08<:g<  <:gIn]Ct t<:g@@<@T 08<:g<  <:gIn]Ct t<:g@@<@TU <:gt((`A<:g<:g<:gA<:g<:g<:gA.<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:g C<:g<:g<:g!A<:g<:g<:g"A<:g<:g<:g($h <:g<:g<:gmD <:g<:g<:g (08@HPX`hpx$|<:g<:g<:gL$I<:g<:g<:g (08M$<:g<:g<:g@HPX`hpxE$v<:g<:g<:g=K!<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g4!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g B!<:g<:g<:g B!<:g<:g<:g!<:g<:g<:g"!<:g<:g<:g"!<:g<:g<:g"a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g?\!<:g<:g<:g>\!<:g<:g<:g=\!<:g<:g<:g<\!<:g<:g<:g;\!<:g<:g<:g:\!<:g<:g<:g9\!<:g<:g<:g8\!<:g<:g<:g?\!<:g<:g<:g>\!<:g<:g<:g=\!<:g<:g<:g<\!<:g<:g<:g;\!<:g<:g<:g:\!<:g<:g<:g9\!<:g<:g<:g8\!<:g<:g<:g:\!<:g<:g<:g7\!<:g<:g<:g6\!<:g<:g<:g5\!<:g<:g<:g4\!<:g<:g<:g3\!<:g<:g<:g2\!<:g<:g<:g1\!<:g<:g<:g0\!<:g<:g<:g7\!<:g<:g<:g6\!<:g<:g<:g5\!<:g<:g<:g4\!<:g<:g<:g3\!<:g<:g<:g2\!<:g<:g<:g1\!<:g<:g<:g0\!<:g<:g<:g2\!<:g<:g<:g/\!<:g<:g<:g.\!<:g<:g<:g-\!<:g<:g<:g,\!<:g<:g<:g+\!<:g<:g<:g*\!<:g<:g<:g)\!<:g<:g<:g(\!<:g<:g<:g/\!<:g<:g<:g.\!<:g<:g<:g-\!<:g<:g<:g,\!<:g<:g<:g+\!<:g<:g<:g*\!<:g<:g<:g)\!<:g<:g<:g(\!<:g<:g<:g*\!<:g<:g<:g'\!<:g<:g<:g&\!<:g<:g<:g%\!<:g<:g<:g$\!<:g<:g<:g#\!<:g<:g<:g"\!<:g<:g<:g!\!<:g<:g<:g \!<:g<:g<:g'\!<:g<:g<:g&\!<:g<:g<:g%\!<:g<:g<:g$\!<:g<:g<:g#\!<:g<:g<:g"\!<:g<:g<:g!\!<:g<:g<:g \!<:g<:g<:g"\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g\!<:g<:g<:g \!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g$!<:g<:g<:g4!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g?\a<:g<:g<:g>\a<:g<:g<:g=\a<:g<:g<:g<\a<:g<:g<:g;\a<:g<:g<:g:\a<:g<:g<:g9\a<:g<:g<:g8\a<:g<:g<:g?\a<:g<:g<:g>\a<:g<:g<:g=\a<:g<:g<:g<\a<:g<:g<:g;\a<:g<:g<:g:\a<:g<:g<:g9\a<:g<:g<:g8\a<:g<:g<:g:\a<:g<:g<:g7\a<:g<:g<:g6\a<:g<:g<:g5\a<:g<:g<:g4\a<:g<:g<:g3\a<:g<:g<:g2\a<:g<:g<:g1\a<:g<:g<:g0\a<:g<:g<:g7\a<:g<:g<:g6\a<:g<:g<:g5\a<:g<:g<:g4\a<:g<:g<:g3\a<:g<:g<:g2\a<:g<:g<:g1\a<:g<:g<:g0\a<:g<:g<:g2\a<:g<:g<:g/\a<:g<:g<:g.\a<:g<:g<:g-\a<:g<:g<:g,\a<:g<:g<:g+\a<:g<:g<:g*\a<:g<:g<:g)\a<:g<:g<:g(\a<:g<:g<:g/\a<:g<:g<:g.\a<:g<:g<:g-\a<:g<:g<:g,\a<:g<:g<:g+\a<:g<:g<:g*\a<:g<:g<:g)\a<:g<:g<:g(\a<:g<:g<:g*\a<:g<:g<:g'\a<:g<:g<:g&\a<:g<:g<:g%\a<:g<:g<:g$\a<:g<:g<:g#\a<:g<:g<:g"\a<:g<:g<:g!\a<:g<:g<:g \a<:g<:g<:g'\a<:g<:g<:g&\a<:g<:g<:g%\a<:g<:g<:g$\a<:g<:g<:g#\a<:g<:g<:g"\a<:g<:g<:g!\a<:g<:g<:g \a<:g<:g<:g"\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g\a<:g<:g<:g \a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\ !<:g<:g<:gi!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g B!<:g<:g<:g B!<:g<:g<:g!<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:g<:g<:g<:gbpf!<:g<:g<:g $<:g<:g<:g$><:g<:g<:g$<:g<:g<:g$s<:g<:g<:g$<:g<:g<:g$<:g<:g<:gA<:g<:g<:gm<:g<:g<:g$<:g<:g<:g $<:g<:g<:gA<:g<:g<:g#A<:g<:g<:g$A<:g<:g<:g%A<:g<:g<:g&A<:g<:g<:g'A<:g<:g<:g)A<:g<:g<:g*A<:g<:g<:g+A<:g<:g<:g,A<:g<:g<:g-_eo>9m1)f`P dj?|zHrSwea+7D'fpACfD (4!h~6<bI#Yd$!+:'t(YZzk4G3bRB E!IeQQ58 Rξ^{WV\[R.CmKYVpqEr!b"W+ԍM&)wmR:]杽jEݱrb2Eda&c]jKR,>6=׳D'_ B(cſ{#?2~u|^5Pϑa`@7'sP0 #RGv@~ؑJc$t\vO5.A"C\-G2o n#7/'j%Qm^Iaz7[,&V汌.OFHb9J[} d1yJѼ r%B <leI?0N: ye;:fGIQjKx8xڊ%}}DTt . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4P 4 (  % %uHH  % %NetBSDʚ;PaXNetBSDearmv54H H D0P/!p@-@P`C`F&a03/T@p:$$A-`0`` 0PpU(pGpG@Pq`P03/T@0US ^s:$`@-lPQMK \!\1 P` 0 R: 8 0S  /S 0SP YD00S5 0pp WI2I0@3)1*03/ T@pA0pWH2H0@3(1*03/X@ ds$L0d 0 P0 0:$(l$HL$ $X0@-t ttUPl@dphP L@`POU P <@33%4bP@-@sH0`  BR` pR RX X/%(%O-pP  b 00CS0wp@ [E0S TX 0S7 0T0 R0S p |16@' 0@ LA`000`00<16@0 0S 16@ 0S $p @ T T 0S ^p Ip0S TMxp -tp @000 ^jp T?@0 @4%P%Y,7(%%7?17O-@Pp`0ĀĠ00S 0AP  0Q @P p偱0 P00S Ѝ @0 P0=T0`00 %4%cLL7A-1Mfv1 Ah$0pS&h(0S P0 S(0(P UP$ F$0S;(00$0( $ PP  \000ЍD$ 0PPU%4%67`%7?O-P`q`a@\1tHTTTM$H00SE 0@P0@tH$H)  R @PSp0: S  0 P00SЍ@P0 P0e0s 8#8T T%4%c7O7@-0 ;7% 000/d%G-؀P t0M@ z  X0`p r  0G PeЍd%Y@:%@- M @00@0  bP h Ѝ:A-` p1V0zP 0 @P@TV PD H W@V2 `C0S@ 6@0;0SP W 0XpBV XpB0-S T`@@]p ,P@0S W >%::x%:O-5M R * @Px Ѝ pp L@@5X`0S 05 ,500 5Y0S50S+ D$PD00CS0+@Ĥ Pp  @YT @0 @00CS0 0 Y(0 p4咯00p bpP300 |k80: S +JpP  p* R@t Y0@@ 0, 003($05y00000 R00SQ 0 0  ppE  p: @ 0T 1(#I0  0P# xx,@  eP T#@|0S =P XT@! (+(" 0R@D 0[0TT$@  p00 R0S ll1 0S 0 9(  P P @T f@P@0 ?oR20S 0  0 0R0P 屮@P ll婮@0S L%P@ P0Rt00!P %>%7h%p%t%l%%%:%sf%|%:d%%%%0@-MM@P  Ep  ;0U$C dP TTaۍЍ08 `P ,(0P X;>%;);|%Q@-@ TzP DD>,QP $ 0P@>%;5;|%Q@-@ X[P HH0"P $ 0P@>%;@;|%@-0 J;%0$/h&0$/&@-$=@-:=@-Q=@-g==@-1   0 0 Ѝ|=`&@-1   0 0 Ѝ=&@-1   0 0 Ѝ=h&@-0   0 0 Ѝ=&@-0   000 Ѝ䰶&h&@-0  $ 0 P/ Ѝ=B%@-1  (0 00 Ѝ=&<00/@-0   00 Ѝ&=&<00/@-0   0o0 Ѝ&=h&,0C-`A!圁!ᘑMpW0 |! R0B=00 B  T+0L!D!7 Q<A 84100ЍPP =.P 0p00S  0 P0P      0 3/Q ! 7000@0@0LD0&&h&;#=>&>8=">5>O>>T0p@-|@PtP00 R 0p800 p0  B0Sqs &h&&0 0 0 /h&&@- {<7@-@- r<7@-@-80M@0(@3/P $ gH08 : S( 0h 3/P   00 0Ѝ00 0 1/qp,?0S 007m8@@-@R"PЍ@ PЍp@-(`Vp80@  03/PP!8003/(Pp?@-@P`P 80 (0(3/@> P >PЍp&O-3 PMP`(P,`B  0SP0 0K S X0\ 0X0\Y0 P % pHp 81/qp4 D 4?P p 04 >0S4 p0 0 0 0 "w/0 0 0p0 t 0 %0 0 VU0 5"SR* x0| 0 x0| ! R(P0,`R!*0 A# 000+1 xpt| 8/0( ЍO%p0t 0 p0t x0| 0 YXx0| 00 0S04D0W004 0X IЍ&?&@?7R?v?R/ R 0 0 /P0PL 0L B0R/S/  AA  AA  A A  A A  AA  AA  AA 0S AA@-tBM 0  \ 0  @ / 0(ŸR(0$}?`& ? BA3c@0DRH0n&}??B3cPoPQ`0!!!! d 4 !P`484 t" Bhh `!d4484 a" B !d4484 N# B  d4{484 ;8p<@ !0>./0f80 /`8dX p@4Z484 Ѝ`&Mb& @^Nc6@O@b@y@S@-@PBG- A `00P4 2#&P8P0 (1/qp $ %㬀夐pUЍ80 $0(3/P 0 `V`PE0S0C0<0  Z $ h&7&B%@@-XAM P04 00#!8 ( 01/qp$ P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `&7m@-@L M 0Q   0   Ѝ&Y[O-xM0@S M. 8S+ #='0|l0S( 000| " ! !x00# #|0 p& d%ݍ Ѝ0'|)4 0 X0 S 0E0WS06  S  S $0S0 600000S60 060 00 6RC7 R0r0C0C00Q0 0S+ ,B< HD6@,SСP`0Z 00$0(0, PU 0`0(0$00,0 0S $Y# 5%͍(0S%0 %00   0 5%,0S 5%0 0|t]pW`50%\X= ?X09*"8 0  6080 $ 680 6p(0, 0 00(0 0@ $0<[@ 00 @ p|d&7:X㐛)00 ?X0: 0X㐳$0吣# ?X0:v'00S/ ,0S #$X  !40S \ ?