,PPP PPP9p "`!@03@0 Vp@& 0 kp@ kp@   Bp@`k0  PkkPk0 P.kPdЍk00O-1MM @`DX!D "( -p C.  PpV7@D;@8 (0Sp p p̱̑ 00Q$ P %0!pp@ t0!0 dP bP 0S Rk0@01ݍЍyk0S PEPU R  Pp 08D<4! @ P0 0o0 R 0+0h,R @P&1ݍЍhL1ݍЍ'tDFtHxtgt0@-P@M 0  PLp@ p@ P 0 0Ѝ0 Ѝ0A-@@`v0 PP0P! 0pp ppr0`p0j0`eVp j``ppY0`p0j 00p@-@PCM3 /@P5 8,p@% ` Pj0003u5 09{C.P F {@4EP @Fw^0@S VS 00 SCލp@@0Spj@l0l 0P@0 A P@1:j?0@0@{j0@0 @ltp@-QMP4@SMZ TE /?PB QP0s+ YeP :QaP 0`6pP @ 0@bqpG H p@ ۍЍp%0si/1p0" +r"i@0 P@0 4A P@1:j?0@0Vp04@j0#S.p@ i00iPi@Ph%@,D@-pP`O-$(pY,PS@`1U+00ï  07YW0 0 0/Y 0R0*V&G 00p&C{p@tp4 2x 2 BppwkP@r`Up@-@M@ <P, 0`0#L` QC<P/ FaS 0L@U/1 0S2 0 "#@Ѝpꫪ*O-((60 @`$M00@=+@ I\b-0@?o2S00/ 0 P 00d 0 uQS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@?o\2  y 4YP$Ѝ0 0sx 0 P$Ѝ0@Pa (P aP (P0 )P0CS 00}P P p R4000.P0S0 0S  00000S3 R3 t 0S( hRf `#S\ [PV PM 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#'XP(0S   R $ R`d Q  0d 000^#d 0^d 0^%0P"^XP 0dR  ^ P   Q& 0PT08<XP0 SE P\0s E`0d XP E ! 0XP E!XP  \0000 Q00SPT8< XP  RQE#XP  0 Q0x*0^q*{ r0s{P T80<s 0 XP !l '.%""""0S(0SO XP80@0 P0D: c 0  ]02   S.Ό  1,ώ$0 d 0]$ Q04000 0-0XPE0'0XP0!0XP0XP P1P0 P0 :($^0<P0$ 0=R%0h00H $@DL0c 0~]02   S.Ό  1,ώ$0 d 0h]$ Q00 40XPt2|0 P0:P0 0<R  $0h00  0XP0  0C0  BQ $0 h00$%XP @ D0 0h$% 0S 0000000XP00|$0Sj"xXPqXP0(0m0XP(0i$QWXP 0RPM #0\ !#/1x2 L$0XP2p rp t t BXP  0 R+ P(#R# & E%- R  \Q%8< &# &0 (0 0dRV$ 0$0 h00% 0C 000 00S P 00 $0h0 CQ0 @00D h00  0  C00 00S \0  $0h0 0$$% 0%#P # 0S !#/10s ad 0D\d 0?\$O--MPpb0k 0b0U`0 W  0 2c1000刀0005@P/ 0v> 0`0?d000P0?T0 00#?<0;0000 000P :0\0P@ 0TP 2 dP 0P0S}ʴ Rzʠ RwʨQt005 0Sd `0?#0S/" ES}> `00d 0b@PD0 E0@ @8 H0X`P`d 0p4 `FQ@ T PQvNNhh @D P[^0`00tx|\dPl`p@> RW S S|\5pTlVh0SdU`0S\0 R{z  RRzl8@0>C 0C0p0t R@ix0S a0pPt`( 0( \0:4PJ p'?0! P ό 01l"?! R1 R?U0v Po 0[T7v~@ pG0/ QPpp 0Z0Rl h Qh Ja 0  $5qp`P  0qp8a0S Z R@Q @T &a 00 ߍ 0a\ 4qp0 M 'pQ !'/q S=P9 RTP\0 P0,P0  PpJZP S 00@ `0\ m``0S0000 W\ ZR0``o d`T0\P0? T0K0\80? <0B0\@0? D090\H0?L0 00X\p0e `0SI O937'3gS:3ß0#cP,: *PIy03@P  刀dS_h0 [ZP 1pv0psX`@(@\ P`s3P ?/& Rß%0Q0vt W0Y 0" Q0P"0V#0,m`V10& Q#Ό3à\!=30S ( 8L^9 0( 0fqp2 Pq_#00_0SL <\|3 РR10"c01 2c1Zÿ sR _T00_0S$ 0_0Q 1&`P 2&>`\3à\&=3_0 0{ x0_T00Z_T00d)||lP)\(\ ףvɻ @-@ L^pTat X00 R 0 R 0Q/  /  <qq  DQ 0@-0P S@@H  ^ 0S  Q 0#0S0 0/зq qH  Q j.0 0#  Q/00Ɠ\ 0@-xPo> 0@" \ 0 0 /ĶA-@P `p@P@0% P PPA-`@@6S `pjNP@ & P 0SPA-`@@D0S `pH@P@ & P 0SPPO-P M 8N`P9 p젟P nP P @@ %  P P0Sp @ Ѝy X p V Q  3p0`0pS긴\XA-pPQ `@Q P 0@DDB(000S  눮w@- M`pPPp) ^ 0 0@0S ^0"S" 0p000S0 7/ Ѝ]0"S1Ds\0pT000S @ Ѝ1Ds$ wpv@-@ @O-p MWP  pp2SI`PL iMP@C ZPp G ,P 1P6 0nS# p= 2@P00Q Q P R  \0 HB"A 0 0@00oSp\000S OM` Ѝ, ZB@`UtO--AM M@pZ]L0 0SP:2PP  }SPm0: PP PC@@%0K PP 0Hp 0  00P: 0 *PP8p ` @P! L 0dSPkPU0 Pp` p| } (WP {@PP 0 PpR iLQ P  \00P/U` P 4pB\0SS  PAލ Ѝ 0H0PP0 p>  P\00 Z0l! 0 300\0D0 0\!0 3ا^0:&i\00 Z0~]\00 Z0sPqP\0`0  P0ettt[[zd@Lsr|rqrqqtqppp0@-P@M 0 P@ >PЍ00@-P>@M 0 P@ )PЍ00@-P?@M 0 P@ PЍ00-,M 0 KPЍo--0$ S   0/ 00p@-PU@p[?( ( 0P 5/p舱np@-PU@p[?( ( 0P 5/p$n@-GK@P 0003/԰n@- @P 0003/ꔰ`np@-P?oU20S@ 0 0 03/pD np@-P`UV00P00S@p$ P05/pԯmp@-PC?oU20S@ 0 0 03/pxmp@-P`J@Pp.[(@0 p@/(Xmp@-P|@P p 0 0 03/pԮ8m-@-M  vp@(0(003/Ѝ@ Ѝ/xl@-vp@0003/,lO-`$M ؤP @N0Sp$ЍZ0,P@@  4/$Ѝ茭lO-`$M ؤP @0Sp$ЍZ0,P@@  4/$Ѝk!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////DlLkHkkl(kkkkkkklkTk@k0kk`kjjjjjjxjdjTj@j0j j jiijN$0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0%0P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-@XPDMP@p, fX@ Ua @Y UT US PY,0  S#3@  57,050,0 Q ,0S 57,05 50RS#,00 B R ,0S0 BT,@DЍD 0, R3057, 5 05 SR#,  0C 0S, R 0C 0S , S3 500C55$0P$ 0 8X@B 0S1 `@@0 SS( S R 0C3@ 50 00 P, Q0Ç0,  0, 0 P4@0S8@Tt ,0 @S>3 57,050,0iQ p`FQ")QP*0ASLJIHGFEDCBA@?>=<:9765432105bQ1?Q*0S' 031 a< A01`00@t 000P, \0Ç0,0,0P`@ZfQ?X0@SfQ p h7xp@S H2p2 C cs3<2000FQ 0, 00 P R05705, 5 0, 0 5P R=305`7, 50 ,  Iv@ 1$01$0@@@0TSQH1=0A?ofV20S00:AoFVP\ P\=Q, R057, 505 ,   R,0 Q ,0 0,0 R *@V_ 0S\ @Z`@ 0PP `@ RF p h7xp@S H2p2T00]`@%#jo%#jx%ju-M{0{0 Ѝp@-P`M0@ 0~. 4/ЍpG-PRM^  `UpP*/a@,P T1000< pp Ѝ80S 1 000< pp3W0S ЍĠ )W0S 0 < @0000< @ ppW0S W 0 W 0 ꈞ\8\ TCD__@-$$@M ЍO-EM MaX@P+p `E* Y0P@+T! 0 ~Y0P@T 0 -0EAP  U0Eލ ЍV 0 Eލ ЍV 0 :]@-@` pMPP, /Y 0RP  rR' rR  P   P @0C-Ѝ0rS\ 0 @-Ѝ0 Ѝ@rZV 0 ]\dA-`@ p@ 0P/S /XP @0 Sp  0 S+ 0U@p@-IMM@`PP p 0: S p0 0rp IލЍpV@O00IލЍp@IލЍpU0@0(Xp@-IMM@`PP p 0: S p0 0Ap IލЍpU@O00IލЍp@IލЍpU0@0$>0@-P@M 0 P@ PЍ080Q 0 080/p@-@PP`  =PP u ?P  p@_*PPp--00 M (0  ЍЍ/T$--M  Ѝ Ѝ/ -- MM<P 00  0 ЍЍ/$0-@- M@MP  Ѝ@Ѝ/O-,M `@RPP00:A!0@00Ppp0 0CSD PY P@ 0 @cYP vM!,Ѝ0@-@0M 4& 0Ѝ0 00 $p@-`@POMpp p@ @-80800M@ & 0Ѝ$p@-M H0H 00@` %Mp  Ѝp@kЍpD$0@-4M@PMp %@ X4Ѝ0p@-@PT T  0M` @Lp % =0Ѝp$C-,M pP`PEUP0R@@t0 0:2 0U @P0 @T L#!,Ѝ0@-@0M |% 0Ѝ0 00 $p@-`@PLpp p@ @-80800M@ S% 0Ѝ$p@-M H0H 00@` mLp  Ѝp@yЍpd$0@-4M@P\Lp %%@ f4Ѝ0p@-@PT T  0M` @ALp  % K0Ѝp$ Q 80 @-l880@08 880/880 00<P 80880Tl/p@-@0@00S 000 X t0PP  `00A"/L00p@KP,V $PPO-t3M0@ 0P 0 `0Dp@ P P00U tpp0 0CY 2ATT00  RG LD@D T]:[ 2 00p0`K K0 V0 W8 P2ATT 0`Fs 0RB zK 0  0 B0SH fK@0Ѝ V0& 0  TK 0 0pHXB0SG 0 =Kv 0 B 0 B@ 0 B  B$K`FtZ  0 B  BK 0 v 0 m 0 0S J00| 00 L$p@-@PJppp@ 0RS00 /p@-@<0<00P  @Jppp@ $808 00 Q0R00 /|$p@-@`PJpT T   p@pp@-@P\ \  ` @JpTT  p@p$O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KD Œ Č Ȍ A`| @p4  W R ? \ QQ Wt ,0 000IC11E00Q00, Ũj Ѝ0d0 00{p$@-000 000 @!@P80@080L@-@@P80@0800-M  Ѝ0-M  ЍO-ϟiM QP@qaԱ  2PX? `K͌U !P? K͌T P> F͌(1S P~> F͌(W P}<> C͌ V P{= JB͌8[ Py= ̌1S Pv`= ^B͌`0=@ 0S078 H0P `P P P Pd P@ P( P P@ (P PD (PPt PHT PxP'( 4Q780L0x100C40S0 00C,0000h0000a0P06 ,0P0@`U 0e1P U.0q10 `00V0q0 `V, 0U @ `dp少Wl` 0 Z hPiߍ`0 1 S  ,00 0! 1S 0D 0| 0>p00 P ,,0$ 0 @< 8P!P H, $  B @ 0S% 00P00C1 0@S3 00 Q!1 p WQ  pXW,000 p0S,000P$0U1p㔠 0 W Pp~80Sz004 0R003180A0S@@X!0@< 80S00!$0P 00S@@@@T'0S0 0 ,00C00P0X00Y,0 0CR0@,00`0QQT d!@YP0 p00 W0 pW0T,00` pp少W䰍 0 X mP0080S^p!f p!:|rQ R 81 R 0S ЍQ  <00 IDh0 T  ЍdUԾ,UxT@0h0  S/SG-TP@pᨤMk +(@($pT 㠻0CS0SX3㢻D৻P 0400/($$ ଀膃0尀:p㴀%LȈ㸀͠x胟H pp8At`l@Ãd\X(TPPLHxD@<84($  h2101:|@ R 0S 1q810S \ЍQ  x20 dCh Jh@ \@  00(PU(p0Ѝ>A@<^v8#:0'#J #H#p--ݹ`_ڹ|׹oԹpѹrιy˹zȹ{Ź@|¹h}㿹xU(,h U!S+!%,!-!.%0%`&i%j%k %l%m<%n#o#s%t$%u4%v,%w%x#p#rd"ye"z`"|R@PRA-``_` p @ 0^ 0(`V(PPO-pTT7 L7L00MJ]070 P0\0SZ  p p P` + pS`H\$ 0` s 00bRS 4S 600/N 0 ;0 $Q`B`q 0 ;0p n 0S,0 04 0 s 00bR44 $S `%5 0Ѝ p P`1  4` 4 0 s 00bR 444P500/1QP p lR Ĕ P $ $ 0d0\0S0 S 4$00`e pg |0`@ `00 4Q0`Q40NQ  000r0  cR$0S0I Sz= p? T0`@b p6 0 $ A` 0 s 00bR 40 ; 0Kp P p 40 s 00bR44 $RT0`$#0 0Ѝ0 ;0(p4SL 0`@  $ `004S: 0040 s 00bR $4S4!SY 0`@s  $ `004Sc  20 2"00`}` 4!4 0 s 00bR L/o 4"101!00#?ca p 02 0s440040 s 00bR44n40 s 00bR40o0 00#?c0`0040040 s 00bR44T00S \ \ t0t0! 0X c`c\cbapaaAQ,_(^]]\\0$  0* 004 44/[O-T4P8 `0$Q@DMh v :Q{#R3Z 300S 8 0P0 @P`@-@=P% H=P 5PFP0S)[P& mR R@0R0 1BqQ;RS S0 CmSr ;S R R0 S0S PS0 C;Sr  QR0RR p O-0tSp@`Md`Z|P YT0ɍ <rr  00bI|"0R 3S(0$00 0p1:PK?T0 ᦱTH&:P ᝱X 0S$$ $ 0|"4`0T 3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 8PR t3l2Z& L[# `P P '0`ᖴ ᔴV 0H5S4S 4S0?o2ၴ8p22Yt2 PV 2t22Wx2 P/ x2x2hЍ0 D p$l h $ <%$(fW ~<P2l2Yl v<Pl2<l2Zj m<Pl2?;~0l2Y b<P1x2Z Z<Px2?;~0x2T P<Px278x2W  E<P<1t2Z  =<Pt2?;~0t2T  3<Pt278t2|200S0X0  rr WH|"R1S00 4S,^L%R)TZ8p2@0t2e8p2,0t2Z@  x 0 00@-0 0`$pPpP `@`@TPxPX@l@ h` X 0 0lptx"| @RܢN8 80 00\ X 0//O-\ M`p0P@T \2 !0S S0SXT Ѝ 0 C-a\` M Q Ѝ |Pl@P QR  PK 0, R 0"0 Ѝ 0 ЍPq 5 P Ṱ P GⰐ帐 少帑  QL8<0<0 0G)A-P@p>3P @P `D`@D0 x0"P0VP@0 j 2P p@-`\@PU 0S1 RU0S@盲0@Sʕp@蒲G-lp@`S0 SV0S"Q0S 0SVC-@0M0`M@P0 0, @S@ @ jJ~ 0圐†p 0|" QU 2 P*  YTۍЍ t;$JI-P PM 0 R  * 0  Ѝx`0 Q0@-@L00S :T g/A-0 0`0S :#pRCq# # P0@P: #C#S# Bn0:#!Bq##訛 -L0LM0 0\ 0ʌ   , ЍĚ8 80 00\ T 0//lp@-P$|`p`@0@ >0SP0P0:3S 8 80 0\ L0:#pO-``3 0Xs0T*PL3B0` p (VS p p PO p   r  `R  01Q @R R3 RV@ X `20X2 `mpv  @R `  R i \  lp P ` @q lRQ 1 X6N @{? ` 0  S, q lRQ  1  ?p Boq`R s0 00#?c s 0\0\0 0㝲<  |EEEEQDP :(p@-0 0P@ :QQ t|}à Ãpp#PpT :ip舆@-0 0@ :QQ σ #ppP`, :QЅp@-@0@P:#R  #Rp @8 “%\8 --  pp#P`p:pp8 :,$@-<@<0@00:3S 00 D @-8@80@00:3S00 @-0 0@ :Q#Q& " "" "`# \`#"p\"p#ƒMP` :Q蠃p@-@0@P :Q%Q( ,"t \\`p` p#P`pW :Qphp@-@0@P :QQp!""p!"h#!h#, p p@#* :ԁhp@-@0@P :QQp!""p!"h#!h#, p p@# :0hp@-@0@`P :PQ" hUh“\ ƒƒ pp#P`p :Qp茀h@-@ MZ!qQp* c0 |0 `00004| 0000408003 Ѝ| 0< 403 ЍT T0 0`0` V:`c3^P`@ 0 000:P/x~@-0 000弱D~T0T 00:3S 0@-pp*P`/~X0X 00 :3S 0-pp@- P`/}$0$ 000:#Ro/L}$0$ 000:#Rq/}000 000:#R o30/|(0( 000:#Rq30/|0 000:/h|p@-P0P`M0@0 0ssp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp8|ht@(A-RBP0@SMu QP 0S `_ 1 P00pp̿p!1L  0Q`11p0S0S  st100S0S  g030pp) 03, pp.C$ЍP Q ` *P  0:# 0` `x   000 00p60 0@600,(L{(ht@$L@-,@@0S500%@-$@@0S500%@-X@M@ 0S Ѝ< 000 00(60 0Ѝp%,@-\@M@ 0SЍ 60 R0 0  60 0%@-DBD2@P,MQ :3SU0b3pp`1)0Sfa` 0SP1p0SA d0  B0)1`00|PR 1 20 0Q 8G 200 X20M0 E :3,pp0 P`,Ѝ0`00|P   50 R0 0 50 0.500D  8 20 0wT$8$lp@-@(M0P 0@ @$@żU8 0X`@ @$@庼ؼ<0`00:3S Z 㪼(Ѝp t 0 000:3S/GtT0T 00:3S 03@-ppb(P`/pt@-<0< 00 03, ppP`t@-808 00030pp9(P`sp@-P0P0@Q00 |P t0 1d000*npxP 00 1(000*C_phslp@-00 P *C T |Ppd  10p@*=xPp,  10*Cp@0rlp@- 0 @P0:R P( P PpQ 0 10 pht\ L0 10p Qrl0 000:q0S,01/Q'0QϜ!0CS Q0@-,APN Q (@0 \0C 0S0U0//Q'0QϜ!0CS Q0@-,APN Q (@0 \0C 0S0U0//\ 0,  B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q>@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@P!80-^\ , 0 B\ 0 ^O--J3dS0 dMbWSUa 3,p0CQ?8 <3 Q7SA0:pP8 , 0pŦ3S00P 0p3@ 0 00p, , ਦ3, P 0 0 0%  0RdЍ|B0 9dЍOh/O-*,M0pP2U 0! %@Te ` @p$ $\TK):0`SO p 0 ḥPP,Ѝ@`00S S> S0PV$0S-00 04S,ЍO>0@0S A0Q  B20RP 00C 0P0V !00C 0 10PS  P0@0 C`PQO-DM 4P3 S-0S*U= 000  0@ 000@'%Q k@` p PJ @0S 0,PЍDH P 4A " 2  0ЍP0Plg|P0  0 /<  D0D M000S :P Ѝ"Ѝ/eH0H M00 0S :P ЍЍ/e404 000S :P /0eH0H M00 0S :P ЍЍ/d404 000S :P /dMDD0P  P 0 ЍЍ/Hd@-|0| 00@T 0J#4R |B0pQ 38@-P @@c808 000S :P o/dcD0D 000SP:P4@//c000 000S :P /bL0L 000S :P @-p @/bA-0 00pW* Z3$SP! #R`@4Sp`3@Tv A|B0tQ 7A`-(b-0    h@a000 000S :P r/aA-00 0M` V$ p @0pޣp   ϠPP 0pңp@   0-@Ѝ@`P  P ]/p@-JP 3S P`4`30PV  0s3$ S"0姡P |2 $R 0X0S 0L3 |20X #$03p03ppp(p@-jP D3S @P4P竢30@Sp@褢A-`P\ J3S%sW" P>@P033SĔ S*/W 0B@ ^0,  W0p,030!C  ! L! \0|! c0000WP3PSSpP4Stpp3PUpp@-@P PX0:|"C0T0XppG- Ѐ\-P@p  `BP LTL!VW R T VW  H000S4080 -0 0\xO- M0@DT  =pߢPP5P( -U9 ЍP&` U$ @P  0 -0 gh `  @RYd ` `- Ѝ Ѝ0 -@0@0[x0@-?S0P  0pP0@X p`a p@^`  00PP@Z0A- Q@PP% pW# 0 0S0],[000 R   R   R  P FD4@`T `TX *P Q Sp  QW02%Yp@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S OT00SpX@ |'(@ 8Q 0@0ppp@-Xa@P`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0pGp8VT0T 000S P@ ?# Q @ $080///T$(0( 00Q0/dT$(0( 00Q0q/,T$A-T0T0 0PRp @`?`,GHS$T0T 00 R X@0|78@08Q0@0/S$0 00 S$0 00(R$0@-P0P0@ MT X0:|20T1S@0?;@0c@000080S@078@0u Ѝ0R$P Q@0?30R @080///RY/R/p@-PS `0H @?DppP X @0*|"7 8@08 R 0@0/P@/'0@-P@PP M X0:|20T1S@0?;@0><000080S@078@0 Ѝ0Q0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/pP0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/O@-M @0@0Ѝ@%N$@-@M Ѝ@p@-l0l 00 Q@P00R ^ p@ p@,N$p@-D0@@ 00P #pp p@M$p@-P@#pp p@p@-P   ` @#ppT0 T ^ @ p@@ M$p@-@`P#ppT T  R @ p@q@Rp@-@P00S ^ p@yY p@rO-`$\0\0T   81S 1S @0<@0/6S/>$< <0 0001S 00 @0<@0/=$d0d M000 81S0 Q @ ,@ Ѝ/&RЍ/X=,0, 00001S@0<@0/<\0\ 00 X0:|20(Q Q @0<@0/6S/<$0 000@/<<$X0:|20(!R !R @0<@0/6S/0 @ /A-@pP` P~ghP v@000T 000S0d;T80  /404 0008  P//:$T0T M00 0P RBPP0T Ѝ/:$8 0  Q/0Q0 PBPPT //,0, 0000P/P/9,0, 0000P/P/9O-X#X3 0@PU @300SPH0,SPQP0gPEHY ppH`HV, 0 ^  1  !!V%`FVI@Y*p0S a 0qZ,0 0D |000 P0VpTXppGWpIYX 00C 0HXP qPaTYO`IVIXa, 1 \  0  !!$Z`Yp0Sa0Z,0 0D | 0 00P0qpYPY0 0CPbY0ISh9x0P0/ 05$0Q /p@-PPp`@T0A(, ,1C BA00T00PPpP 0S 0@//P 0S 0@///// ///O-1!000, S 1H`?c``PD % AAp0@!qW0 8 0| 0Yp@W0 0C@ P @ 0@40 003$T0 ?o2R0S P/( 1  //l<-(^,0R0SQ!R@O-A1 0@ 0MR03p P `ࠟ, @ 0S" ß#SßI00 0C ```P  (0R0 (000 0 0C00T0 03/p 0PS@  00 Ѝ2d(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P^ (0@SpH0@-0\  @ 0 Q@ R0tO-P M@ZU``J0S2  P0  B( T0P0 S `-, 0 !S Pp0SᴀK`Dpq0 `| 0"pP Ѝ0 P0 00 S RP Ѝ,ٕP e,0ҕP 0X p 0 ``F0,0C,(`aaA0  0 U  0p0E4婕P  p`, 004@J 0U` p0EpPT   PB  0SQ 0 0QPC 0$ 0\R R 5PT 0 B 0C G-8@P Pp5 0PUPAP0S%X0#P 0 `0UPV`C ` 00 RF `C`V` p[ t1 $p00S9 0PAP807`P,! R ! P3 ! R. ! R)  R 000U+Q*P0 `0U0PV`  `SW Ѷ`x0 @p 0 $pXPD0U0P`W`PEP,$PQ@ 0 00 $\ / 00S0/d*PQA-a`eڤ1@pP0$ PZ 10 0 QT$ D 0R U E]pM D10 0 QT$ D 0R U EKp; 0D00  Q P@$ R U E4p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q *$PQA-p0p`@0@* $ PP t@T00T  0Q@J((P/ 0S, 0@- \$@T\8x ƌ8 t @,0A0@PU 0P0U00 S00/Q?XA-$@0S00â?P2 0\-@ 0T `ApB 0S#0^ 0S0pW F7@ 0 0 04@U/80Q@0@080/A- p0 S B0@( P`0,,0A0C1!0 0 0`S@( X0@-8  PE? J0R|B8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M 48nڌ`pᯑ@Ph 儰到ᨑP,c ὒPP0` Z4$ 0 X01800a0 `X`F$pT`   @ H | P <L06 t1\ 80` d h l p  ЍP47 l P; 0 Q" Q 0IX   pp VP PʮU Ѝ@ Ѝᐓ @ ጓና@ᆓ ᄓ႓ @ }{ yw @ A-0QM@PP(C p`QAR   B P1 \.X) P$,P4PP D0 D0H0RH00 p0$`P!b@0RЍPЍ!@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@q@ pHP^JU`^VMTPDD    PI tT1D00S*Y `$@(D0p0S0`@0,0U00 D0U@pC@`C0vY Ѝ00H00H0|  P PEPh T IPIP Ѝ0P00x$0@-@l0l 0 \ B/oM "0  mPP 5Ѝ0$@-44@M00 RЍ\QP-D00M  ( @0:Ѝ 8 /00@-MN  P@N000 0E DЍ0O-A-PUP5P`0@%@00?C,5p 00TP 5 5 0@0@0@0  00P 4 4 0@0@0@0  00P x4 t4 0@0@0@0 00LP ,4 u@ (@ $ R@0@@0 0 (P !R 3 Y0@ 0,@   8P !R t3 G0@ 0,@ T!R   P ,3 5 @0;@0  00P 2 & @0:@0  00P 2  @0:@0  00 P x2  @09@0  00P <2  @09@0  00P 2  @0;@0 004P 1  @00@0 00P 1  @00@0  00P L1  @0 0@0@ 00P 1  @0@0@0 00P 0  @00@000PL1S0  @08@000@P L0 } @00@000L~l`pxp@-P@P0@P006Sp0 pG0 0p@O lp@-APQ@`Q }10  R* 0  0W pp!R!  Br (00(!C R$C1Sڸ0J @Tp!Rڸ  *d2 00000S / @T *@TUpx00 QPڸ0 Pڸ  4040 K @T` x -M 0ЍC- `?PpPEIP$Y/ P@  N @DT`F࠱V HX $ P 0Cp@-A1@`P0M@00 !P Q `Ѝp ( 5x! h!l1P 00TtP1 0@00@0P5,10 R00S Ѝp@  0P 0 S0 0@00 @0 0P 00 @00@0 0@0X P@00 80L * @08@0P ~lxp`A-@`PpxTV,1 @ 0 @A O--x/x? dM$ 0*#R$P/@ T<  ( ` (`RP(080@80@V @ ?0S{$$?@> 0D000D0 R_ (@AD000h0S80@0800 0S4$ P>0(0 RR, 00s0S^H 0"( @ t@T,0Q0@t@T<0(00S@0S  (  R ( , d HXL L,T,S(0 040,100 180<00,0 10 <$ 0p0H |0D00H00_p& 0H SL0HP1<08 0,0000c,08 0Y0Y 00S0S0A0P<08 0,00 1 1 01IY0Cڸ P0D00 L  /o^" R 0YP@r00PPP 00P P p, 0 R S R  0\ ɟ`V0JZ 0Z hp   0R A SwP  P  `p P V  0R  `9$00S\D QV 0C00 S40( 0S(00040 0 S(00 R4 000:3s L  RL   000Q00 0\,0(0s0,Q0,6P 1 11RY@ڶ  R5 8 r  ` qH$0`V 0\S0JZ @ J  @NN Œ Č Ȍ N LL\mɟ`V@<p80bT 0P TD0D0 R 0 R PP! YR *Y7 $R  0E0| xp0  0E n D000P $ 6  ZD0@00!R 7t <000V ! B0C 0$0P=X 0*1d"0p@5$  y 0@P`< 0P8, Tp P$T000 @0pI 1`11QUm 00S400 <0pD0 P X 0*1d"0p<0V @ 40S pV0A0 0C0 R d1SDdЍ 1P VUQo 0    g#$ R 00S0 ?3lcQ@APL`@ 0?3T 1HX1QEP @?0D000L00@ 0@0@00 XX0P40L0P S @(080 x <00  $,20 p`dЍ80 00@ 0Ce00S1$ 0D000h0S(00S2<0 (0 G0n<080 @0 80^R00C\0Rʗ@t( )0$ 0, QMp! <,\&`@VP  xtHDНl V@P P0,p, PQPJ q <@,T`V@ V@ P0 , PA,\,P Y AIa,@IpE ! W   P  X,00,0Q00 , BCR4 R0<084 00C, 00S<,04 00@0@0 0,00400 00 S` @f` P 0, !Yp, 1@S  Y@pL _P0000 00S000 00 0S 040C04 R00CQ8(0 00, PEuK PAj0, \ p(@0 <00  } 0PU@`0V0S 8Q004CQ0V0F0<00DPB `P | <0`0PL W H3 D| p|4$  D0@0 0Q2 R/ dP,  ) R d1S $ 5  DuPp:U U6` p 3`FV EPEE(0,,P 0E0HDp0x 0E ; D000P DVP0 0 : ,0R<00,P 0 apC0Y 0C040| & 0&: 0:6,080@40 H 0SX1!0aP0S00Y0SHWMW)0 S, 0PU00P@8 J , @DHTH J@ P0E0PE0PEQ!  00 00C,0X<00,,0100 0R0<0`0,P0,0 00000Xڭ@W 0 CD0X0 <000P`]P41 pQ. S4S Yô4SQX H5S4Z  <9$p@ 0 p_D 00p0 pR00P;  0D 00 B0 0p p50 0p{0 p)(PP p0SM 4S 4S Y00ôQ0S9 L5S<  :$ @ U0   D0 00pG0  D000P \ 50D 00 B0P ) 00Q0@000 :0D000P  T P" +$ <@ 0    D000P T<$  0 o R! X <$ @D0 001S X <$ Dp@0 0L5S 0 0RX D=$ @D0 00LXDpp 0 0LgoSPk4SP 0 00@D000$ >@ 0 pC0p   *D000ȔY   j0 {\opD0 0HpTXPy D00 E XP    p|20 1 W0!Q:|20t0`1=}Q,00S|20l`0 80!Q:|20hRl0 *s0!Q j0!Q 0y`l/p@-x0x 000@00CS0 S p0 S P00npPp0l0p@-0CS@0 S p0 S P00PpPp0p@-,0, 000Pe{@<ppp@-P[{@2p@-|0| 00@0J0Q P R, !Q0000$0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0PQ`@ ){pP 0 0C S{sp ,0A10A1S!000A CR  (  \ 01A K" R T 0 0 0J T0K0 00Y?3 0Pq fwPP| 0Y0 00 W0(@p ڼ T D H0W D@ 0 ( 0C P8b$Ѝ00$ЍNT0 S80 E 10@ @D  BT zp`$ЍHȏ$Ѝ 00C! [z @ D0 |0p H0K002 [ @T @P0  H 0 v00 P00 Kr R0S0?