\0 * 70 ,6 0 7%6# @  |0|$[㘒4 0 !x0 $ , o0  !i(0, 0 00(0@0 $0 <pP1,0S 0`QP Z0(<^0Xp00- ?X0)*O7 0  54E70 $ 5;70 50000004 00 p%79X㐺+40 ?X0:7 0X㐣$0吓# ?X0: 75!  0 @<a  0p 9&@ @*AdAAAB%OBB@@B B&LBB@2BBB~BBBBBBB3@BpXC.C@C5C@-pPP`@@D ?7P Ѝ`3MU@FCp@-XP8@T`@D p 2P<opQ<Pp&A-AP0P$ 0 0 SQ ( $0ՏP 9^h d`P, R3HHqU``0``000P9A w00CS000 `   0,`0CS0000 (00@/U R 98 4D 0$00 0$ &g%@E'r&VET0 S 0SP/P/S/@- !&p@-HAHD0040S*0! PPP P`04 0PR@ V04 ^000( P 0PU 4`0PEP P 0P4  P  P0CSRP40P 0  p'&B%&&p@-ءTpp0pp00P"3U  00CS0Hx10 t@p@P0 5 0p0CS0100 S0 0  X 000 0 0 0@ 3  t固C 0`00h0 P`0W0$0T P 00 %|'''g%r&&t''FFO-PpP0 SPEUP ЍE P 0C0 X0 Ub000YP>3庹 H 00C0S.20 & 0 0CS0T200 }. Z0 P CPEP 000S S  `V% V000 P 2k| xt 00C00 0CS0D100 08.X 0PFjP 0Z0 CPF V(崀VPP0PP00ȶP 2)t p巹l_ 00C0m0 P0CS0<00hj00`6'l&'g%r&'EO-P@`p P`T $. 0PSeP 0@^S00\P0S \ [ h?!P @P@+0P00GB%GG(%i@-T 0@D ƸP 0S( 0C00S 0C0 Ѝ&ht@B%P0 R  QQP0R/@- &G-P`P@ X 0S@ @0S @T@@DT pP 0S 0 0 YPЍ&(GG-@P tp0S^`[PUP 0 @+P @P&X0000@-@Z 40aA R    0/P%1G&40000 0h@-; P%&1GO-R蒟@ 刀p0 pWp0#s) 㼢0`?VJV$ V0 00 0S0 =D W1 D1@s4M10"S00 @∀ FQu SUUUThUUDUUUU ShU STUTTTTTTTTTTUhUUUUU^V^V-Vk @ 0000@^V-V00@R 1 p 1@s@00"SR 0.V@0 @R O /Fo@P0 R00R  G@PR 00;V0 00 X@} T0Sx&P%'HG0@-@00 005P 000 0 00 ,R;R 0S  S   0;SRp& p@-PD0QS@@R0p`VP 0C&p@-P@P p0, (z$" p 00g%rQ 0Q\S@-Ao/`@-0S*  0@0S! P#pP +PP ߲@P 0 S</R/    س 0 &9W\GcG( Q 0@30/@-&00@- R 0C30&A-plA1SPR a00S S P0!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0"0 l W  QU0圁0CS00 pP&%G-AP 0pRpGWR0`0`0$!` 001S 0100CS0H89 pP00CS0' 0S  `P 0Sp`0 0`0R00 00C0p00  $`p&G-p0A 0RSXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*Pz`&G-A 0`0P0 P 00CS0-0 o& 0FSSp P1S 0p10 PE0CPPBSP0&O-TB`0pS&#P UC0S0001XPPPPዲPE 0Q0CS00LN )P[00`F`0^P/  S P) 0100CS0G'(BP; 0堑0 S- S   EP*.妴 400CS00  0堑0CS00  k)0Py&g%rA-A`qW ڬQ1ECe R1 0 C0|00PP-T 00CS00 t 0q0CSQ00 \R `R `&g%r0O-D0!105P` Ѝ0S/T SPPP  垱P-X T却P500CS00  ^0Q0CS00! P1ȃԣԓ 0 S*"Rʜ0Upppp00_P 0r0CS00 ( 1Q !@o!S/ %S pW U 00 00P 0帱0CS000!000\Q00pPR# QUpp0pp00Pb 0q0CS00ik0p 1 1S 0S11a0S S`l   ԰P5 0a0CS00<>10P!pE S:`00  1S `'qP ʼ10PE pBR    Pp|000哰P 0q0CS00 &hGg%rH'FG( Q 0@30/@-G&`01S @-0@!S @h)P /.P /&hG7@-A00 S1 RUWʐ0\00>PB#,埲 -00CS00- 000 @P R0 R P Ѝ00!S JP M0 Sڴ 0R0CS00000  \00sP 00&P%g%rGG?A-O0 R P%Sp WS ! GYPZYRW~\~m|opuu|o{k(llhmn|oDpLxP0PPQUT *PG@oG`GooPbVWP 0 nR pR lR 00 S101P0PP0SOP0 nR pR lR 00 ST)0S* HH &P0PP0S/P0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Ss1S P yP0PP  P` P 0 nR pR lR 00 SN!ZP0PP[PP 0nQ pQ lQ 00 S / PP: 0  9P.P pP)0Sh `Vl0ViVPPPVPU0 p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SP0 nR pR lR 00 S2S040S402P0PP0S 0l0C0S 30 Sz1SP 2SqWPP00@ 0S0 0e`Pv P0 nR- pR& lR' 00 SV1Sc1S0!S X 0S1S 8c PN 0S0 1P0PPP`r0 gRG  R: 0 B RX( `E@p?N(0"S;b!pR1 rR1 U p020 R 0 S$ 0U0b0 ' `P$00CS00 P00 S2SP00PP2P02 P P 0b200CS00UN !2R00W0#220# 020 nRL pRA lRE PP0 nRE pR> lR? 00 S1S"P%&GGGGB%B%GH'g%+H@H,(FTH`'H''9WmH'B%HG9H4 Pt" 0"0" " P0PPgP\p PPW0S- `V0V PPp0 nR pR lR 00 S,1S945P0PP0SP0 nR pR lR 00 S P0PP QR000P0P0@l `P 00 00 P0 nR, pR% lR& 00 S1S0!S |0S1Sq bWW 0 P0S0P0PP1S 2SqX<0S 0l0C0S 30 SL P0010CS 0nQ( pQ! lQ" 00 S3 00SK&` `圔S@p&0"SY`w 0  P0 nR pR lR 00 SP0xS P0PP0SPNP0 nR pR lR 00 S.P IH2S~$P0PP0P%  p-@- 00M ЍЍ/''-0^S0]S0]S S]S[S .0A0S>30   \  R]\0G-霁`Pp0 SS'PG(!RJppU``0``0,0 @P.%k0 ,(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A ! L0 0pS G 0'''g%r&HX&p@-!0 PJ@p P@01S?0A0S S n@P P0P 00S`0`00 OP0A l0X 00U0aP`0W%ӫ, (a$'(F'Hl'p''g%rO-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00P@ 0A0CS0p10H 0P \RI0P 0 S 010S P/ 00P S)  R [ U   بP0$8 ƫn00CS0L00} W0`00Pp8 P''TH'&''%g%rA-@`@0@P X0@ p>P" 0 R00R000 1BQr$@ @X^@pe$0"S,@gR000''HGO-@cMpS嘳嘣00 0GS T`s000T3TPPPPLP1$孪( $; 00C0-0&SM0 L\  DQ<Y0 0C@p \  0P 0$~l h d00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW  B@ \  ƧP AQ 0 T Tp p pp  壧P p BR   @e0 P0CS0,00 0 r''&g%rO-M0@ ]0P0ߍT40S 0 L0 000(0pP@Pd p0 S pSx 00 0(0Y01 Y  $ 8P$#嘩 &|  B Rd30    BR  300S 0 0 S 0(@P#Qb 0bppG XxlY 00 0P\"B, (Щ$x00C0S0 Y( Y 1  æP1 "" 尩X1  B  BR p100S 0   @ Q 000 "2 0 0(0P1 0 0CS000SUW#00 X00S 0 L  <  0S&''g%r& IO-pᰡA0M0CQ` 01 00C S00`Op   0PЍ5 *P!` 00000`P00CS000  [  }0S00CS0x00` P  P&&'&(G'&O-RB0M00bsp 0saЍܑ0ԁS 1 7  000P@ 0##⩟ɐ Y Gt10S 0p0000000CS0D41<  \$ \ 0 0#0L\ 0C000@000000 0C LN "&B%&'I''''&A- `P0 0Cs 0p 0 h0 d   B 0CR0@pT s@'&B%&G-@p0 PR` 0 P(S%0  d P S0 ,('g%r@-0 ͧw7I%O-eGM0PS@pM$Q403/P ЍGݍЍ0: S 00W + P8: ?0P0: S 0SP0: S 0S 0S 0/S&ѦP7֦0p0pzP- uWP 0#vi PvO+H0P ]<#PU]♦P Z/*P/*P ;0P,I [)H Z& U9.0. 0rPT:.0. 0fP@D!0Q\ PT1RP o R00S$ 0ST 0: SPPO 3  0;G=00 04K /G=00J0SP/ Hq7XG 8Xæ00CS0Ip Pp  pYW RX0 X p00CS0 00 0S ḤPP 0 d R;c 00Ḥ'T227IJk J(%=J%%JJXJ\\|0\\xX X0p@-@P@@DDT` U H H0Rp@\\bppX 0Xp@-@P@@DDT` U HH Qp@\\GppX X0p@-0P0@44T` U 8 80Rp@\\-ppX 0Xp@-0P0@44T` U 88 Qp@\\ppX X0p@-PPP@TTT` U X X0Rp@\\ppX 0Xp@-PPP@TTT` U XX Qp@\\ppX0@-t pX0pt0\@ ^0@\\X @-0ptX pt \@ ^ @\\5S %R R S R SSh -^L^S R 0/0/0000'O-QM\v @ `u @ 0@0 @0T0@@ @L@P@,@0@D@H@<@@@4@8@5 SS$幤\ Pis0 !00`V0SE 00吐0T0S{ 40D0800<00@00$0S00( ,00B?-$x)xW,0S  @?C000`$0L0x0P08D0x> 00$xx6$0S00D00H0#0xx&,0S  @?C 00 0S 000 0#xߣx 0p#xףx0 \ C@Q C003/040 0S 哢Y\ RS0 00 R0!0T0S XP,0x |S00L 0, 00PPP050L5[D1p0tQHD0 H Q (4.Z(.X 4 4 8  8 < 0<0@00@0 0Sf QA 0 !`h`0$0Q= 0 !l^l0(0$ 0S0( 0 0R  P <X0^@u0S00X0 0X00ƟPP5\0.S}0Sz 0!