@P5/@T YЍ H\00r R0S@0刀0@P5/@Tꄮ|TQ" @-@ RM !R "R pPĜ\  00@XЍ/0Q " @-  MS S PpP$R (@/Ѝ/ܫ-4M0 Ѝb @-P000M, PЍ bȪ0@- 0\SY ^S9 %@@ ,S'Sv{cScXÁ0@4Ÿ^C110N0000q0}00%@000@0>Á{C0q)@@PA 00@S801pP00A 0@@100CT00C0q S\S:S '000L0d%{tꀪ|QO-M  r\PP 0p p00047 000R0pp ` @ 0,R6Ti \ 0@ 0  @ 0 0 Rg  QS%R +0@GSSQPNMLpoIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! > 0 SWt} 0P0Ѝ% 0iP 0@  `fv`00 0 "!.Q *Q0 0 0RZ@0 S\%p 00 @ 0% 0dP 0@  d 0 @0 S 00  00000 0 C@030 S`  00    0 0 C@00 Sm\ %p 00 0%@@c 00 a 0 SH\%p 00  0 % @ @@+c0 00 0   / 0  0 000  0  C00 <   0 @@0D0 00T0 S\R$ W 0`C0@ T$<0  0 m/> 0000   0 0S0\S 0 S0 ꌧ|$x p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp)0 WWtW`8WA-@0MS0H0D!0@p0S? `$ 0&!1Q!1!1"b2cP0A @ 0L0L  00210BP 0 pW$P@WP 0fSPЍЍ 0 0Ѝ NgA-@0MS0H0D!0@p0S> ` 0 1 ‚0  @P0P0A 01! 0120BfP 0 pW$P@TP 0nSSPЍЍ0"0Ѝ萝kL>C-@0MS00! 0p0S2 Pe 0g `1H $@0!b4!b H1c$a1c0@` 00  0#3c`10BP pЍ 0<0qW X $`0sSP p`VWT 0S lPp PPЍ-?L*S0 O-LM l >oPG $0$ 0g0 : 03 @PP: , @P 0S  R 0[ M #[ =[ =`P` s000`0xxtpP-  [Vp p  RR _pP X,     PrlV ml0PS&q H0 1$ @ 0d#ds112cp0@0L!112c0A0L0 30`b1a`@$0Pa `0```@$@b`Hp, `V @Tp@l;=0 P@@0 l0`VP00LЍ`# 0%!q0ƒ0p0@ 0200A0!1 120BPH 0`0@4` 0L1N $@0!b4!b N1cq1cp0@χ 00  0#3c`10BP 0tS0cS0S``d0@0` 0 0< `0S?pzl~N,gݰ|kL>-?L *S O-@Pp`0\ %\0pS sS lS@ 0\TT1DW 001 CR0@CUP$O-ϟqM pQ P`P? 00S040H $  l0H [0   RU0P G@T %0%T 400 R,B*Ph p 4 @@TP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+pnP" 400p,1S 0C11ऀ R 3400@ R,*P 0 p 40P4qߍ00f0\!0D]SAA t~x|{|x!00D R`@0A?S@:T00 Ѝ@ Ѝ/IF Ѝ@ Ѝ/ 0p@-S@ 0000p0000  P 000p@-@ggg@gg g0g@gp@-(PS@:pS fP!pre@- ^fR^ @T nR sR^00 \ A- `@V pfS@`V P0P@ 0nS sS@`V@00 0S00@PA-P# P 00`|pp ,RR    0S,S@BeP  | xp`p@hG-P@`PeP 9pWT*nUK sUB fUH0D Y#R= @DfP H0D@pH0@0 H0>H @0p nUH P5 sUD fU< L00L0@P @ZP00pY 00 ,00 d 0S0000  0@ SH0 $H00H0H0@ HH0@, H0@0H0(H0, 0H0($PH00H0 ,O-@M PZ p pY ` `0( 8000H0004dP2 0P   0pPPZ P   P P` Y    ` ` V S0P@M 0@Ѝp@-1!000 @S/ 0SpQ @\T 0Sp Q00pPUp:`AoobEU@@\S@@ T 0SpPx0Uppm|A-`p PPU@R eP !0峀0 0V0pp00000 00 0PcO-P0@ p$M 0\P `e`Z5 | >@P   G  d0P  0 e ` 1 @@dP e $Ѝ  ee0,@ T 0(0$0,0 0 0W  ``R P00 jPJ @Tle0L`@VH0@0D0L07 fS,  0 0 @P `V  @0nS sSW@@ )e $Ѝ$``@H ( A-Pp ``V@R! ,dP A0峀0 00P00 0"0 0 0 Pb0A-P pW@`R cP 0` 00P 00 0PqbO--0LM< <*<+, , 0e`P |Y@P0|0&PP00 zPT PU :PP\cPL  P U 0&T 0 , -P 3 0<*$0 0 0* 0 4 Q' 0! ".Q  ROQ> = @P pPu< <0 Q4 Q 0 0S, P Cd LЍ# PP3 @ p@t , R 0S00 R 0S TR C `}$0pW %S$  .c$ PV $p j@ @R^ /p@tP 0Qv Sq 0R 0Sx @Q 0p Q( 0Po )\QPaY'%pWp^QpWq p`W  P( 0 P'0HS3u  0Pg c LЍ0AyPEA/P{yxwvutsrqponmlkjihgfedcba`_\[zXWVUTjRhPONp~z`Q@ Q, @  @`, p` 5 pp D`D P R P PX0 T RC t0 U000 00Pn0}p``$ 4 80p80p `pp pp pp p ( 8080pppsSt 0 S00 P!`ß0 AR ,   0 80T80剑T0IY【`B 000 0 0s0 _PWP p@t p@t? ,0 Se Q0S ^ Q; 0 c40 0P+EP0 0 0 0 f0 P P p@t  < 00RO0 R0K Q| 0?WpMp@ 0 Q00 0S00 Pj  0P0 0 < !00 00P= p 8Pf< | P D H  P/$P00// @-M@00 20!1l!1"b2c N0L 0 0@@0#@B!A@C0PЍ赁N g P0`0K?//8 @-M@0 0L B0  N\00L 0"2<@0#AB@C1dKPЍkL >$0P00?//L @-M@0 0L@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$$C!d!b8A@C1MPЍ-?L*Sp p@-0P0M`2a@P 0Ѝp[00  R 0S"0ЍpPG- 1 !0 qP P@3 04 S0`0`2,0WPP00|Q``  EVPeȄ`EQ  :V|0`0ȇ`H00W`h@-@P ``` `$`,``,00!R  !H 001/001P//P@--@ X@X0@0@0s H ՄPJI HH @UDp@--(M G7@` @@PR~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{UF{{!00 (Ѝp0P0 P 30 0U f {kUkax!00 0P0 ~P L30 0U 0"P  0cP0J30{kUk 0 wP  0cP0G20U 05{kF{{bPr  0cP0t20U 0x 0"PP=  0cP0x0 0U"  >P?  0cP0|10mU ! 0a"1"YJ'P2  p0cP0%ژ 0U"  R b0cP0$d10U 0"P1"P  P0cP0$10U 0"1"P   >0cP0@00U 01"0"P@  ,0cP0@ڜ00U 0 0"P  G??TUD    X   Gl ( \0cP000{kF{U{ 0% P  0cP0uڠ30{kUk 0 Pd  0cP0\30{kUk 05 {P  0cP0n30U 0_"3"iPH  0cP0L20U 0="2"WPS  0cP0ڔ20U 0"t2"EP  0cP0EP20U 06"\2"3P9  |0cP0 20x{U{ 0 "P  k0cP010g{U{ 0 PF  Z0cP0ڌ10U 0"\1"P  H0cP0H10uU 0 PE  70cP0k10U 0\"1"Pa  %0cP0&00U 0"0"P  0cP0ڀ00U 0"p0"P   <LxGl0cP0(,00U 0"@0"P  0cP0l00 00U"/ zP  0cP0ڰ00 00U" hP  0cP000*{kRF{U{ 0 SPr  0cP0`30U 0q"3"APf  0cP030U 0"83"/P  x0cP020U 0"2"P  f0cP0Wڔ20U 0H"2" P4  T0cP0HT20 00U" P  B0cP020 00U" P  00cP010fk{U{ 0{ P  0cP0ڈ10U 0"`1"PP  0cP 0<10@U 0' Pe  0cP0Z00U 0K"0"P  0cP0ڸ 0U" 7 P  0cP0qt00 00U" zP  HGpx X  $ 0cP0_(00U 0P"<0"RP  0cP0h00 00U" @P  :P  00{kF{U{"00 t3030vx30 3U""00 aH30@30 3U""00 Q30 X3U""00 D20{kUk!00 72020 2U"$"00 'x20p20c 2U"!00 @20} p2U""00 2020 H2U"!00 1010$ 2U"p|!00 10b1010 1U"Gi!00 `109X10k d1U"Y!00 (10 01U"L"00 0000 1U"B<!00 00400g 0U","00 00   X  \ H \ $ T | h P @    l 00U"T!00 bP00FX00`00.htp00N |0U"!00 I00{kUk!00 930 3U""00 ,30{kUk!00 `30vX \3"ZI lI  3"U"00 30{kUk!00 20{kUk~!00 20Sv"00 q"00 t20 0h20 0A ~ PI : S@ Z"00 U"00 P!00 K!00 kkD!00 ?"00 :"00 5!00 0"00 +"00 &"00 !!00 kk!00 "00 0Sk !00 {0S6 !00 s0S !00 k0S !00 cP  ]0S !00 U0S !00 M -DT! @ X 4 ( 4 ( 0S "00 50S !00 -0SV "00 %0S1 !00 0S "00 0S !00 0S$ !00 0S !00 0S !00 0S !00 0S2 w!00 0S  o!00 0S g!00 0S _!00 0S W!00 0S O!00 0S G!00 0S ?"00 0S 7"00 0S /!00 0S '!00 0S !00 0S "00 0S !00 } 3H ";}P !H H  3"0SG!00 c0S  !00 [30 0c|30 0u"00 N"00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &"00 !"00 I tI "2"2t0 0Т2T0 0Ǣ240 0ྡྷ>20 0ൢd20 0ଢ@20 0࣢20 010 01t0 0 1T0 0I140 0v?!00 X10 0iQ410 0`h10 0W70 000G 0II0p0 0@ ?0 d h   l h X ` p  ( ( p 8 L 0P0 040p0 0.X00 0|00 0\0 000 0n0 000 0ء180 0ϡo41X0 0ơ&X1 000 0มh!00 10 0ડ10 0ࡡ10 0@2 0008 0H2 000zl 0| 20 0s20 0j"+SH0@-C @AQOQPPP 00 QȠ\ 0 +CA{ 7G 00+C03Q Q 00A@@1 0^XnA!0k+C{6F{7+S 0+C0 ( / /P 0S $0S 0S P? @4@P//A-Pp8`Q) , R0( 4", 0R40BV@1@! GV @D 8,0400G0, 0 40@( 0 (3/P840, 0S004R000@-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0$ R(400  0@=0U 0PE@T$0S0  0@4=0U 0PE@T$0Sx  ($  0  88 (90,K  @Uv 0PE@T$0DS, 0 D0@+@<0U] 0PE@T<($(<,00@000;00SB Pt<00 00CS:0S ;008@ Q;0(0 S0(0@080t0 8904;0U 0PE@Tx0S  :00;0,@:0000 pC0 0,0S P<@@B0S 0*S3 W 0PC000000 00 0 0#1<0 S@0@0R0 RR<,0 0PUS0S00)9 0 <0 30DЍ  R S R  BP>0 P 0pBS 00 0 C0 S 040U 0PE@T00  BR00S  \ 0S0($<,(<0$(0 R x80090 00 80B4 R,5@0 000DQ1  P !ADL B \000D0S707 UR00t0 0P <@@b0(S0 ʆ  P<@@ ;TU 0PE@00 S  SP S> 7威@D00@T80PE@TULQ60 Q H0 @S0 0CR*ʆ+R h6006000LQ`D0ʆ;460\0T 00T :0PE00@SUld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@Tz 0Sw 400d50Uu 0PE@T:0ʆD+1 0D0@D8+Ua 0PE@T:ʆH ;0 H @D;8^Dp840WR Up1 0Wp!WC 0 0C 00 00D0PE0CD00*Dpl `R*$0ATU% 0PE@0 0Rl @Dᨁ:R (0,00C 8 P0l00X0S>0p0P0?0X00 p0tP 200L30 R=0 U 0PE@T20H?o20$0S0G $d2r ($B0#22cR<0S 420020 0L$Q   R D Up1p!W(R0 D ! $ R D ! $ R$!  $ R40,0000 100HU  PE@T  ' !X$ 100T100+000;8D@Dt00 R  B0 D  0P00x)  6?7?8?=?>?N?O?5? P?#M?$ H?A?L? J? C? B 9?:?;?0@\4 @Dʆ+8_,4威@D0F D0B(8<#0#xpW" h400,40:Q  ;8D@D _ 0;=04HL0  : 40040 0@S4Dp0I Z0PE@ZU8tgx|p@p ⨃ ^':l0wp 0:00pZl.  0S50P0;T050- @D{5威005@D0 :@z 60050@ 00l(4890 (8(8:0;t600T606l 0XZk0PE@ZeUx 0C00Sd  0 7 0pe41q岠pT*US 0`4`UU PE1q岠@pW0`8@DQ{8D@D,8tgx|p@p㨁U7L0R0 PpC% 8(890@+Z\8@D 0w@D(38l0R0 0 0P00<0@@50 0`pC( (0R@D0+S(0,80080 0X0S>0p0P00tpXp040P40. \9008 (892 TSR: @3 0@0L9@0l900900 pC \ p dT 0  \ h P H:000 00威@DpCx:00:0 0S:0=0 pCwp@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  . +0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000Pi@Pp`W2@ R2Q <00 0 0S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S3# R0S  l0pS0pCp)x0 00 0P,04F0p0 p0 0 0 30 Ѝl0Sl0@@@Rp S??? P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPw@ 0!(`3/PPp 8XG  ( 0(3/P00@d  Q 0  `!?P S>0Rp:oRS B P T  B T p X0Bp  (08#!8Pp 0BS.  p 00@ Q 0  ` P S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?00@C/O-PM@ @㬰(0U 0C0 0$SP $Cp`0 sRpW-(0p p0Ѝ0` Q`V00p<J\S 0W0T0S20b60s0P0U 0 CP0S 0SCU\! V ! 10T2 0 T 0SЍЍ0D?o 240%R00S020,0@0000,004@0D?o280(00<000 0 0 0C$0 0S03p@05 :^`033N , %0! '05 %0 %!0(P<90C1P RP@00F3 0S C 0 $Q Br R$AVG  ` V$  \ F Y( V F(*Q BR  BR^ : 8 Q  Rc4 %Q  R]<  BB!   S @1@ <01( 00 040$0$ 0 08@, 00Tl O-DMX03 0\0300 C  2 000ӗ1х1&=  tx l0J B0x t HH^Hl0:8HpXT`!Dp4`ᶐH@ᰐ00Rx0 Pl h`0 \0S8 B0l0\000S\ tDP`ux0l h Rl R010#P60 6SC \0P8 B\l0\00PЍl8  Ƒ R0Ƒ0Ƒ !  h0\0P8 B/l0\0|00SЍO-T $M t44Yl08H XT "D 4@@QH 0 , CA/B BP`&P]pƈ0Cs00&#ĠƘ@ph# 0C s0!I.S8# 30җ1Ӆ1&=  `tQI Y 6R06t0l0080EV` l H 0U#@H@0 Sl \P8 B0 l0\000S$Ѝ8ƈ6&6 &!9096tl I Qtl 1Y` +t1QZ 0S Q. Ql0mR ,l0`h@A p400D`H0` l @5!0 PH0 ` 0 ll R1#:\ 6S \0P8 B %l0\0r0P$Ѝ\0P8 B l0\0`00S$ЍTO- ,0 IY!0 M@pܴ0UWZ0c&P* U! Ep:\l`T`F Z PUP!Y /ooW"Z  [ZW  0u0 #4 B %B B  0BV V`!0\ 8  \  0C  PEU``\  &Z  BP 0 P  `QP ,8\t06 A,0l06\0 `QPl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \6&S06l0R, ` 6V`!VX\, Q* 65@ 0CP!P 1RW G/o"S W  R  PR#P`1`!WH80  D\00\0_Pl<N^ Al 0i&lR &&0R8  0C W6,AQ  l00l0&l8 q, l0BP0l0\P`1`!W 80 \00\0c  PR#P" 0S $0S 0S P0X*SES[SgSqSS9 C0//O-PM@`?o2P0S{@0S0v S t0Sq0,0S$ RgL0Dp 0CpB *,0lp\p v`FP0*SUtpWR 0s ,00VpE*0*  00 P  t0S!ԥl8P pLpD@4H0P  ;. 0`RH0`0t0l t0Sl  l \  60 `h  00Ѝ* ЍA-@P 0S $0S `PlpP l0t,@0S@1VTU@80C Mpp@-@P$ 0S! $0S H`PP`0 S0c``,0S`  *00 00(0p`p 900,p@-P@P pP,0L D0<00 B@C 0\ 0 1 0|0:l@\@t@Fh@H@x ` pp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:`k6 @cU@ĠL Â0 6PUWtPPA-@P P 0S $0S p`P0p`P|0A-PQb!Tc@pTeAP0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟0P 0 X  0@S P X 0S\\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 03 0  0#400  0 w0S0c0?o20 Ѝ0So = 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm q00010S9QI Q0t0 0 0  R 0,0S0Q0Q0$ s0Q0s0R 0s000 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00Q P p K 0S  0PESp p W *PG 0 ,0 SR0 B0Ztp 6l8&`6&6 &!909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\070P0S P{X: X(0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S00ӈ R01q 00 0SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0 0 ,0 QR 0 0I000S'  0 0S0   0S,0SQ9: RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:T R+0 B0o00,0S!  Rg  S 0 Q10S 000#40H0q000SE 0 B0:0#  #800#"0 IQ"V\ R8 C0 l0\000Sjp\tZ(l 8`pR B 0 ^L 6ƅp6ƅp6ƅ!9096&tRl0A0tl0 Qt QX Q Ql 8`p0  X 0Sq0 B000 B000,0I ^ ^<00 Y Y Y Y Y Y Y Io^ᩒ#Y0C0KS`00`S&ƅ&p0Cs0 ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 090[DB:XF 6S \0S0,000A  l0 0000 B 0<L0DC0C t0S*l0\06\0S8l  B0s l0\000S(10 \0SSQOMKIGA-@`pPStPB T00V0SI0S: (0sT Q 1@0@!A00000 |0 `jp( 0S*t l00\ R$6S S L D0 BC (060@D0 0!1 0Rpphp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pSz $0Sr wpViV`F0HSr0FSRnZ WkFoY㫲[dV @!( `4/@Pk * @ 22)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fx00$0h(0 ~ Ѝ@ @0  000'-M 0 AЍA-P@APUPq 0`0@ 0S  00 0x!(3/@PX `!@@ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/80S. @ R+ D PR% , 8 , @@ L DD  0 0C006& 0&;> 0$0;/ O-Q$M R0  \ "r !#4"  Pp Dß` + @0 *'@$0z t %q q{0~ 1Q`!;~`0#:~)4~P(>6"r ~!p'P% ` R ` ! 8Ÿ0# s !P#4" Ÿ " " r01P"$#00# " r01P"$# 00#0# s !P#4" P% 0# s R#4 PUS@h RR.~0R$D. pR$.0#s0A0R.$ pAR.D$0#s00R$D. pR$.0#s0APE.4$ pAU#D$ 0 @  P   "r !Q#4"$Ѝ\ "" R !L /Ppq؋  x L ȉ C-`R! p `  0 D^00# PL  "`@18P\0 C @$! C-`R! p `  0 D^00# PL  "`@18P\0 C @$!( @-@Plp`hPp@` 0!đQ0 0#B  P @-@Plp`hPp@` 0!đQ0 0#B  ą 0@-1@4P\0 C @$!0 RG- ph Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H.7cHN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq%R&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /qR&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /q/ᬔ U/ 0`0/e68ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O- |ş pjDMWP@TĆP4Q @Q- NP0P4 \ˀB XS-ʨ&σ pPpp Q-Yp& B&^ ScB C 00 p&P4 À fXQP4 !\˒0C`K P4`ˀXT$`; BXKT$T;!P P PQ͌Q- 1^ 2r6w|&A `{6P4pST.0J`@T41\0 Ѐ0 00P 00 p0 !Z㲰_Q=0ⵯ00 PQ !  W Y ^PA ׼V БR"S & &  R[P- Y> 0 Ό KK0RPKPG 0 QR0C Y> 00 B 0[0000C01 KR  00N 0 @ 00T00s P\ R @02^02N00 R0P\DЍWP 0 [Q / !@LY0S F0GC#6pQ@Z p J  =A-P@^1RPA@D0+}n@R- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O-pMWPP00RF@ʀ+m!k `  Rp: W1 R5 Q^pp`0`0p#406 R`c^@F v0`h7W@Hs`s0p R`vpWk @P0 [ЍZ㼆`f Zv` !.0@ cR(r C0` P`P`0P`#4`0f`fTfἆv`0Pc^h0v6v`@``@`.0C0nU6~ BSr Y3@s0P0P00@#4PP06cR.0C 6W W~  @[P0U R: 0@P0dS8`s0000`#406@D@0cUSFuP TcN0~ Dt@P@P@ 0@#4PP06 c^ 0C606 @0P@cTh0v@6v```@@`$D@F0C0@dUD6t@ S1 Nr 3@s0P0P00@#4PP06cR. 0C 6| @[P0`ἆ 6 Br T@PFgX@uPF Br C0@6[O-ʀ6k^pS㼖Mw 4004@0030 0300300"10` cy Rwwppp p .0CnV~pp~漖6S&00wp @4  `! Ḁpb W zp&z帠 B pp't pv pgXw&wpaY taN~bpiW vp&v``` Ipp`&d`v pg^w&wp0CS㎀aޕbޅಐaᶀir^wwp` pp p"$ InX~pp~漖 `#R~ `d0Cs0yb ^wwp@`pp`p. BnS>sps6pS἖_0 c Q~P~"`kNPP!``0C0aR! 6Ѝp἖8p἖p἖0k. 06Ѝć 6@-S k>@@0 #400k.06S0k. 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&ʀA-@k`P s0! Qrr  pp "$pp &bS1 B0&u 0  u0#Ġ  <##4U0 0    *60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-*k΂6 Sq@q;0PP@0@#4PP06c^ 0C6 S0Ҽ60k@PP@0@#4PP 06 0C6S S00k@@6 0C6006k>@PP@@!PPƂ0O-p0@S M,0S ─&]P+ (+%0 N. 0r?010S@P j600&6 0!R1Q  S030#Z0Sk0 r Y9s00 00#40编0iR# I⼖r0(+ ,Kr Y9s0k0 00#40编0iR# I⼖r0 Yڴ 9s0kΆ000#40编0iR3 I⼖s0 Y @r 9s0k0 00#40编iR! Ir漖D Mk> ! PaR, A   / ! YqqP἖   00`" P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 00G. 0R0 0xS0   0LSI>W&&&& Ѝ ЍO0 &k0p R2 ʸ006N.V l s000 0#406 cP 0C6s0漖@q9s漖9 9s0漖s0漖 ~ 4| y :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  Tx p@-@P`d0P \0PV  D@T @̱ 00@p((@ yaratcid@-M @PoЍt@oЍ@-M @PЍe@c@Ѝ@-M @PoЍT@oЍ@-M @PЍE@C@Ѝ@-MpP` @P 4@Ѝ  Gp 1Ѝ$0@0T 0p@-S P@0 C`'0@FT @p 0 p0A-S Pp@0PC`'0@FT @000p@-S P@0 C`0@FT @pͽ 0 p0A-S Pp@0PC`0@uFT @豽00宽@- MP Fp 0S @p0@Cs'`VFV ` Ѝ葽0 0 Ѝ芽 Ѝ@- MP cFp 0S @p0@Ce`1FV ` Ѝl0 0 Ѝe ЍA-Mp@P `P 4Fp (0 0S P0 C4@ FT@ Ѝ;`Ѝ60`0Ѝ/0@0T` Ѝp@-@mPt0PPptcidp@-@aPh$0P p!00ploobp@-P`!@P   @[p@-@?@@-@9@@-@3@ @-@-@*@-@'@H@-@!@W@-@@u@-@@@-@@@-@ @@-@@@-@@@-@@@-@@@-@@8@-@@L@-@@e@-@@}@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`u@P   @pp@-P`c@P   @pp@-` PP@P   @pp@-P`>@P   @vpp@-P`,@P   @dpp@-P`@P   @Rpp@-P`@P   @@pp@-` P@P  { @-pp@-P`@P  i @pp@-P`@P  W @ pp@-P`@P  E @ pp@-P`@P  3 @ pp@-` P@P    @ pp@-P`@P   @ pp@-P`@P   @ pp@-P`|@P   @ pp@-P`j@P   @ pp@-` PW@P   @w pp@-P[@b(0P p'0P 0pgntsp@-P`@P   @T pp@-P`@P   @C pp@-`P&@-HP p:P U )00ppatadp@-P`@P  d @ pp@-P`@P  R @ pp@-MP@ d0P @Ѝp  +`P  @P`[-Ѝpgntsp@-P@ (0P p0P 0pgntsp@-P`)@P    @ pp@-P`@P   @ p@-@R  @ p@-@"P $0P p 00ploobp@-P`@P  # @ pp@-P@P ?#@s p@-@"@@-@"@ @-@"@$@-@"@B@-@"@`@-@"@o@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@@-@z"@@-@t"@7@-@n"@P@-@h"@d@-@b"@}@-@\"@@-@V"@@-@P"@p@-P`@P  k" @ pp@-P@P "@ pp@-P`@P  I" @ pp@-P~@P "@ pp@-P`m@P  '" @ pp@-P\@P a"@ pp@-P`K@P  " @ pp@-P:@P ?"@s pp@-` P(@P  ! @` pp@- P@P "@O pp@-P`@P  ! @= pp@-P @P !@- pp@-P` @P  ! @ pp@-P @P !@ pp@-P` @P  {! @ pp@-P @P !@ pp@-P` @P  Y! @ pp@-P @P !@ pp@-` P| @P  6! @ pp@- Pj @P o!@ pp@-P`q @P  ! @ p p@-P_ @P L!@ pp@-P`N @P   @n p p@-P< @P )!@] pp@-P`+ @P   @K p p@-P @P !@: pp@-P` @P   @( p p@-P @P  @ pp@-` P @P   @ pp@- P @P  @ pp@-P` @P  c @ p p@-P @P  @ pp@-P` @P  @ @ p p@-P @P y @ pp@-P`{ @P   @ p p@-Pi @P V @ pp@-P`X @P   @x p p@-PF @P 3 @g pp@-` P4 @P   @T pp@- P" @P  @C pp@-P@. (0P p0P 0pgntsp@-P`@P   @ pp@-Pz@P @ pp@-P`o@P   @ pp@-P_@P @pp@-`P?@ HP pP U 00ppatadp@-P`y@P  F @pp@-P`@P  4 @pp@-PV@P n@pp@-Pg@P ^@pp@-MP@| d0P @Ѝp4  &`P  J@P`(Ѝpgntsp@-P@[ (0P p 0P 0pgntsp@-P`@P   @Mpp@-P@P  @>pp@-P`@P   @-pp@-P@P @p@-@Q @@-@R  @ p@-@0 P t(r(p@PP!0S !p; !02@-$@@ 2<2[P 0R @-P Q ko//$  0S p@-P`@`PPpwP p@ d P ;0 o@-0 \ `] \ @-P Q @&@ @0@ a0 Ҳ( (0( b0 ɲ] \ T\ \ \ 0\ 0  @-0< ⹲\ p\ [ m0@-P M`0U! w%@P 0P0 `  Ѝ'ppp[ P` !R  @' ЍH '|Y/@- A%@P $0 0 0 XA-pP .%@P ~0 0 0 ٧`%PP  ᔳP `0 000 ,0X <@dXZ |Z Y @-@P @ te-@-M(pW ,P0  Pu@P$`P  0 Ph UЍ@Ѝ/Ѝ@Ѝ/ 0 0t Y Y X E( @-@P s@ 1"p@-@P x0 00R0 P$0P Q 2" p@bppxVض p@-@P `0 00R P$0P Q " p@pU\ P/0 00R /lUP/<0 00R0/P///@U 0P @-od  QP  QQ !/T\ P/ 0 00R/dT@-@P \0 00R  $0P Q !00,T P/00 00RP///Sh @-@PM /o000"P R Ѝ R0 ` 0 `p#PP 0 S  R L  ^ `PP &  00dSz t h @-@PM 0 00R ЍQP! 0 U pp #`P 0 S d P % pP` %000( (0( $0 ⨰hRy pT TT S + P -/o<0"00^ R  R/\QP/D0 00R /@-P ƭo Q P/D0 00R /@-P oPD P /ol000"\ R RP Q  Q /PPа İ fP 40 00RP wt/Op fA-$0`SM"P@U Ѝ P0P "pP 00  0wP S % "@P d0 0 0 @Ѝ4 PSP  (N 0 //p@-PQ& @R 0Q: Pp$ P  `0` `0 ಯL0L L0 ય808 80 ࢯpQ R LQ `Q R ,Q P |R Q p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@ O M $@-@P@M p@-r!@P  n!PP 0, 0p#@#p@-PQ@` 0 S S   CQ R 0 S S CQ\<S0S !S0-S0F?o 2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ CPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0``000 0pL L0L H0 ⛭0`tC  >R00plJ I H P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- BoO--l1KM0 ` 0p0:Z 04A @ Q, [ uBPP 0P3/P 0吊0  @04/P 00 0 PhPPKߍP@ 0@;/ 0 @PPKߍG [G-@,PPD aq`p@@0 S S   CQ R@<S,  V'P   P'P   J'P0 S -S@0-S>Q@@0 >SS @S@!P@F F F !A-PRMePp`0 @T- 0@0W   W[ 0 /R C 0CW /RW  CW0  B/Q !@C@T@!  ;@04D.0 0ᱡ  R0 *( 0 0Ip@  5U Y0@5 7R0@ۍL? 0 ۍE 0 ۍ S05p -6P+6D5p 55p%@C C-`M]P@P5 ,|5p`H 6pB pEe0R:p#0 `[X00s5p*  R00 0HXp" 0PPЍ0 `8X00P5p  /ЍE5@ Ѝ|6 @@-@ p6@ @-"hP 0 0 YdA @ ? O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`ga P0 p 03/V@ 6/T gT T @T@. 0S2 03/P V 6/g0S @0 R 2/0P`g P V 6/X3 003/Iߍ 0 0C/ު 0 0C/ժ 0 0C/̪ 0 0 ê 0 |0 ⺪l l0l B0C/ⱪx? ? > T? > = 0? > =  ? > = E> p> p= ;> h> L= p@-P@PP  P $0SP  R Ppd?P P VPP , `PP`= ( < P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0aP 0 $ \00 Mߍ R00 0 0K/; t; P:  0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-e@ d {L p@-!@ (M  P l  ```RP(Ѝp<  P h(Ѝp; \: ; $@-@x @-$@@.o\ 4p@-M`P᮫@0 @0Ps0*0 00 Ѝp藫0"Sp@-M@`፫P0 PAqp 0 00 Ѝpx0"S 00 S 0 P:\03#/S 0 P\0///A-P``@P (pP  @P s.W@(0( (0 è 2`8 8 d8 00 S 0 P:\03#/S 0 P\0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00R0 /P/0 00R / 0  Q0 R* R0:/- ^ : P *0 S0*/@@/ / P0P $0 00R //d/P $0 00R //,/P $0 00R //.P $0 00R //.MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/|.P/l0 00R / 00 0  S *0/ ɒ\* /-P/|0 00R / 00 0 S *0/-  ^: T-P/|0 00R / 00 0 S *0/-  ^: ,P/@0 00R / 0 0 S /4,P/|0 00R / 00 0 S *0/-  ^: +P/l0 00R / 00 0 S *0/  \* /P+P/l0 00R / 00 0  S *0/ ɒ\* /*P/|0 00R / 00 0 S *0/-  ^: P*P/@0 00R / 0 0 S /)P/d0 00R / 00 0  S *0/  R* /l)P/d0 00R / 00 0 S *0/ R* /(P/h0 00R / 00 0S00/ \: /|(P/h0 00R / 00 0S00/ \: /(P/T0 00R / 00 R /! /'P/h0 00R / 00 0S00/ \: /'P/d0 00R / 00 0  S *0/  R* /&P/d0 00R / 00 0 S *0/ R* /(&P/h0 00R / 00 0S00/ \: /%P/T0 00R / 00 R /! /4%- P M /o<0"00^ R Ѝ R Ѝg$P/L\ /  JQ\/h$P/L\ /  JQ\/$P/P\ / Q/S/Q\/#P/P\ / Q/S/Q\/D#p@-M0 P000 00S Ѝp$0@S `0-S 0S0xS hP T <P ЍpwPRP' Ao/A-PP@@Pp t0,p0P4080<0P`p @e@P@"V@-/@ K @-(@@2 r(!ᶡⳡ@-@@O-4@T `,@@D¤@`T PpQㅑ ┡PZ P PZ  0 0 4p& () & z @-R 0P< P 4Q ,  D D0D @0 0 000 0 ( & % ct( L& % p@-@M4 00R<SP,0 S R( 1`V9 P` 0 00P 40, 0C40P0 `ЍpS 0 0D ǣЍp ЍpR t t0t 0D ⯣\ \0\ X0D ⦣H H0H a0D ❣' % $ a ' % t$ & % P$ q& t% ,$ A-@`,psPP W 0 !ˤ,P0`,P0`G-@P MpP  0`0Ѝ!0 /`P (0S0 젟0 $P (0S$`V00  0P 0S  `P  P X `0 uP A( (0( $0\ @! Lx l$ l# " K 0  @-0 |$ " !  0  @-0 D$ # ! 0p@-S `  Q P@20@,p 0  0 ֢ # D! ! {p@-0S h`@`P}Pp7P p@ 0  0 Ɫ묔 (# (" | 40@-S , 0C!40R @J@ @0@ <0B/◢, ,0, (0B/⎢" !  " 8!  p@-@PP0S ,  Q <0 0 p@`@O-`p@40Sa HP@ P 2P0U9P 1001000`SZ 0<0S 0  R 圑 # 00R&P P [H P P P 0  03/P PP 0 S MO 00CS 0 0PS Px@` `0` \0J/ۡL L0L H0R/ҡh P(s  |   $    D@-@ⵟ0,S<SSPG-J `P0pUIU@* 404 SS= G000,0 100,0$ 100,0, P  ?o 0 2\0S PP*    0SuPPPPD D0D }0.R, ,0, (0.Id      G-PP& 0 0R!p~4z`P 4 R @, 儡ᄑ! ,04 儑@ 0T:80#a`80P 0  Q@-P80080/p@-@PE80080p@>p@-@P 80 0R@ pP04@-p p@-@P \0 0R@ pP`00S@#:p5@A-@`T |0p0WPP X000L000A0@S 0< p p8A-`P 0 0R4 p40S @40S,0 PP@ ppA-@P 0`0VpP0S P @T @ @0@ <0R/K@@   A-PP /o0`0"Q@@T 00R pt @P @T i@ 0  0R/0   O-@PM 3` 0R PЍ4 00R80p = PP @`P .ЍSP ڜP3 i 004Q\ a4[_ P,10Q1 0P0ZUPE Pm 0P !rw 0 ,0傁1`4 <0 04 <0g !,XG<XIXK`PUF ء0  K  ნP"  C 0,S<SSLPP ,0P`<04 0<0v100 ᱜU.  ,P<PP_! w,04 `<0 0P4 <0P 0 0^/-h h0h d0^/$!P P0P U0c/dx p   l  0 H  p  G-@S ` VP p P  000 Gs 0 0i/ܞ  ( -0P M ?o@2 ^0S Ѝ00 S Ѝ @-PP M @1 0R Ѝ`@ 80  Ѝ BP 40 Sp@ R(*,P  C!Uv400C40<00<00.h h0h d0s/zT T0T P0s/q@ @0@ <0s/h4 L d  H(  | J  X I P/?o0 2 R0S/00 S/0P -?o82 ^0S 0 SG/\P/0 000R/P/0 000R/ P -/o<0"000^ R  R/p@-P\@P 1P 0 03/P BP @^p @WpA-`P @P&pP $P p0P  pAWt+ p@-P@PP E QPP p0@@p@-@P 0@-l @-@0P P 0R R@-P0S /2o/808 80 m$0$ $0 eD      O- 0S7 @` P. X0tqPprP 0 lP  fP X0UUUB!#1<00@.B,? TP@HPOX% XP0@#r 1 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ᩐ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pτ80 0 @ 0 048# /UUUU3333  -p@-PQ@ : S d S V Sb00Z r0-0w-!- R00[ >R-   @Rx  : rP-Pw-P  RG !R-   Rx  r-w-0!@ T8 T2 T8 Tx 0    p Rs   ! Rs   0 Sp00  Sc00 ?00 S1  Sw00 Sl00 S  S  t 0 T 0 - 0 h0h h09 ˎ: SqA00ua0-00pd00ms00j4 p H G-0 mA耐 0 x $ C-dd"d2dM 0 P%L\Xm P`` 㔐嘐圐堐夐 P@p@Z xp  8p@e 7,P  $(0p@] `0<S0<0x0@S<00<0@DH@-<|-~-0e- <1<0 00L000.0-X %0S qp@   J@ЍOoBЍ@00 ˏ Ə   O-PMp 0GW"S00`0v@P-TPg +T@`0W ?  00  P p  ! @00Ds \a0DSW0DA0DS70DURY :Q P   S  R y "000R00S0S R Ѝ0pS 0F00T& W p p0@0`K0 0R 0 Ѝ0 ?0 g00XS00 C R @0 p` 0| A BRWf p poꙙ H  0 0 074O-PMp 0GW"S00`0v@TP-TPg +T@`0W ?  0R~0 K~ P p  ! @00Ds \a0DSW0DA0DS70DURY :Q P   S  R  "000R00S0S R Ѝ0pS 0F00T& W p p0@0`ꀎ0 0R 0 Ѝ0 ?0 Pg00XS00 C R @0 p` 0| A BRWf p poꙙ , 0 0 07X4O-M8@P' 0 0 00㼀@$P,`(pD 0W xPxpPpV W XpX`p`LPPD``F00p||Xp@-@PPM& U 0`1S ,0S '$0S   9pЍp@0@ @<0 (0( (;0 ꜷ p | L @-@P 0S$  x0 P @0P 0 0001 1 00w404 4<0 ฃυ 0 踵 p@-@PP% U 0`1S ,0S ⹄$0S ⲄHpp@0@ @90 (0( (80 | H ȴ $ p@-@P w00CS00 PwpZ P0 70 U, --M  GЍ Ѝ/ -- M0 0:G ЍЍ/0@-0P$M R P0@S&  S$}x0  B!  0s $Ѝ00kx L000 0 PS@$  XX B p WP 4000S$/00//W8 dW C-SRPQ zWv0!010 ,t 03zl #P \0S  S 0 0 &0 0 &H0 0 0 &0 @ \S 8 lR8  85Qd p | P  $ Pؗ P P A-@P`p0M- V6 W? 0 z0 0 0P: @T@T 0 pPP -0Ѝ @'P0Ѝ 0  0yVd d0d ` 0yWH H0H D 0yPꀙ T 8 ( T Ē ]  ^-|| $M! 0 0 0 (0 0 0 30$Ѝ묍X-xx $M! 0 0 &0 (0 0 0 30$ЍȌO-p `PPM  By0@"02 0  0B| ^ aB\WBAB\7B R Q AL\  &QIDD(00 D0S0R0S? R0*@D T T0@Ѝ T:0 0 }x0p D TD [ R [/ :` 0x 0 \0\ \0 xD0D D C0x n\ ( h h Ȓ 0G-l@P?0 @RP;T !3*.0q0000ap ?p??`0 S Q#20* 00 Z* 0U0 R*Q * 0U000?0R*00x?Rp1?p#`@0 0S ?0Q*:00T: PLPHPDP OOp@-PH@H0@`M000 @ЍpTX@-@PM 0l   00@D  5QЍ$0$ $30 wN t p @-@P(M $0 0 0000000 W<P !\ 0" 0(Ѝ( (0( B0 wꠐ M $ p@-`P8M@P ! T* U3 40 0000,00(00P$0 $<P+" 0# 08Ѝp 0 0 wTt t0t 0 zwUT T0T 0 owy 0 4 ̏ d  ܎ t  O-8"82 0TMP0L00`w Vk  0 00 00 !8 xPPPf @p㬱 #0 p@P< 0+S+0S(( P,$ 0  (2 P 0$W,$,0S 0 0 L0 30-TЍ0 <P  : Py 0 p p0p Y0@ vT T0T X0@ v}M h Ș ` P $  ` 8 O-!1 0pIM010 lWX %PP[ @`| 0 `@P; 0+S+0S({ P  0  P  r0Sm' 0 0 1 30"Iߍ P sP vx 0 D D0D 0P Ov먂 , ,  0 0/G0@- 0 0MPP000@" T* :0P ""  0S0 0t h0 0 0 30Ѝ0L0L L40 vT!P@ ~렀 , p 0 @-!1 0FM M@P0d40p/ `ኑ fPPd@"ᝑ+U P w0@hw @Rh \0 0 d4 30Fލ Ѝ4 404 N0 u/~$ ؈ p@-0 0hM@P0d00`P ; URX P0 0 d0 30 hЍp0 000 h0( }uH~}T @  S8R8@-<@<M@ /0 kЍ|D( 0P1Spp//0@- 0 0M@P000P# U+  @0@  "" 0S0(0t h0 0 0 30Ѝ0L0L LF0 uU)PP | l| 8 G- M砐 pP E$e{P;0F W08p;t0' T CdPP!  T0@To0v0@mv@  z 0 0 4 30!܍+v0@VvU@ 0P PnQFp x@|`*${z 0- M Ѝp@-0 0hM@P0d00`P  ,X P0 0 d0 30 hЍp0 000 0 nt zy  P O-/? 0M@Q000] 0Se d@@P 0\@? Pp la'' ` - `& `LPe! Pdl";h@Xl>4Ol!`m `"t fa\`&:p, `(9PPeQ| PTpxp2/͌7aQ&+ .* PP%`P썈5_l @$)p'paq,p`aq'p` 6oh, "   *a}:` @$@ @%hQ  P hQ%P 2/g @ @.h,]a>8 @gA!+*`&@ "$gA$,  ͌g!@pe! 7  +o&(```)) 6/`*`&* ``. &.`0*$M*l*8e, (e.ࠠ( ` (d,:+eQ ! & `_+P P&_%(`4  $&,` _&o%8 p'_+'_'(`` p p Po&o&`&na ,`  d`& ` dQ **PdQ%P*]@an!O n,mpeq! pfaσeA&n@σp'eA$ 0@菠Ϡ?/( @/"/"$@0,4)(@(p(( @,,@e1,,`Q&PʟP%0n_`A.`P@$=_`aA.m@$`c1_aA#@$O$'0 O$O$O$ fQ#@OP%a@_)0% @$+@_%+@'_%_%` PfA _@$0_0fanA (P=@$an!`O(_O%_%O$_% O$,_%m$Pc!_(n돠_(_%_% (fa((ꯌ c&(ꯌc1`&0(nꯌ0`.(`0`ꯠ*((***<=돌(a.*` 믠*($*( m*c1*,⏌a#* 鏌f#୊a.`돌f 0 !돠/(0/"?"00$(,0(/(4 ?j! fa "? #(`))<`?#?#0`?#ono80j1.j`0#-揌a1. 0#b! a1"0#όa?Ϡ#'o'p`4,++(@?#8?#?#0,0,,,Dp p୊`" ,jhƟ`1j? nፈj1 naa $?`n1aa`?j?/#0@ `/"4@?#?#蝉O#/" @! "0%0 ?0%0?S@@h pA0hV@Hp` 70V@@p`F ApH H0H 0 o, ,0, 0 oq pp q lq Dq p p@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( !oTH H0H D0( oep p do o |o o o Po 0@- 0 0M@P000P# U+  @0@  "" 0S0(0t h0 0 0 30Ѝ0L0L LF0 nU)kPP Fco 4cLm o n G-pQM    P0E4e,P;0F Z08C;t0' T DPP!  T0@To0p0@p@  y 0 0 5 30"Qލ+p0@pU@ 0P PRhQ@Rp p@`ba 0- M Ѝp@-0 0pM@P0l00`P # *X P0 0 l0 30 pЍp0 000 0 n`t`Ll j l {-0 00000{   #EgܺvT2O-tM0@ @P 0\@ 00 '` 0 ,40ʆh'0 !80ag+, 0 " (<0h+l[!h;P%PD@0eZg[a "g; D0 l l˃b;% +0# 0HcpmvmzNS.00@0i;h!@kd00@ +NDCDGDl˄@ dD@ `` @*mČƌ͌3kˌf+"d n , Th++KꭠᕳKgK0᫷K)e;#hˌg 0뺠cP1d{荠fa" a,fk`Hhekb( b,e[P@]a[h& h,aa4bf% f)b+ L@+IᕓI@嫗I d <*h+@h`i+@@de! p@d  p'e,pg|nlɠ\pfˌa "p a kfk`8iK+@@@nh *ꩠn@ @$@fi @lekb{,pe[b{'pg}0Pa{@lK&@alK$@DPdIbKf'f!b+ b-`l+g$lˁg. 8fd"fkd(hd`gb.P b,g[PdsXpa{``p[d[gzk{Tekj ,``!n(dˌn!h@  kˌ `g4m+K╳Kik૷Ki  ` k aLbhK%@b+hK$@X,MnKe! he,n0hhX0f+d@0 n;0a;$0a;#0cC3C7C`;0n;,0#dKl;%0# 0Lc:nne;$0#0<;+Al;AAld.`( he8PPh[PUjPj[ " b)g+,P(Pdˌb˅aP,b[Pn[#P% P]dK\UPg[pb[c+( "jn隠hfn+ih{$p' pHg}c{c;0 ,gH P+K╳K⫷Kfk`fl`kd.,P% P0dc<]ha[<0*ad hn;'0# 09dKg(,` nh $ T0 \$ g{ g+id+.g " (h d;h n+' " 빠dKg{(p'0ph$dKP:nPnP( fkꪉa` tЍG-`p 1?@10@Pd00U0T?WP@0P\@0W*U@(PU(pG  Ggh  ch C0dW*0@-P@!1 0 M0 000" " " ? @ aR a# #0#4 B0 T  0E,̠S,ĠD 80 0 0 30` Ѝ0@gvDdP CQ- 00 R- xB@-d K@4  R  *4 8/$ t0 S@- d/@ 4 *8 R РS /0ZxBM Ѝ/+S$# /0/--M  Ѝ Ѝ/0  0c  8q8pPb b`(00b0PPP#Pb b`(00a0P P P @daapЍpЍ'W(0( (H0 >e, @B8e I |I @- M`]tqt1pP@P`@@T 0Q P Ѝ$ d]P @ Ѝ@ X]P"0S- -S?@0 0000 P 0U 0SP0+S@@D!0DSX .]P0S +S!@ ?@!@pI l<I | X ?P L0P00 1 R/@P/!R/:(0 @>R0 00//l:@-M Pp @f`P`W0D>S 0!31000 fЍ>SH 0!31000f00f00:/-p@-M]fP@U@0 ` ` =Px0x 08 R;0Ѝp@Ѝ/0 a0j=( ( r=89HF $ A-@P`PpZ =VC #X0FS#S !  +0F0 v`0UPP`PU`0 0 +W% -W' =W000U0- 0@+` D0%2! 00 PPPP @0@ @]0 c000000 C D C p@-@PPa 1 @0RuSpWSQX0CSG5 +p 0R \PSPQP\     0 T 0+S -Sp0$ $0$ b0 LcI@8B B A O--x[pTM 0@@ 0P004080<0 A`? (Be @(U;e@ T9T8(0p00000Q 0,8 0: 80: ` (a0GS#! wmde00e0 @e@ TЍl700d700+W@ 0-S=W 00 00lP @X B R j b\S  "=W  R"  ( P:0,d @ ,qTd R, (" @0 (偑   I(X# (@ T:,dp@ ,OTd0Sz,0(@" @D@(@T V00X00@(@pW ,WspP@S(P! Y0,]d P , TUd RK, (P" PEP0 (P偑   P(=W +0G?oX20S# Y,3dP ,S+d0S!,0(P"" PEP (P傑U V00X00P(PY,dP ,Sd0S,0(P"" PEP (P傑0T0 00( V   ;I?I00V  l0S(@ T:,c @ ,Sc0S(0,@ 0C@(@T{ P2-+ 00 P 0TЍ'mp~``=W   0 0!]0 ua:]  oaia1Eszc00 TЍ(0[pI p X`+P-@ +0B XR Rg  +0Bp0+R XR  -Rp  X@PPQ`p0p p]0 azX X0X o0 a4|@ @ 8p@ (@ : : 9 L9 9 09 8 8 0@-@PPM 0  P@ p`Ѝ00 :0 `4 8 8 P 0 @-a/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`7P+7U PU  0  P@P PPreP \000p@400nb0PgbP07 ԉ i p@-0P@`T @T0rS Ppp@P0+Spp@p@-@PrQ` 0  P<0P0 `@p0  P @-1 M0 00P0^ 0SR _0P0 1 00S[Rp@( P \ 0<1 00SE000 Ѝdz0 0 @05a@[0 00S F><a00@ Ѝp0p p0 _X0X X0 _@$'pp! h! `! d! p3 3 3 + 3 3 @- M 00P0  R 0SE 0P0 \1 00S5p P 051 00S=000 ЍGXa0 @00S %Ga00@ Ѝth h0h  0_L L0L  0_0%p\ 2 1 1 1 $) 1 @-hAPP@ MI X1p0S)H1@T2 `0`S& @0SV- 000S$``0S1  BpP P Ѝe0@T0S [`0P0hS\0 0 L L0L H0 ^#p@0 ,0 / G-`PPHM6 p 0 p@ p@ HЍ 6P 0 p p@ ZHЍ|`0S @XH0H H>0 T^`0P Rx@/ 0/ / O-P!@RPp0Q$_A 00000(04l10`0d0 00000p(0(@!@1@ 9@ 0]@tpd0P%mR,00 P*0@$Q5(0A 00A`0@E0$0 0@  0 ,6>>t t0t 8@ 0\2. . GzGg - , , e `+ SQc * * `* ) ) * ) O-PP@`MI TQ V< 0 444ŸT:R P$ PG P R 0Qw SQЍR P P P Q[@ Q @ @0@0 `1`!``0 ~\L1L!L0 u\T010!000 k\岀pX & X p@0R@p0岀X 0SR:0S@#p 0T @ 0관T@X?[*( () ( 4# ) \( \( ( 4( !]-p@-@PP U p@KLX X0X 0 \U8 808 40 \p@3Lh' i & <' & & Ep@-`P@P T U 0sPpPUpH H0H D0 [0 000 G0 [& `& % q|& X % @-1 0M M`P040p@' T P+P( 0@ $03/ 0 0 4 30ۍ Ѝ}` `0` \0 [H H0H D0 [T% 0% $ E`% $ $ CC-pP@ MJ TS P PPQ U00"5RP/ v`P\ 0S[ 0` R 0C  PC   T0P9   1 0PU$*o` Ѝ`P, Y  ![ 0 0 [T 0 0 [,] 0 0 0 0 #  # # 8# " O--Ɵ M Mč|ƟP pTDe0\ W. 0S7 U@ VI 㰠\U~0U@@ R R0 0C?o2000RU 00 S0E0 @0S|0000SkV* d0+$0$0 @$0u 2/Z$0t 0@ 500(0:0H$0 03/P   0S00*  0.S  Y0S0 X:0S 0S   P00: S  P $0IQ/03 10I10 0 0@P000 0000S  (mP00: S: 0# $2 ݍ ЍLZ$0 R + 0P @)\ 04/P 0 000v 0 00 `P0FVy 0SK 0+ $0P$0J  p 0.Sm0SX 0.SgT0Sm  0@ 0g  2/0S[  00.S= L Pu 0  @IP, 0 !1 0, Y0Sx!x1x t, 0YU\!\1\ X, 0YV'@!@1@ <, 0Y(!(1( $, 0zY!1 4 0pY{0[ 0R7H0P|[0PS PPP!s[ / 0 } \*r h    |  x L  L   $  p   H /O-\\ß KMMpPč@P`؄ܔ_ Th Vq Xz \1 //\  0\/\   U"2 0 4 30KލЍRb/\]^*@U `/\ \` `P 0   R  r 0T/S 0: SV S> 0 00D!1 @ 0XT!1 @ 0XVl!l1l h@ 0XXP!P1P L@ 0Xz `@ 0`W `+P 0 @ (03/P0: SU/0 0ā āg= 0 H 0_XvZ/0 0ᲰTd    \   0 m   n 0  o P  SO-LLşM$M; PQ0`- @ ~RM 0 pR 䤟䴟*R1 r 0 @ R ?R! [R!^ 0S0 R@000WS 0GZ 0< S  y@V 0, @Ⲡ \< 0 0\S 0Ჰ@ 0  p G0 R/R00B0 4[S 0G*0; 6P4S 0 0CPJR*0S0;Ry W @G 0Gz +m@PT "; 0 2 ۍ$Ѝ@P 0Dj SS 0]S\2!^0r ]R0  r -R0]SD s0020 ]R0 @, ! =   LXp \Rm0LXj 0\Sg0@,0Q 0C  00`1A0 Q [;P^@[0!^0 0@ 00 pLQ0P\0G*0 ;PM 00 00@0@0P x 0V0 dX VS7A@Ni?**[-]`܄ !  p A-`QPM3 0  0 S 5{\ @ p\ {\@0 +P  oЍ Ѝ0}S0S ЍA^8 808 0d VX 0  8  O-MM@PP`p8A RJ T:  D W0S @}\ \ [\ {\^6 N\]\@ \ ލЍ @ ]RRR @ !1 p 07VVt!t1t pp 0,VQP+[S0 ]SS*SP[0 P{S &,S^U ' B0S00 (0[ 00ލЍ0]SS 0]SS }S^NU  E B   V    d   8 A-MMp@PP` < 000000,  0  ;T \00  ލЍ ሀ \^ @B0@S0 @90BR ^JލЍ$ $0$ | 0~U\@4 p@-`P Pp@PTQ@D PEP@DP XtT000p 0  0 UU 8 0S. *S9 ?0Cs R#S 1  \0S /Q0 S 00 /p@-@PPD 0 SJ  #S3 S S" S 00@S "S0, \\S 0000 S@R$ 0p0"S@00 CQ@ S 00p0p,0, ,0 TppL X 0@-QM M 0P̠ 0 0@050 0 p @EO0 -0P0 p \0 0 5 30 Qލ Ѝ0D04 P 0 H   G-pepM` p #S$GmV0 9P@$ 0S %P @ 0SQV0SЍt `p0@S 00 40   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 kP 000#3R0 \# 000H UP 000#3R0 # 000 ?P( 000#3R05 " 000 0#S RP@0 S00+P0@@0Ѝ0 S SD P 000#3R0 " 0@00o P  P0 000#3R0' ! 0 00RЍ 000#3R0 P! 000</ 0@S 0 '@  P =Q*0P0 P=Q 0 @0 0 ௥ x*0P0\ |l D ,  |T    H  p ,` h A-`P/ 00 P$ IPpPpr@P OP $P 0S 0P@dPPP j00@4 404 I0 RhH    l P0@-0$P 800 R @0 P@(`Hh (00 R @- ,00 P @-ߥ @-,@@P00O--$$ɟ M ɟ@P `pP̀  VWZU < ~GpT0;, ST G V 0@㐺 P'02h11:88@00,800$800ZA A0,00*((0p P5T<0 Pᐺ0@0SZ 0 T0SY'7 0 0 30 Ѝ hs?0t0h ⸘Mp@ ' FPTpR0' CqQ0#R X0CqQ0#R Y0CqQ0#R ^0CqQ0#R~ [0CqQ0#Rw Z0CqQ0#RJ Q0CqQ0#R P0CqQ0#R O0CqQ0#RI T0CqQ0#Re U0CqQ0#RY V0CqQ0#RM W0CqQ0#RF L0CqQ0#R M0CqQ 0#R N0CqQ 0#R 0S:V 00'@T R B K TP> p0'@0000@'@ g0 UT@=' R P@ᐺ$:S00 '0'1SZ0ST 0 %S00  QV   Pᐺ0S @S00'0'PSP0@`0 0a l30 0@0@ 8' 43 0 00  # @'@2 0 00  " @'@0'0a2"_0 Pc,p84M 0000P`x 0S R00'0*'@R@ ,Pw {` @' WpRpR000`00K 0SCG @@ Hx0@' 070@3  @' -00PP800P40@#@80 `RY0 P @ᐺ0B P@ᐺ=0S0  ' `00C0  ' P㐺@ P㐺@ P㐺@@{  t|P X d @x \ 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFpP xP ЍpȺTA-P`< A@0S&A@Q)pPpPS @SP  )p @BAQA3M0@0 p p ,0, ,<0 O8$ ,  p@-p`pP`P@T T0T0 R@@pP00ĉA-P@P`@p0S |@@D R"@`߼ZP@P00MQ0@̼8tT@-Q 00 輷C-`\MPPI@P- 0S|00V $"$ C( UpЍ 0P  $ R%pȁYT  0N|㠁0|xx{0R1 0QG Br&Q&R-.4 p0ሀ Wtq{\ SzڙHv X+ hT* $ * l* ) $ `  O--044% AM M $ %u *%p  000 0000+0 P0 40 4I P P @\ KP 0S p400#S \ <P 0S 848d0``\ -P 0S 4d0``\ P 0S 30   \ 0P 0S 9r30\ 0P 0S ,rd30\3PE0 +UD3Dc0P`0P\ @P 0S 1CP0[[ JP200xS0xS0Sc 0P" $2 Aލ ЍdR @P\ Pk 0S 8200#SB \ P 0S 2R0P\ PV 0S 100xS0xS0S 10 0sS(0wS%0S"x! t1tQ0P \ j0P 0S q@10\ ]0P 0S q!0 ! 00P00 $ܟ0 000 00EJP8  ܴ@ ij` LL l б, \,@   dH  <@ p@-hPP0S P@L@@p@`@` 4eP@ఽD$X < A-PP$ 0`` 4P @@@IP QP@dpdp8P@D4 404 0 L갮 8<  x A-PP$ 0`` 4P @@IP P@dpdpP@DI4 404 0 sLȭ P; , 0p@-dPP 4P ΟpD`D`P@ pp D : @-@@P00hO-$V4M@PP07 0S? 0Sz 5 5( 0$0000 P  0 0U 0p`A  0|0?S SQ *S U 00  *Q .W Q8 /Q0S _#P @[S8 \S 0 S 0@U pp  R?\ \ *\  @[\ \\ 0 SQ@ 0@0yW 4ЍWn /W U 00 ^\!\00 ,0 0c `  `/S \S V U0@  0SC -R S0 U@ ᱰ0]SZ,0`S * tb cU ⊠Ằ Q]Q \Q > @S QࠣW /W% .W&0S# 0Y 0S 0Y/S 4Ѝ/W0 0S7 0Y 0S1 0Y/S.0S@0SUu oVU@  ᲠQ@ (` [W@ X414!40{ J0S1!|0 JQ@ "0(C0@p0U0 $  pW 0 P/W[ ~0 / %"Pt| @0hP@-@ P L 0 Q 4QS<oa p@-@`PGP LGPT00pT00pL 0 pX H O--0 Ÿ M pb @T `A ?!1 0 2 30]ߍ߼PW 0  pL  Ӽ`P: 0S;p 0 0P7`P* @@0  {p@ 0  `P0PpW*P<  ?0 "C 0 Zp@00 L`-0P0000`e0 `0DO--0 Ÿ M "pb @T `ᵾ ᳾!1 0 2 30]ߍSPW 0  pL  G`P: 0S;p 0 0P᫽`P* @@0  p@ 0  P0PpW*P<  ?0 "C 0 p@00K`-0P0000`0 `0O--0 Ÿ M pb @T `) '!1 0 2 30]ߍǻPW 0  rpL  㻻`P: 0S;p 0 0P`P* @@0  ]p@ 0  BP0PpW*P< t ?0 "C 0 <p@00J`-0P0000`M0 `0p@-T@0`P@ P0P0S SP p\ p@-T@0`P@ 0P0S SP p p@-T@0`P@ 60P0S SP p 0 00 -H- M0S000 0 00  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/`-H- M0S000 0 00  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/x -- M0 0*--M  --M  A-pPPp` Q @Q ᤾PD@L 0000Al$0$ $0 GL| p 0P R   0//jO--<'<7 0@T@!|P;P K00pUP0 B@T@!8@,@0@/S$` P X 0{-DM  {000p 800S DЍp@-`Psp@ P p V U ph p` V@@P , Q?o?o 0C-@c^?c%^& ^ `pCc&Pc268270EG2&1H01. "0;:(0C0 /0 @- /? P!Q/o/o G-@b^?b'^( ^ @pBb&`b4')4(0VX4G1Y 1. "1;:( B0 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C Jd@ @-ap A JY@ @-Vp J#@ @- p J@ @-pP `@-E00?0/R//R/?0S/R/P/R/p@-PMP`V  @T 00dDЍp{ : { p@`($ 5 xD 00 R 괕,@-jE00 0S@<0x /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB` 8@ :P PXY  P @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍlPP @@ @-0(@$0sм,|dO-鰏DMP`00 0P0? 000 00S 4 T/ @p%S{ @0@ R0`S 00S S 00(4/!/#b!!"AK/ "bQ3:bQ#3P . ! P0 00 0 0 #>1?3c112AK? .## .cR 3:.cR # 3 00 0010!00C0 0 0@ 0R PR0<R0@@mWjp%0KUSd,ba`_^]\[ZYXWVUTSRQPONMLKJIHqTy-;(>=<:87 -,+*)(Q4ih".