_0P$0 0P(0 $K0( E R X0<P000Ѝ'y-VUUUZaXO-@a!80S PP" FdpW  ЍO<0Sp|倡倱@P @}@0SL H50CSꄦHԥXԥԥX\q $ q00L0S \0.S0S @0S40S  <0?oQ20S X ߢ040 Ѝ'toJnJ8O9G-pc㝢]P0EL0 ڢP0S%00D0H0P0` Px0  :pZ\5T H0J0P 0 <P RD5X0 s0X00 00dt |  ` `R`S Y =( ?R004(0x |0R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z  000Ѝ1@GPꨪĬĬĬĬĬĬĬĬĬĬĬĬĬĬĬĬĬlĬĬĬĬĬxĬ0HĬ|ĬĬĬĬĬĬĬĬĬĬLЫĬتĬ$$<T`p\Ĭ40PPL0 P 0PPH0LP PTPFX0s0X0 0PPLPTPHP<0 00PPLPTPHPX030LPP00PPT0LP P0`P\0%0\P`0!0d0``0<0080 `000DPh0lP 0DPhPl0004@pl0 h000  L00S   ֠7J%kJh'l'D'$0\ 0S Ġp'k70L0S/0 000/@-0M0S 0 00!px@p坠Ѝd0d@ `0R@X0 0B?  0Ѝ@膠 ''$'YKK,'JJ('P `00CS`0p S00 P0S X0X /X{%: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\=@T10S H10S. 00 00,10'p  !@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B? 0T00S '*K'$'YKe*h'l'd't','"K('D's@- ᝛P@@P `PU00S @GT CЍp0t  Q \0 \0@-T (P@$U1K''p@-P@Tp0 0C0  ,A @G-@0M;43030S`V0Ѝ0 0C0w 0XPS !,e0S 20Si  4 "; $:p  I◜0 0 p@T20S 8@8 (04,20S  $,0 : SG( 2"6000 0@0<01"$010SP 91 100O 10S10S : S0: S x`|P1Pq 1Rp@1 B? 0 'Q p 4 ͞l^ 4Ğ00S00S '@'''JK*K$'YKe*X'SK '`ZK`'h'l'd't','"K('\'D'1O-0S,0@010S 10S40 001q 1000PS ЍOXa0PQ 0P 0 `0SpᡸQPPU% Ѝ  B 10`    0S[  L0  ,R4   V ''$'d'B%t'B%'010G-S,0@010S 10S40 000 0000PUG_40p0눠PUG k0 0C0 W bp0S,4  `YpP R`''$'d't'B%0G-@0T,@0@SP 00S40 00@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S,4  Dp` ''$'d'B%@- M @ p ЍT P 0@  QQ  00T P S  (%0p@-0PS``#@P iP PAq@P4 *P9᭛pl''9hK7C-CM@ `^ ZPȐ`T *F 0pPPCߍw ? P@;w0S ?@țP?oP@%@-r y#wK% 000/'@-b0 hK%@- ME0P ! 00A00P!0 0_g㿜 p]  Ѝ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx "$ 0P @000 h0h: pX   DH=k"$  (06k'KKKj47KOLKLL"LO-P@PQM +`Pn 0Sr   `7P 0S 0P  ݜd00CS00bpp/`Ѝ0S P XP`P`(z1 44 Rt(tpx0) 姜0 p W ̓00CS0 %p pYW 0 P 0S  tXP `0: S %P8Xԛ P 꿛`0: S\pP` V`Pudb0S x >P@ ޗP[I  [ ,MႛP F0˯S ,!00  1f 0! 0 pCp| 80H0 <P 8 x t9P 0S `0;`0`-P (P 0-S  ԙPTpPh`V  <%M`'8^WL:%%jYaL}L7LY@::LLLLs@-@ `PuPy0P U]叙卙ЍpU SP\@偙0 P4?<@@MB%OM9M^MPB%'NL0@- R88/P 0 0 ,/'OԱ'h0'OOA-p`P@ 30PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p@P00T@ (0( '/( .B%'h0'OOs@-R@T` V0a@$00 ?00S 0CS1P10 S7@.@ЍpPڀ;;S! 0 00 0Q P?P@@00" 0S @@0ES TT 0$00S0S }0S y0S $0STڄ00Q 5Q`Q.T( HJ.Z(00 .$B%'OO4'QPO.PP`!0SN@-PQM0SB @100CS4:Q000SS60S0@pT0S 0pL Qo 08  T0p QSQ00 t 0ភP00 0S L-Ѝ00/ -'B% G%PmPQG-P0 P Ѝp@PڬAQQ` 0Q P 0@@Q< -P 0SB%'LQ@-pAPMP \1`0S0 SU0<900U0p0 p0Q -Ѝ P0S(0S 0hQl  Pڌ0U 0?| 0 dF-0 P 0PN 0, -B%'|QQQQh0'NmRO-rM4M R0`RX0@FPi}0 0S 0  0 F0S(0S l  \"5X2p00 - 08"(>00 "#!Tq " #> ܍4ЍT 葟0S =! ! !0`##1 # Ô0S1p1 00 0@!>0H!041 Ph0D0 3/P2 0S 0 R 0pU0403/ 㢐A00S Y'P0h0CP0PP4'(' '''+'W ' '''''''P0'@-@@P ( ('W@-鍑p @@m  (X@-@Pp` 0 (@-Xp@-MPp@P 0S  0C0H  `᫑p 0: S = `S NS Ѝp@C-MpPЍa0H03/P0 03/PUxphA]P@ 0AS0@0 a3/PE0 0)P)3P/P \P0/S0P6 A0 0006@ p (0(03/ T㻏Z~ P4' ' ' '(%%BX'O-MPЍhe0H03/P0 03/PPw,5p0S 5P %'40SD]7P 0(03/ n 0 P 0AS0@0 a3/Ph4C00/DP 44 C$P40S  ⾐P 00  ⳐP 0R S "`Qd 03p Qt 0pP\P H9SP3` Qd 30/SVP \ A 00  sP0SU 0S "`Qd 02p Qt 00S "SB 0H 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100`"Qd P  t1 ,[ T RP (10 Q I @ 9/0S 0S 0S 000Y\0C00,4S 0S 04''G%VX('+'' 'P0'$' '''0'/' '''''ܱ'G%'G-Q@zP@T  T 0 &H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/P@BP 00 @0S 0 00QP@! ɍh;P0 l0ߏ X0 0S LPY }P4'kX''' '''S'Ա'XT0@-0S^PP 00H03/P@'4'0O-MMDp$0 PP[P[G-@(0SP`p㌀匐DPP 0$ 000 00/ 0$  0S0(0vPb 0P `0'B%4'ı'0C- 0 Ѝ(q 00CϠP 0P  0 _0 2Q%P` @"P 0YP$`@0 0$ V0 00CS /R0 S  0`V00@`0'G-pP`lV   BRl PPEUPR@@  &`Fp`0'O-钽M00p0PQ`@܁ 0(=P(X0 0㜑$0T0#U R 00Q0 T0*D1@PTP;Ѝ{ 0!!  BR P ?T0 0 0$0.PʐU 0 0 R  SQ0@T0  4S %! `0''Zw[G-A`#RPp㌡H0S5  Up 0)  y000SPER0  : 0P! 0p 0P0U00pPF0P0 000/`F p B00`00Q ᝤQ P0 S  PF`0'B%[ı'4'p@-0@0PpP Eh0Pp@|`0'B%A-`PlplU@@DTj@P U@0 00`PE`0'B%G-P`ကpU0 @@BTG@PğU 0@0 "0@UP0 ``0'B%G-M =@p P`\10S PL:8(! $$U00! J(' 8  BR P`ލ?U0 (P0PUoⰉPJ8\ @D 0RP J(@ J8, C `'N`0'B%[\[ Q/p@-JTUP P0P ( PpEP4$  ̇0 40p1\T\'p@-`M@ ;Ph0PUP $ R\ 04 0R\ ЍpP$'e\0@-MP @PЍ000S0: SxPIPU 0D P 0x0 $'\'T\0@-M@, 0000S# Q0S 10S ʈP'0S% X0 ?A3c000S&!h0 ?A3c0 P 80NS 40X rЍ0,0< j0S ᳇p G%G%Mb\\p@-@P`ᴈP p YP $00 Cp謱'\@-!@HP 0q0@ .ꬱ']O-@0P/S`p/M/P8 0 0FP  sp /00 ,P%  P 0S   P !P0 K pw  Ѝ'G-@P 00/S (QP u00Q  G円&ZPv0 0`0S /뤀夐p0 =P[0S@$<iP@D0 40 @:D꘰'1] ]]'']A-M`P@p᥇P5(10S Ѝ 0RP  0RP 0: S-P ȆP0 FdPW BP  P W0 @($']]]0@-:(4@: SM=!R \000[ P0 8p 0: S ,Ѝ000  u^:P/  0 gA-`QFZDT@P0@!81P @$<qP10SP+(0 000 0 00! "4S `ᨅPf`0 †Q0p 40Ѝ(tS|(tHP 00 1\'' G%G%1^'O-Z#Q30`@ (tKMMp 40CS񟗩<hl3l8P \30S ℆0P0 0: SQ [PY 3P @$< ?o2P0S(4ĢS2P <PQP|0t"0 + 0S<20S| 4m0C?o2 000! "Hn!ⴄp0![Y- Y10S- 0 !K>0@4@~z=0 CRz˄ 4n6 ᯄu PF@$<P>4S(4R0(4o k$hR\00 X0S 0(4| 00H 0KލЍ0pԱ'i''' G%S^G%H^']q^^/O-p@M W 0DP 0S08 0<000SPP0C080pG0S 0`S * 0R 08 0 x x/  P8 @0 X2@ @?Q*@0 ,0嘰 R P` dЍTT z  ` `@^^x't'^'|'Rs@-Ѝp@ 0@`PQ08  元P0 _'^0@-@MPPᭃ00<00S  = J" Ѝ0許'G-z@M`Q M Y #P kP 0P 0P=! SR J(?ݍ ЍPJG8| = $ HL0RP J(DP 0P(QȄJ)8 ._NC_d_G- AP 000qPU+`00CS0ᨹpU 0 0S U 0 P 0 SP P0SP 0S0 0 S P ꬰ''F%% 0 0 S00@-@R00000S0@000S `eP LP40P' ''' ~_'p@-PP 0Sp `<@Pd @P0/S0080f R P@@@@p__'h0 RX R  H R/< R/ $R/Q/ ꬰ''','l0A-0S X0XP@0P`PpT R S* I0@ꨱ''g%_O-c@ 04MS0S zB9PP P0 0P@4Ѝ50C S5%`%(%`%$@%`%`%T%T%L20S 0X0(00!P0 000" " x  0!$!$! 0!=C X 02($ * RC 0  R<  R)  R08 0H! 0 J  !1@P@ 0 R  R0  R $-0400S ̈́!!" # "040+04 yPv0< 00  ꬰ''`:`V`r` Ա'S`p@-8M@  HP~0`P`iU0$ $ @ 0NP8Ѝp``A-t1hM0@S TJhЍA`Z(="(<p@1WpP0 0000p084 &40CSH$0"60"$0( 4 CR+x  whЍB>'PS+<  Qꤱ'gY````@-@XM="p:(0 XЍ`7@-@Pp P Q Ѝ0 0 . Ѝ0@.0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq/@-0CP0%S*0 ,  ^Ό!0W0CBPBb 0  0ΌC S*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 B^00 C@ T A C@T   \a0C R  @-0C0S0" ^":00NB\Bb 0  \@ 02W"!N ^*040@-@T@@  '`A-P0q0`Q VA-QQ@@TQ S AEA膅^:TP0 dd}?@ 0:S@ 0S000 @,а'%&a%=a/ks@- ` P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* & 5#P00PG- 0S赚`P |0P  T@R p00T0pT0S ,@Pp=PP ~Vajaذ'as@-@PP0@l C300Ѝp0  R R00`U|@P 0 `F 00ذ'@-  ,R~%a0 Rr @-/ G%@-4@4,(, ,,6~%1bbcdO-pဠ倰 @ 0P0 p`]0, Y/   `veO-@lM/`밯PHPP 0p px/xx_00 \?\/~pL?H?A0s 4/S XB\   CRX0`F>}zP񟗳$9\73\79\7\7\7\7\7L9\7\949<9D9\7\7\7\7d9\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\788\7\788\799\7\7\7\7\7\7\7\7\738\7\7\7\7$8,88\7\7\7\7p98\7\73,8\78\78\78\7\7\7\7\7\7\7x66\766\77\77$7,747\7<7x777777777\77><P q,PM>J=0 -R,Q0 00 0;h= |=l, 4d @0/S000 0DPpR0 ꐱ'','Rlol0A-j40@TPp 00S 00S0 00/S @Tt0oPL0D0S sP040 ꐱ''0'x2A-0@SP' 0`.S0.S0S/S 0?P 0 Q CR S.R  S.R0S/S U 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p 00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0P%A-Q@pW : H' oO-1MX@ $PR4 84S00 {040 < 0[`[ @ 0SY $P ^ 0@0T o@P ׍P  0000Aqx Ѝ d  $0R  0CS $00 0qqH' o 0A-@T:8$R4 CSR [xc!AT0WV0 $P ^  @S0qAqH' X0A-@T`D'L@PU pPqqUTH'p@-@`V!TpPt{ @pd0dP \bP0p@}04  r@H'Go̱'ȱ''p$G%5p@-<@ 0S $!pP H H'Yp@-<@0S $ pP3 H'=p  @-o`O-aM0Sq K0p40S W00 $p p0PP0 0+ P UY   0Q  PPD 0 ZY00W00S nP5 0 " 00 RQ3 0S0 V0P QP LP `0 ~nP 0 `0 $`040,  Ѝ "H'pp@-<@0S $loPH'=.qC-d`M0S PHp0@T " !(@PUЍH'O-M`P$ %!0@pDW% @Y 0 QPQP (0S0 nP P `!! P"(Ѝ ?pЍO2H'=dqA-0@T `pP[1AT  RQ( QP (0@ 00p pH'=/@-p0M0PS`M 0/S FPP ۍЍ(m@P  pT ۍЍ@o᧋P 0$p0$!#!0 00 @ 'qqH'A-P`@p娀TЍ000S$0S  00 0 00! !A<00S woo@H'' G%G%G%C-`@Q@APP@p!@ WT  0q ! 100` Ѝ 0p`G-鬑M@T- `P!ApT t0S! @T m@PM 0D0 0OQ@ *P2]" 0`! Aލ00!6!QP 8 w P +   P ]"\ ıD Xo(  H'G$G%qqr0rOr1G- `V@0P TpY  l@P) ᩊP! ᣊP AZ @P`P nዊP< nn@H'qrrrd0A- @T`pH P ATP @H'Qqp@-@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSB 3b 30 0pp0 S  0 - R 0R$R:/A-0A Rh1\pP.@0MTaMQ 0  C0/S' 0 ! Mo ,P3ڍЍ *\0@C ?\0@C ಀ 0pC00C 0 0 %o P 0` To P 04 $o P%r rrsp@-`0Sp@e\ 1e #@ Pm000p 0@- s 400S  /h'0-p00@^SQ 0Q00Ph' Qp@-!0PS   pPd @t Lm @@T@p00@i(G%6sG-`p娀@PP}P  0tE`0X d@ kP  BR 0 $ 0 mse G%wsssh'A-`PPЍ4":0J840K0CS2 `60 01 -  d_ (lX <tS @ |qp}  C=/ 0$  4 =CL2P ! 1P) ($5P/^)040)($84K @RKP  $ p++  @ 04(4 :(40/S04084(49)($ q++ l$t' |'C-j@EM0@S(zzz{{zz{{30S EߍJ(hJ(J(J(!L 0\ ` @ 3 30 QJ(| S7000-00 s++  10>L  Rp0<x P J<p0@ P J11   0 ypP J =<^@TYE   fXM  f} 0 QpP J} 7P RP$PP P "P 0$p pt s 00bR c7Ph'vGvhvvvi~Lvvv v'vYv0@-PMM@ ` V=X X 0P U+@0  $ $ ,  ݍЍ0$ +Mh'p@-@ PP hp@*vA-0p-S0S) jPP%hi 0NЍ0` S0 BP@P,0U ᤞP` w%"w-@-0@P   |Ѝ@Ѝ/ᐲ'p@-@ATp@0 R P[8P ` `P`p萲'-P@- 00|0 x0 t000 h@0S X800L0L <j ,{$ 8 Ѝ@ Ѝ/ı''''%Ա'yp@-xg@PlfhPP X_P p,g000S  pCw9W'('Lw -P7@- 000@ 0 000 P0S xe800l0l hi X{TiD 8i0 O8 Ѝ0@Ѝ/ı''''(%Ա'y%@-醃 i7ghw%@-M@P" 0/S1P|1P hp \hp 0RP 0RP @ލ]ywl 000/ᘲ'@-E Lif}w%A-q`@ MT tt=ilAPD00CS0?῝@R @ <R =R @ |R@ 0&S@ 0=S@y  0+S'@p 0-S(@i )e&c#a@ ^P%|'}x'p'd'20@- `'b0s@-0P`0mV0`0@S P 0R@P@&  P@0S00S 0ST P000 R  Ѝp`''H%v}@-L ^8,D4lx4X\T @@~, \ 1#P?0 C c0à?0 c0àΌ SQŒQQP0R0R0P0QPQP !귅ÅԅO-`pp딀P @%R? &R X(3! /[00  0 PP@@ Ѝ`'@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F2P@$ P@Ec =T`'y-p@-@P0)Sp`'O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D b S! xz! r0  0@@P! e0  @P\VS'T@@`@P, @ b  `'y-O-p`M8P젟찟9!@ 50 X@0DS '00S^^* PU @ 0 V 0DS00SY Ѝ` pUU `'txC-`p  0BS00@SP! @ 00 TPP@@ Ѝ`'G-`dP0@S! p0 000PP@`'@-@MP 1`PL0P  IR NRpp PPEP@@0PS@ $1Ѝ`'*PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 Pi1g1Sp0@b0PH0P@ 0,O0P1YG%G%t''v7@P/- 0/SSS00䀳'@-@PMލ0/S Xap ap 0RP 0RPp@-`\0@LP /D0p@;0:0+0"SP Vp$aq뀳'Fp@-T` RpH0@Q 8 PP /pp@ꀳ'hG%]O-pW,S 0S)P _ C000000000CS020S @T  Q QS/^h2hb0d00@/SpG/pHHDPR0S 0/p0CS0p@0@ppW00w0000pA0P00 _00_/ Q tQ00CS0P10S 00CS00W0@0 pR0S/S0@D00=0@0W0 P  R*0000t/S0S  oP 00CS0p@0@pK0S 00CS000@ 0@00ꀳ'''Z]G%t'G%A-`p00@0 `P 00CS000S @ 0P0CS0X00S 1X @06 R0S U$0$pM%蠳''H%'gG-p2B`Me6&0@T"&R@P$ 0SM .S00.S0 00/SSC10  PPB| ePpZ% ``VT(PP@ ` w.` E0E\D]@`0-S0S0@T@@QP._P0: SVP >PЍH%a'cGd$z'q}@-5$0Q @ fP @ꀳ']p@-L@Q50P000S LTPP 0S{@@L 101M00CS00 L 0 L0p_Rt4'φ' I%G-pPp@R` V101 Pp Pp `R\TQ @0Ti \0DQS񟗀PX`hpx@00CS00 2L 0@ 0 @T0S 00CS00 L 0 0SX00CS00 L 0 K 1% 01 @0Q  0BPA0@D@@@ @ @ @ @ @\@ I%s#"A-@ ` PR 0R 0S SKp0S0 R &L0S  LU   LTL^ xLy Td@00CS00 K 0 AlKH%''yI%a7I% 0@-P 0]댳'@-@(0Q L댳'@-x0@T   @@@@ @\@00S 4060S YЍ茳'p'H%-$0@- R    '-@-   0@-'-@-0@0 H@-P@` =@-@-   3@-@--@-00g " ЍЍ/p@-P@[ p@-@-   ЍЍ/ 0H P @-4 4TK,P / x'0/ᰳ'p@-@]PPPP 4\p` 8\`P (\p` ,\`ps@-P30P d0d`6 N q0X0@T PdLD0 0@ M@Ѝp萼'H%B ''A-`P0@S'<0P| 0*`pu0 ᭌ \06S 00S PЍ @0t0S0T.S 갳'N@{ 0    /ᰳ'@-@TЍ0Ѝ0CS꨾ȾȾ  000 P 0 3@ 00 0@-@M PU PP 0ѿp +P   HPP 0¿p  ,  Ѝ0 5[0 0갳'lG%!tG%@-@P 0S0S l3P 00 0 Ѝ'G-`0S q0P00 #@\T0PQS$@L&$00CS010S *Ѝ00S P U[d\5  R &)P00CS00S U@0SZ@ UZPZ@꠳'''C-s@P`^PM( UPG*릐) QdDh\\xxxxxxxxxxxxU2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU qH^0S 2 R$0S20S E@ P10S E10S Do^0St1 R$ R @T$@L10S D(10S D10S D00S D  @06 $0?o2$0-x0$@T $ fd00S D 4H0CH ЍH%'''H%G-PMp@)0 "`㠀堐堠>PP 9)Vx0$`W U ^0S W 'P 0`S)Ѝ舿'H%H%'P8PG-P* `0@00 0R0Cp0W S `S0p 00 P1*/*S p0@*)PD0(00$* 0$ 0$/G%G%t''A-P`@耟0p00}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S S갳'H%O-P࡟$M^`AV $`)pWS0嬱p0p0✁0WY 0S, |1S2GlG G00CS00 ZG 0= H00CS00 HG 0 *G  J ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ($ЍH%''I%'C-@$M p䀟( 0 0`@T+ 0S0 PU@ 000XP 0t 0 SP0 0U$0 @ R^PU $0($ЍP0ꈿ''H%G-P$Eo@p0婒S' 0S$ 1a11 G GZ/GUG00CS00 F 0 |FtaU000 @&PE U04q$0! 3#$  A BPP00CS000S @00CS000S U0S0S<0<0.1FDFG0'FUpH%'I%'Ȉ'''̈p@-(2FM000000 10S 00S 1 `10oFmF0Q@TfF1EߣPP% t1 1@k=0S @T D1ޣ TA@GF4EF 1E0S  1$ FߍpA 0 000 0?P00CS0 0@ 0 00t0 .=00CS0 0S FlFL0EX00S I@00S Cꔳ'H%''I%݈''''0@-00`o00 00^0$MSP4P @'000P; p+%P 00S V<V0 p000CS0(00S '$ЍH%''C-@?kM000@H0?