{s(b 00 000; 0`0P `DЍ0@@0@000@0(p,P8 h0$ @PCp6 r9P @ T$0S* $ 0(p0,P$00@PCpe6 W9P @T$0S $ 0 `0 00 0V$z[0@$ 000 GR +Rk -R 0400``PW:S 2a2c2SOR0c$000` 0(050 4`0tU0[04000000 @Wd0`nW`pW\ 0, 0 09 0I`0 844 40W0C`00B 00 0c0 4`0@0@0W%S0NW-|=0 `0r WD;0  0 p0p S00W0 0` 0 0 0U0 ^`0 0 0 0000 M`0 00 07c0 4@0`S0G 0X4 ?2c111400 00 0000 404c0#0`S400111v>C 0C40 &!/"b!!!A0400 0@@0@000000C S0`0`0W0= 0@*5 @8P 5@  8P` 0 0` Rv40W010 oWm 0 0` S0pYWW_ 0`0N00J50 4`0  044 400C`00> 00 0440 4440v>C 0C`00+ 00 0x40 40\$/A!b!b0C`00* W 0  0 0  RM 0s 0 0@0 0 0vP@ @ P)` @aJaj B  B0 UR ZRU R   @K 04# @ ( 0$04`L(p,P@ `W0` (p,P@ `W0` "!/#b!!"A0K/ XX"TbQ:L2bS0#03 p"10 !A 0  40DSd040ռ0 MR[ 0@^  @Q 0 "#^  z K/o "0P8 0`0000C/< 800A Q`A`0PQ0N#όF0 0  D[ 0 80< 0A Q 8P 00`0 0@z[3 0@P 0 TR RO ` @D0 CR :а|P)\(\ ף ` QX n d l'$I< tH QA ALA|r` \V6JQu8 @ 00 (0b$0 00\00C4PN00P01?2c 1A;S40`2ca12B @0@000@V@ A\N A R$ M a@000"b"b"$ (0(p,P$`(p,P$`40 @' R$ @  R 00@ `p40 `$ 0P$ @0004 0C$0(`0 0`$0P$  @000 4 0C$00!0(0~ ` 0 P 40@! 020( 000c$0i 0 0 0<p@-\\1 00Mp0,00`@P7 U?    P00Q Q Q z? 0   , 2 '0Ѝp H0 B0 l<0`0` `:0 8=UD0D D;0 .=ꬷ$t,t,t, p \ p@-@PP U 0DPp P @pD0D D70 =U(0( (80 < 8    ܱ G-pP`' X/ Y C2V @P0PES  R  Dt0PEV R  SS0@0D@ D0D DH0 <X(0( (I0 <, l 4 8 D R@- 0BAs@ @Q 0CR n=@O-騡PP p MV WC 7@PI 8PU  7p`P 1D101S Y8 Ѝ070P7P0 0 0P g70 0 o==00 h=|0| |D0 C<87X> 0 D0D DC0 2<]8  ( l 4 RQ0@- M@@ -PP TU ->0P Ѝ0! Ѝ0#> 0 Ѝ0G-఑ MMp ōP`pG |1PT zpG @PE@ X0^00pAtAh0O⤩00 TAXA\Am: q$@P0,  (@ @%@P O'P 0 0 5 30ݍЍh0h hD0 ;@=0@0=0@0븗 X 0 0   ~Е--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-錒@P p` Mx X X00?/&00P @ P @00 P! !  61XP8   -VP" WS V[XPVppPp2*0`0 5V0M`l!l1 00S/ Ѝ`ᲭpP: P1XP C0PP00 5/ Ѝ0 0 : `f` 0 ?0 :}~pP V wpP X0X X0 : `T\ Ԫ \ \ 0 D  @-@ M.(0S2 &0 `0( `1/qpPp0  0 0 PUR <0PU. ЍPPTp 0S  0CP.P<0p0@-P M.(0S< %0 #p0( p1/qp@`03  0 0 @ToR <0@To.1`VP ЍP@T` 0S  0C@oM<T 0 g.D< 0 ^.p@-PPE 4A0S5 @Tp1 Rp00P0 P 0S P0 c ( 0P0 0 S,P 4P ݮ8P ٮp@֮T0T T0M 90Sp000 0K0 9eE̦ d l p@-@$PP]Xp@V03,p@- @@OX@I2op@-,PPB Y@;p2oA-a@P`MZ P10p00S   0 XR  0@@SM `@@ X8 CR48,0L0 S0\^**N^&^$ 0 r SX   "\ ^ #R.S @a A  00C ƒ`0@ЍD0D DF0 29 "^ #R|H x L 4  R  *4 8/m 0X\S 040:8 R РS /kxB@-@`P:LpL0ppD尀 LT  " +ݯx\ - MP@ : 0A-x`Pp@P3 T(  r PPP P x0PFX%xf00(8(((0 88(0 8   u00'    70Cs0 00Cs0 20%% "\X  R % H/o"#& H/o"$=Hoᨂ%$0    6000W0Cs0;S & m 0B0!000?X00 Sf =S` Sb 0    H 00Cs05000W0Cs0 0 S SL %  / -  00C70Cs00 ",E lş ;S cPLşLU PsdP 1R01 0S1000S0Q 4000 0CQ 100C00 CR) 100C0-X ^X00 HnR~|{zyxwvutsrqponmlkjihgfedtba`_^]\[ZYXba`_^]\[ONMLKJIHGFEDCWA@?>=<;c9876543210/.-,O*('E?$#"m `WQKD> #S ?0004" 刀 N 0  00C0 00 0 0 0 0 0 0\ 0 0 0 000 0 0 0 0 0 0 0 0 0 0 0 0cPdP00dP 000<00 0000000000 004 X 4 | d ` O-`RM@ > Z2 X p  @ P pP 0  0@ ESE Q@A2  00@X PW' 00c800Ѝ 0 /0<6 0 }/026 ;]P T0 @G0>80@0T 0@D0L L0L 0!/6*80@0 ܘ \  0 y 0u0s  RH A-q@pP`Ui !4"#12b! DqW7 0S$ RP QP0S! 1003/P P $@200W L!P0 $@ 0V0 P100S) 3/000PP0S 000S) 3/000(6p000p3/P WPVSP 000SL6P0P000$a/>3`#p #`""=A-q@p P`Uh !4#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@00W L!P0 $@ g0V0 P100S) 3/000PP0S 000S) 3/000(㫧p00 0p3/P WPVSP 000S㫨P0P 000^^`!D ] d A-PP} @/*`Py qpPg  00Rc<!"#b!0CaqV- pW 1PWV $00dqp0ST100S004  ,1003/P0 0$0 00``0S 000S+ 3/000(P`0003/P 003/0000S PP0000\/>3 \[h =A-PP| @)`Px qp Pf  00Rc<!#b!b0CaqV- pW D1PWV $00dqp0ST100S004 |,1003/P0 0$0 00``0S 000S+ 3/000(㐦P`0003/P 003/000$0S 㐧P 0$000|ZYhY0SR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP T P00 D0D 0 p`P/(,XWWWWpSR; G-P0`00Sp 3/00 Y @IP R T 00 00  Y @IP ? T P00 D0D 0 p` P$/ WVVVxVPA-@P QP P@`p\P30`P ᙽPpW .50"S &5@00@`O-PM M Q0` 0 Q /Q P.00F C(PPەۅPp/Q/ Qp @0/SS.Q6 0E00 0C S"/0  D030 I  0礽p  0: S+  S/ A/o" R_/Q P4?0V0/0000 喧ލ Ѝ DR .QRV  u/R0W03ʨ !0Pu5 0'0 Q)0 3(/QPpPVP/0000ލ Ѝ `P `cu400q4>00m400i4?00e400a4 A-Da@P`: '00QP0ԤP= 0p0W& 10pp:W@^ 0 \S 0@ S @ 0:Sp@:W W0 0T0P  <00 4 0 0plR|QlQp@-@PP`2 U' 0Pp:P@0P S P:V P0@Sp0P P@Sp:VS:SpH0H H0 1000 00 1x А P } , 00/p@-@PP" U+ 0PE Q  Q:\|\00\0S!R B|S0 0:SSpT T0T P0 i1U8 808 0 ^1p | 4  v  O--``ȟ MM<čpĝP O 0SX 0Sa t4!S S wpP 0P0!  ˣ@P 0{0S < Z' S 0 00 Ǻ P] 0吺P|00 ` PY  R( Xw :R \R R R  U:pG{PPE Y@pP+  YP  ` RX[P #QQ .P@600S0 00,0:@ = `P| 0:R@[ @R0t400 0`4JP pP p:00d00[  0S gy00\:R[ P40:R0 0 R0`FC,0DC000S:S:0 0 H0GY0 E0 04 P@CD00DZPEDvpG p{PE`F@DQP pP`@@0S ǹ$ E0AU0: 0@#3 0 <4 30ݍЍ0 0 0*$P@P ⨢@P 7D3P00PS0{;0`S8`#3 0 / 0S"2 0 /0S"2  0/0 S R6 10@嶤1@00 S O #Pᢤ0S? 04p,0%,@00  `6/p P0003/n00k4`X80,`0C0000$ p @P 0 03/P$0p0H?o20 0@E!1  0d/{1 0 @Nt1@1I0S4Dj1 0  0$03/80S[1 00| ո Ҹ긩lhN< t Hhl  ` 4  <  ` p Ԉ  n p@-PP`@M V T 0 @ Ѝpx x0x 0( /VX X0X 0( .T8 808 0( .( s p Ѕ m D @-4@@ P 0 000ED0O-8ğ8$  0M MpP ( ` 0 V 4D0 @R` 0S S P@T 0S  @P 00 C R 30000#30:Q0#Q0S(  0R\Sz D3@0T  P OP )0 0P0 P  20   >0S00S\S00 RAPጒ 0S7\S5 00S1 :S000 0 Sx4Sq A 00S :S|S@0@ A@0S'!1 0 8 30] ލ Ѝ  t@P 00 C l10 Y P ק@P/ 屶 @@4QP P @ 10   !1 04 -V( 0 04 -0QP 0 0oPX t @U?bbDxDXD4D|Cu 0B44 R0  0R!0100M P@@+ T0:S084  , 00ULPHHp0p pE0 *.00"0<44 U w w PT0w ̳ v M \ u Lu  0 00 Q-H-M0S000 0 0 0@  00^100M 0 @R0    R L00 @ 00 0 0 30KH Ѝ/ˤQQQ4@-L0 @ @0t 2s O-@P,M$xx`មd20 R\ A00pb 0 MP Z p RP p J  J PP0 S"3#: + V(10 r# 1$4S!1$&t@@x!00P @P0S?"@!1 0 $0 30= ,Ѝ100S  V r pP Р CP 5SX0(, UT00#    (PP P0S pP|,2d1r r N0:q ˠ@-(@M@@0?PЍ/  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T +P0 0# 00Ѝ *0Ѝ0-$M  00 0OP$Ѝ0-$M  00 0?P$Ѝ0 -M 00 0 .Ѝ S Z0R/C-<< sMPPp/ W7 @X0^00pAtA30Oo0PP P0`0TAXA\A 0 $@2 t0 0 1 30sߍX0X XG0 y(W<0< <H0 o(JHIG Hm m m m l 0   0IO--ϟ MPÍP$0 U 00`!R !Y  0 3 30 ߍ GP0 #P 0 0C 0 S 0 B `0 zRNc_^]~}|{yx^vutsrCp?>=ge+`\[Y``YBR000`0C0 ៰PB 0S 00 0@;+ 0 ['U;+ 0 Q'@00S0  @DTI< rP0 "P 00CS0000@ 0D S*7v0H0 S00@0 `I @ 0H` D0  BPR '+f 0vpC0pZ Ml:PWp! 0\jPP P`p + @MR^V\TZYMNMNMLKJIH654321A@?>=<;:9876543213/.-,+*)(!  XM P 00CS0,000pWP0 VS XR    0 Q!$ 0$        00 0P0 0C0000 S000@cT @0 !P0@ S0 B0 0 R rP00S000000S0V >. #RR 0@00T0C0  0 >. #RR 0000C T0 S >P Y 0 00+ E  P BR  X *@PNU 0U0P0CS00X 00Z*@P XR P@PAR*P e!P0@<00  PG@0U0S00CM SP00[ '*<@ @P0ESH00SH :!P 0@0CSPH00 0000T0y: `4 8@DV*T IT0`0 @VW 0$0P0  P r$00 400S P0Sc 0$P0 00000S @0P0CS00T 00*<P+ E P BR  X E* @P W P @0P0CS0 0IU0P0CS00X 00$*@PW(  R D  R~WW  BRp P n 0@>0@8>04`#C0 0@ 0 + 00@00   00 0 iP 0 0C 0 S P `   +   +    )     00000@ 00n * 00@90 0 0b * 000@ 0W0 0@0Q @00S<@@XL  M ìPA "PS00bS. P 0@0CSPH00 00 0P0CS00R**P00 ᘬP P0 P. 0P0CS0 0[ *P0X P 00<0{0X P  P00CS00R*PYS3?H00v0@0. #RR  PR  B   P 00J P0>>03SS 0PU0C0000P0007 0S ܫP PY9 Q~ 0$@0 0000C P0^P00<0 0 P0 R*0P ᶫPX*0 @PC T  娫P R*0P00YaDSP00[ * @P$@`PPP0 P 0C0P0P `V  0S tP 0$@0 0P0 P0PC ePT*0<PS$0xPpp$00pTP0X` З P 0  B0>>@I  v$#0 偗p P p0S )P0SY0Y 0S0 00 0 gp b>>3PS 0S0P0C000p0000S PkXi*0P0<0 0 7 iPE 0 @0>>` BF, vo" 0 p0- P p R`408>@p G  0 v9pM P6YPE7 0pS9U PU IP0T P@D0 0ϨP Ua,0@P0SPJ00@@T|0| |0x 00Cp YPE`0pS ᥨP W P DK I I tI 0@-@P M 00 0@ Ѝ00@-@ M@P x 0P0@w Ѝ0$A-4R@QP`Y v6 200S5 X0P1S010p L000Pv`! pW@0PJ PP\ 0  00  C `C00030  Q  Q*RQ2 <00@8 B`00 `0 , P00P0s0 aP + B ?#A 0#@ # B0 `$" G G p@-@P ጁ0@p@-0P$L`T M 0S pW  07/@P  Ѝ808 808 r0p @ ЍF H F 0 0 H!A-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p <0$Q @ ЍG F E 0 0 0p @-0M$LPT`  0S (pW 0 7/@PЍ< <0< 0y, 0(p @ЍF tE E 0 0 0@-0M$LPT`  0S 4pW 0 7/@PЍ< <0< 0D 04p@ЍF D 0D 0 0 0O-MD@`Zp@P] UV 0ST$Z0 0S- [* 0 ;/0S0 $\U 0S H[ 0 ;/@PЍ 0 0 y0H 0 0Jh m0@Ѝx x0x 0[ \00$\D D0D }\ 0LD 0D B xD C B 4D C ؓp( LV 04O-,M`PP pE0P@0 p00EPs00D5ʿ000 0   @0 0! B b190Bp   U\ @ 04B@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 Dr R R Q  R \00t0!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0$ P 0` S^?0@00 0  P 0J ZS 0  0J ZS 0-00d10000 ,Ѝ0\r  `0\s  `0\a  `0\ S00 0 0``0\b  `0\t  `0\n  `0\v  `0\f  `} @岐P 0` [0\  @`p|A- Q@Pp`! ἐP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0\ P0 Af< < A-@P`DPp$T0 pAQ_T !T '0DS%(0$"0@ !1 0P< O--ǟ UMLǟPP 0pခ儡<  ?oY20SmZu Yf y @㥎0P(0 b`ᝎ0P,0 0S0080 9P40 H  T. (`000P@Tp` U T 1 # 0-0P?0S0 PP Pp6p&p0 t(0@FDA T @! D`S0P$0. 0 :_40S V D0$ 0C BP$0  ? *500R  ` '50$0R` 00` 00` 00 `"00@`\00000 upT- (`,$@T( 0 7/PR0@0$&,$("8 $p4 0 L1 30Uߍ<0SPЍ-M $(0Ѝ@-@ M00000h0 @ D 80P @0 0 30 Ѝ薒O @@-@ M(0  0 0   @D <0P @0 0 30 Ѝg0O 0@-@QMP0 2 0 Ѝ0`N @-R M@0   0  @ ЍM 0p@-@Q0P`0M  0  `ЍpM -M00  }ЍLM -M( lЍM -M $$\ЍL 0-$M  0$Ѝ `pVP0STA 0ST@!0 0 $0 305,Ѝ  @`1( s0@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@Pu( X0P @-DQ4J  h h0P@-X  S H@ @,0( (@ ̬ A-p`PpP@ U! T 0F0 PU 00@^ NL0L L?0 U000 0@0 }h   p@-@PP  p@$ 0 10 c 000S 0 00 9/`-  0  ^^$  00jjmNAdj(j0 0 A-`pAQq@"0F P啀0Ch@12c` P@RH00p`PPUTp`Lii_ N\ip@-HP@P t0S,000@ p@ tXhh(hA-<2@Q`pP`Fj $ nt R6 200 UfU 10p    Rt?U#0!P 00010 nl100 C0B100L100C0A100UU-0!P 0010 0 P 00000@ 0 0 c` s0 P 00?0h00, hglhg@hpgHggggf8glff  Y fe|fA-01@PppG> `1&P #Qs PFR'000 0 0 UPQ,P@P@ 06&```+00A @sl000C0A100H H0H 0 f@eee ed@e e8 @-(@@ @qsu0@lscp@-@P PP P @p@p0 A0  | A-PPp` @P& P! yP  P@3*"0@00@0< <0< V0 |@0@0 P Q:// BQ://G-<1<0000 $$!0p0Q= `AQ@P P 0 `Q Ѐ@P   0PR@ zTp@0@S z000  B BG!`x,Xb,`bܢp@-@P P8PpU0 =Sp=Spp p@-@P PPP@Ppp@y 0 0 al t p@-Pqw@P 0 P0@p`p@-@PP LPp 0S3#p$ $0$ 0 `` O-10  MYp @To p `P P0=S] @PTZ^ A@PY1Y04 S@@@S*Y3 fy 81 0   `J0S:a z D!)0 0 @ Ѝ0Y   RS@X `Q0S a1S  Ѝ PPDPp@- @t,PpP 000ppA-l`PP` p\@P 0=S SP(00@0ܷ ,@-r@P0@\,@-q@P0@\,@-q@P0@|\0!-0!0!Q00 000000 0#0, 0# 00!R0Q0  0R0000@-@1 MS 0?P"1$Q 6Q 0  R& @  @1S 1  S( P  P    Ѝ0\ w100 Ѝ0@m0000 0/A-`Up QU @ @E 7/P@G-PTp AT P PD 7/PX PPHPG-PTp AT P PD 7/PX PPHPG-P@Up`L\ P@@E  7/0P/@S@@ @;X; 1Q`0000$ 001@00a0@00 0 `PT1S%  ! 0000V @ @010aP @@@@0@@` `01 @0a1 S Do @000Q0 -"P 0 PC R00 SAP 0@/ p@-`P@T0M \ [ Rv    T0"k \ ` ``R```aa0 00000 0#0 0#0000``0000T ^pp@P ``P`  T2 0V0pp@<R /o"!T0#00#00!0 0PT 00pQ  T \0 !G-p`/tP# `Q@@PppW@Q`Jd X 0Paao0O>opG00wTaXa\aX@Z_P 000 D.%@-_,@@0@P0S@ XA-@P匀@_}`P(p0@aan0OnZO00TTaXa\aXP(0( $0 0 0p@-05S P(oP0SZ sX@ 0CR\op@T P ZP@o\QWpQ(Q/p@-@P $PuP u$uP up@u0 0  T Mp@-PP@ T $0p@! 0/L L0L 0 T, ,0, 0  ` h h < p@-@PM$ P$`0.UP  P pp( S00S 3/Ѝp003/( (0( Z0( g4 P \ C-$`0DMSP 0(p0 0@0$ `PP 0 (0Y,00S 3/DЍ  ,00 (3/ BPP A-PP@M) T2 0S Ѝ $`0P t00 @pP gЍ00pL L0L H0< T0 000 ,0< d l  @ O-lhyM(p`s4PP  {s@Pp 2 Um20 RG Nm0!$@ !  00g0 4L  00 0. $(p,`Y PR 80 03/0`0`>sP"  !0 0 1 303yߍ         P"pFtP Bt@tPPp6tP``Ppy1Ħ8 | T < ,  P00/Op@- 0VM 0PP0T10yp" 0P1@ᯉ ` 安0P`` S 0!< ,0 0 T1 30Vߍpny1$Op@-`PP`@M& T. cPЍp fP PbP  KbP |0 0  PL0L LG0 T000 0H0 H ` 0 d 8 O-p`@(,WbPP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW $rP@@+o PMs00P WPT G-`R p@P8/PP @VG-!1 0M@Q000`PR UH U D.0P0!1 0 0 30\Ѝ 0p ) P00S00 0师PP  0⭈PP ᤈ0PS Up$0T  ⡈Pp0 Pp0ꀀp 厈pP 0 @PL0 00sPAx뜠L/ B/0  Q B  /0S 3 %0C  0% %//Q0 / 0R  B 1 // 0R  B  2/ // 0R  B 1  // 0R  B  2/ //0S :p@-@P0C0 P Pp/0p@-S@ :P0C0  P Ppp0$00$00  /00p@-PP@ T" cP 0S S pp@caP p@aD0D D0 T(0( (0 p H p@-PP@ T cPp >p@cH H0H X0 , ,0, W0 p 8   p@-PP@' T Pp TcP 0S S]aP p@Wap\ \0\ x0( @ @0@ w0( 0p@/ H ( p@-@PP U p@ YcL L0L g0< pU, ,0, h0< e8 t 0@-PP@ M T# aP Ѝ0bP 0Sl00 cP P0P 0L 5T0 000 0L *꤄L p@-PP@! T* 0 Q p`P bP `P  `P p@`L L0L 0\ T, ,0, 0\ D  @-PP@ M? TH  R R  `V V  0L Ѝ0 0 Ѝ0 0 Ѝ`V00 Ѝ0 0 Ѝ`V | 0FS73.*& 0 0 Ѝ 0 I0l Tp0p0l   R Rh `} 00 00 0000 0L ,  %  @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`' V/ T ^ 0S^  S 0RR00Ap@@TppD0D D:0 V(0( (;0 D C- MPÍ`@PA TI A< YPJ (Y` 3P t!l1 0 3 30Rߍ(3@/0SA S3 p !0  0S 0%  00 0 T0 0 p0  00Sp"P 00StP\ h  O-DIM@4MI͍,,J͍@Pp P0`S S  p4,$I= ,0 2 Iݍ4Ѝ RJ- RW# " "  J= 00岠p} #Kz0 J gJ=00PkJ=  0n0SO S UVW J= 00p,:03 00'$000J0 40UP @'0Sk0S  0S0s S0S UVJ= 0 % J= 00pfYY O < XP^ P o03?"R<UVJ= 0 p`p^pZ<0K8 hJ- 0% $ 0Po J=00P00J= 00noS Sp#< lJ͍ 0 tpp p 00SVL2Sp S SJ= 00Y0  GXP pJ͍ LPpsH t  O-ğ MQdH4@0P0CS,p6)('&%$#"! 9 QVW00 R04 0S SQj#3 0 0 30Ѝ#3 0 0 300 HDp@`ЍOoVW7 0 L#? s0`P#T!0SN0S ? /r "s0 DPT QVW00RTD`XT 00" 0 W* P00Sz "0 T@@? 00!D PT`!0 iT 1i #⻲Qc0|||Pp`P 0X! 0 sP030#?Vp@D `0V0 0 `P030#?p@D0Q0 p0ĠĐp `pP0 W 0`@Dm    <T00? \  0urTL  T ܻ x   P ع @ p G-p 0 FM& P@`p P  RW  P Wr`ov`  0@Sp0 0 0 1 303Fߍ000 00Ͽ 00  0P Y: /r RX 0S ČP 0 q4d0@-P@ M O0 z 0P  Ѝ0 Ѝ0p@-MP`P@@P@T 0S  R0S ᠱPJ@PЍpPBPЍpp@-@P PpPpPSp0 @0  X 0 0. AASq0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0R00@-d!$M""00(  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S.  R  R R R0 S 0/0S S S S S00@-/ 0  00S S00/ 000S00/00@-@P M 0S PP0 PwG@0S0S 0S  Ѝ0$0$ $n0 t  p@-PP`@ V T! 0pgPpx x0x t0 V\ \0\ X0 T@ @0@ <0  x س L  | O--ŸM4M 8,00PP@0 "0 * 0,$010`(0000  ```   E P8qp0  0 P? 1Z 1#U 01  8 P 0 00 08 pp P _0 0<,8,011؍4Ѝ 0?sQ s0 0PU 0S $0S! S S _0 0 0$0t t0t p0 eEon_0 0i_0 0d_$0 0d}Я @{̰ | @ A-00 AM@P čPp`/ U 0P  P@,  0 0 4 30%Aލ0SP @0.Sp @@0 T T0T P( 0f_ 0 n\z4 yH H A-x!x1 0 M0000S@> S0  0` V" p PQ 0S @ T S   0S QRp`V| t0 0 0 30 Ѝ P0 0 0`V    snxw@-PP@p`M* T Q Q Ѝ0SS P P3p0W R) R'  p0S  Ѝ 0 < 000S SP0 P 0  4{ (  } G-`QPp W$  Dg@P   P P !L L0L H0H iW0 000 ,0H ^T 4 ȧ ( } O--LJLMݍ<Ѝ\0@0&<(00SS  F'VR1!pW: X:40$0 Dh!PK0`S`V 0  0,(%$50 5s 00S9 <0@C?,0PRC.@&<(0PB@?#(0%P@ jh@00SC@fC\00D (0R |,0LRC.@H %D0_/Jh,#,3, 0$P w(0S: # 3  0P k0S1"2 0P _0S("2 P 0S80D0m2n0 0 @[P00 $03/P U00@S 0  D?:@0?s0SPP[P000000 [0 0[0 0[1Pn0 0  T[P00 " V P \c@P D!^@ T0 R4  4S P 4S @0@@0[Pw@0@0S 0R $R R $R 0@?kf#tt ]luo`< | \ \ П , П  r p O-@ğ SMD`1cPP -cP  $p W8YP00[3  P00 000 P @pPY 0  PJeHe@P#3 0 D1 30SߍZ 00]00Z 0P s .P0P R R. B/o" Se d! S<*0Sr 0 00 00DD0Q 0 pp00 `Pk$0=S Z0S4 S* S) p0S 0so[t0S Z00ddP0  8PlʍZ0S00Q 0 p000  Q000S000< D 0PBd   DD Q000 0 P2 ! 1  *k/0X p&0 P AZ000 DD0Q t0s 2Z00+Z00imd$Z0P0 Z00 0 PnK(ji4 o O-`@VpPM 2 0 S[ `P 0,,0H000 0000L0P0T0X0\0`00HS? S7 S yY00YP* P( PЍ0 ,0pLp8 40P0T00  z0Ph h0l0p0t0x0|00 d1`K0S 0Ѝ0 0p8 4000p4080p P h8 H  410T0 00 !   R" 0  P 0 p P !0, < @ D  80  ,40PcY0 d1 d0SVT N00P0DOh P00\//M0 p@-@P P@P tcrcTp 0  0n/tꀗ , rO-P@,",2$M 0L000 0 p@ `HjP0S@ ر@ @T SP-  KP  p@p!x1 0 0 30U$Ѝ0SQB pP? 0  4@P40+00S @x P 0S00SQ opP 0  @P 000S ;@P _@@ .@P ^hTaL`L O--ϟ MS0 p8 `@P  !0` [ 0S0S ` |P 0 0.> 0 2 30ߍ0 00 RS0$0S0$00 00`P$$8>00@,0$>(0y?40>`000> 080`V f;62 F:20V00S   S  R  RQ P  \P/oS`Q" RP\0Sa 0 &P`Q} ,0 0Sv Q0S %o0P@0 PDp @ 0 B  ~0P<0S`VP @0z H@L@p@`V> 0SY 0S  0St S 00S PP0 e>P R R RP0S0S;0Su\ ;<p`zP@H@LDa<0S``V`V1|0S0S> `3@`*: 0 x*0 4 l*Y p$@$,80< W 0 g372 G:2Z 0SW 0R P RSMQ Q D \Q^=SR^0QpP 0 p=`P`&04 00$080Pe?000a@P񏐓(8 r/0=0S YpW|V`Y p(I [ 01P @0P0@TPU _0P0 (h`}oX 0 @@ X@ \PP `|0S 0S ` |0 `0  }vP$Iu0 P R H00S S00X  `P 0 0P<0`0S `,`00~pW0 ,`` <0 0 PpW 0S S00S`P\ Z`` 00S0 p<`004 8En` <0`P <0 0G0P<0 <``` 0 0`V X  500\ Q  P V X  RZ R l T p`Q `V/ 㤔处 0vP@  @ `<@ `V Q  ?P44 0  0 @@P` 7 `00Dz_``]P  0 @@P`H`YPN]P HIH H\0 V@0\* _@3z0:0$Pz|` P@ X`@p `h1Đ0Y|0D Y0F  0=0 : ؐq %uP sP50D  T T0uP00D* &0|0 0T S R SL 0 S 0CBR 003 Sኡ*0 S:0SU s@$P41 0iz0 "|0R00^XP @0T 0@^@0T@^|0)``0 D_<^lI@ Ԑ G@ E< ]Ѝ ] D  @Bu@| cDq Ii f. > jH <tP1x00x0 ^/d<`X@0T00\0@^PO-PLMa Zj  d@㴱q p  PP0 0 ფPG ``0S S S T@tP `0S `(0 ( (`P00 U `V`V 00  `V0S 00SU$@LЍTT T0T P0//Z8 808 40/$_ _ l 0 ~ h @ ~ ~ i G-XM`@ |P pP @00  Z0 |P 40S0- XЍ OP ]@ 0 {P ]8 8<.P 4PPoS 0 x ~ O--ŸM  ! "4P ğ* $! ğa @#, P@dğD 0"0#P 0Hğc>  !,$P,$ʃ  $ "0P$a @ # " `!`&@ `ßj "! @ ßa  # ",@ ß$ 0&0# 0pßc> `!,`jD@LSPP"P%P8CeX@ @#@$@#D 0 ,l̈́ 0 !蒟$ `ab``P P%P"`X @ 00#@E0`ጒ`& `xŸfm   "0X"a 0P 0#PX0 ,, @(BŅ@` @@$@!D`dM 0 0#0a `̑`& P`V0: A=0hV@Hp` 30V@@p`F A(H H0H 0 , ,0, 0 |p hp ,p Tp ,C p p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 '^p7o 6@o (B n o A n G-L"L2 0M000424"00 P00 `p4 0R @  0XS@@ rY<0s000L T $. 0NrY)T  aA 0s00C 80BS,!1 0 0 30>Ѝ.R ^V* 00RP 0FS0 S S Q >Y00@^*0^0 48 <^*0 8<]65|4- M`P Ѝ@-L!L1@ 0,MT0$00 `pVP ?o2T0S9/o"T R @ 0 0 $0 30*,Ѝ @`!(0r @$0RV$B R T0 R ( $Q C#]3 3k k A- rM`PpP8 U@ @X0^00pAtAP0ONP0 $1TAXA\A 0UP5  0 @pP& 0@zVP 0 0 1 30 rߍ0 <0 OUh0h h=0 EP 2W00V 0P0\ 2B81T/ 0j j pT j i 0   \0 -- M0 0~ ЍЍ/--, M0$ 0 oЍ Ѝ/0p@- M@\ Pt00h` 0`0 `P@@X@!+0@#T  Ѝp` /@-LL1 0M` !000lp @P  1 lp Vk@ 0 0 0 30(ЍHkP@pW @@T PU 0SP@STN0@0 \(/i.p@-@P0sV(0PpV(P,PlV 0p0PP 0P 00 0p`00ZP 00 0pf pA f   / 0@-@ 0 0 0 0 0 i 0 00@- 0 MP @0V 00P 0 C?o20c Ѝ04 00 0 0p@-@P0 0U0 0pp@-@PU0PPU(0PU(P,PpG-`0PX pPQ 0@00 S S0 S S d؛PP@ 00 pZp P7 ś@P 0P00S S S@ 0AS A᭛@PP 0S00 00TP  LTP0@@D= d < < O-@ 0`p M,0(S{: (T_TppW 00SS 0QM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AS00B0  :0S000 0  )0S& %0p@T0ppT(0pT(p,p@ Ѝ TP  (,@ (|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ04p 0$  $ 0 . Ѝ0O-0PLM 0D `E$0@ @ ``0ϘP0P$06RpPK  0``P@$PPU 0`@Q QB QR Q. 0U 00S{ RPb  `0 @ 0,p R  R/ RY R 0 @Up5T 0J[I0 0 LЍ   @QA@  0U` (⼐p 0  ,/  p0p 04`$W G`@ @U@ 0 @SLЍ@ 0@SLЍ `^ P@Q  QA@ PU ^ QP @ p, 0S QARZ  R  P@ P@  A X% X XB p X2 T( QX X X0` `J`  ` `  `Q@t0t t]0 [ @  P@U`:S _ Z Z Z @-@P @-S( (0( 0$ 2@!S@Z (Z Z /hO-P<`P p$0[@(0` $pL0W,0N0-0(`` P `(QJ`0c#UU`0* 0U'PS$Y:W' 0WV #((RP P54PE2PE1PE`S0PEg aPE:`uP4;P 0 @R[030#W,0W030#-051-0%!0Y" #((RP P54PE2PE1PE`S0PEi (PE8`uP09P P:04  P800 0@-M gp/ @|hp6 P0u0(04{ {@0@ gt 'U r0P  9P Ѝ0v00/hЍ0fk 0 Ѝ0f @W A-'Qp@D P`rP0 AH00V / @-\ ,@\ \ Q :\ :A! 0  0 C-P$0@SME 0( P04 :C1I;p1 B$`00>1B- 0CIR0  R0000809L>01  00LЍ0 0 0@-S@ 3/@Qp@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$E@  BB, D B,&" @A!L@  B B!"AA!@@ pQ Q@#` P `N@F$PEPET% B B&"@D@D"F$PEPEX% B B""@D@DA$PEPEU% B L B \'"\  \ \ , ($P@\ \. \* \, P@^ ^ N@N P@\ \ \ \ @w< 0PPU R800 0DQ`1S   ;`1S0 0  0PL0  0P9P  PP&0  0P0  0uP0  0iP0  0]P0 0RP`1Sy40S{ < P0ppW  0R 0PpW 0pW  0R| ,0PpWg 0pWb  0R4 00PpWHpWE 0 PS 0 P`1S   (0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P  0001p 0001p 0001p 0uwt1p 0kZ3ML PtЍ tЍ 0 /0 0  0 ܕ0 Օ 0Ε0 Ǖx0 HHB ,B lB @ t@ (@ ? = = l= @= = = = = = |= \= <= = < @-@`0 0AMM0 400p00 <@PP0S D 80 0 4 30AލЍ.<P0,@-@ M pp P@`PkP 0S <0000 Ѝ00S.S 0S Ѝ_ p@-|0|AMPt 0  ` $ 0 @P .8 00 0 4 30AލpZPHp@-P@Q`  @Q LPV 00pV00p@-@ M`p&PU 0PU  0\W 00 Ѝ_00P0 `LW00 Ѝ8 p@-@MP`0S 0 @S 0S@V00ЍpO00@0 P$V00Ѝp 8 0@- MP0@0 @x0@T U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0$A x7 8 ,,7 p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@6 0@- MPy0@0 @?@T U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P Ѝ0p5 6 $7 5 0@-@ MC T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@=T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP6 |6 x6 D6 5 5 5 5 T5 5 45 5 H5 4 D5 4 4 4 4 4 4 0@- MP@O@ P Ѝ0 0( 0P Ѝ0* 0@- MP}l0l@0A> @0@T U Ѝ0O,0@ 0P Ѝ02 2 Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D C000T H0 0 <0 30 @Ѝp@Ѝ/.0 T26NH3 O-PM`@P P = p 90 Q  ЍSv RSPP -\00 +\00 3P0 0  R0N1011.\ 0 @T@  R㞀( 00 S #3@  R\ Z 0S#30 "#T$P+<0+80+40'<0'4 0(< 0(400'( ((P p 0R0p ` 0T00@0 P   0R00#3@0 PS \  R#3 000#3TP 00 T @ P P 00 S #3@  PR \ 0S#30 "#T~ {00H 000J00  0L   3 |O--Q0 \M R 2?"1>Q1|" TSSNxB0c<$CdbBdAAC22c1Ab^f,RnjaLWEP0>%S8_2eRlQqQNDB<">"br!LgLH @p qN [H LP0H Z J Y L (D $T@ 8 < $, 0*0Pp45D[ FZ FY F\Ѝ  BTꠀR(i  0 0\ЍTZ DY  4ig8 MbQ, L, ,,  p@-P!@P 0E .R S0P*S@U .T@@Tp< <0< 80( pQA.@T@4 t+ + @-$MP `@P` 0pv> 00pp< pp_p  嶪Pc$Ѝ+ C-@P@ `p MPOP @U /HP@Wt Ѝ @Pt0 0000 b0 P"@Z0S0Toᨂ#$' |x* |C-@P@ `p MPx@P @U GP@Wt Ѝ @_Pt0 0000 0 P"@0S0Toᨂ#@0 hl) |p@-@P00CS0 S u P `0 PpJ`u00CS0p  Sp R 0/J@-M@ 0  0000 !R !0@Ѝ@-0 S 0@Q0 R  004S 0@l@Q0R Q  R @Q Lp@-DPD0P`@0pp 00p@,X0Lp@-@ @ `@0Ppp0p@,LA-DD p@0P`p0 AdLC- P0`pMpp@ H 0D @ <8 @Ѝ: LC-tt `pP MFp@ ( 0  @ Ѝ:dL0 00/L0 00/L0 0aLA-TT p@P`M p 0 EЍ|L 0 0L@-pp pM`P p@ ( r@Ѝ(:LC-|| `pPMp@ 4 00  @Ѝ:tL0@-P@(0( M0 0 Ѝ0Lp@-D0D 0@0pP p@ X9pL  0 DL R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0 0 Hh) \) O-q Mp@P`P&X/*00T*:Y@L TT  T* p P@ 0  P0 P0p00000 Ѝ0 Pp Ѝ0 wPpDWXW X0X XX0 Q Ѝ0 ^Pp ( ( t ' ) ' O-M=<;:9876543210/.-,+*)('&%$#"!      % P^*R 0S .St 0Sq 0Sn00S.Sai7YD =400S 0'0C  :  B_P5D0SyD@  0D;pD+0S0 `【t0`Sp 0S @0D+@T 0Y4  0d  0 |P|T&= 40 2 ݍ<Ѝ诽8000P0 0 _P`0 0P:,=400D S5D;d 0D;50 0 <P :  BPH+,B0?Q0SH%H5H 0<T H ,0@$寽800P0 0P D;0B$ 4Q<040d  0 PxD; Sw*4 00 B$0#8 (0$00(0D+00pCW``W,p@D+ < V@pI  0 PBWʸ 0 P80 0P0|3 00W0#80X3 D0N 0C0 . q . 00CS W0A 0 PD;`0DkV:H+,B0?R0S"2 0T PH ,0@` 0 D PD;D"0F ID;4b0`d 00 0 DPD+0D  d  0 3PD D 4D+0 D+d  0 PD+0D;`Vs LqpD;`V0D;s 0d 00 0 P0($p`C : Px 0 Pp 0  Pg `# D" " " T e <4   d  %    | @l p | x  E L  0 4     * < ` \ 8 4 (   <  p ( VUUUp   4  P \    X L =400SD 74D; D+ D ` 14D; 0D; 1Ed 0 0 oPP:D 4D;la0D;`d 0 0 VPD 4D;0D;0d  0 CPD 3D;d 0D;20 0 0P :  BPD0` Ct2 Pp( P_ 㠒 `/X0 0 F P0H0GW^ F 0 P=400SBD 3D;d DD0 L30 0 PdD0` C3L pP!W W 㰓 `/Z 0 0 FPG0J 0GW  0 P9dp`D D  PD :Wt 0 P%+YD  =400SD;d0`d 00, 0 P D0D d  0 xPD;p0SD;=*$e`D;0SD;5*0d 00 0 \P=400D SJ2D;d 0D;50 0 CP0($p`C : P  0 .P@0d 0860 0 P=400DS 0&0C  D t6B!?C0 Sa 0 P=400D S0&0C 0 D !PpD;v 0H+D;`D 6" 0 P\D; D+ D ` x2'*D;媠0D;7Z 0 P> :  B`P6 0 P.D U2D; h0D;`d 09 0 PD @2D;0D;0d & 0 PD )2pD D $2D;`D 2p`D;d 0D;80DD 2`D D  2D;( D0`0`L90 0 NP D 9B!?C0 S  0 <P=400DSt 0d 090 0 &PDYaD;  1RY`0`p 0````=00H+%H F=00pP x: 0``: 06/=0H00C0D; YH+D 0S  0 PZ=400SD;u R0ti-4 Rh k0`d 00W 0 P7D+0D  d F 0 P&D0D d 5 0 PD;D 0SSdv7=400SD (1`D D #1`D;`0D;<2 0 0 hPp 0 D P D;m`D  0 SP 0 D 0P D+0D; 0AP 0 D nPr D; D   0.P :  BP=400DSI 0.0C =` D440 R 0  P0($p`C :  P 0 Px:  Pp 0 PhD 00CS / =400DS0$/0C  :  BwPMP 0 PED D f0D;D a0D H[D \0 7D;Hk0D;=00PP ?0 `?06/=0Hk0 0CH+0W :  B0PD; pBqWH0`〠 `W@ D;1 Z2  0d  0 aP-4 R 0B+ J-4 R=00H+9$H{ᇺ=00`P0(,8  p0(; 07/=0H{0D -p0C H{D 0 R:B!?C0 S 0 P=00H+#H{I=00`P00+P  p0@: 07/=0H{0D -p0C H{D 0 0 PbD  :  BPW9 000#80( D;0Bt) 0h)0C  D;0BP)  D;0B<) 00Q0D:@H+q 0 P 3Yf  0 PD;`DkpWE 崨 GQk D0 10"3h(= 00;D0==0;D020 200;D000300;D0<=0;D0D10 0;D 0 JPDk`Dk0S70: 0D;D+0S01 p〠 0pS( 0S `D+`V 0Z6 :d  0 P D0 =10"3& 00;D0==0;D020 200;D0D00 0D;DD=  D010!3800;D0==0;D0+D200+D;D+D+D=0 D !   ;D+D;D;D;D;D;DqD  0 P<YD 0S~ 0 P0D; 0BD% ` pPWWh  `/X0 0 FP0H0GW ɸ 0 P` pPnW`WB 〔 `/X0 0 FhP0H0GW@ ᣸ 0 [P0$0C I-`D D -D;pD -`D;`0D;32 0 0 7P3d 0` 0 (P0S Ls`D;p0`SD;0D;~ 0d 00 0  P0"0C =00H+!H{==00`P0# p0|2 07/=0H{0-0C0D;`0HkD;42 0d p 0 PPD; 0SD;.*! ` *ؑ  D+@Jp Z 0 P3 0d `E 0 P%J`p@ D;S:4 0 P[=00H+y!HkǷ=00PP ,10`0 0 0B  c$M    VUUU     h l X @ ( |     HH   `  @  l | 4 0 K ( ( h p $  t  x  `   h T <   | d d   | ,pD;p0D;` 0 P1d `0` 0 Px0 )Pp` 0 PhD ,D;`0D; 0 P[=H 0g`PS=00V0! p02 07/=00-0C0H; 0H;0 P/X 0 P'D N,D;`0D; 0P=H 0%`P=00V0" p02 07/=00-0C0H; 0H;0 PP 0 bPD  ,D;`|0D; 0TP=H 0`P=00V0# p03 07/=00-0C0H; 0H;0 dPH 0  PD +D;`t0D; 0P=H 0`P=00V0$ p04 07/=00-0C0H;0 H; 0Pi0 Pa\ 0 PX=00H+Hk =00PP3 50`5 0! 0 P5 0B& T+D;d 0D; 60> 0 PP 0 P`  0 D P 0 P0v`CD;p 0D; wP: PD; R 0 dP/` pPD;WW$ L `/X0 0 FJP0H0GW ᅵ 0 =PW 0 2P7d 0 0  $PW 0 P< 0 PX  D;0Bp( 0`0DkV:0(0C  D;0B(  0 PoԘ W 0 P`  0 PX$ 6 D;0B<) D  0 PF` Wt  0 P7  0 P/ QWq  0 Pi : 0B)  D  0D D DDDDD^PDkpW`Dk@- @R  MAP  ,0(; Ĝ0 Ѝl MM$000 1 2Ѝ/OA-PSp+`@ @V0 X :@Ot@PU )P(0P0TPD0?T0S,0, ,l0 PP8 x L G-0pW0:@0`?T0)0 ?0 0@T0T?0P0S0 PUT0 "$P P@@( 0 A-QM}p$0PS@` 0! $, (0v(`Vl0Sh(0S0! , $P, (0V-ʨ100k(P\, 0 ^,0W /  , U/ ,(0T0PT(0 S70P$00Q (0, Ѝ 0F1P., (` , \(:0,0?0s0\, :$( ,00(0 S PU$P0 "ЍЍ0 0 (( 0 A-QM`$0PS@p 0! $, (0w(pWp0Sl(0S0! , $P, (0W0<0000+P^, 0\,0Y U/r ! , /r !,(0 Q0QQ(0 S80P$00Q (0, Ѝ 0GP/, (p , Q):0 ,0?s010Q, :!( ,00(0 S PU$P0 "ЍЍ蛿 0 ꓿( 0 G-pP@`Px Vm T} 0  Œ<U.@D (?O0p  p0 <U. @D()Œ?09:  TT! T 00!#2<0^0! T 0=    0 0 = 0p W*0@W0@|0| |0 `0` `0 H0H H0 } p 8 l D O--DPP@`p M V 4匴4 0 0:x4x0 00 0 :`4 0 0@Q 00@=Q 0Py Z< Z Z V WoP @CAt@ @Qc 00@=Q\ 0PY  C2[ B0@ 07:SK@QG 00@p=Q 8 0P: V W5 C 1 03[0 07:S'PQ# 00@J=Q 0P V W C 00 0@Q 00@,=Q  0P@ ЍP@QqZ@["2 0P  ЍPVP WP @~PMKIPFPQ 00@=Q X cP o0 ؔ|  A-Pp@LU`, T @0 x0W``W0*.pPE\p ^0070.200 0 S037#P00 \00( (0( g 0ࢺ /o/௻///ጜ@-` @0 0DM0<000p2 0'0 RP*00P@0P< 00 0 <0 30DЍ44 @O-424P0ਂ0M #੒ r i C2'r0ApqB# C@$Aah!d`P3 @@C4*T<WDYLX @00 SP*Z R 0s0L0 @   00 R 0P0@P0S, ЍW 0 jPD0 `PW H0 VPY 0 M KP X D0D De0 ǹ @Ѝ: %I$| A-`pP 0S.@ ȺT$ 0D0 .R T  S\R C @D.R @0.  0T  S\R  @@ꚻ( 0 0@-0M M 0 P@ 080P Ad P,0o8 ,0 0 8 30ލ Ѝ03됍 0-@- M0@R0  lPP * Ѝ@Ѝ/ F+ Ѝ@Ѝ/3PR0@- M P@'PQP0 ? Ѝ0@C>)00 Ѝ0PR0@- M P@ZP*P0 ? Ѝ0@C00 Ѝ00@-@Q M P5PP0 ? Ѝ0@Cݺ00 Ѝ0p@-P@tCP p@ p@ p@-@P 0P   L  S P   p诺 0 pQP@- 0R R  蚺 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  uP  T@T @pgP |K 0 pp@-PP @UP j T  @`P9 0  00Sy P<{ J{ @Y L 30jS*k&0B:HX 3L RH0s { 7 @ŬPP   !  \TlP@ 㘭@P T\Q 0 0B AARQ6`v $   z (0ح@P @P, @٬,(0@wȭPP XwGPPrP2 A< XL H0S46S{l{  ^l{MO{^JN! B"$ :co{@ 7 XO{O{L  Qt1h ZA 0Y0jZ0S k6 C AH{{{*10 SYb{{H0$&0G?DVZ@0omkig kkf{G + 40S:0:G{G#0dI0 00<0X h0 0?A?|0P Pg < 0P 1 @R  _0 @$    < $10LP`MP P p{`@kp{'P@W{LA5@Lk{{'  AP{FDP`,q5排d́L BK{:S03:OXO{O{ QN 8 @-PP@M; a `p@T+ W 0 0 忚0  z8P L  0 Ѝ ?@<T Ѝ <8P @ , ,0, (0 3$L ` a & ` 0@-PP@ M T 00P00 Ѝ0L L0L H0 ༙T0 000 ,0 ౙ4a = _ a D& _ p@-@PPM% U. `V V V Ѝp003/P 00S00Ѝp0 0S0 02/ЍpL L0L H0 tU0 000 ,0 i` < ^ _ / ^ p@-@P`M* V PU U U Ѝp003/P00Ѝp 00 3/ЍpH H0H D0 10 000 0 '_ Z ] ^ ; ] p@-@P`P U  p@Cp0 0 ; \^ 0] *A-`PP@M' U0 T9 pP @R T7 T T @ЍTW  0@0R'@Ѝ ! 1   0̘U!1  0T 0 & 0඘R W  @RP ` P tte @ @RP pt] : <\ ^H] \ \ _] \ [ \ 9 p@-@PP U  ;p@mL L0L H0 iU0 000 ,0 ^[ 8 Z [ `[ Z A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0 0  0Xl l0l h 0 WP P0P  0Z Z Y Z <7 dY pZ Z 8Y DZ Z Y 0@-@PMP` 0D U8 0pS SW- 4  P R`V V4 V Ѝ W`1 00 R 0SPV 00Ѝ 0 0 ग 0 /0  00Ѝ K Pp 44PX \X W X P5 tW LX 45 p@-@PP U p@T }P P0P L0 eU4 404 0 Z(#W |4 V ?W 4W tV p@-PP`M1 V: @T T T Ѝp0 03/P 003/P 0 Ѝp 00 3/P 003/ЍpL L0L H0C/V0 000 0C/V ,3 PU W\V 8V $U p@-PP`M1 V: @T T T Ѝp0 03/P 003/P 0 Ѝp 00 3/P 003/ЍpL L0L H0G/ྖV0 000 0G/ೖ 2kP @Qa 'kP @Q㈀ kP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] jPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $ $ 0 ]R& PR " YXuP   Z J b"r R ZzA @Rg .R`P@F0@,Ѝ P` 0D0C  [4:7( 0 ,Ѝ0 0 ,ЍP   0  Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy K K |0G-\aQ`M*0 S) \E p0P0S? @S2 0X:U  @0s00@А@@ P 0S00@BT00Q0Sp p0p l0.gAU0S!PPQP0Xs(0@0` |`F E E RO-P3P#RP3 M0U 0p`\ @W @RH R R4 H(00 ЍW@ Ġ[? A @ GRPR@\ 40S @[0V0A[0S 0 0-  Y*@T*0P 0A\ R!ɑ" 40S 04 0D XD D - M| ЍO-`S,M@ [ ` 0 `S 0S0\s0{ @\e ^vQp`0030Y?$00[00003 `0 0PUX P0S @S^  0r XL*@U pP0U00S 0 Sh*`^` ^ F Y[ R0P Z PC w(00P0S 0CQ * 0G S0S 0 p  0AQ|Q0"1 0^0[ ` 00K(0@0,ЍAUz0S"  ! 0S@84?<00 R~^ 0 S"000R0 ABQ AAX QS R0S0[0Y0S< Y 0R `? 0)$ @C /P R 0 0U/̐@00,Ѝ @H0?X0S` `0` \0U/Ⱀ < 0$ 4ঐH0C B ? ? D? J? D? > j> p@- M P0 `009p @ !Sp < 40 0 1 30ލp@ A-P 0 0M `0 10@0 (q{p 0 p0 (0 0 1 30ލ T Q:/R/0S/S:00/@-\@3$* 0^ @R R R =( 0 0S0QA^ R! Q 0Q" 0 ARL @-  RQ0A  RL   0 C( 0 /C/A-@P`TP' UVT P @TP 0p Б 0 ʑ( 0 0QSp@-`P@ PP@`V  0R p/pA-PAUQU@A`pPWڀ1AP膑( 0 耑 0 x? 0 Q" @-ASRB 0@S A[ 0 U( 0 /-- M+ ЍЍ/@-M@ p TЍR/0-S0 \S  R 00O-P M@P 0DT"S~ ` jP-Y` +Y Q0Yb T @Q ppt`Ppgepi`P" [-SQ& K0Iq P0aIQW0IAIQ70IS| V[SQ;+ 겐0S \0J0 Ѝ Q0YXP(0@ \ @ꎐ0 0R 0 ЍQ} 808 8?0 Z^ AL\T@n7 . 0 0 0H EA-(( rMPPp`* V2 @X0^00pAtA0O00TAXA\A  PPk0 @t0 0 1 30rߍX0X XF0 V<0< <G0 z  0p6 H6 L H6 6 0   d  -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/ O-@SMb 0YSg 0p0S000!R !03  aPP E`#3?`:0P*Q30A !!!! P = 0 ࢎ U 0C pSP0 0@pQ 00S  Ѝ聏T 0 @00Ѝ@0@ @@0 Xo 0 083 3 p@-@`PM s0 r0@sЍp0 0Z| T8+p@-0 000St@@@pdPddP@P@P o0000 0T p+*0@-@M Ѝ@A-@`Pppp0php IT  v<0 )LW  A5l P, d @-@P0S 3/000S@tA-pP@`  F >d000@P p@-@P寉Ppp@X@-@!1BMM 0`PF040@@@ @@>~qPpS p10S d!p0@ e P@A0@ P> 1 0G!0 0 4 302BލЍ剎P @P  4/P Q Q 0 0Gx0 00P k0 0 f @U x40 (, / \DO-qQpMP Ap@f a@0` RD0 0]i1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00<VQx00p@@7ЍP1Ѝ<0 0F`. &%D%% 0@-@PP$M U" 0 P' 00 0 P $Ѝ0`0` ``0 XUH0H HH0 ND$x0, - 4, ~,, , A-@PMU  RN h10d0SB P1PqPa0P0p` #)/0PS-00允000S 000000 000 00 l ЍAPP00H H0H D0 ۊ+ Dd + + + + + *  + <* D* G-P9 0S@P$0S!0p`PP @0S PU @@P 0U00 6b`@ 0@  P` 0 000 ,0 ↊`! ) ( ( O-DdMR@Pሐ 0 0S Y 0S X4000SDd`0S00 ,u0$004 0  0 0P `W003܃0 03U0@0 Q  Q P0S/ 3/0 0)@T&0U00 L0 0L00\PK 0SH 0 <00@00<00LP; 0 S@Tp@RP00S," 00C0T@dЍdB,@@@yP20\} 0,0SX  R20$   @$(0`e@[$0S(  ( @0Q0Sp0R p1S `b!1 0&( ࠉ0S-l!l1l h0( ┉Y @dЍ@0 M 0|ЍZ0000@Ѝ (l  t @-@P Zz0#3@^z0 ;0 <  p@-@QPJ 00!R ! 00! 0S uP A0Q0R0S`' 0S 00C000P0S 0 U00SpwP#0sqP `mqP  `0` `W 0ʅ  A<0< <<0 ྅Շ 0`04" `" " н," ! 0-WM 4@.T0彆  T 0 M      切vh " _@-$! @-4! @- RC/A 0\R#R! R/p@-`P@ T P0F R @P  q00pT P808 8?0 EP0P,! ! - M ЍP/D -0")2b3c1@2`M1 ЍCp@-@PPM `  0 P`:>p`Ѝp0 ;0 D  p@-0@Q r P p0 S P1 p{PP   ! |@0O-`M p]~ A QP +5[% 80Sz SQ  @T Rs Q)Q0 <0 婆" $W `W `{Ѝ @xTQDQD@ Q A[  P<0   L <0`0 <0 QCW   `V0BSTQ; ` b  <0V 6TP a|PPl1 !P j{ P T@@`   2  _ 0  @0 a`P  0Q/ R  B / 0Rp@-@P*`0B @!R@ @B@DR@@@3 ោ0  `f2f`pS@ * A BP   ኄpbzzPPO--p0 tM@ 0x 0dp\ h ` -R-+*)('&%$  000R 00B S 00$0P@1T00PCTЁ0Ad @00B S0\  EPJ00 dp0d00+Sh -S,0,00d000C PR0Sdd00S 1CP*0Cd0d(000C Y d00L0C Y( @Pژ(,P(`(0\S 0p\tЍd0W(XP 0\0 0( 0 B0S  S ?o200Zg{T@Xpp XGڐ7 f01k5[Xӊ 0Sy 0Sq %0hS 0pHpl00XS `d` 0R RKQd000S\00\0R  hy Y RiSa IS^ NSd@d P 0 \0000d00(S 0h 00nS 0h dp\0\u   Z% \ BdT0 0C Y d0Y ( 0; 0d0000H 0\00 0 |PH h lpHpWg  |501{'pH `{Ph; ` l BpYlp f lp`plp 0 A0S@0Q,0|GY  Rh` %r0`000$0, Sl  @00Sh,0@0000 00_ 0( S? J 80 0˟۟:( DD@xPP   ! h0x`P h   !݂`ply0G@P00 S( 8 B p,0 G(8pS BpGpp W Y (0RpGJISGQʹ 0SZY Bz@P zpP 0S0S  pz00SPX} 0 S # Z @0, S0\0 [ 0h S 0CQ 0 R00S400H00Ja00` 0# R00lS 0<0VI XTzPM TQ0hSN x h7zPh; 0S A ^@0, Si`0A0` Nx LxX` l0<0 Co4 婒RY )K{8Ik{Zɋ0SV 0x.x,x*xy`PT ?@?AV瞯<` N4?|Ddp( pg  ,001{p W'"Ux0p0{0z?C0C'zp:0 0:AQ'0 0R!:?C0Cp4656:m H 10{  0QH _000d0 R `00W'"t1|0{0z?C0C'zp:0 0:AQ'0 1R!:?C0Cp4656:* H 20{  00Sq l d00S 1CP00C(0d0` 0(0Q Pd@P d00Cd0Pd0 0d0 00000h \0j hxPh& `0 0`0s 0300 (  J1k{\00G 0 G3PlP<  OZ 0J4H0  Ph A ^0S7 ` 0Q0`0w@P w P4 v4 `#8wPP Z% jxPP hdxPh @0 0C@0l00Cl0v vh"00 Z 00΋H0000H^4UCZ{相00 zSI8m S\ ˋ_5aG2xPD{zI:țv\0H 0\00S `0KS0 hxPhs  l00C l0  0vvvDvv 0 l0RW 0 00S S SA hwv0h00 \0000 @BAR *0     00  0 b3"  0Sl $0S 0P0\+"0h 0`\00Q00\0X @0\0"0h 0Q000 \0h0 "00 0 000h ?8 NK hwPh l0` 0Cl0H!A0P@!0\0 0J 4 H0 0,0000000c0010uv0ov0S0 00 0dh0P\b0h Sdp0p@00@00h40lly00S 40u400CP*h@0 0Cl0`Ph L.vLL(vLQIQ # \ (Yl00P00\0, 7 :Sx2 0!l , n:6l0u, `0"5S 00 0Ӂ!{'\  H  eP2 0S400:40H0相00cH00S R0  , B0 RPSЁ S,\X Ч  3 00  h{ ' A1{(\00H 0 P ,0C#pq 9u, 5`Zi 0S h`0 ||P0s !,0 00C \` l0IZI0S!0\0?0@ ,R08ZvpP vP20\0l0  0Ch`l0Ph&S0!0\0 A)0S E0SA @ 0 00\h 0h000,0l0P0\0p0\00S!0\0 0 0#[00Sh0 Z 0S U0\0 3S 0\0@0, S0\0!0\0h0 R0S$00$0;PhB 0`thP`00`0!0\0l0  0Ch`l0/Ph)O- 0RPPs@PO ``pP r{"8 +8!80 X#0H0C X0003pFqWGL  r"8!8 Y0@@#Z 0V 0 a 0sPP   ! }s@`@O-3ß0 M00@Sp 21 `000`C0  00 0Sl  0Sg SB0S00XS 0QZ P@  Q R^T#3\QcTPQ0 ^ \ <0QR- U00\0S{Wc*0 GV*0F@S3 F\   }0 RVOWM 06S ЍЍT@DPD@ Q09 Q0Q l  l>P:00XS Q0L)AoR^& 0 0S  0c1# 00Ѝ QN0O0l1 c, 0# Q:v00Q )Q  0x O-Mp<0` H8@P00S 0@0P 0 B@0P 0SQ^  H0PP   Q0DR0^^ 0S 0S S SK pPr@00@0 0Rr0W@ !+|pT0 Pe 0SUP0 @0 0R R 0\Pb S 0CPPa R@ 0D0CSڣ0SrpP[ 0[0 0 RYd*0  TDQ @J \  T @   T 0CC10BrPDP|0S0SCU 0S S S r|P@"00ЍSu 0CPP @+P~ -P% 000LP 0ࠃ:L0@^ > L@YPl #@Ѝ000 PL 0\@0Q  R  r KS S80S pq0p00 0p b@0|"00@@yP  D21 2 Qn\ 0\0C 0 ^  00@Y 0Sg Sh S @0p 0ЍI q PePgt0S``q>|@"00Ѝ@ @QA@ErpPJ 0H0Y@HT   21@4PE>@80SjU U EP 0 00b80S80S800c8080S Tp0+  RP!@L80S L80SH00@X \y0l 00f@`  BR"@^ 1P5"@!@V+P(&l A-`< RϠP@pl3 ^dpP 0 W`0 p0U0@PEPU 0 BpP `@ pV  0 BpPp0U@980@-- M@ Pr@r0  C00C2S*ސ*KU Q6cZ AKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ y0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/h<A-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0@- !P@M: R @ 0S R0o@Ѝ@-xap`@PM? `1PIPP3 pP-0S  Q> 8p 0: S#w0P  uPP  @0 $ , ( Ѝ:zO000Ѝt0t tE0 x\P&z 0 Ѝz 0 4 (Tp@-@P "l00CS00 P lpP0 =0 w44@-@P 00CS00 @ 0  I0 wA-@PpT 0rSM wS aS_` y00\`0S e C+Sr/ ^R$ \0SPP0[S0TS0US0`SP`0 >0 UwHtPp@-@P7 0S= yk P00P! !& 0S 3/PP೼000P @ P !00 `00aa^kd0`` 0p xbP404 480 w%y 0P0`@-@P 00!R !.P 0C 0 ;0 vꀂ @-@P 0 0 S 404 40; v0 0 S@.b0p@-Q@PPD 100S3 0 QX >000SC 0"$0 3/0P:s008p00P @ P 00< R 800pIu0P| 0 J0 xvaP00s0#ip  0@000 pwx  0@00pԂ dx\-Ѝ/@-@^S S S Vx 0 H0@ ,0@ 0@ 66@000 0 0000/ ?`4 ;`@p:pAB98C D`? >`Ep=pGH FI`Jp< (O KLM N匀FE`EF`GpD ŠK`DpG JpĠI H`H`IpJ KN M`OpL`0NM LpO`pC` pBD`Ap@`EFpG`ˠ ^ʠP`p A/`p^ APpM_Ām[PQ 0pPM`Q 0pܜPBQ 0pҜP8 Q 0pȜP.Q 0p徜P$Q 0p崜PQ 0p媜PPQ 0p埜P UލލvOv ,!aQp@-P P4ATp  @P 41S P0p@u@A-4!@ pP31S L @P!4Q w0P0W0S!R PMoPP !Rp /Wupupupp@-@P 0@p@A-@`0P] VapP#PQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V +u0@A&u @O-,M0 0 S ! (sp2/0, (Q0 P `@P@P0S$Pp LZB @PUXX 0 `P_ @\P0HŸUJ[e`pp,Ѝ 0 PPuA $`EP[ 0 $ p`P5 @\P0  0P 0Q QA Q  PರZ`K@(  ǙP 0 P @PP,Ѝp  0pP ,Ѝ 0 ӜP@00,Ѝ$`  ᘙP(@HT 1SX0$(Q $(1ն`n0 @-@ ! \ @7t,1t00,1S@-@0@ "t00,1R@-@1  @0t, t ,!O-QM `y0Sp1 Pw`@PC QP   sP 0 pssPQߍPm 0p '0 YW \T A/ !pP  0'l'%%ȠpP `'.h%t.