_00?0,@0P@ &\@`PჀ0L0`00@T`0p@0o dP0h@T 00.P0h $00\0S$N&\0 S 0D0>60S |>0S$0S 00D0$ 01C 0T>0S$0S pd@4nT@ tP H07S 7S6 =0S700SC -000-0,0(00 0l(0P |=&0S(7S%00S 0 0ST= 8  =, Wp@ P 0 = PJ8 = <, R , ᲻,( B$P000<<0S V0 0`@G-.P  @J$ 0 $ R 0T@=<|;9/DdPU\PkUH0k PUX00CS00 8D 0 ;DCT 00CS00 "D 0@@t`P hE00CS00  D 0@UE @PT 00CS00 C 0@?E @P L?P @P07@:|0P DPP@HP :| RP00P0$ 0P0S `-V`-V P0E0R9pPP$ \ B$ 1 0 H$0SP0077S 0C8#8S|0  )SS ?708#8S?P0 Q A!Q|0(0S0(00S  8 @  (00(00@080040(8<0000L01@P8 7H 00Rk0( =$0SP0077WSdmG 0'000 000 7 0'0'00$(07  101|03/$0 7 pDL7L' 7D' BL0S H8 6 6 @ RL 4 0  G $Bn&@00CS0 Ux60S ĠP 60S&,0US6p6$6` d0 ~I5,,0( 0000E,0( D"0E$0(0SJ,m$ x5 50S M@5,0S l6Tp90%0850S ;0 @0 ?PLETK<0 0<0$0 0C0 0|00D0004 8XN00CS0p40S CP% 40S)T0SXNH8 40 3  3 384D(0093 0 |0S 'x0R\#CX#0LCdH00S0ڨ|BM0 #0C00|00MNG8 3TC  2 2 (00 02 T0S"00CS0 l2 R   0L2D0S#kߍU9H20S |08"SS2 @08 L0H@G020@0@0S 1 @0S2 1$ @0S  t1@0s1| R#0S1   B  @0S @0S7S@< 0 10S -8@,0S0  ?;,0Sd@Q [C0,0 0H |0D@T(0Sl0 p0R,0 0)DEq'''''H%ly''p''''I%H<$I%'',% I%H%I%''!x' B 0/ᰳ'0 /ᰳ'0 /ἳ'0/ἳ' 0  /ᰳ'P@-@&P<80QP cR   8'0 S0/ᰳ'0@-0M0/0@0LP SP 0: Sl  S` PЍ0SP0 : SO" PP'3AxJp@-Px@x`M$P)00S H"0`;00``00!`l"$Ѝp谳''@-`@P$8&0S0S 0C0BS00 000谳'//C-LMo)8u8 p@<(P@0` D, ` 0@LЍY I%`A-@P`QpWU 2K! 00'p蘼''O-pWC R``%` P0S:S2E@А @0S,W@  @0T/S/00O0 00S00P R:R0:SPPP@DO=!S!G%G%'@-P@/` =P*  0 KPU0 "U# "`VZ0S  0 o80S 40S 0P;! ~pPP8> ER~  @ 0t'A- @PM`Rl 1000  Rp !XZU l?? Q T?P?Q<? 04AS 00CS00 e? 0* 00CS00 U? 0 ЍQ ??U P000^J 00CS0P00S @??4,'}7 I%''p@-P@@Pp 0S%SpP @tp@-P8@Pp 0RPp@- D0D0S RP P\ 0G%'G-`P@唀0吐00p 0S0 S0S00,PPP|U00CS0$00SGTp꠳''G%'G-@Pp0`0帐0 Q :RQ :QR``R %Ru #$PPP0T:Sp0  4@0/PSu`P''ډG%A-`P倀000p 0Sp00JO@T`|V00CS000SA꠳'''0A-pPS R+k`a@T"W p000`0 @0 0 M00CS0H00S `P `@'''p@-P$@Pp0P0@@-L@000@00 ZO00CS000S@꠳'''O-PM/`@ 08P @@@ (PP00š0 @0S <0S 8000w#   P@ {P @cP: R R R 0S 0   " R00 mpP B0000S. R  pl" RZ0 RH"00<0  &pPZ Z 2 @| 0=00ЍQ  0S/R0SZs "P pP t"P R  R (OP0 * R; R 60@@DQ P R  fS@0000S R    BR <D R8 {6 t'ىG%''I%KډG%'O-@`pM2%PP2*0S*[ 000`"0  p0Rz0#| 0Z8 RhB<01 P<PЍbPEU @ (08@Hp  `@Q pV  00X!W QPYXV H1 0 0 Z0S& 0s1TP P*W 00SY0 [  P 0S4XT 0s  P ha=T'' I%h''G%p@-`P0000S S@$H000 00 00000CS0p00Spp@z꠳''0@-p@M0 0000T0P>00G 00CS000S [Ѝ0蠳'H%'@-dP 0SGO-`pP@lM$P0cS    <YpP` vPP VP@ L RrYcS" ?U;آ[LP VP   R񟗅Xhx 0R PU_@;%U 0; 塶P% ;;[ 00S A00CS00 -; 0 0@ T Ѝv;/rPVd!  [ZU!Zy;v;MPUl;U~\MU U UU/;0  g@000UYk'g2YzƊ I%֊'@܊)F!+O-p$M R 90b@ @T- TT:T"  T /T" 00CS0@  @0D S  4     p =$Ѝ0S R 4a@T00000@0S?@PUL=P@ @ T ~̰pX l=W 0 0CS00 S00CS0 0 00CS0 0 p00k00G%l't'H%cGA-(A0S 0PS0 0aqP0S00 P000eK00CS00S P 0SRh`hp0P RP000AK000CS00S ol'''p's@-0!S1Ѝp*S@SP``00P Q0C RP00C S@ `4@0S00S=STT00 D0 R 0AD1U0 0S 0SG%x''A-dp`0PS@  R R00PH @l'O-s@0M00S00 00,`000Т00<000000C <`0 00@000$00CS$0C0S00CS0(20S PJP(0Z00(PJ P nJ(P 1X0 DC{0@0CS0t10S Ѝ\0SJ$P 0[0. [`+ V , R1@ 0C\A/@`F 0SX  BR  R  B ~   B `FAQV  R@ @l'G%'G%''t'1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xQBP  `V' Q`:00Q@  @% Y0S" S喳P 味P@剳P P儳 DoQP @@` l''p'8I%A-XPX@X`P0p00mI0p0CS00S l'''p@-Pᶿ;@G60@ pl'@-Qp@0` 0S*00DP@`_P@0`SP Ѝ `P0@P0`S@0S0O-@p [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xPS@ R0B$x RP R  \$Ѝ$HPX:$P 0U0/Sl 00E0pP $0S/00E0S``0` xQP /000S V/00D x00SR00Q: 0 R @?~0P . B/o.Q" R  0P V 0 cE$l''0  Q0@-0 @QC\0CC/x^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0S P $$$F0$000CS0L00S 0S 0P 0l'''p@-@ PTp 0@ @@l'G-p @00 ST@D0P ̀`V .`RxP VP V V@ S`` S =RR QU   0P @}0G-`@ M G0P  b(q000e U00SV-00E@`PIPE@T Ѝ00CS0@t'O- R@@0`-SPM S! C Rh?So @Sy 00C Sh0 0 .`0S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P6솟p覟ԖW@A0S 0f0CS00  P6FBЍx6P6l6X0000Q00S 6 pR&V(0S 0 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 R L 0ppUppW~|0m R  R9 V} WHs 83 BR  BR j ~  B Rs `2 BR  BR  ~  BR   _ ~ Y   0S  QAQAQ   Q.)    ~ AQUd Ra 4q B R  `V~paQ 00S T 00 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00꘼'x't'l'(z,zH%l'Գ'G%'8I%O-,M0$00 060=```V`p 0  L600`G6 @ V 0@P 00@S0(00 60P@  R@@0% T A % R *R@R Z  JRG tA@TZ   + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S10@8 0&  [ 0 0, Z R$ CR 0S 0[ 0F 0[ 0 0@S30S0@000J S񟗷@#"!""""""!\3 BR  BR  ~  BR  ~  K R  BR ~0 0  BR ~0 0 (Rx[A0lT@ 000SS @Z,ЍT TL aQ00CS0)0 儁$00 0I0 0P 0C A 0001 10AI0000T 0 00LP 00 0@[@R p R0 Rp Rp B\T   R0S}l't't'G%H%;x'O-0M  P0 4400̴̔0@ 0~Q  0 pd匤0@Q Q#:Q =Q Q Q     BR  ګP AA  p A P񟗁'\%((<(\%|%&&h&X 0S@ЍQ Q@Q =R 0p(0  BR  pw w p    BR  u  l u  BR   [ ( R  0BQRQ B  X  BR  v p}7 v 0S Q AQ~@AQ  RX ~     A@@ P  7@P)  ~R&=Q0S! 00   @'8I%l'G%t''G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S000`0`0CS0!0 0@p   0   0  R 0m00e 0p H%l'G%t'G%'' @-0n@OG%O-XAX`0$M`F:P(0: S$0 į0  <P  BP< 0 00㫯0 <d"T<L00CS0,00S Ѝ蠳'Ëȋ'A-h@Q0P0`0 PHpPв<0`00CS000SA꠳''G%'p@-`P@00P0"P T< 0S00M<0X 0000CS0p$00Spp@q$G%'''0/G%p@-@,`,P0SpSTp~G%'p@-P@0SpG%'p@-@Pp P0Pp؟"0@pG% 0 R/G% @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0 '5rOG%A-R0S20SP`AR p H";ppƩPpW* 1N <p !"9P ; 0P Y~&&&; qP -<p<  8p,s< ; P <pd<  8pY< !00^&[&X&`'p'G%Cw.H%x<l'\0S/p@-@PP1PDHA|P0a 0(00R 0S"0D@f05#0s  0C?o2^0SP}pP {<LP p0S *00CS0p\00Spp@ Ao PQP'5rO'ό'p@-@\P0P00 :@00CS0p00Spp@꠳''O-@`LM R0 LЍO)ؐY. PPY   t0 SPs   0S0P0S PP PQ 00SЀ0S@LЍ0S|22 F! 0R+  p  !R -  "o)⥰p 0 0T"c) ᙰp0 sR ,80p) 00CS0(0p W (e Z 00CS0(0 00CS0(0 | 00CS0(0  Ѐ YZr(000v  ) #40  ( (P S#4d;  0 "0p@ gp  (Jzp0㓉(ЀHp0'G%5rO  ).=@- 0 SS0C 0.^\Q0 @  C/o "P R O-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  {P T"@` A Pj P D \0@00SJ R Q !" R @G%Cb'RrG-$a$w0S Qq0l0@S7 @ 'А㼠0Sʰ00CS00 W' 0 (0 R  0 S !''Y'5rO= I%A-pP`AP00Sʄ10P 0S hjPp pPP gP`W@ P$1@@A~'PV QPU, 00SJ h'0 a'`00CS0 &0S 0 0 00S0 S 0 0`$p$꺍''5rO_ I%40@-@T  vP@@d'b8 P  /Q 0SZ//'G-Qp0SPS@00SoZaP000M: 0@C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠d@  0 Z7@Ꙃ! P00B R @'''H%A-`!@S1p@!P [u$Tp1@WV2 `1N0SN U 0S0P9P 8V 14pX8 `"]"060S$ V"S"P"Ve$b$U 0S PPK7\37P LLwWT 0 Vp''l''H%G%L08 N R S  0S  P 㴜H%O-`R0pMxB0  pP 0S0S ЍP 0@000 0 0!P):T 0S0 10S  160S  0TFD RD B100CS0h10S 0S  02,   ^ \ 0Q R0 ~. ^ {  No[^ Q  P 000Q@V{  No[^ 0'''p'H%I%' G-pPK@P EP1N0St `3@7T @73p-7 y`㜠@0S0S 0S0S>`@Y 0 X 000 HH%G%j'A-@Pw P PT0Q 0S ZlP@ pP@ ZP@Z|06 R0S@@Q`` 0pJ 0 0 Sk '7H% I%O-@cs$M0 PPT  %P )P lnU pUT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP p㴲jY  \   0`P 0S00Y 0STP a'$260Sj0`00\  \ 0?o2? TW ='\0#Q 0 !X R8  p"P0S 0S00 0 RZP S  R 070TpP/o" R 0 S0C0 5 p0SYX X YPPV+'/E''XH%p@-@5``Q000 R 0S <12p !6!0S 0 00D1  S  Bo00P0R ` R\ `` R00 W0S00CS0000S p蠳'G%D'5rO'@1A-Q40@SM#P`q0SP00CS00 " 0 $01p $5.p!##PlP000T0@0CS0800S 2'7= I%G%''@-v @ 00Y'@-@ k @Yp@-`@0 0 p 0Qp\ PU"00p'QO- 0@LbLPDDDr0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS^4_l^_T_l_x__^$0!PU0 R$ \S0 \0 0S0 @ P   0@ P0#P"0!0 P  0  @}00 S$0)0 !"0T 0@ 1 }SP0  :0@"00  'isG%|WA-@dcdsdMTZ 0SW0S Pd Pa P^ P[ PX PU @,'XɈ2=WȎVԎ4N͎7Xڎp@-@P@`TpUPU 0S G@jp@-Pt`t0PP6 R@N0S@2@@0S. @D0    p 0 p'H%A-0P@`Tp R@ 0N@T P 0S@@|2W\0HU 000000V0@ p'H%G%A-P`pᩏp P@ 0 Aꥬ!30 O-P 0qM00S 1a б100 0000 S  @PЍ~0SG 0 RS/Q  C2P 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S+@/$ @00CS00  0 ( `0SH0 @ဧ00'4''$zH''G%t'I%G%A-M`$P4q4A0S M6V@oP 1Ve0^0  0P!1U00V0S^0SP60S .0S P'P P1ЍP ^X8 0P0C?o20'H%I%I%H%,'0S/p@-P0000@P00CS000S TpP@T` `@V0`0T0@0v 0S V00T00p@꠳''H%p@-l@0P00q0P I00CS0 Sp@00S ꠳''p@-P@dPUrbp@--Pt@-P/Ptp@-P@z.pA-@P0PS`~Up~0000 p 000CS0h00S 70p00000PC0P0CS000S $G%''P @-(/ 00C00/၏G%00  0 00   /G%t'p@-@tPt`0000S0 000D0 00CS0p,00Spp@00/꠳'G%t''@-D@ 00040 00CS000S@꠳'t''G-qA0@0000I?o2 V0SPkPP) 00>0 000E000PS V 00CS0l00SG E P 0(` ᶥ0`PP꠳'G%t''T 000@0A00CS0/00S/\꠳'G%'p@-PPP`@ P T @Dv@p00C0C0pG%t'p@-(P(`@@Dw00C0pG%t'( 00C 00 A0C0/G%t'-A-@P(MHp@`DpPVP u 62T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@-0 P pꌏO- 0@4MtT@0,`P3P0S pV@ rV00 dV000T P {t!3P h#hhC p z.P w0\Q"\Sr 0S!k.Pi R Q X BR )  "p JQO Q /P d*P~W p P{X  BR    @P  BR 0@ ! P R   0 00 h1  `PApW    pAqJ0 0Z* 0S  @P,4Ѝ ṗP ᴗoXPJ Wp X =  BR 6  1꩏''4G%G%t'$zA-PB`Pk̂000-.p+.00CS020S 20@T[UU  r0@0w 00 C@@x 00 C@0@0  0Dr000w  B0x  B0 00 Cr0P 0w 00 CPx 00 CP0P0t0E 0G`A01 H `ЍP(5 1 000 0 0A^j0@ 0QS$ 000SPP Rp,00CS0H00S #UXl. <<-(S''' I%YP%?O-f@P`sMS`P>Ls0SC<30@TDUP3X 9. 0 @ @ythX   X 0SB01 `ЍSVP aV HVP@ 0S4X0S UPP= p 0/S9S W:*00CpïS  B P 0 ( :-pF-L 0 , @0(@T0 S ,P -0SyB0tS x{tg 0  0P]ky'b I%/{ ֐Аh'v7 BR00/0S0/@0S/ R /0@-00@00C S ■ RR R1\0* Ѝ虑000C S0S//QX0 0@- ^ @P U@R000/H%p@-`@`P6N0Spv@Tp,,,+@, 0P p@H%`'?~G-pP@R`Q7 @I`r0S 0 ^ `V@A00CS00  0 @aq匁 Q  R  ;@TPP,aHqH0 R R %@TP@00CS00  0 Q P @1@ST@Q@`Q  PGB`V0 82H%a͑&  I%Bۣԑޑ 00\#P0@-H%0S/p@-@PPEPp@**A-@1Sc`p@DPU 0@P00` P_x'G-@P0LaL00 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SGx''H%A-P B00`0QՖ 0S 00S0S006X pW#P P6p60S0S60F N0 B/oS60"N00S R 0 0-S0F0 1 Q0CSRC0SQ 0S!, P0   000S 0 0^0 PA. R   R0 0x'H%.'PG- @@P0S`p0C 0 XZ0OA0C R 0 0CS0@00S 0S i)<x'M''P0 @-\@000D00S 00CS000S |蠳'x''000C S/ @-3P 0 x'G-0p RP 0S6Q 0S!0@ 0C?`C10 !1,b``@ `Z0i `` -R \ -Q0S 0`@T0:SE 0R@/T/:Y  @`)@T0:S   @`@? `0 :\00Y00  T@0 CB!0 4$@ ЍX~cjI%YP@-HD0P  Q 000CH Ѝ䜒x'' $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0@:T  ($x'Ғp@-H@HP080Sp0u`0CS0` 800C80H%t' 0R @-@T (0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @H% 0S/xQS  00 S/00 0/0S/0/}08 0/=P/P/0/}0 0@-0H%p@-`R`@PP t0 0Ppd0 Pp0-S0S0 0pV ($00080@ph'd'H%O-RM0p0p R pl"l2lb @d 0SXy XR00CS0`2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B R @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { k KpG%DzG%G%t'H%0-0@ P RDM`0 Ph h "  U0L T<0< A 0 01 0 H%̓Dz @-P@M0T 0P0SÜp`@T*vpPT @T}%PLP @0 ÜPЍ@G%G%'(l000S p@-XP@T T D0T@p8040@p 0/H%ܴ'Y<\'G%'@-0@ܴ'p@-d@dP\Pp P 00008  P8 p@G%H%GG-DR0@T @ B 0S 0 @ 0r8 0 00CS00 `)V*V V v va G ` 0F SXX,XXDX V@0000 @\V. |V ;V&P @0 ;P @0 N@0U PpFx&P@0 ?@0o|P@0 6@0@0@07p P  00P000K 0 H%G%''G-pc0@0 T T+P,0S)㰀" PP @᚛ k@@`P  0RVP @FDA@@T 0 H%zp@-`0$P P g 0R$, (@R   RP9Pl    Q  00000S@p 0 BRp@ W080@ pH%T@-y0 000H%@-@oPp@- @fP P @0 000p` P 0`@`H% O-鰑`P0  Pᔱ@APp0 CR00S00 s0@X ',100S @%X U _@P@W W- V- O0@PpGWPV oVP 000 0V p0S 000H%DzG-JM0 5@0 0 00$040040(0D0p`P $0S $$  40  |4 pt$0000$`SH4 `$t,4( ($00CS0! 0S$@PU3 0RPPS p10SP Pv )30S l3p@p3p0pH00 0S  0 |`PPA P5 \P p'200pm PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 Pc@0000 Y@ "00CS0O001@@PsI n@m1000S 10 A0 SGl!|V@0  幙0 @00C0,000:#0$000CS010S g0 0 0 0 02 P B1 0R z0u`@0PEPUZJߍ6~00CS0`R {00H%'G%'G%'G%t'0O-̟̯M0ϟ0 Q02202280?_@? 000"`00/20S@0Sʷ@ 2P8,Pԭ0 ܨ$/Q00S .00CS0.0.Q00S 00C00000Pa210S9xPpVTP"PF SPMpM vU0@#SGأ(ԣ0<DLT\x p00@ Sr0pG A0@Sr7pGa0@SOrWpG[Jp0 S00C0t00  P ('P 0p@W00@S p p p p pq00@0pGSq0pG`0@?o? @2;R0Sp _\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp000 S0 0C0~0 0ĕ@00C0pW'*00C00'60'3?00  R~   B  ĕ?pAp000 S00C0~00•00C@0W$*00C00'90'6?00  R  B ~  ĕ  B 0'3?00  R~   B  w$00C00'<0'9?00  R~   B  ĕA0'6?00 Q~A•W?p00C00'?0'02!R \ @  }P0S h00C AQ 0~00@00C0 @!