\  ( (!!ȠpP"|"X `.#l(!"$ pP ` $(,p0`#0#4)̠))T(,0((4# '+/p3`+̠+P '\'(!"0&&8 +'t&d$%&()*,P- .p0102`48<@D)̠)X)$7;?C45P6 (|((4 l !Ƞ! G+(!+\+9:0<`=>@ABE 8pDPF|H`'&&&pHIJK`L0, p  A AA` P  L0 H HH岰 S+I !!!EEEE,TGPGp'''NpNNNR.FF`&&Ƞ&TCCPC`CpR'BpB z 0ASZ RVI^Rl  a6/@ PJ(P 7bQPP p 0D A2n0a!NpW QS`0QVa```$4a$PP @xCxßxx#xcx0p 0 0! pQߍO0 grzcr Rq^rQ  P2"8 P40D p@ ppW PtP0Z4U QS!3Y 4,"YYe@4lpP3` D H 0$ `+PV<0EI<0,0(ai QdPPS q@̠0(Z 0(084 Pp `D ap@ pP(P 8qP0`Q ھqPPqYqBPqqLo a|xt0XO-@(`10p  0A$!1kP@. 0pPS0 200`5W00T500L50 0D50 0<5004500,5000 S S p00P p 0@Ѝ[ʓ 20 2 00p *0Y 2Z 00 20120ؑSI 1S 0 k Ijp@W*wpW w?w? ÑpÁ 0b,P0 "m  ,P 1Sk0Sh1Se,Xp00Up0SQp0 p,P  j,`P pW010!! 0 pn .- *-0 29 20 29 20S 28 2 R{ X2@SVh09pa 20 2j 000v감 Y3Y#c2 20,0 , QP1P:0 "S  "J  "#,0 #(#4 0p W,,,Ġ$ ̠# Ƞ ( "! '$!!,0&"+ (""$* #,/0, #(#4!%)- .0 oO00P0 0 mؑl0 `0@0S IY㩐Q*y0[* C00C >1 0C!s0 1! 10 0 0>0>(0 0S 1S RW  R[J  N& 2  0 zp >& 0R1 S0"1!|1|!|b0 gS %&0 IY㩐3*yI Z[ PT0{F ! {0!10CS` *v00C S010{/ⰰ1p0p pb0 fX0X Xb0 fh00=H tH T<l|O-(0p RMB @aP0lb0PP P FP.>1uP0y1JZap@0 R 0 1Q@10CS㣰M* 0s0s0S0 Q0q6T10C1(0 0S Ѝ@ Q! R0(0 2 0p0 0  PM  0R1 S0C10 p p02"b0 &fTPf Y 0I p1P 10CS`+*v00CY:YQ[10CS`?*v00CY" Up崑 (00(0O0 1pP(00(00!0!0=1!b0 eQ e$`P @ `AP=(00(0 $ 1 ! b0 eP@00 0Pp崑P b 8$`P] 1`0CS㣠*0J 1_P(00(0  $(00(0 $@0@ @b0 eԦL\`pp@-@PQPp #P 0 0y$p #P 0 0m$pO-`2M00|2 00p2,00Q Ui 0E 1#@P! U0ഠ p0  pp QPEUP*uPU0SY P.P PЍb0  ep pp J<1wp扐0HX㴐p1P 0 R 0 1QP10CS㣠5*0 0s0S0 R 0r 6 S10C1 # 0 R  ZPP PPP 0! 0#PP #(0( (b0 dꀤ,x ĢO--@p`QM #00 V: V f0`0Ѝ(0   #PP 10CS` *v0S 1 1`0CSp*w0SV z#V` 20 2Ѝd7d0:0:T7T0 0*&PPG  R Ev`Y* P 0PNa 2`F `QV㴐: 0*b v`!dY:aᴐ`FV 01`-*v` `FooS0Cb0  P 0Sp? 0BRs00`0QPEUP*uPU(P`0%0b c0 "`ЍV*v`V~Pmo嫲d "Vc` "00P `0" Pj P0 Rz 004 0: 40:40: 0S0 "q, WS 㐪 v``FYd "q W 0G 1 "PP aᴐW`FV`: 0*b nc3#b0 ec3#b0 \c3#b0 Sc[ g"3#b0 EcmP `P R" !PPU 0R  C" !PPE괠W1 z 崠01X0: 10P1 P0 1!" !P#V"`& e0`0c "* P 1 0: P` 0RY ZV !뼁,Yp B XR3!뼁0Y p0H 1I!PPD 0*bb1`Fv``w01 `1P ! +!PPpG 10CS`: B1r` W `0pG1 !  !PPN\̜ܜ`p(ܚ4@-@PM 0 0P Ѝ0 50 Mb0xPO- ß KMM@PčP l 0US00?4wpW0S0R CI T/ 9P 9d005d0p0l"d2 0 4 30KލЍ 0T 000; I00/ Z,Z* 0J/S  00P00: S c0 p0 R C Rc?00D1D!D?0 a4 <0 0100U# - :p$c0SY 0 `0 S00R0K [  9Pc00}0S kp psgP cppGore0 0 `.`dR Q0P:Q0Q:b@-< @-@@ ! @ ( p@-@cP` ]`ZP! p@ O- 0@TM0L3 pP` 0L0 D@ @ (,8p p $00`4P<@ H@P P "  p'gbȌP% 0#  P !@$d(ah  P% l` ca+b(*alb̌` & gx)c: eg` .dH(ଊďeZ,a*aȌ b, 㼋dL+d<.00 0bhc`: \&eb(* a#a` *錈g|(gȌ,igx(ǧi ,00dH+bldY̠eZ&c:. ̠dLe' t& @-L"L2 HB0M@000A0S $RP@P2 R[ "1 0 0 30tЍ0A0SaD@$ 00$0(00 0,0004080<0@0B10v 0\4  R `| \pv` 0  0 p@/  2p' T@@ @ R*  P|@|@_P0A0\& l L 4& 4 T` p\ @-MX @( 0T ЍЍ O-"2 0M Q0|00P9@  0T "2 0 |0 30Ѝ$@ zh 0Tl @I@@ D U10 E U p+c@ 0? 00 08:%VA UJ:ZZ#V c u 0@@0S 0000V`[LZ`  !1 ^X 0^0#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,`@ 0$P0#0p`+p ?(P)1 ` =<;:9876543210/o]6P 6P 0P#0Ġ 0jP8?CP 0P 0! 0H tp$ Hߍ0<RP 0 0Ġ 0>P 0H Rp HP> 0Ġ 0! 0! 0! 0! 0!HP  0!0000Ġ0Ġ0Ġx 0! 0!0 !{ 0!v 0!qL0Ġ t4o 0!` 0![ 0!x 0!s 0!n %0!i0R  0_HlPA e 0!T 0!O 0!( 0!# 0!@ G0!; F0!6 E0!1 D0!, C0!' B0!" 0!|2P @0H @f<2pH0 <0! ,0! +0! *0! )0! (0! &0!O0H @0p h P@0H P@p D ?k>0Ġ0Ġr 0! 0!z 0!ud} 0!o`0ĠXP0ĠSP ONlNHNNHN\>4/.ipJDJJI0G-` Mp@  000 0%VJ QP0S  PPL W`A 0S7 P= Tp8 T 0S: P8 @V (! 0S01P0PW 10 T @0@0  ɺ Ѝ WPTU U @ U U X00YY  @ D,,+ x \ 8  *p@-੹0@T 03/@TNdPP 00@T 03/@T\pH00@T 03/@T$lp( 8 t 0@-@M@P Ѝ0P  0P p P(0( (A0 KЍ0)`FF`FO-pPR M ഁУ@  `880 S" 0SJ: -# 0 Z  0080 S 0Q>0 # 0 0 Ѝ 2  0 0 2 08 @@ @ Ѝ  P00 0 00 0 tP00 Ѝ^P   WP  000@-0 P R@MPQ   0 13/Ѝ0s?0r? 9P100@-@P0U1!^ 0C BS \ L0D0p@-P`V@1@!T 0N B@n\pSVpG-`P @P0Sp:ؑI Y `1`! `"  PU p K @PǾpP pPO--Mq 0:P pG 0 PU  @P 0U`1`!000  0 "X0 PU0  ЍЍ0A- P@P 0 a`F P@D plV: f 0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-Ÿ2 0|M@R0t00P`\ 00S80S `h"`2 0 t0 30|Ѝ4P  墼P8 p0\ 14p0pJ`0$  8 0 0 `[9 P%8pW= ` ;1!040 *4PU 08  R88P@PX`0 A@8孾 12480Q8p :K0 S K08P嘾KP8 @P 8 ` 0`P 8pK00K08PyKP8pmK0`0h`eP 4 ~ O--ɟ M @pD$\  0{ `Vu 0H"4SkSi90Vm ,0:0l`00G0P.  ]00\ Sx S`PI \ 0P 0  0CX 0 !>01H@K0(0 Cp7K0S(00S0!Q0:X Z c/ \@ c/<0p 0S 0 Z00 0p 0SZ0SK00H2S708 R,0:' 4P0P\ R,0(P,I4`0( j@ 0  p (`V 0` 6(7(0 _V704`8X00 S  0 \ V Y P! P P X V0"2 R8\((\ :P00S 8Q 4Y. @ [`@' X`D 0SV 0 }EPZ【NX 0SQc/ 0 0 0SP ZB !SR@T =0S $0S  !QI0 0S 0@T `4  P!SR @T r=0S,J?00Z【 c/ \C!SRr@T V= R 00J"00$3 0 2 30 ߍ  p 8Qf!SR@T -=0SI00Z【 c/\p0@ &yI0 S c`aᢼP((\X` `0ᕼR48 0\R408  \P0` @ @!SRG@Tf `<aX P2 `0 R(S VPR V`Pa `8@40M !SR0@T <0ScI00RP!SRf @ f@ ``ѹ 0PP ` EH8@P@0@ Xv x@ @@ z!SR @T [<0S@ cut x| <z y | u t 0@-Pd@$M@`@ 0{80040 00000_0@l$Ѝ0r O-``ßp MWA5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @H0@"2 0 0 30ЍhTŸ <AЍOkT 04S:`X ~> P Pp` ;   `X  qGTpK`PYH  GT  QX ( Q  ` T 04S`XA @p~ _X` `H`pAG`@ T W`@Z~~ @-@0V@p Y ! 1*G@pU VYp:q?oT20S@` Pc0H 0 ^q \ @- A0@ @ €1p@-P@Q `0P ! "0 2pp@:p@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R00: B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/0@-@!@1 0 MR020* ^3 0 @TQ*QQ P1D"Eq0^ R QQ*QQ  Rl d0 0 2 30ߍ0D800230ߍ0@ .묻 к QRO-PP$MQp X 0#!  0 00 P `@0Ps*@ (PP%  8/P 8/P 8/P Y  0`0S00 00Pc8/P`T*0 0 @T:8/PY Y| 0 SYy 00` @TP* 0 0C0C@J BS0!AQ RS Y B10V[0*Sv* S:P@ 0pC 0 00j0SPg0`p%V\*@c⃠PW*0 0[ P 8/P Y Y 0 +  U [0`0V:$Ѝ  00SjY 0 0V Y0 00 0 `r 00S0 e0/R$ЍY u 0 S 0 @`YF PSc  BYYt  0R08/P 8/P  P08/ PP 8/P0 PJ8/0P o8/P 0 D0P 8/P S 8/P 8/ PPP S*0S : ?00S  fP? 0 @W P?0 M 0 R0"! RS  B#10S8/PU 8/ PPPL8/P8/P8/Pv8/Po8/Pu8/P` 00S0 l0 B0 k0 B 0 0C0C @JS E0!a 0 0C0C @J ES0!VX(((((R Q0P:Q0Q:@-C- 4PS@ M  $3/`t  0 >QP` 彯4P4S  $3/000 ЍMD 0 A- 4dpV:@T@T 0P R 00 R 0 00 ŵ@P0`0dp@A 0A-`M p@P"0: S堵PP P\ 0 =tdЍCP00ЍPЍ( $$4/p@-P$0r0" @`Pp4 $ U0000C0  0R 1 00 0 p  0% 04t뜮 $ 0@-S N  0!AR 00A0 eO-4MSw`A`ↁP@p0 T0? S-Pj $ 0  = QP R®$R PVSB00`000aS0@ `d 0V 0  $6/ЍS    00`S0a  R` 0 0 0  0000Ѝ C 0 C 0 CO 0 0Q 0A00/0@-S@  R   0 õ0S᾵p@-@PT @T 0 Xpp@T@P`pRQ3@-p0#03Q00S@PMVЍA0` 04 *P` F"=`4Ѝ%S BT 0`@0 0A-!1 0xM@P0t00PY 0SG@0 SEa`\`a!p0  5P9X! `p,`0 H z5 1 0H UUP @@T  JA@ 0 0 t0 30"xЍ0嘀 S``  .BT00*B0d0 00@ 1ꀺ눩 d D ( ,` 4(@Hw@-0M@ 0P m00Ѝ@-0M@0P `00Ѝ-4M0P S04ЍpC-DDŸ <MpϠl?2c A1A11A@@4a\00AD?8P<`@ Rd@PW6!1 0 0 30\ЍT00ì?d@DR ?\00S5 U*-0,!0 QP  0S0 QPW 0@d 0@T0@dp 0@U*0SP  PR Lp0  0U*0 SP  PR 곹Ħ Q T O--ϟ M|ϟp 0S㰰 ` pሟ` [ 0@00S %SP 0@zSzxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPOMBKJ|HGFEDCBA@?>=<;:9V@DS3/.-+)(5h[$zxD B)Q [n (-= 0 |0 30zЍBϠl4 @0 P $08, ##,cR:,c2S <  @@ 00CL``C@ @r  ^^A!/3b112A0<  ̟# cPp<5: cP` ;0!3b112A0  K0 S 0! [ K 0R Qd; Q00dP  ? [ 0 S  R  |;  B2:Q/0A!b0dP   [ 0 S  R   0  ``: Q00dP   [ 0[  R   0  `m 9 Q00dP   [~ 0 Sy  R sd)d9!/ b !Q Q00dP   [_ 0[Z  R T8 Q00dP   [G 0 SB  R < 0   ` 00 S00C  B8Q2@80/A!b0dP  l [ 0 S  R   1 '(0 dP0  R [ 0 S  R  1 p'0 dP0  9 [ 0 S  R  [ 00[006 Q0 0dP   [ 0 S  R 0 01?2c 1 R11Aãd0Sâ/d0CS0c0(6dP 0 [ 0 S  R  08  8   `W80S0 R05s0dP0|5 0 [h 0 Sc  R ] 0 0  `.Q0dPS004 0 [D 0 S?  R 9 [7 00[^0  0  `$ 0S!8 qp   dqp 0P 0# S! -R? S30 [ K  S Q X1 "`aa!B! #<0 dP0    0[ 0 S  R   0  `4   0  `z`0  0S=0  PGP u [ 0 S  R =Pw0` 4m0 S  1h [e K 0P^ QX0S 1 [P K 0RI QCUP 1 00 dP!/ b !Q    ~ [* 02P 0 Q lP)\(\ ףmP*`LtlDTث d  npd $I0$ S  R  1 h 0 dP0  5 [ 0 S  R  8  0L08008<00dP@0 0D00H00L0 0X0!  [ 0 S  R  0l0 S0Cڜ [ K 0R Q0S  [ 0[  R UPUP 4B28" @ $08VS_ gS 0 `^ " " N"N Ϡ$0B!l0 8 <40c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0h3dP 0o [ 0[  R oP 3Q00dP  Q [ 0 S  R (4`0?r<+<$+d $0< x+ 1|$<0 0  d%A- M`@P0;0p<0@0008 0@pPP T p;0E Ѝ;" 0 Ѝ;T 0 @-$$@M ЍP A-p`P\@\@M 嬧@0@0  0 @ឧЍ t4A-@P`\p\pM 劧b@0( 0  0 `@|Ѝ脍 t4@-0N~ \0N~@ T \`;T 0 \V; 0 0@- MP@0 P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000F̌0@-l>0F. "l@V,h @P^QhLl -R 0 P0R 0R R0; A-$Ÿ$20#Lc\*0Sm S} 0C l l;Sàʌ͌fc\*0S[ S@a 0Ϡa^l@Ҍ 1C0o 1fcf Qq P@\ pp0T0CH` G41@?L1c1c0P0B0P0BP`N4PQ` @PS( 0S l lVàڤ0@00002c2cPÌ l làL l là@)\P ף*Qgfff$IH 0P /0S/ 0 S/0S/0S0@//O--M0 @  S 0H$(@0 48<0L T@W 0R \ 000!10 R0s4 0 Ѝ0 S, 01P0% V 0? VP.42P Q%3PP ΌQ V"> 0RR!:∫ RF\0h V0PC F. l V h@Y(@ pRAh \ b 0V00V 0?0P 0 K0P  V    PR/R  RPy 0ЍP0P0 0P  R V,h ( d P/R  (  l Y`Y`"  O-@PF"F,l Rl0l0\"RP*;<Ѝ"R 0S*0Z000C R\`,⸠  `P 00R 0R0S 0V0W`2 z6 @S%V 00@0Q6S! BFLGkh@n&R2R $1\0  @P00`=02?00cS00 42lhVhO--0@<SPtM S 0S 0 C R+0CS`@0FStЍ0-S +S @pP Z 0S10ƒ!0 "hh0/ Y 2WCD00S R ;S,S S@0\- 0 (\N 02F0S; >S``F0F2@pP<.9@@i@V|hlp崠hpx|…崠 ራ 2/tЍ@pP @00c@00妠P $ 0 [   10 00pS0S >S0C 1 0H0:bP 0,S\0:XP 0S   @Dl6 ihƎp60 |ax倆0$吚<0@4P@PğȄȔ0(0`,p[`T @D pbX p1:|dbV p1 p!/0P``c V $@p(P`,p0@4P0C`($ $ @(`,0pcQ3010pcQ*cs SPQ" ` Q0#cY*3-S +SDP GD P ? D00cD043(`0,0p`$ Cj00,`0`4p8@$@(pO"28#!BcR^:"cR"20!YO Z c! \ QAϠ ce ^.࠳^5R / ! !c 0@?p00c`S+0X'*  `1 @R @1Y Y  0S,`04p8@0<0f΃g>0=$@(P`,p0@4P0  0,`04p8@0$0 Hp0R0C°1&.$0s1J00H2()\(\{ ף3Pp@-@@0S p@yPP @P x0 h0@:T D00 8 "S.@< ` [H2ث,A-PQ@ 0S# \ǞpPQ 0 `VU*V& `|FWP,W*V hd!0PPT` P`00 01Plh6l6Vp6ʄ0h;0:S P V _pHPVLg@P`HPpV`-`H2tA-A`P@ pa !PPPW(PqpAT> PPUS lQ8 X1X!@0d0 T000(aM@@`F T0P0\  R@ d?@D  }@D0P0T0S 00 PP@0 0 l0 00WPࣥT,D,$X h[@x t0@-^ F=<;:9r7n3l10/.,+s)('%m#"k RoNMLzj TyvNK|S WW[ 0W0   0Q񏐫00@0C \$ShPe u0Ss 0Wp1!PI  u0S 0Wp1!P9  u0S 0Wp1!P)@@@1 /u0Ss 0Wp1!P   u0S p  0Wp1!P Z u0SW 0Wp1!Pg uu0SA 0Wp1!P `0*S6 0C P@00C P00C P`a`00`F0C P$S2 uE0SWp10P 5 u60S 0Wp1!Pu)0S 0Wp1!P * u0S 0Wp1!Pu 0S 0Wp1!Pt  u u0SE 0Wp1!Pc @ u0S 0Wp1!PT p <Ѝ 9 u0S p 0Wp1!P6u0SL 0Wp1!P) p l  u0SF 0Wp1!P  u0S p  0Wp1!P u0S 0Wp1!P p[ p xp0W K*0P| <Ѝ@@@@ Rp4a KpxZ DpS =pL 6pE /p> (p7v0S p * 0Wp1@~0P H pu0Sk 0Wp1!PW C u0S p 0Wp1!PBu0SB 0Wp1!P5$Sy`ᷕ0P00 pu0SO 0Wp1!P)@J u0S p  0Wp1!P p p puq0S {p  0Wp1!P kpz dps  uL0S Vpf  0Wp1!Pu90S CpS  0Wp1!P00C P0@ 00K0C P$S u0S !p / Wp1@{0 S p  0 W p1@ r$S@p@-PP@ 0S0p{ 000p0 0 1"/O--ϟ oMMPƍ@< D0 <0S 00 !R !0s0! 0T0 0S   R 0$00 @08?ܰ0,0\0(?<00@匰h00XHPU @%U PU `D0?Y0S VU 0pP ` r01 0 0FZS(-&%0#"!/A     mM~ = vP    R^0s[ <0S; P=*X1RRXOX.TQXQ\Q"ˠ~@Q`G0D,TD< l(80<@P@ P@@0@0@00v@00F `A@00F S$V @J; \ 0!0pJ0`0S00``6p%x;$ 0z   Sl A0PS-0@tPr0W$  0,00SW00t,@R@@TF pr0d`( _L P 8 4 |PuP} 00S 0媕0@0S0000PP *9 0 6 30{ oލЍVa 0Pamr0(P@L0P08040! R PQ  R,  儠 AR5S 0000S0r00f1S 0010000S0G?0]Z_ (0@DT0 (0`000S00 0PCUJ,0P0|0PU0Q0Sx t040Wp0$ SD0100 D040Sx00Pt0| 7| @R1|0P3 x 0R0 BR0S@ 7 00S 0P00 t0$PS-0r0|0s80c ` (00 $00`0k0,01,$0  Z Q$ AP$  T` ,,4<2$0  Z{ P% !AP    Ra$,W, r 0S ,00A 0`sPH040S|0S00@ 0C(080ZZڐ0 0S@08@Z @DT 80`H0Si000  0T0S 0L(0@CT@T ڐ00S`@0pGWW0<D@@`pGW3 0S@ 0PB 0 0CZZ0)ڜ$  `PPd@`@JZ0S0PJZ0 ` d@`P0S0L5 000brPZT0%ژ `Pd`P` @DT0S0OP@DT 0d``P0S08600@0)5P! W 0TR)@ @R0` 0~@@GTX R> 0PR,P70`PdpPl@@p `@DT\ P@DT `dp `Pl@80\ 0r0KPEP=U0ڄHp@`PEU 0S@ 0P PEU00S090P0P 0000S0P9000000 T000000S05|@T00@ p0(0q0'0R)`;IP)3000NS `Vr00j`@P  L@(PP@8@X*X:X  0`, t<0SWx*x:x  , 0hM0,0,s U 0 ` R Rd` R M00$BN%R0f0)Tk``p@DT 0R`)Pq)@DT   0R@),,@,0: Qw $0 @$ 0  P,Z,@,0:T Qm $0 @$ 0  P9@ 5 PD $ D p3P$)uP)xPL RZӆ HsLPP`pPph4UZ`o40U0000PE0pGJS0C(00CS0S ڐQ`0;S@@ATT0ڌ8PP@DT 0S 08P@DT 08P0S0H00@0P 80P 80Pd`!0NQ00  0f0SP000F`B"Pr0T0H 4P``P` @DT0S0P 08 10R+ S0bB- C S!!/ @/cS#/L!b0C000A0 A00s@0A^B0. ^@0X0X W r0( 0@( 0` ( _L@P@8@0S0H?00p0(/(?( 0 , x00C@0uP PD $ D @P5 @ P P.QA $@P$  [SD$01DS-0`r0͵W$  ,0 0NQ0 $@P$  ;``4P0S0=00@0+%P#00H 0`@L P 4 ( _s0 U0`0 > ,$ UB040y?(0H0吊8Lp(p4(p 0Z0 `G G 0S T  S  R0 0@P8Lp(PYpGPPQ   PD $ @AD _|  Sr $SD0$@AD0_0, , Qb $$ A _   0 S $r, , QA $$ A _(0k$0`}H RA 8 A R R Q8(  LPH( @( 0`_4@`V|j`0r0lj`IPBp,0 <`0@,00sH` d`WSw @p&P4 ER.0 "!.0000AX0qPD $ D pQ $@$  PpQ[ $@$  PpSD0$ppD00Qe $$ A SD$01D$ 7QJ $$ A PD $ @PAD Ph`q040c0(0 0 0 !0 @P0X0 S< 1 0(0`p x04 ,S@ 8 G BPt0@d>h' (P4`P` @DT-0S0pP 08@0`LP_f`d00G0S 0c@P`GV4`(P0S0h600@0|@D0000@PDD$ @P D,D$ @P D!D$  @PDD   P@D D$  @PD HpLPP`p(0V`!D0DSD0$D000$ N? P∠N 0p@\ 0 @00o$4 D 0Q $$ AP  Q $$ AP  P $w$$$4$ , 0x 0B@00?T0v$  D@PDp 0  0$ 0  0D$ @P DD$ @P D$ D tP|@0< 0p 0SD0 D0b@Q SD0$D00$ 0$ 0 D@PDpJ$ 0 DD$ @ D_=D$ @ D_5 L P 0gK0@00`00F S?@A@00A S$Q0S7 q`0`S `$@  SD0$D00$ 0[_ 0 0 SD0$pq$$D0h0< 03pO `$@]@ꦐ0< 0$p@ 0SD0pD0 $ , RPPV ,0L 0,0@0/( hx ԃx $ ~@~'}}d} }>0@-@ M@P  0P0@  Ѝ0D 0@-@P M 0 0 0@  Ѝ0O-PP Y 0SI 0}  Rz p`@p* ]T B,B R  l R!1@ 0 0C 0  ` BR  T0`@p`@pT T 1 !,03/P0`0CS@D0R) T1 ! 00PXQRf,03/PZ i 0`0CS@D0 T0@pT`0  P@@P0~0S *R *D0 00PX @DX<X   R !,03/ PDRi* @ 0X:0P3  H  00 Q  0Z0C00 00yP  00C0000@C 000`Pu 0@00p0p pH0 X0X XG0  0  0 uuuudup@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 mtt0p@-@P0 0 Ppo 0P0, @j YPdpL dp@-P`@  R T0U:T:0T:p@H갎O-KU/ M pj0Piq` L ЍO{KE{&{(3@):0 SA. @0c 0c833:G{000@+S6LR S 0, UUGoPEEéQy?aCoc?`(?yPD? hn'0nP 0`P 0 < PQ4 0(0Q8C6j0 $ 2 "P PRP@J B,Q ( P$0 x P  P  @y $0( ( $0 P $0( S UWQS `Q` ZR R XW R! QS 00 F 0p p( 00,` 0 `$0  P00< `U`R  0   0Q``V  0RQ KX ( 0 R:  N @P W F P  @ pP`DЍWpR0C  aS 0A0c,00 X4( $0'`P WU 00X Y 0( $0 \8  kHK, \{KP | {k&[ P {[BJk{{X Q LJ ${ A kQ;0F{5q [kDk6k+K P5['{;k&C{5{0JG[2k$000Z X44Ձ v k{{ Q L{ AG{5{Fk{LJ< PQ Q    QQ,` p P 0 [ U[  UQ Q R,` p0w @P  P09S $010 D0 DЍOW00 0000Q DЍH[7 `kk( F[  { [%^F[h Q,@P$0( / ?@?$@@dP$0( UWQ0( $0$0( `X00 ?001k X{k&Ƌ000100 b[ ^\Zx 0 y ( $0@P$0( _ $0P$0W  0P 000C 0@PG 0S 0X40SPE0a 4 t@P3 00S0S0JS0PW0 W @P P0 Z0JV  s9R   E X  > P| 0[00~@{;$# \ \K{'k[E{7@{0 quNk[3{Ck6{Z0^0SN $00W 0-P 0e0 01k,K ( {{[F:N8N0CB:N@:00s001 RUW+ W 8ƋF"*  J @$@?VN 0r9S 00  pPw (Pq   ! ; 0P 0 d PJy X 4\Kk[%{{A$ Q N 08X 0U pp,`W 9S09 P $ 0000000ZX3U-Q$000^QQPQ S0 uQqQ j 0 s0R    000100D  0$P 0 4 R E 4|4 Pp,`9S,` p Xʡ<`Z^ $@@H-Me  0Ѝ-M Ѝ@-@ / ?!BC  @p@-@ P` !LN|  !@ApR q P 0S/ /0@-@P M   рPP  H Ѝ00 :0 ![[A-@P`1UT0p  R *!P @!pR T@p@@p@p@- Q@PP: 100S 0  R 0  00c0 p  p'   0R0 0 P @P 0 0 $0s0 ,0, ,<0 pt $ZY@-8qPPp`@M+ V3 T; p p战P0:*C/o" R; 0  S  L 0(0P  Ѝ ; 0Ѝt0t t0 g VX0X X0 ] T<0< <0 S 4 t|YY YTYXY,YX@-\#\3 XS0lM@PP0d00< 0 C 00  #3 0 d0 30lЍ }0p0S1 `0P " VP000`S ppPP000P"P2P |0 4"424 0 `0S"$`@ Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!`00 +{ {*{ 00{ 0SP pq 0R ```  00 ``P  l WPWW(WHW|Up@-@0MPy00TazV( {0T!R ODz0T!Rz0`z 00UTX!\!R Ѝp@y\!z00Ѝp@y00UX\! X\!0 000S/, pp@-0 00PUp@0y00TQzU0` TQUP ypX1P0X1z0T0`X1 ph0h 000S/@-@0|y0X10CSX1 @syT1Oy0@ly\ p0 000S/g p0 000S/p@-P@0SyU0 \AQ\ X10CSX1 p@Cy`Vz0T1Oy0p@8y p QD !460/\460//@-00Q-X X0 04M 0,008 00 0 ,0 304Ѝ x P@-@00 R@DP@Rp@-@`0P0RP*30PpP R 0 R VpP 0@!bO-0@MS]@DPqp1 0[1`q0&:0 @@F0 R0 W 0 *0 @0S 00CX:X@D* R @  P `00 0P W 0*!1R 0CX:X@D* R @Ѝ /p@-@QP  p@$宕 0 90 t,@hNN  0S RP/0?c0 3??oP/O-M8@0 Y0 0[ PT@T 06S 0@ЍG-q0p@9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,13u1.uPU 0C  P 00Sj`P! 00000000i0S x0ud0uiV0S 80t ,0R0i xp<Bq0G-`0b@TP塢ڃ0T'P# Zp  !p0  n.  P2)0@R0C`0P003 `MpG P `C-0P!1^$23\ *G-0@P@DT`G !1PG*32\ =:Pp @@  Q0 0S 0SQ 0 A B`Q3 3pU  0 0S3#U0 E B S 02LS @0@P`P 0!p@-@ AP`DG 0` P0R @*P56 +CpP `0PR `5<#511 +Cp `1<P0DR56 501?C-p MKU`EP ܀4%66T0@ 0X0   CHH5` Ѝ P0 `00 !30 0S  X0 C@@1` Ѝ0S0/0 R / O-PMp 0GW"S`@wP-TP +T@`0g0TW Wc Xp pc 0 0   P @p P Z Q P  S  RQ!P 00Bs ^a0BSW0BA0BSL70BUI| X[ ; Q P  S  R2!00XS00 C RP A BRLWQ ?0X  0Cj 0  ;"00"00 0S \0F0 Ѝ@`cp0 0R 0 ЍH0H H?0 @7@0 p`0p pꔷ:  0 0 0p 0 000/P |0</0 000/ |0</0 000 /Ȼ |0< /0 000/ᄻ |0</0 000/@ |0</0 000/ |0</0 000/Ḻ |0</0 000 /t |0< /0 000 /0 |0< /0 000@/ |0<@/0 000/ᨹ |0</0 000 /d |0< /0 000/ 0</0 000/ 0</ @/ /H-M 0ЍA-`pP@(# W@@@@-@M/" R Ϡ?#0! P O, P!ЍG-QP` pS Wb PRSW Pi 0Ct ?oo0CS00c<@SÁW B  sS& o?oHX@@ 0h0P<SÁ0Ϡ 00 QX@P0WP@0BW00R( 0b /ob0 5?oo0CsP! X 0h0<SÁW W fo0`05@h>0Q^@<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@ P  000d / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R R  // U /Q R 0 0S00/0 0/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP Q  00S@ 00Q0 /0 U0/Q0@- S Q0CP S  @P 0@ U00Q 0000@-Q @ TS Q@DP  ST P 0 U00Q 00S @Q U //q 0/  //R  Q 0/0 U0/0 0/0/R  -/p@-@RP` 0S V 0U00S0 0p0 0p0 0 22s R S   0 /U/0 0/0 0/RQp@-`P@ 0S 0 0 S 00 p0 0p 0   0111R S Q0 S 00 /0 /U/S0 0/R S 0Q00S0 0/0 0/0 //q 0/-Q S Q R  0S 00R 0@-Q S B @Q R0C  SR  @ 0U00@-0 M0| @00000FF00@ B4 ,0 0 0 30Ѝz - BMMRč `` T @P " Pn2  ` /\/<0@- @-Ÿb M M`$ȍ@|PpM WF b"@$@ p` 0 H",2 0 $8 30ލ ЍB^"P0 @p r 0 B^P.!0 dv100qp0P0 N\A AL+\ 92( PH[y1뤧 Y H.: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !02300  ;P0ЍM000 @-0M 0 000@>S@ "0!,03,0  P0Ѝ*00- M Ѝ0 00/ğ - 0 0 0 M Ѝ䠟 -- M0 0 ЍЍ/$ $0 00S0/D p@-@p@-0@ ,p]pPoh0PpH4//////P //1G-0pPW`(M 1 0  0(0 $5/(ЍH@PL 0S TTT S0S4*4! 00S S) $S 1 0 0S0S "S *\pC 0RW001 00 S0000t0t t0 >0X0X X0 4@|L8`%x%0%$P%%///O-Q-P@@̟ MQ0Z [< 0 0:; 000; 0: 0%SSppSE `0 pp 0GZSZ?XW9UTSRQP'"MJ~}|?>=<;:9876y43210/.-,+F)('&%#"0 ZUg^ gjyW  ` P0$p $@  ` P  )  R Y 4 P  R0 [ ɄS0CQ [0Ԅ0ɄPU*^ 0`CV`FY 0 [0Ʉ`V*S 00Gp! 00G S[    000S0- pvS # 0@ 000 !0d00C0FQ0PA0TPP:* p"pP @T v  0P 0CV`P f0 PFsp xp0 '  0v) 0SV$`0P@`X 0= 6   0pp@ p*W 00G S`pa`00G S+0p00 pR0 bpp0pS 00`  P$0$@  0 000vx 0SV00q`P@00V`S00C `0 ?,  v QV~ @.10d0Q00S0) 000D0@@0# 000 0 plWp Gp倀D0 000  04 00g\a 00- 0+ 0 vS  P00%0!: 0@P0 0 h {dT0*00C@C ]\Y 00^ Y 04m Yk* 0[pɅ Pd  BR B_0 [Ʉ R*Y  BR BM [Ʉ R*G00 =  00000 Y0I0"x2 0 0 30Ѝ  u  000?0,% 0P0  0 P`0 0Y00[ 0E @00r  /0P0@p 00/@- p08A@D0!010  0<Z3!1  01)0 0000P0@p 0L@J   00p`V`0$"T0 0 `t %$$  `8 XtA-@P@ `t0pP@PU J0PES 8/`uX@pW$0$ $:0 l tp| 0SS S 0R / 0R0@o/ @-oG- @ Mp<čP`0@  0 @0 <4 30*ݍ 08p ` 0pPP ot 0h prL+ i 8i7sD  $(G-0S0 S,QU) X&p`@V 0`S  0P0 S@0S 0S0S0S  qP PU@0@\  R!R  R0 R RO-- PAM_uP MUčHd 3 p ԰PE @PU*:0 bP @ V:cc0 @YPO?PL @0 0 4 30Aލ Ѝ8s묋 Ԋ O-PP AM @ MT0č?2 Y.: px (R`5 Ps0_uPU"UPE/ @V: Gc Cc0  {P PU:t 0  mbPP D0 0 4 30Aލ Ѝ x (Rrx l O--MMΟl h . 0  @TL 1SI 6 Sg`1  0 $?0X0 0{0h l @0D0 >00S/ SB`vP⨐0pS EP4 p 0O 0#P)0S1Ss/P @`TP00ST`0v_Ⲡ0Sqs`V0@  ^  0S< X @, \P Tf0<0080v?@0h0: 8 0T S<0#H 1S0 x00S S00L01< 021l0:ATX0D0Sl00h040800*SAT} H0@P| @0PpPPwz 0;4@ >rP @0PAPy 8 <0 @8 @ 0 T<0@ 0P  SP d D0S*,0SU i< 0 h0 S00D0#*p㐚x`tP6 0  0P4/PYt|*h: 0 6 30ݍЍ;0X08 040T0 m! pW5 A8@P@0Ppw !́@0Pp/0 = 4`0 @]P 0 t P> w<0PSP0S  uP@0U  00P`F $0?kE0(0 萰 Pd10ူE0( &|#PI [0Z  QP `1  0 80 (X0,0&  R ,0Z0,0~$0 0 A0 SQ@0b0!0p?A9c!P 0S }@{0P l0'0@0'0 o (,0P,03 Q#  #64 0 P0`1  0 70X0 ,00 0 0  ,101$ 0,0`1  0 60X0 ,0p0 O 00 L5xP\0,&0<  XQoQ80x00S;0L0<P0@Y@  0 @000D00,0[Q @U`D 1帠00 V p@چ Q v?WU1u 0 1 # 3^U10#03 @$A 2UY1#30C Q# ? @EU  V@ᐪ$0  00Y @0U  ˆ0v`100x@v0P k0#0@4#4 nU (0X00,00 X3 X0@0p0(3 @Xnk0"0@" n0 AQR# `1S 0  Z t, ^`!!! QZ   X20 @t X0Q  0D R[ YAT *`vtP 0h lxPp4/P@0 1D@\X0  0,0a0+S .0CS@0PJPP O~P0q@ p10@D0,@0 0@X0 0`!`V A  Ԉ <,l 80 C    T `x T p,lHDLTS0P01SH 0T0T00S S00 00㤰 f$0P14TT0  PW00 T}P1014@`PD{^ 0 00p t}0P_p P 㸐D TP Br R DD }P0X0P0@6@X06S$0S 0$0 ^VPI0cv Dp D  T Br R D0D O}P0X0@0PU Cj0"0@" mHW 0 0R^ 0`1  0 30  X00V  0j UP{     Er R  T Br R D  R,# |P0 30\ X0Ųi0#0@0$0 l0,00 4 X0h0લ&  R 0":U 0tPC 0@ E`P V@ 0 Zˆ20Z0P `;D0S<0X0- A0X ;X 010M$(0X00@ 0.~PT@P1011S1= 0  0 0 5(@X0" 05&  R 00 <6 X0x$# 0 0 0t06 @X&l?i0&0& l0X0@0P: (i0'0@4'4 l-0+S .0CS!@0P  i0|'0@' ki0'0' klP0@ h0(0( k/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@|P$Ѝ0 |P͡0ıġ0"c110$Ѝ00@-$MP@|P$Ѝ0 |P͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM { ?!Ac{Ѝ/MbO-1 `0AMM0 40ppPH dkPC @ + 0#DP7 \4 !P00\+ @ 7P0 @R  R R @ @J @a @z zD ,0 0 4 30AލЍkdn (n @|l O-- ß BM M$čß@ Ÿ 1Xd$p000S000- 0p  P?QP0p\400 PN0D04 !/ S  0  i\40 0P 0  0 0  PP P01 z[ S/ r[ H010$430CBލ Ѝ0?s0S0Q Q) Q N[     =[ vpϿ| 0/?r s0#i&[ jl 4$@ @j C-HHp0 AMM č`@P04 R6 0hU 0@P { P'8ĝ0  0 0 4 30AލЍ PP 0@ .RT @@ @U8  ZjDi <xh dO-ß BM M`$č@pPP@Z[; 0.[@[VS5.K2o11T. d1 0T 1 #R T4 00mP 00S 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 QzPN l"PH T4 00e0 D DR000& 000SG .SB T400P`ʜ0=S 1SA S5 S6 T000SB 0sK0SP0S Z00d1  @@T>00& D DR0 0 ! 00000S0000   R00S0000< !0T40 0P]Y00W@;YQig f   p@-@P`yP p@Qp/G-p0Ÿ`M P@`$T V `"!3 0p!100UϿ@0d 0 P`Ѝ20 00V 0dgV`0 0  0 FXP0swplYiY0SUPP   B R`00 0 BXP OYLYMYFY ⺐PH0?X0S0 0 o`Ѝ0 `F 0S0 s (Yw%Y &Y0sY0S  l0<0c H0G-@0`P p2@D T@=)XWpX0`X  @X U 0@D?0s0?0T00S   T  D 8 808 40 @LdG-@P` p崒Ḃ6 F0S@`?0WV!; X@X` ,@F0W0T0S?T0 *GtX0U0PFU0S d d0d ` 0L @ @0@ <0 P4=|AO-0P䱐 M0S5 @@d@t@`p S S0  hP&  hP0 gPI  gP00^ V 0  SR 0  SRS ЍPd1 00d1 HewP0 e  gP  gP060 XP0 e gP  gP090\ e000<ei0:0  ygP  rgP090090| cgP010r  YgP020h  Og0P0[^ d@i ?R? # k\ 0 2M$ 4g0P0[C @N ?R? # P\ 0 (32 gP+ @ gP010  gP010`thDdL( lllP<@-@HM{wxVw% |Ô0{ D   0  x{ 0gwxHЍ @-AMT  v0000 00*wЍ@@ꤸ0@- 0 A0tMT0l00  v 0P0#0 @ 80 0 l0 30tЍ0@@vf4X W A-@Pu 1!01n0SPpvOPp sup0Sp@-Q@U x3s|p `01P `01000pSucvVxLuP //P //G-P`@>V%0VQ\@ 0\!R p Âp p "p O--Px+x; 0_M M050\;@0$0V0`T 00 ]01(0`,4 05@ d!A  d!. 0`11110^P  J0@ʏtz( p d10 d1s4 FP- `@ Z`0D@SH _j S\  S S00 Q@0S S\ 0CQS0 C0SQ00000`9`SdP ~/0 8 * 0}0+ 0^=P 1#S;S 0(S# 8 R 0(S> 0(S 0(S 8 R 00sS1 S S 0( t8 R1 S S0S 00 S S SS@@ `0 :Z_A{0P0@@ 0Q"0A'A+S? 7R1 S S00(R00S 0`0 S S00 t@@0S S 50@ @@@@@00@00807uO 00*0H[Pd4@ R`P 0D4@ 0R`;`L 0d!S 00 02d1  As0 |3r1|tpA τx0`0S [ `0`SH@DH .S0S[ P`.LV00K[0S 0 0\P L% 00<%004 0 5 30+_ލ Ѝ0, SA T T0 S400: 0弔 ᐪ P$P,p T T@ TT  ;T RP@T \$ ` p ;T 0s000@@T  P 0 0 P  80  qh1P! @@T;T 30 0s000@@T;T   P 8 l! X@ P,ph3 Rw1 S Ss0S] 00 S S SS@@R `` X _AP@`0D`SH  \R?* S S00 Q`0S00000* }OcP.[P `Y 1x#|#DQ aD@`~aQ0 SQ  #P 8 -0!! 0 h13?S01S 14l1k 7h!2/R!0R$ l!^  `'M 2 r(@Sp c\U 8U ТP HgdomasearnamesortoptionPin8erN xX|ch !1 p@-P@hlHM QP T 000HЍpp Qx#r cDsV p 0xP00YsPT $000HЍp訩\A-P RP0p `V pP0\\C\ `@`@ ꃃ `` O--POMP 40]a0P:   ~Z0P 0 0@`         hCpP ^PV" RP0  0N/!I`#Vn 0PP m^P0S V00 R' 0 I0 @Q1 P`   0`QUI #V @Y* P p  0 S\y00 Oߍ ᐪ@ P` 0 0CQ*002"0 @T o0 S  :C X 0 q:H00ᬠ@ @ p`R  3  YpG:0p` p`^ R@ H:T,  KpX:  0H`V  0 [ oV 0 j[t 0 m0 vo  0 c p[`N @-<0< 0@P @ : 0 0&`B V@-$0$ 0@PLo00DB 00/@ @-@P @900` U@-@P+o00p@-@PP  P  0 p 0  |0 bp@-@PPM( 0 ` 000_PP#0 {P APn  0 ЍpnЍp@ @0@ <0$ '  0 Ѝp$ U@-A`P@MK !1 |Q0 Pp 0 RpGST `Zp? Ѝ4 \P! 0 \P 0S@ R \P@  0 `\Ѝ  0 |\Ѝ|0| |0 dd d 0 `f\@ Dd@|`$XP`0p@-0PMU# 0U#0PUP!@@``FYP $YP `$0!E1(`P 0Ѝp2Pꨞ''l0O-&F @M  ,0R004 6`0$ (0ᨖVv娆 PpS@ !FaTx d(!< 0CSQ %+38<  60(<  A0d@B @`87( `4<0P(0P[ `㔵E 40@Sa 0S 40SpX6S P40S<00S S$504QW 440SP0440x,00,000S 400  ( ^A-*02`10SL T10A S\L40( @40 0Sp $4$$0 @(4c81`(5D\30 (``Ѝ1Q Q*#@ 04c!5# 40(P8@@`(01Qs430# <ǜ1\ \0g 0T:p @( 2<01`5(P^4'20(  20(<  l20(<  X20(< D20(< 020(0 208(  0 0(0( 10( ̱ (0(10( Q   1刱0 0 00p10Yp (4`Ѝ0/p 0L)p  i \4clo``0 0  S 00J aZ` T= ȝlh|8̜HX̛hXTԚh4l@L̘lH$D,@tO-41M0 X C* !1 0aQ ,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y$00 ЍP0@-$0 0\Z<4 A-@@`V 0 CQPqWP pG PVP 0`0@-@00 R \\  $0!0D0 0@ ($ T@-@PL  0S  T0S@WW@WlP/0-` 00 0Q,000 P0($0 p@-@P0`D P 0(S  1T  0"00`php@-`0PU@P PUP 00p/ A- 0@S  1S p00  ( $ 8PP(p`0S 1긑DO-|:|*4M 0 , Rz pTT: +^ 0,0? 0,:p` :0Z  P^?^_00}O00 0 0R `^ :R ,0 00^ 0:S Ve \90 P9Py00H9HY0pP0 00H4S   !$RH S(QPOV` , Q 80( R? |800 R? l( 0S  !R L8p0p( $ p b Hc@(`P 0!4 R B  B QP70 pH'  ( |'  X 0 hG @400哠 p20  0H0C(01`,0ǟS0,0(0$  00$$SfS_(@CPs @T  B P$ , R  A  r,p p$ P  UP p  B RS RA 4Ѝ50PP 4@ `%0 0 0  % 00!@T:p5 B0P\500L50 4A Tn 5000C?00 P$ ,p0 R`1j#S$0r $ P@᠔ (hp 0! P 1@ V @ P $H$ $`V $ `% @T: $ \ 030$@ \ `(0pp00>0#0 $0T` #$ 0$`1,hC@ 01$000b`,0:T,0 PY `F `5$0 0,P (YP *0SJ&P( 01 (0XPP$ 0`,P1 0,P$`1~PV @` P $m0b$0`( 0$`1j(,@@ P $YP, 0` 1R(0 `;1!0<0 ^ςS0}00@ P +.000@P$! /1:^0   ^00 pp<^@0 84$ \@؎ĎX؍$|PhT4ԉhDԈH@Ȇx@-@P200Q  P   $00<0 0@ ($ ꐅ0p@-l@@`VpPPpR0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0Q@P 0 pPP``p`(`,`0@A-p`@xQPP T  0 000P   ̼@-@@0/ 00(/0000/004/00/00/X 00(/̂000/Ḃ008/ᤂ008/ᐂA-x``PU pqW@PfS404 0 ,(0x, QsRPS/-< <0  M00( $ T Ѝ́8 w@@-@P p0`00@s0 50 0X0@-@Q =00 2 5 0 G-H`P@pM[ 07up TW 00K 0 000 00- 000 0$00nPP: 0 2  <R 2"  "V &= " 2I 0  0 qppn W* W+ 000@rV WgP@Ѝ00@T0-00nPP 02 2 2: 2 (hP)0? 2< 2D10 04100(10 0 10 0100100100 P 0 R00   0T 0 2  13/px0SW 2: 2l dP 2 @0 2@001P,00 8<p,}C-@`pQP M D00EPEUC\A@E=2 2 X 0 R0S 2 +13/PP"?o2R03S HzPA (0$( p 2P 500 Ѝ(0 $XP ЍP00 Ѝ(0" $X000X "X00"?o213/pP ͛ Ѝ@-@`pQP M 徛00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ 君 Ѝ0P0PC-1pPS M-:b V%*AYp ^dpY 0 P Ѝ 0  P`V: ЍIPP `W 2< 2 ЍO--rMWb9*0P:A̱dp V [KDP@P+ Á @1@DT0 @ 2< 2Ѝ0 @D* @. P0pSЍ0  P ЍC-"1`S M2:rWB R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍOP"! ЍG-rW" RbM"*R* 0 @0\ U@D0  PpY  U 2< 2Ѝ"ЍЍG-P഑p 0@F `` I`!v` 0 !`!0 0CS @QàHz0S0Cs 0 R 0 1P@10CS㣐**y0 0 00CSÐy0S Cr   0S00s060T!2 B0C!2☐pl0l l0 T T0T b 0808 80  ({Th0@- M@W0P  wPP   Ѝ0Pp@-P`@Q ؙ00T T 0@0p0Q 2S@3:A@P p(0 2S $A@P$00C$0@ 2:0 2pC-P`@Q4M 圙00 Vu 2+ R2 13/p) 0 [0! 2$  00 2 p`0 9/0P 0 9/0P  c0P 4Ѝs$  0+qp 0 ;bP 2: 24Ѝ?p`(0 0,9/0P 0  0a@P`&*0v  RP !q0S!Y ! Y Y0!00C0 V 0*b 6 K0!00CY` Q0Sp0UY0!00C00 /QW 0E 1囗P#` Ѝ@@PGP Ѝ uG-p`0@ PR@Dt@p wppT@$:@Dt@vv0p@00T`:P0D0@l0l l l0 P0P Pz0 808 8 r0 \llDLP G-P@@ `RLZp9 0ഐS0FI S0y 0 B (0V F@ 00 R C C0P0@00 000 Y*80`F0CⲐD`80000 Y4y, ,0,  0VG3ԩG-M( py\W`P= \.S<&5S0@ @::0 L l3< 0Ep P#,0S9 $2 RBЍX@`00W0Fwp0Gs00pЍ\KS p< Pb,0S0S !Q #$ 000#$ P0A 0SD S6s0 Cr 0Ѝ ,  0#, ##$ QA A0A 0 0 pWp0 p0 2m@0@-m@0@ph h0h 0` 0S 00 O 0 yh4#51Sp@-@M PJaP8 \,0P8Ѝp[LЍp/G-@B@M@Mȍ qŸY w@`P_ 1 R2X<0*%@R[ZZP ? B2< b5<R P0DpF YPhX!8 0 2 K؍ЍU9P`J8 u8000S "! !.<L0L.8.0LL\ Z0J  CQ"$ C|,nppfl@0`l@0O 0 QQ4 P hO- P `cI@P H1嫲p0q1  J  0000N`ⴜAO-40@S M0S0040000 P`D 0$p`B17v0C1f0V0N P V NW 0 ^Z!B! 0ST|  R 0S  p`s"`fRΌ 0!2!$0 Q0A$0U @ Uh  QR`2QqPvUp 0 lP0g    @@℠ p `V7 `FPG` @ ЍVD $ U D Y @ppB W PUtp1 PD D00CD0 0 10CRJ 0 B Qs "00lRwp31pwP!1 0| 0P!@ A 0$ 10C0S  0"WDPH0 Ѝ1 _ 0  Ѝ RpP0Sʅ `P!D0p W0D0wpPU PH0D0p0CD0@1 41 (1 ȞȞO-@0SP` M.\p僰Q`@0T,k P @0S QS P 0Qk PЍP0S0 P"@P 0S00 000S^0 P00080080ЍOe 0008(840PЍP 00CP0 0000:0 0Cs000偬 0S8:00Cs000u00000 0X00pG0p0@00 P 0 0 70 d d0d 0 0H H0H 0 0 P`\(0ԙA- @`t051@0JJ@0D @$ AR3@D$0@N0qPW T00 t 2@@bR!DAAkpP 0  < 0_ĘVO-0- `ƟtMV@ `Pj0P0y 0 j P$ q v`0 000 00p0S `HH0:@0 @: `[ { J ණ `00K00Ჰᴠ000 R@ڴ R5  J@D d0 FP{ 0  BL 0* H0y봠 0B `s0  Q0@: 0 A 0 p000$ 000tЍ0 ``$00@At@Q0$0(00,03`0L080304030<000CS@@0S*00A0As0 p@R@Tp0: 0p@p0`0( ci0P(0 p`W ,0wpS , p(0,0000 pWrwpQ[@XP0S0\0 T000SPm   f000@t@Q900 pW100S B0C\00X0T P d0S 0S0\0 T000S0P08 0 00 000 'Qh,0S ,0(0`00 0 00Pd0S0 `0X0 h0S(0 `,0u 0 0 0X 0(0 p,0000d,0SDpT(0,040p 0000X408 <,0.`0 (S O-\\p0@S`P @L$P G jFP' Y  0z S40 6 0(10S0 1$10$10 0S0YhP 0 P0S 0IhP  00S 1$10$100O--MYP @ 0 0p0W0 0 ``FV*Yv`y \$p *P$z * D$ * @ 0ಠ0`2ᴀ PP Y$```0S S 1 !r `0岀0C0 H0x00崩0㲀F0F000 Bೠ0@ഀ0@000 ``FV"*Yv`+ V 1 !0ഀ HxI0`v`0s0抠H0Z㳀01`::*y 02"0 Y0v`p0``FV*Wv`T ll2l 0 : 0ಐ0W0ഀ0`0D00000``FVD*Wv`4 V 1 !r 00SAx 0pG0ഀHx 1`0`v`s0扐H0Y㳀01`::  0 00SW0`0FlЍЍ0 0PP @0 0 d0 0k [0`0 b0 P0 0e F 0p|0| |0 ;Wv`iЏԐ\čt8Ԏ\0<T܍G-p`P@0R"  0S00 0fU@ pT9 P0X BPR RQ 0R0Ӳ00ô00 00As0R0 BY001*r 0Ⴠ 000<UU800C80d 剐BY001:P P0P  0D 0R0ಐ BXԋO- @T @P@D(0t@S(,W e0PPI# WfP @T @(0@Dt@T `pV T`  0 eP``p@-P@ 0^\ ^ P0Qf Pp\ p pG-@` 0PS 0S  0Qe@PS#  00S p\= 0 BS5 P@ 0 \eP   00(!S%$! $! 1Q0 eP @0弐p 0'p 0 S {10 B\r ἐeP  $10$1 !( 0 O-\0@0C@LS`Pp M P D eCP& 0 0  _P 0z S0 * Ѝ0 0S0WeP 0 0P000@- M@ P p10 Ѝ0O-@`M 0p 0`PDHpf ` PR0S !1  0? Z0 0 @ @ 0 `VL0@r s `FV01*0 @`0@000S `0C`s0VpḐ01*0`00p\P ZЍ0 dP 0  0 0  00 `T T0T P0 0 p4f8}\܁$G-Ÿw?`0 (MR$@pz2SD:0JSA P P崐2Sy1! BRS:0CS㣠C*z0Y6:101@0p扐0p 20  2再x!p1 0 $0 30S(Ѝ PH ZP崐 Z y C00C ߥ0 0b >z0Y*0 pesP202 {p 000 p  ` 0t p~ +H \ XHA-@pPQ` M 00 2   Q a:1Q儥0" B!2!0 0 VJ XGFZCBH@0PU; "R!* 2 13/pX "P* 2<00@0 PFP: 2 J0 EP VP V$P "0* "  Ѝ 0 Ѝ0PU "R:(0 $P0PUP`" @P  ; ЍwAP 21 mLB@--M0 @ 0 0Vh hP 0PSP000S 3/+ V"6X; 8 80 $0Q/ $0S/ᜎ T @x~<<0 0R/$ 0S/L  H$~A-@T 0S"ep`/XP0P@Q0@ @@MFP 0A/P&O-P$M`ihCt娄D vEp4D$4aSX 0! 0  0EVpLDBP b0@S<S9p0q0qpp0q0q0q0q0qp0qp0q0q0q0qpqq$q @>04404 4000$4040(404,4PVG04g8 4E$Ѝ $40$0($0,$0$0 R2p0X" lP "2QEPP =0 `00SdTPXR0 `0 00CS0z Up  RF($R [Y $R8 [ Q R  hE&@) 0@ <000`006@?U0`00 T 4S !HHE6@ 4S $dp [ [ ,$R ^dp Idp$R [Mdp -dp   ^dp [?@0cj @ .&&(&T&&U(&55_ O-@`MpPgA3# @Ap#3M RPGPP2 yd H@ P|v$u$u$upu$u$u$uv$uu`XP! d@QQ(u$uv vv$u$u$u$u$u$u v$u$u v v v v$u v v@0!C!-\\ R0C0p20pW WT Z( Y D$```X`r`T! gPP   W`Pg 0+0Z!Yq``pUpP @ % B Rwww xwxxHxwwHxwpxpxZ ѹU X  g 0S X  R! 7/ P  R ; $.A M $$A tCY.P0S @㡂A L& @ .&P{j >O-`(IwMpPf@`` `` Cp8pGW( 0RZ S 0 0 _vPePRP&GPff0@SzyyzyyzyyyzyzyyyzH0@ S\zyyylzy|zyzyzaP ` ` `` ` ` `$(,S4 0S000 0S000-S0TpG4T` 'V P C=`P/V  00010ST0S0000 C C0S S/R LTp}0Se (&tTm0: S (00/V%㩁00pJ`V  PpR #PP0S6 喁0۾P0@ /Q50CSd}x}@}x}x}@}x}x}@} $?  `0SE 00   B R\ L Q,Q p / 0 pPpGp` 0 U Pp K/R  S/R/    C  R:  :#   30SS/Q$ 0S% S0sX. @D!R\0PT!R\ `X00: S  CCS0: S H1: S v : S  Sy  Sq bP9 `6 Sf S0 L0S !c(0尵0 [ <P  ᭷['8Ÿ0 S802"lQ pSP,0!SQ  2AH1: S 00[0S 80d!0CS80d1d!daPQ X0SR ,0S !c0S !c ኵN?W(0S0S 0 Sp!J0: S0 W D' &L&"@L&4>JgT'$67hL?W G-@Pc\Z>H&@p@<6eP8P0` \5\%H`?QP8P H0< 04(%43/00P08004 (e0 P 0! eP (1eP 0000/0 f$0 DgP0; S "@D0#"H0`86/p 0 Q 0 0m0(0G@-P񟗓(lllllxllllllllllllllllԊll 0@lL\hlllll0@00$0<00D00000$0100000$000,00$0;0H00$060(00L00 00080S }PU RnR oR0P<0,&`P n9P8d}P,PPPX `( $><R4 , 05 `uPQ4 1SqH0S880S5@0S2 L0SP uP4PD0S |$=<00 +`p P4D4X(D`尠UV 0PU 0040D0S eލЍP 0`@0S0H0S 0  gP L 3R㓥' F FP3mY`= VZ dZP 3 H8P ] 0br40PEP OP^gP 50: SSgP4 01!$P4H  P  0  L~  UgP 40pYX 8SU # WpVJ  U00!"00 00!"00 0$0!"00 (0,0! 0 0004 0 008< 0 0 @0D 0 0 H0L 0 0 3]P ǹ  dP40SPP`S ,0ST (@ .X}&/& &  3\A-0D嗹P000d0PTr0C?o21 <p 00C00S4 000-S/0 2R$0pP EP SP   n=;sP xPI30202020100000C0MnkP>x\@P5 Thd$z0S\cT2S  D.=00$CP@T Ⴖ0p/S[/ P r0 S:  `p ᣘ ⡇P` t(&A-`P@M\C3 0; KP  K KP  J KP  J KP  JPHD3P0<3P P$P 3( 0P+( P3( P7( P;( P?P ( PP( P ?P8$@Ѝ(P (P0"U(0S (tP(0S (jP(0S (`P(0S (VP|IxPch!Pp Xw`PPa D1R`ᒵPU 0E /R 2Pp(容PU  >00,0/00000CS갢ĢP0$0~00S pxX0s00Y(&P(VE\ tU& ) X(L(T A-@Pw[-6`p 8p 00S VᛌPwLP PP ֹ``۹P $O 0@6 &(&&O-`pFMP᜖9[5` ` G8p p6 HX.0S ЍfP WP! PP p `RP dP ѹvP iP0p0 `rPxPpp0p0 p$p q X 1S ׳VDdeddPU *JP$0 S<500S5 0ᒴ@X*/Q /P.QQ .QQ[  Q00@  0P0SP$0`S0S@ RpP ᅬPP0S v50C SW8ĨĨĨţĨĨ0$S P N5 m00 $ C5 0(v0S $ ?RR00R0SV1 $0SX  P ᣭ0 0C0 HP 0S 0S W/0S 5S 0S 0SKIP 00 0 0gzX  ɸPsH0P k0S u0Sd q0?S` m0SራL5S 4 000: S R  S/o" R 0: SGP 0S  |P SNH 0SHڸP "0S 0?S 0Sx( &( *>A-P@Y84p` 6p 00S PA@P4pPp HP.PW` /\P 0S 0S0PGPz.0 & p@-PMN 7 $ 0GGPG@HU3HTD GP00ՑnC3寷P3 VP 30S S! S  3eH \3! d3 00L30S  R ,#6 R #!SR3H 3 2 j20S (i 2 20S 0S'002@T$AP0"@IxB00CS00  0 < d 0S60016 R0S 10S< 0PR<0 01 10SO 10SK(p1\1PML10S H10S d1 X1 0S 160S 0  @1 G01(V0S0F0S 00s0S0S 00@`|P@ Tok@( O+hV&x((p(((|(Il+pW&xW&v+l(V&4t(_+dG-@MP X22br@@0 S d ᳱX "5pD 0 L1 0厱P8| ?GPh -dx 7GPP-L8 /GP8,T< 0DS 00S8 @0xL0QaD0@0 0Q)@0SZ L ~PUta0@S񟗶@ꀁEP `t@@L P kP P 0@0 00 L#+L3+0@0 00 0 Q6PL|^!D0S hx FPT|,2 &&hDnDtDBt @~Dht@Dt@D(&DD@ . AgtD@--WD2O-Mp$Wx1냽@0o0C?o`PT20H$H4H@@@ @1p$44 X XT 0S@ Z`> [``: csRPGPP f!H@ P4@(hP dP fPvP@` ``k0T 0090 S2 : ᄒP @[! A0S #S.!h2  Z`PdM 0pX#?. ᒿ0P0 4p0 p -! Ep r0S<0 0@0050C SU  0  Ը  Ը  0S ὩK@Pμ0SA 8r $*1p H 1 R qX  Pp P    3/P00S S+ $1 t p[h0X00S hm1 X(UEW&@ .&^E@{ d(j>O-MMM`f`4Jp^K`5 00 5p`5005 (`9p 00pP k PY P㴙yO IP  PQ|(rA@6P񟗳лLLLLLh\XLLLLLLLLLLLLLLLLLL4<LLPLLXdpLLLxLL0USxP 2pQ PQH 0(<ȟS SS{ (q055050050505 ζP ȶP5 P E p0"S dq 4 p ꟻ0"S  $ p0"S P 0qp)!0050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X 0'o-0U5SPP5`FV5S UU0U%0;4dpPl%5S 8DP@0: S055PEU\@ H V05#V$'4P$040zVp)q@PP Bd$iB[,%h-tA\D00 0$00( 0#BlPP#2 (BBdBBBPc`0 0S #P'pp@.dꬺ0#S (AV)YCQ0E?o2? (AX<1PP:)f/:k#AX &PP-C`100CS0 JAP Pp PNU0 P00CS05A0 Vh&0S:00S:0x*1V51V&1S(1S n 2!Pdh!iB+%p -V||1P 4i#P,0V0< &P(o0`FV} 3pP  f/0 ᧸T  ' PL&h(iVCWIV@ .qVVWPWVVVVVW&&4(bW&  "(&oW]VSg vWo"_}W(&md;VS(PC-ʅ- 0P !@㐐`p@XP50 P0`00CS`0 i1@T ЍX0 X @0h(&f`O-P`@dMu$P(P,P0P4P P  0p4pK[lTT1Z03rTdT00 0@p0-t$tFoSPPP@S    a0@S03P0 0dT5 RT ST# QT040  opT[ S0lT[ 0 00  $WqH$ Ap8 dЍ $Iq$ Apn 8`PpG +nPC 42"S 200002^S R2SW10 dbV% ``L0np LJ(pP  ``L0nppd2S Pm@PX0: S0d2232` 3`Sd2S|}0 t=`Pp0SP L 03PE/PF1@PCpx9P<````` `````````````````````P ``````````lP\``A@9P0007000`컟 ,b,000S0?# m0d204202020202 @d[dk @-Taߍ0220202;/`GP000S T0p, 00[ / 5`P000S B0p 00V /#P000S 00p 0 004*2j000 0B ByP 000S l3 S;3Ť)00i 0 yP 000SX"\2RRX2Xi/ ܋P P=?PX0: S00y `P N)/NjP 0  8P[l=`P %V=:+0?p X:{\10 [xt*=[` H$!14@(S8=̲03%703 7Ilpm70372 P ʴ0 S 0R& 2S# 2St 0sd ^=pD$P0 !lP$5 f/H7w0L7TP'\?S@<"820,"(2 .PPO0 0  RZ$ G&P$ `Skd2S+ >pXa$+=00RX!