$P "P1S 0~ 0C00  B \  @Q0~0A @00v0Q! R00C0w00@u0`"0p ! R !R0S G0`2 5R00C0v0)0!Qp R00C0@R 1 00C0v00 `@60"0 !0`0C0w0 1 0`0C0v00(P05(P  0 B y   "! @ B 00pS 21 0`0C0|0000C00  00S 00C002  B )Pp( "1@0C8#8S10`0C0x0000C0p 0 j00S210" RR 21Sx0pW 0 T0 00CS0S82pP0@@21S80 0#<R00S/ 0S(?0@SP P1P0U1 UP>X,UP0>P0 |P000P$@; 0ЍP0 ,  0P& 0&P00 0<P_ >P &P000p0p0((0 @ -P 0(0  p 0@0HH%G%t'G%''ɔ/<Wh'd'G%P%'}c5{G%t~ {P B@ < } p l {S  D  B p/#P0p*}P0$  @@   ? }P0 V0 p 0O$  @ Pp0H! , @ BR #@mx!0  = BR@ Ĥ0U@0Wj%S` :S/ #S0[ 0 pA0C Q @ BR @=W0 0 @ R,  B 0+0>G$p0ᜲ *P H02!R1S p0HS2@p0 pXp~ $0X2 ` !r,!!m00S Go}S㫲[| p'P023Q w0 00"0 `!b$0 0 @ B "  0$2  `!G-`ЀР0@T@@0PU @ 0S 0 0   B/o"P`0p 0S 0 ^ 0 0 02H%@-1P0@-2_M0$ 0 Q< 10010091x0000iPI@1x 1Q @<00! dr 0S $Q. 4QG Q (0  400,8  (b000 0 0 0 0 0 S00_ߍ0  p0 `0 H0 D0 H00SiS,0* 0ꔳ'H%'H%G%'Y G-Vp0 00 P" 000P6\\\\\\\|\\\hTd(0$00p@^P 0 R 0`     {0@0S 0 00( P0, RP[ 000@ 00 00 R, R吔P4 D00300 0000    BR   00r` P 0000 CR Sm 0 P P`  ``{s 0 0008 @0C 0 I00=`0 Sp9P \0 R   L000`0S0 R Ӻ00P 0 R000' 0  rP 0@S P 000e `@` 0P00`P P0 000000S$ T 0S 0@000@00S0P0S0S 000@Ѝ0$00pYH%NgH%H%A-Q@`Q` @ p0 P0 0X@p 0P R$@@`/R ( W% R"pn0 `4 oP 3/'`P 0 08 00C0%04`Ѝ Q  0Sj0 00 00 @ 0H%G%ĕ A-P@0 P/ 000`P 000p0@``@@{P 0`0 U000 PPe``0SU -PH%H%p@-@|PP 0 @OP P 00000Sp ppH% P/0S/80 P/0S Q/0'p@-@ `P?00`Pps@-` gPŽ@ῐ PP Ѝp @Pz   0P/'RQ%$Pp@-@ PQ P ,`G u?pA-P`@XpT@Q00C0V P&@'p@-X@X`0P000000CS0p00Spp@꠳'''p@-PH0@TpU@`V P`'@-@h 0 S000C T DP ,0O@dA T @0@@H%gfff'p@-`@0 Sڌ S  PPT p蕔0S 0 S Pꇔ0S 'h'p@-P @:0Pp 0  0p'@0@-@ P  Q \@0' 0 P/ R/'C-@P @2@/  zV 8 4Ud20S T g`D"D@P$2V0S' ` p@" pPP 1 奼 0: S00`t!`d!t `V&qP5P H 00 V U0S00  vP @峓/ 000CS000S ϻЍ"@|B T  OP` 0Y꠳''wH% J '!p@-@PPP Up  |崻tp`U Yip0U N p_pO-`PppW@p  10Ù`ȐȠȰ0S UT  O   0@  U   T 0S@@ `U I% Y<{>vcp@-P  @pp R  pp pp pp &  pp'p@-@PpD0 0RPPp03/Pp'O-@M0 @ 000Pp`@A b`2@ 儲|U  0Sp"p2 0Sd2X" Ѝ@0SD2 R@00CS 0SP P  úPmkP pT }0SR PMt0000 S}L1 0R  Xp)? B R$ 8 a AP )0S  7P  10SP 00CS0X00S 4T0 0 0P_'h'$I% I%I%d'''O-`0@@#@SM<d'h'̗<{ I%fF"A-PQU 00CSQHq1QL R@ 0`0CS00 `01L00<S0S  0qL0S 0CS>S0SSxd R 00CS0I0 - <{Xp@-@ᨐ0TP R R R& 1S# 0 哐PpR!Q QT " "D0600S0T0S 00S0'''H%@-@P 5:P0   X'QA-@ 00CS00 P `ppp B?U U P@U00CS00 `7A-@`ptPt@0000S 00S p`V@40`00CS000SA6꠳''''L0P  A?Q Q R:///'@- b@0pSM10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 ᡀp0 0S" UEoAp$ W`RUl90@D>T000 000 q Pt0N R  DTR 60SЍQ Q2 1 @D@'p'H%'PO-P@p sP `mP hP 0PEpSUpUX@@%` PPO`Ppl44APPEpU]X P$d$t$ 0E0 10ST@ T@P@UT @Pcs1 R 00ST|z@ TL@P@UT ,@,s,Q0S 00S hY@@T`X `Ȣ娲pGY P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP PP 7PP1 }` `0S[  0E T0 S R0T00 (@1 R I U@ ^00CS010S qPY`PP@ᘀPq0S 000!T 700CS0t00S J@@T00jT#IBV I%'b{'gbI%'G-PP ?p0@`吐 D0S 00S Eo0D0@000CS00S pW@UG''''p@-H@P02`S@20CSpg~V02p',0T0SP/0S//'C-p@`1010r!Q0@S10C1 ЍqXPU X2YP˸}P 0S 'Գ'@ 0P/!!R /'p@-8P\2Sp@xur\Bp'0-KM01`"R !R X"R   1 1d"1!d2S (^Pd1( (^P H!(000^@P$1( Z@T0d`0P( U @T 0S sPQ00CS0 ! }000 0$00D>S 00 "J!031'Գ''' 0@-`"d|'p@-L@'P{0PPp0C/U00p{p@-T@TP0 0P0 0 0000CS0p00Spp@ٴ꠳'H%'A-p`@PU 0PPEU` XD茌0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S xsDP`0000 0C0d'''p@-@P@0SH00Spp@00CS00  H%0H%0H%@-@ͭPXЍ賙-@-   Ѝ Ѝ/-@- 0  ЍЍ/H% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`zP$ 0S! hl0S00CS0>0 "  u00CS0/0 " 0S 娬pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 ޙ{H%0RH%@-@@H%@-0rS\0G-@0 p0R(0帀P0=00y=`y`F@V@p@DR000 S=S B`` R`ť` @G'PG%t'G%0@- 4@ 00C00 0 0Ѝt'(0P P PR /0@-PP@^ ^ R0L00/}A-鸀' 0S R['p`@PU pWp0 \ 0S 0S   3/P@P00ꐿ'0SeA-@ PᣅU p`pp0S'SSP@DAL'(yPP(  EAꍙ0KH7;jA-P0`Sp@    3/@PP@X "W p0@=SPUP00 00CS00  0 00CS00 w 0 T  I%اO-A0Sp 00P̀ 0`V S 0t@PU* ЍY   R Q ʁ r <0aP`0 lt'','0@ R P=R/=R/A-Pp0S=SRpGp'㠆h0h`!0aU@`T 0S  PPU``@t''@-1`0@S @  PPV 0 `< K d哱  `C Ѝ@.@q   R <0 2/0` 0R , R  c0a00 0000@!L @UP U0 j00CS0\00S ' ЍY0#L 00P P H%R't''@-@P= `&P )pTpP pp0  BR = T   `\ Ѝ00@0e-X0GM0000ZP00$0 0  Gߍ䔳'p@-8X@P0` @0U<J) 0U`00 0p@t'}?~!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ^$Ѝx'''H%`'p@-@`TP000T 00CS0p,00Spp@U@꠳''7@-P@T@ PP0 P00p Ѝ0 yP 0 @(00000 00P8|t'A-Pp` 0   0 @TPUA@ 0@00`ꐿ' @-;@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =rv@@괳'O-p@`0QrSP W 100S V'>nP pPW`0I?o2V0S Ep`VD10@T0  ЍOf @0P=S7 P( PW0 00 0  կ`U 0 X  ЍU0 00 U 00S -W KP,ZPPPP'@-` pk@P@ Ѝ0  R@ PR000 00S x0000     0 @@DT@00S ꠳'$z'A-`pĀ@TP0U0    0 R R   0 02/0  00 0000t'H%H%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X 3@V Y@Ԛ'PP@- 圮 bٚC-ؑp000P0`-S㰁@TQ 啁@ 0@00`0CS0d10S K Ѝ @P=tP 0 @0 00  0 00 000000  RP 00 00=S l0T 10=S010C0 PPP꠳'t'H%H%'  t'p@-@PTpv@p@-P@`P \NP@ xP@ IP@(P(P0 P pW '00@/ 0S0@/s@-@ᇅ0 0~P`~0S z0"S U1r0!l%*0S`0T庭000 @0C?o2R0SЍp脛P%@-M@  P ލ P@D0 SQH0PP0@-M@  P ލ P@D 0RPH0PP0@-M@ r P ލj P0RP 0RPA-@` P13@ 0SC P UA  PPPp PJ! 0RA @- 0-RS# 0S0 00t  Ѝ0SX0 0P0S00 040,忁P$T|h}}|0@-0P!S@M0SPЍ0P{ 0SxPUo U U wPo U  P? PPEUR`8HT| O  P  P  P  P  P  P P p0St00@ T @4 0(S0)S 00qop@-@`P(P} 0Sz00CSt       \ |      H t  oopPހP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(Eb0S0!SPpp(S0)S0S pp@-@PpPPEjP.U)P P     0op=Pp0\0!S0P p(S0)S0S kp&@-師0nI%@-$0$0 00 `'I% @- @| R1P\0* hЍ艜O-P@,M, U0pE `-R lRF 8R -R| P ,@P 2 000J @P i,pe pGW` PpW ````F %RX rPPx8CpW3sR RP3pUP`/2 RpE@@W1 000 ~PPP@U\ ,p 6,P hdlŪX1Dv@P +@P0S0Sp@G  | PY0Q ު RP!p0*Q( R0pu`  嬪TT{!wYP%jߜg I%v 0@-DM⁷0   0@@DPU#@0     0P x, pp LdDЍ0=pP "kꤴ''-Xn8I%4K?~slp@-00S 0x 0t 0l0l l@0   PU L@L0L D0D P p Pp꘳''''H%'$I% I%H%I%I%p@-@0@噶X 0 0@0PU@000l@0\ PB0S00CS0400S p@i@CԳ'G%'H%'''P/p@-@PTp000@p@-@P_f?l0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 8 /@0D 9K<@0(080$00= 0D00<00,0/+$@"x0@-0$ 0d8 Ѝ@-@4+000@-@4#000@-@(0(S00 0w0,0Ѝ`t p@-@PPjZ8X<V@THPD\`PUL\J`, 8`V0,0p]@-@48T0,0@-@4ע8F0,0& X@-8R@( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8$@0<<@00,0@-$ P = Ѝts@-Pt=nt |@-Pi=ot p@-0MP`0@-S00(00P0 0  P?P 0( RT  0 0 S40(PD03/Ѝp,A-Pp`@Q`-VPQwP 000 0 `wP-V 000p0p@- P@@0P ,pT 80$P< D0TP$ <0<Ppp@-$@P0S 00Ppd'p@-l@P`V T(pt`HV8 0 000pd'eQ7bQ+  0 BR@-  M| 0- BS^0@Q ^ 40 ? 0 C  / /Xl'd',O-M`pAPU TP XP tPW `PU p PDoT<†pS Z Y X W@  U PCT<p S @[  Z Y XW   PT7pP X W P T;&S) < S/ 'S*  S% 6 CTy# !W)  + 05:?T`P($F$vPU;ЍIS@TgZTbYT]XTX5CTS5CTN|TKl5CTFT5@CTA<5 CT<$5 CT7 U@T34CT.4CT)4C~T$4CwT4 Cp$ B 0gT 0S\X_TL4@CXT44CQT[JT 4 CCTZ<TY5T0TW)T3C"T3CTt3CTXLH T<3CTW TW@T W@S@ S2 CTWT2 CTt2 CT\2CTD2CT,2C00 dv @PpЁ0SU /t-T   Q  W0녑0t  PK UtP p꿧ߧK#6*Ԟ1Ч_gfmlut{ƦΦ֦^$-,5<DSRZa`ipxw>2::@- ?%@-,0, P 0 0 |t' %بs@-@`v000 #S@Pv0S  0900S 0 9Ѝp7D0S/#Sp@-@,P$p0P 00pt' s@-PRP@ p`p 0R" Ѝkv0"S0SO 00SS  00@OP%p@-h@P0S 0S 0SS <<< U   S(n000P0p' p@-Px@Q d?9CsP L0    P     pp@ @꘩'0@-@PPM 0SL1D00Ѝ000 0tP0 0 '5O-Pp`llM 0S ;$ , P 0S ߍP/1 Q 0S @s?0   P P@ P@0ST WpU: 0S  P 09/PV/` 0 `'KaU@-}u0S S S8 4 ЍS$ Ѝ_7 ű7@-lP$ R\p8;@ Hx$0S p (h8 \8 Ѝ0'β'p@-@P 0S Dm0PS 0P0 >00SppS@-&PD@D D`DpD0S00 ꌬV]%%@-ThPL0 p@t0"S8Ѝk'{@-ThPL0 p@t0"S7Ѝ蚳'@-@PPM 0S00*`/`0 ;P$ /Qp0` `0 0+PT 0`2# 0 0P!00 00Ѝ ''ɳG-@0  R2!<#|( t`, hP0 \@8 P0}4 D y#4R," (p "4S i"4S b!4S [!4S T!P0S pM!T0S TFHqh刡P8X,  ЍGd0S> a`` N 0* 0 %0US, !S  13 0USS0C SH IH I I I IH I IHS 0U   0lP(%f&-4Y=FOXajs{jjO-(Q ,@Q 0QtP Ѝ4QPPPQ<80S,00 80<0S804 <0P=PP=P1 QB":`p㴡崱8W0aS R   <0R hP 00< S  P0pS;`(pQ (ypQ @P0S0 BS `a 0ph R R * \*a 0]0`0(S0<Ꜵϴ@'P*TO-;$M p*.bP 0$S ) ߍS $P@T[D@P 늤40 婫X ZS' ("$0f0Qf/ j4n,2!S!R !SS0䡟1,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2 S 0 \p,"b"!4b4##> 0"448#8 R* 0S 0pjX P 0S 0 p1Sq j3  @1S jP f/ jm01T T %Hl ''ζVEW}}WEVY0_T'(%A-P@`%Pp5S$ Pv $0f0Q h75%R 0R00000( '''p@-0@P  P $p@P 0@- 0S, P'@-P  'O-@:PkMM 00(p @ P @|\P00@֒@00SP : `P( @00p(归0dS (nP,X 80i00(0( P P:HHἂY9 0  ,0P,0S( ,02 nP,吙吩,([ 0S,00 !( P,00  P,00  P,00,0 u@ \nPฟ,& , @P(,0S  S;ƑZ\0;s 00 0P, 1\  `J@ ((Y= 0SX8(0 S0000(0!nP () nP ( n P00(,0hP,0S ++RP0 (0| $ pm P 00(,0MP,0T0 4m P 00(,0=P,0`0 m P 00(,0-P,0X0 m P 00(,0P,0\0 mP pmP 0 0,0(P,0d0 0mP  50(,0P,07 m P |50(,0P,07 |m P <50(,0P,07 r xlm P 40(,0P,07o b <\m P 00(,0P,0x0_ R Lm P 00(,0P,0|0O B@0 aH0 S0S F_0Y: Y0 h*/(0TLSH &H 2(0S 0> | 0(0S @|pݍЍ30"000 00S D $0k  QP;$0 G7P$04\  BB! k ( 0S(0 0SO 0C RS[lQ[lQlQP\lQ[lQlQ[lQlQlQlQ[ 妐 0(0 R000S0 H 0 ( d2000"0,0 0 0 ,0P |@,0!S 0,0, 2 N(0S P E(0,S kw:(0 S Pm 0(0,S k& (0S\z(0 Sr PQ (0,Si kF '۷S5.Ԭ߷w!,1'?N'y''kx*ɸָڸ6V'4P%ws@-`0PU V  Ph@P hЍp`PD!1j 00Y0@⨐V4չ>$00S K@-n00\I%p@-@5S4 0PSP p@cPp 0S 5S 1S 1|Pp5S T \Pp< HPp-(( Pp1''QedArdA@-$1$AP(000(p;ge V5 5S PIn0S En0S 005S  Pl0P*5S ` ЍX XkPL` 0aPWEV'fd.md?\I%`'gdP@-@P f/li@' 0 C\I%|'md0S/!  -3@-PP P 0S S@@ SxP@Ѝ0@ Ѝ/%p@-4@4PQ#p@`A > @dI%@-t@t0MQh  `P0cS CS SS 4勏sS00ۍ0'*@-\@\0MQP  HP 0nS yS0 $h00ۍ'WA0@-MM@` PP 00YSP ,JۍЍ0PPP`r 0 pT'(%@-@M0 XP ۍWp@-@$P 0p@ O(%T'T'@-YMM@p ip\JYލЍ<0< S <f%Pژ10YS<0<0rdA@-PM`pg@(dJ H 8`[  Ѝ@-P0@ 0$S0S 0`Sp8 TQ-BQQ-4t10S 8@0 g0000 ! ЍC0AShfLfLfLffLfLfLffLffLfLfLfLfLfefc0A R8= 0! 0!`(p0 0h" X0! L0 80! ,0 0! 0'@P `00CS`0p S00 P0S X0X /X%G-` 0pP08f@P [/pGgT@Y @ 0@2WH3PFhpဠ 0  QC V _gPU PP pXЍWoJd(%O-@M MP`ۍ%u倅倕0S0#!pO P hP4 09P(p0 p3 P  ndtT(p  P 0 ;P 'ZؓPd08Hd8tDT( p P 0 :P 0(0csS, p P 0 :P 0,0cxsS0 sp P 0 :P 000@cs\qp 0j`p ,7 P \ T6'wd.xd 4J%m(%CA-PM ' @\P D  \P $'c  0`0PS c0"S U1r0%*Vc  0p0S c 0"Rsp&PdPd `尀p^p0 8&0:Ѝ Rj'ydC-p`@P Q &`P 03/ ЍC@@ R; 0 p &I%'7 0@- &'P7@- P@T`P D`P804 p Ѝ0W'wdP7@- c4P@, p Ѝ0'd@@-@(0   A%O-,M00@Q`pP0000 0$0X,Ѝ [P  p,&$ P  p $0 S TP@㰐尠$0S"  0k 00SW b  Ƅ0 S 0 @0D@fj p@-@PP1P' 0P, 8>0P t %0P 0P< 0Pp@膄p@ 0x@dp@qU@@oPptcidyararbmngntsʫ"v77 @0R/#B%B$1 4! 8</'p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @'0"!#/P/'A-PT0p(,` _@_,0T@@DA??@@@'?0@-<@< (20,20\P0  P*0 002'> 0R//G-`0(,Bp P\ E^@PP5W ,20CS(20CS G&0'p@-@`42SM%^  E@ 82<" 0 (2,"Ѝp@g<"82El@`Z,"(2H0X"\4Ѝp@'J%"0:Z1s@-P`Sa  @0SЍp00S@Ba0"S1Ds@-$M;@\00  0 08Yi%A-`0p @Tʰ-$P Ϡ~,0d  ? Yqp  RЍAL`0S`@D@,Y\ ЍJ%'A-0ሀ`Ppp@h!14P S@ D d" R S R 0@"/U'Mp@-4@P0S( e`0B1p'O-PLMx0 $0|0#(0p0@00030儠s,4000S; (2,3H($ 0(` 0[ 0<8 ?[ 0 0[ 000  0 [8 <0,bd"噵P o# 0$ 0,(0 D`[ 0 RD0 $R0 S h2000#1-R0" ,D.D`P@(Xp0P00S cP  cP  cP% D`!0D00 S< V[0g24 hhE%KUD1'A$5\"0 [P@\2S@0p0@XRp0 XP@p0 XPU@p0 XPU@`D`$0U(0000[ 00S $0 0(00 0h5 @ PLЍ P @'J%'% SP%M-s@-@G00CS0 (P` Pp pp"0 P00CS00 Y@oЍp@Ѝ/%$ O-a pr"Pp?C$@0eO 0DWqp Ѝ  R ЍO"t`=0S 0 +Wqp `BE,Z 0S J%*'p@-@P2S 0p`n/(2xZ1!41#41U &"U 80U p@@PC @^@Tp'''G- r@,X`P "` VPiY0TLE J$C,^U 0V!U ! [EPsO@s 'ZX2I $! (! "4! 1"8",1!#$sO(@, "!"",!0 00      0  0 0 04 8 < 0@k000'WA-\P@PAds 2FY t B B$C00C0'O-P0p0Q`@06 0 4 Q %C?C0V$ 021S 02/ .0 1  Q 32 $4 (5 , T02SlN Y) U'PL 20 0SR00P[# S 0 2S Y 7P !Y 200@@PA`0S Y0S S01S 2SL-PD Ѝ`b/. $0(1,SR[#ZY  0S^   BN R@1SO148<$`B00C0@@PA`d!R 00P !$(,     Q "R. Y 00a14a8a<0#d1a#h#ʇߍ@ h[QS/2SrW#,K p` 0 ಟ00 7 0`p#W0 002Rp`" p wp< T"QP20H" [ 0(1 RS Q0S!Q10! p12S  ?01DP& |!Qp10l4!?h02S02S 0 0S>0)S Z0)S  "Q  R  Q !PA00 0I0<   0S<('9hBYQJ%n},<U^yA-4RUP@P@ZЍp(0PPPB1P@TaTaTS <ЍAO0M!14!8!< B1!1p 4 1/1!1<0 & 1!1 ?01!1<0d  1P  1@?0ЍA'Y.=NbuO-BTd:\& "!R &/ .0 1  T 32 $4(5, T @\   Q R P H2,0L2000&0S- 1S* 3, T000P0  00ST0!14!8!<!14!8!<T0,@0p,0`\T (`0 S( 21S$ / .0040 81 <T , S  PT 32 $4(5, T0\,0000`P$p 0 0$000`zS 0 S00$000` P  HW[ $0P0  W 0S pL 0S 0s X2 0 RS  $0倴xo((0 E 4 0 8 0&4 0&80 &< 00p `0 @2Sc RU 0c+P[ 0 1<Ap 0PP,2`0C 00PP(2 00p d? 0PPpp0`Fa ??`1`<A` 0 PP,2`0C 00PP(2 00 0PP? `Fa?`?`` 0SY 2SPU PUSJ041S'Y'+w_1J7'PtO-HBp42MgS0"yP(r(b42S 0P:U42S 0S  yPЁБ 42RSfP:x42S]1!$1(1,ЍO0S `Sxp t04rdW2S f0`lp ؠ0OPV"PR SL0SЍOxM@ D0ЍOSP5 0Ѝ' ' &-^B@-0@M0@ pp`Prpߍ\ Q0  0P \ 4Vt02S 0S " ` PD!SR ͣ0P"'0@-Xa0 0LAP d2S8 P(x!p! 2SP0U