\1 '\1X! 0 \k.02T7,2P7p4$%^>pV%<p` $<`P%>/P  1lY&z&)ނ1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0/g))@ .9&edAJ &*)))X}8Y& )) !sfPq*)zd@*)ƖO-`@p̑́Q 'p%W㬑 0S 0S p1`VA 㐰P `勰0S H兰@`V-Z ЍyPmPPP fP P:n0@ S4H 0 0000000000pGW 0HP d:P:P '8Xu@ ./)~& O- 5 %$MpP d9P!!8`70DĴĄĤ00``` 'p6Y00S 0S 0S l``4pWQ* 0S00P (0S 00W30S$ЍzPOPBP4 FPt ^P@*Pdddddddddddddd$t(dDddddddPddddddd 0000P02 P20v00b 0 x^}&j0 0 P0 0^ d ުP0 0U 0c@Z^PN,TI000E00B00?0 mC^1 >0S e00000'000#00 00000000000000 ` `0S@t.P` t0Y0S 0  0P !E"PpG 0"t^0X6]XA)9)@ .0=)&ɴA)Vc'$*;dY&`sO--MP0HH 2 PUPEǰIvPlP*HP6 TP8 7px@|p `,  ~Lqp@p! 0S  4 v40@Zpx tdm@ P (``("z%p2 R Y R !$ Q ѩP$  R  0*8P8:H -RH 00@00 00 p0@P@Ѝ0 0y ,6?0,0P 0000R0S f```0SpZ0S0S ~ 00 0@xp` @@@ @P Pn  03/p T Uq0 Gb&nSg @ .e[&@-(@(392@ED)[&O-P8M -pF,8 0f`^ p p d6 Rl,0 P8 /P0T 4P0\808vpHP,,F U86W`E`hC0IPHPU0 }$p0(5O005SO /5,* 0(0,00(00 0GP> PPP%PcPzS `SNSM *AS> CSP 0vp0jKaC Q8WSL4$  P$ ,4RD +K L J ~O c{05xN 0Vt 3M pH n$0%0!0 0 c "$0@S. p5cI (3V``R zS NkS CS BSHLS aSDcBl0CS><<b+b)ZimQPeH0SbI0S_O005S& LAP" T( QpH (0S  0C#P @P!#@ᣳp``Zp! P! P|! 0S1\!~3/ 0wp@ P\ PP!< P010!0 HR # 0 pK P 0 00 0S0 pV[&D)p\&\&D)0\&/\&&d@ .H\&YH\&\&\&jwAigui m@-lP Ab4@N 0J)tp@-D@D#P(@(  1p@78J)a&p@-D@D P@( p@TJ)xb& D A-|@|p `(P,0`8P@@@4,AlJ)b& tG-`M3PZP4P0 ]p) P4T4@P D4@28ŸP8"0 0200@ 4 Ȟp HQ f4P ] @  p1a 00 @ p0 @ t080<0@0D00P0 0 080$@P  82 HL@P@T@X@\@HPL HH222 0400,0@@,0( 00PhbpKPPUPh0PP 0/`Ѝ+! 6+)H++W}+M+"oQ+h+P*d&(('(J)O-`-Ph6MddF(`0  !p<6X0K (V0Sv`@@0V}P 0SЍuPfPFP RPh g@P D000P0 D`0#S P00 $U$00S  $I$00S IE`P `0#S (sP $.$0(0Sw P $"$0(0Sk 0fP ဥP !q !q  ` @epKWwQZ2@X23@0 RH0cS pS: bSAJJK[0 0\Z9W W, 88 0,3/8 RfV ]D@&2Xi 1P'0 0C?oR20S` htZ|WJ% `_00 0 00 00$,0 $00S WZ 0 %0S0:10S1 0S  0P0 0  Q00s  `1000L,0 0182PX& S R 0@0@0 #  R S z1P(00s  m1pHJ2X 31 01.-@ .&J) 0--,,P,@-`--(&--O-P@p'M Mfট$PP p6 @DT T/ TX 唶7Z`PK'ݍ ЍAP? a@PP񟗡<$5P50S $+PW _e`pP%000P00` P LP <PP  P  P P( ^- qpKPq/^00 000#0 00$00 0P@i(VPPLdD^(00P(X@SW  ~s2 P P( !{P( (mY@P` Tუ0P` 0(Ȑ⨀ qKP 00 00$0 00p@P Y@P  fY@PY@P^Y@P `SP NP IP !g`LAP X  %P( (`m` pP( !qJ@PP WD aPa>/pp+0S > +[` /⇪Pm``> 0V@ r}r0 0W/pp` `  0P^/0S` 00 000$000 e( 0pF/D/0Pa0SJ+S'- 29S!S 1aV`8.D2& Q2J)@ .2!sf\2  Ns222 qzd@edAp@-P@Ap@-P@ ALp@-P@A@-Wp@-P@@Ip@-P@@p@p@-P@@p@0O-nMM800䮟p4`;PI 00 >R㸎0 00>^(00㠞$000 p@:x>P10?0S@>D$RP$r R  $t ܥ<4tA؀ @0<4x00<$ 08/p0 ]P  Pp`FB@D4TF4ppptp(pppppppTpdpppppppppp4h0dppppp<00@ơP d< $w彡Pr tt  0< j <$$r $b@<᧡P ;$0 00 0 B<L0(00 0,5;0@= n\ \;$50 00 0 (;(0!00 X 0 : 0(00 ( 0*:$0!00 0 :(0!00 0 X:,0(00 0 $:0:0S P0 0H: 000 0 4 !00 0 :0!00 0 :0!00 0 (940c 00 0 (: 0!00 P 0 88괸@0S 0 GP[G}àP0@4v 张P@p 8([ ᰠHPD40 娠PD40D4Y  /0P(0O \800 1 D1 548C?  P0 067000 * G: PzP/ zP O[0S 0T4000$0 <4 L!H\0PFU [U  z0LVp0`R 4S<4[0 H$L40-p`壔@?HL480S $I?I5HLY  $?᳞ 5YHL0(4SH$L4R0 &[,p`  -p  4S@ {GP ?Zk NP `; M`Pd%d-p X1: SD : $R ,@P  4RP   P [Z3$R  $z?0$@0p!$4p = ,0P,0 r0 4P ~P$$<03}p4p40S0X44SH0S4x2S, "20# [Pr 0T40S PPp*0ST4S x3H#t l?P `3 `s'x2S 2H$L4P*pZ0 $L4H1#"0)pL2 C  Y$0+ !ypĮt  P X 㨢L$H4#"0$R 0p0_Y P0$$4RT SQ  Y  0 +p0 Y?S  S!0$Qh +S0$:$40 Q$ Qq*4/mL)L{LWL@ .Q)&NJNLV&LORL!SDS[SS$(&MS&M=T`TCMe&6<TMkMSg @SMMLO0Q)MMM\N8OoNN>L)NNNNJ\JNOO+\J []OOOOO2PPxe&PP Q1@PQV LQ*QHL$ Q,} Q+Q +*0$0$Q0$S\ 4S$岒P 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,4 0 000(0Vv *t *0S 0-Tp@$ P& 0d! z>0]xP8.X Q(041$4+\T4S#  +d00"y*A*?*=*T +\4$H1H4L1x0<$|0@ 0*p^\⨝P Z > P✝PJ  <⥃p  T< : .00 <O--0p PDMM⼓c4, pP^3`4pGs04WY `  XaL 4S<44S $$4R0#)p @ `+p : 4S P,0S &P<;S7&Ph QX $@<nX AŻG8 ({:< (;@ST 302HS1<+0Y2E20SD C@4P7 42222@722622258562722222222222232342(4h744D42242444,5D5`66267 09 0r Pw P0P 00R0S S_ 0;8;08;X 00d1IQP,1 P00S  ( ?+SS P@ P000S0? < - 0< 0: 0 S@0 00@; 0@0 00 008;0`RMb@A?{Gz?eAt1tJt@ .au(g*uuuuv&Qtstttttuu,u P P00S0@S p0K 0!; 000 0! 0 000PL1 P00S s  nY <01 ,d P 0: 0 @>!.v8`X2[ `2`2VȌ0 V00̌ ň p+< 06 P< t R 0@ @ 2 0@TePg 0C Sd0400000,00(00$00 0000000000 000000l0 0^0` RB @@뤃夓VB 6;8;p 00 L0$p 8; 00 L0$p$ 8; 00 L0$p` 8; 00 @L0$p 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;`+  @ ` L0$P8q;"0#10@00 0pKpQHE  p   p 0r$PLK0S `` K0e$P? 0  00 6X$P 2d 1$0 44J868v``0 DD$P`d6d&d<$l7!2`(10kkkk,a0a4aV 0P````vV<;SV$>@ Uz{  A 7䛟:S $@ UVz{  A 7I:`"2RifT' { @p30S 0 ' @MHIN2 X0弅"pX00 宄@+X@0V0 00 D@0`" 00S O ` 02#P$Gy82AQJq#`Yokfik{{'8Nj@A@Gތ@8HINV ({*X@"PU8 Ӛ0S4 @>0x`T0T00`0p+t"pP 0S j 2L#t;@000!R<  W0 0 |# ,d2"SS 0  -C6?8~A$@@@H]*g*w(&Tv h*@g*^ww(g*ww&w^*(q&!G@ 1PS! 2R``@p:V\\0!Ld0 0 d20 !  ,  `00hl0?ph{{7{{{3{{ {  M@ )*3`f03 0h 0S hʘ`h2d0h220Wp |x"@0 0H 0 02 0BS* (S2; , 0P;zpV*42!00ss0S 0 0@ s0r c 0 T1币;    0;N 0W |%"@0 0H 0 0p0Y 0(1 J,P@0<0SRW  0 0RZW |!R@0 0H 0 0Q 0 H0D plph0Zp  ^*(q&xx:xex h*(&g*xwx0CStFGGJJ4HtHHHI0ITIxIIII0 P Q:FG GGG4Gy.yOylyyyyyyzz-z>zWzqzzzz3{zzz{H{c{{{{{{{||"|6|H|]|p||||g*|||S<0KX0C W [B0C<0<00C <0H|l 0D0H"D0X0  <0K+0C;#<0 D0D0 <0 RKX0CWD0* +X  $*PWD0 D<08<0 \帋壖Wt+p 0D0HD0X0 D0D0WO-M`P[@0P-S@wP0 @04 $t p$+4QP a`F0pP[NPijQLpGK2 PL   0MAP@ X3\C d@P N O O O O O O O0O ON OON O O O OO O O O(OL@0S( @HGG 0B 0pi fY `LZ'XE`PP`4b2 R \  u 0 S P  K U+ 0 a ! 0!00 XJGDA> ;p8 0 p0S }X }` p0S"0|@0p   0[L Vp|`g+}&& | & }}+} gM}O}>}\}r}}| }O-PAM Mr@`\눧P |VPt7tW00-S% P jPL @ p H PZ `F0S0 ` @DDA@Dv  p ,0Stb@qQ 61 Qlz ,rP -00 `@Z-00  D0B5S񟗌C 0C0 0B 0 B "00P00 C0 2#10C0 00C0P00C1# 0 00C0P00C1#0 00 C000C2#0bqp4 0P 0PQT+D JZ2V @d`'os`F KP$ 0SU030#:U 5%PX僪P H11 0P&T6K/r0R 3PvTS0 0R3# G@uRPEX!EK/r0;Pt"E0<6S"46S|" 02Q|" 42t01t\;6S L6 P W0`W 0 P0 t,6S m/PP |0t<6S46S;P1|Q0@6D&Sl1 0 00R\!  H&PRL! $&R@! 8&R4! 0&@R$!  !Q   @ m @@t0P0+@ .&"BAa+5ܪ+Ъ+} &(&eh&g|°ϰ#;]pkLuG-P`pIHM 9p10PEU& HP h0@ S S0uttt@uHuluttttPu`uHHII坯00pa 4P ` 1!daPP VC L`$@@Ȁ`(` `Cx MP *PF0S PxW FP X'C0 0000 v8{&@ .&J + Dyt Ct 0G-`HMp0& C S p 2B1 `FS 1S 0$  !RS@$ P+PTuPQ|BxP`PAP MP2 a0@SPxxw`xpxxwwwwwwwxwwxxwwwwxx 00 04044041! 00101@30@3101101101101ДY 000 0HЍP PPp  tB0S  O0 E`PPV q V `FV R $Sa (08 ]V Z8+@ .&@{& [_<+ (&C-Mp`>@PV p-6TpF`F5 VE@T T&P D!P!0F,V p6PU 5 `V V 50S aP tP0S ( 500@V 0S qpG  P`V \\) TL%tP9@PA0@3S|`{`{ }`{`{`{`{`{`{`{`{`{`{`{`{`{`{`{`{ }`{`{`{`{`{`{`{`{`{`{`{4}`{H}\}`{p}|}}`{`{}}}}}}}`{}~zP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0{ B0SZ<0SU00SPLP0$0-:FU 0SA 0S 0S;`V UU52P t-P |(P& UH U U6PEU2{{{{U( Q P! @ U4 @U U0000  !  U Qa;PJz0000 0 !P  u $0S f! Q p wqp囦*#_@HT ᑦ 0r"600"$08$P @᠅P ᛅP`$'b +&Ba@ ..&K  wG-@PMaqM p10S `A⼑P R ލЍRP fP74B#,P\ >@X@0J#UP1 JP/0: S2  S)J )#P0 JN@~p 0Ca4S00pr]0S p J "PJ "@PJ(`4+& u$C-PGM M\00$M\#= <8=8X@8DXP=0D80l8"=`{C0X `XdXhXpXtXXXXXXXXHhLhPhThXh\hxxx8́PP   AP:?  0D?aL 0 巁P(< $ <@P PL ;T(Xk@ዄ0P`+TX8 囁;P  0S;x+,tKh8S <PU hX 儁P@ pgOoBd;pp{+P;(8pp{P `ZT`h^TPdh0Jp኎P0 pP:T P t:h(|P P:T(X( %P :h(40FDSN((((((((((((((((((((((((Ȋ((((((((((((Plx(((((؉$d(ċ08<)bp`0H >K9 W B 0،10 ܜl  di8\0>0X `X崘0P S0 xt#0X8T80<0<<0<0<0H80L80P8g+@ P: ?  07`p[Px780T80X8|D70<8x47 P 00Sl 7 6 P 00S\ 6 0t8U6pR0`P0`8d80e\P ըX 5?Q0PGލ Ѝp5t hD$0DT<<0P 0S ` 6PZ@P `d<S P 0S _ _(4 D8SQp_3 _` ? ?t |PCdt PLt xP4t qP kP$ eP|$_Pv YPp SP([SSSSS0S0S2  9@@h288S#@PxsN @+v? P:$B?   081<S|w+0? P*Sކ0:V\P 0]P?@P|xS lSsQP@PD|S< yS0@`(r.\PP0@P`x@+ ?00@0@8004`<0U00P<P8U`,8U0C?o20SP ,R  \0,0S _,8S= m,8S +qFKUO &(&-c  u&@ . &>5&G< .2F\IV 2)` \ + H G-P`5,E.h+ AP037jp2S l P!<UڸmxPH p 㘤嘄9PB/PE0@' s p`40pEWQU D4 000`>yP L,I>PE0S#3 4# 3 ]P{xur`kP ;vP303 Y`pl d`}PX34qLn4S 110101$1Mm   0$"$2Q<7p`e Pb Q1s0S kc`qԁԑmpl0V0C?o20S DnpP  \qm=p`S 0 0000 ln1s0S |3S P P=?o20 P P lm1s0S 0 P `?oP20S 0PlnxH,CjW&(&vX,I ix(&L&X&T,,! *6  & 9C-@`ṄPP 1 刑q儁 ^p0h1QALH1PD uu41?4P $P 0 nSbS9S0S00C0c0C S 0<HVS   0 00000T TT_ sju0S,h&&#cO&4A-` fP@ CPA dh娭pPB rP p4RA,0$ P80: S0S006p`P p^uP 00SpWmW  AJ`P ? 3 /|3| CB@00XXXTsZZ0@ H`,P  @tP ot.]Lnn@P0@UP4PP0@<00Vp4P , ,@*A00,2" 2sP1QW zoJl@ 1 Ѝ0pho40TP 0<0S0<0S0aip40H 0> H0R`1Z8`1qhv>(0pQ H1!1lR0( ۰@Pv0` @n H0R 0>+00$.(bT`18`10SpVPMP 6PU ?PL 4PpЭN@P񟗬ж````p㔭fP j@PP񟗘H``ܷ``d``````t4=0X1h=lh~f`zpwd1f3d1kq0000k0d1Ced 徘`p㔬]0 P(⑯P 0P 0%Pe(lD 壘0 HR(į0 (@@P 0 P(m덷 剘8d&`(00`1(⽐p `(1S(ᗯP " db(^q 儛(⹟(:0P Md1@ @ Tp  p )( 0 R 0 0  P819:0  0  @VZ/0X* P p0@ P*( %`11`V loPP[9 )[90)0 0+)(;Sd1 (nP|P ՞@ {(0 0x9ixp0`  W! (*0S` 4 喞^PsWWB  ዞ(*P9(`!d10d180D8"/0   `! 2s8"/0 2s "/ p+ `1M (P/`!d1 0d1(00 7匛pt}hz(00 79p{0S $|@`1apGWr{0SP>k{0S g{0 S `1d!8 0d!'zpW{0S &|pJ{0S &H (P q(  jg؝%`1 H S 0ϡpP ,p5 P 8d1$A>d1 0T1(00 6Tƙp*lҝ&$0 T1(00 5T嵙p(p ,p P d10d1FxwJdt0(@00 o`P  <T0 \40 (⽎pd `!d1$$ $$ 449(Gp ()S⩺pq(00 4Yp@e!R`14`11(Px4~ 0,t,0!0R0S"Rd1ќ(A`1!GP0!  R!5000 Q01pW< (K(7`1p (1PU5`1d!( = V @> ;0儜((/1R@T? 0S 0 @@ 0S  ᕒp 0S ^ᘝP`P P ( RV R   (001@0 S   0PUQF|~d1@00fhd1@ R R Q 7 ^V pV V 4& ,R -R 8 & V O P @ .O P V V 7 Y M @V V V yEE\ 7 V W (W rY CW fW W nW W W W W W W W "X 9X qX M DX OX |X X {R ˂R R X X X X X Y .Y UY d Y Bwy0S 8  Q/0p@-x@0Ppp@ P T0w4p@c 0 0$010L hK/0@-hPMP@T Ѝ0@ 0@ ch 0 @\he0ƒ S'* 0@- P@ R P@ 0\ R^H00"@ 800 0^$00"@0/$eddd@-M @{WЍh  0S/ -PM00 0 p 0 S 0 0 Ѝ$x /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/0*/)-*/=**/'*/$*/"!*/*/*/*/*/////^ */ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/x" */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/J*/G*/1/ B*/?*/I<*/9*/6*/3*/0*/-*/**/'*Q/"*/!*/*/6*/*///*//7 */>*/ 4T*/@-@v@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogressotxG4g ԑ ,m/T=8("L!L) %+at1tl@7 = q0 `HHW}QV W d  ( qH ~P p     X! +n30PMPM$R$RslZgtjtsvDzhEg5 ܗܗܗ``phХ @8W , %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory A`$PH@@X<@@(r  @@p @@ unblock and -DNO_CONV?P, loflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... #  # 6#H#R#^#k#^#k#.###E#Z###$#$ $_/$^/$F/$</$>D$?W$j$PATH= <l tGfDI-dP-I-s3Gc]-I-mV-I-ld-k-r ^W )ps-(n{-I-v -b    EOF reading here (<<) documentlk[2_2c2h2m2q2u2y2~220222222222222222X@2E2J2*O2U2W&% **m*H}-+?= @ 44444444@*gB****44abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'(0 7,(17(17(8%7(037l(0b7(0i7p(0p7 X(0y7@7A  euAB 0 p  _8  "k77=P7V o[!A lgB [                  ((E\ 9TQH>W i6pN*pk W99OT/p9HF \9pBh9|9| 9&940)9D0  `ZkTZ19 *G)PR999h/\Nto@9H9,5g O9sU9`SW9l]9vY  B d9.Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20240503090059Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed@@ %n@@mB@@l @ -@ @ <B#C$i@: X*A0,A*lV*A*)A*B*A+ZA+&q ,B)\' ,gA+A,-7h x,A*A*+[A,1,-B1B5B9B>B#=B3FB#EB3MB2LB3SB3RB#CsCzCC C@U@CCCCBB C(C7C?C0CB B@BBC  C&BCC AC$ACAC$ACApBvBAA}BBBBhBBB@ B@B B bBZBBB@BB BAAAAGCNCUC\CdC kC@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.Z'Z/Z@Y@5Z@=Z@DZ@LZ@UZ@ZZ@_Z@fZ@uY @kZ@qZ@zZ@Z@ZZZZZZZZYZZZZZZZZZZ@Z@[[[[![([.[Y4[:[B[G[N[U[_[e[Zk[r[z[[[EYJY[WWWWW XX0XRX_X}XXXXuXwk\o\t\V|\\\\\\ \\\D \\C\uR6[[[[[[[[w[[[n[[\D \ \\\\'\+\1\<\K\W\g\XYJ[ YYYY%Y,Y5Y MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] kfKhUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'1{…Յ Fm dž   - O_v 0E[s !8#8$&8182È38485߈68899:;*<H=`@oABCDE(F=G=H=JSLpMNOPQRϊSTUVW,\6aQc[def̋gߋhߋiߋpq8s8t8uv8wx2Cmό,Ldэ.K[wЎ\(;J]h8888ȑߏ(Ceee~Ԑ<Ws{Mx88j3 ĒXޒ8!8Bex/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]  B   6[[[[[[[[w[[[n[[\D \ \\\\'\+\1\<\K\W\g\returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock\\\\        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-%@GZe] 6SatY&L[&Y&Y&Y&Z& Z&; d|nQn- q+o{|nQn- q+|nQn- q+|nQn- q+|nQn- q+g\=rGy=iG};Mt?mWC 3KOOyD<#*=($3Dh&.6\ M}-IZ@Mjy֬k|-чH \-чHZIчH IчH IчH2IчHS'@ )Ѹ*1@ )Ѹ"K\1x )Ѹ'1backupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps'6setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcapszi8]&?yiW9W9W9\&$`&QW9W9\&g a&Zj `&H`&p`&`&\&sT_&\&`& `&\& \&(3>JV bnz@ 0@Xa 4  @O init_current_mediasetmediamodesetmediaoptsetmediasetmediainst G   -c w -c  -c `  @   -c  media_statusmedia_constructor  a& a&  \a&    xa&  a&d da&paddr_matchTT|TTsettunnel!\&!(b&print_link_addressessetvlansetvlanif"b& #"b& # #  setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan((((sethidessidsetapbridgesetiffragsetifrts(Hc&(\&(0d&((L\&%c&%%'* \&W`d&(c&(dc&(\&ad d&~%ad |'* \&P\ c&#c&)&(((%a%a%%S#S#%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s|! 66!sf 3 Q 60 2$3 -120@ 3 3usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o ?QfQQQR>RRRRRS;SOSoSSSST(TMTmTTTTU@UeU%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @hBhChFhIiLiNiOjSJia[ibkicvieifihiiikim jnjo)jr8jsIjuZj@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@Ip@h MppQpp UppYpp ` ]pbp@ gp $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()s WWWwWVV|VVVusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYcvԪ'Oo۫ 5]}լUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printӾ "0HWaty88pǿϿǿǿǿ$0=OWov '/'W'r' DD(3:?bitmask_scanO %*1%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_url1Ssendrequestrecvrequest imquy}***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16K) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz  " $#!%Z^\`[_]aM| M| : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data _8@LESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i  G[r- ' Y-4 k-< b-H Q Hf-  b Gg-s { Fh-  [-  Z- Ei- ci- bj- l-  W- e- $ e-. (f-8  l-A  X-K \ XW-h Yl-u Y[- S ]- d ^-  _-  \- `- `- a- S m- d n- o-" 0 c-B p-N p-Z q-collectT  X '  6[[[[[[[[w[[[n[[\D \ \\\\'\+\1\<\K\W\g\NAME=  BF4 mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds6[[[[[[[[w[[[n[[\D \ \\\\'\+\1\<\K\W\g\ edit_fs_type_extC $k q l, T, , D@ lA N O 1L, d, t, edit_and_check_label 6[[[[[[[[w[[[n[[\D \ \\\\'\+\1\<\K\W\g\disklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiy  p $  ܚ  \ ` | L 0 d L 4 | disklabel_change_geomp outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default-h-Ċ--pm_from_pepm_whole_diskgpt_freegpt_create_newĈ~(T TT 8{0~zzz ,Hh<}{8w|<||{ ..  U E \"' !0 69Y0 0 0  B 0 0 ]340 84 A40 \0 +F4 J4N40 C\"0 gpt_get_part_devicegpt_get_part_alignment@Z] Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCEhSFU0eCK\Hah!IdontNeedEFIUZ(s*K>; d|nQn- q+o{|nQn- q+|nQn- q+|nQn- q+|nQn- q+g\=rGy=iG};Mt?mWC 3KOOyD<#*=($3Dh&.6\ M}-IZ@Mjy֬k|-чH \-чHZIчH IчH IчH2IчHS'@ )Ѹ*1@ )Ѹ"K\1x )Ѹ'1 2 2 2  3 \A3 &3 63 F3 Y3 g3 mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newpTxp|hp̩TtDĮ <,XlPп4,$mbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_free/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.10 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.10 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.10 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.10 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.10 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.10xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition*************************************************************************************************************************************************************************************************************************************** imquy}usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2Aqdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionP bc4dPet[ fa g!\ hG\ iCj ka lg ma nAo%a p\mqr0a s7a t\ u@v?a w>W xFa zyVa A\a Bia CIZ Dpa Eza Fa Ga Hn] IJa Ka LMa Na Oa Pa QhSYTa Ua Va Wa Xa ZN 1a 4b 6b a |9~!b },b *b 3b Cb Ub cb ab jb hb ob wb |b b b b   _ b b g ^ b b b b b b b b b b c Gc c c c c +c ` 4c  a @c default_configread_configrt_compare_proto00rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrthhrt_buildrt_deleteppsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initTwg V g g g P\ n+g script_buftoenv-b a P^b g make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osc%i i i i i i if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leaseread_leaselog_dhcps s s s dhcp_binds r s s i _q s l s dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sSTOPPED%s: removing interfacepid %d failed to exitNOCARRIERPREINITDUID %sdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.6--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.6 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.6 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedRRRRRRVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bn @wY`wt wz ww w xf x @x`x x xBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ 0& z  ~ n Yt z   f @ !! !n HYt Ўz X  f$ h  4/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist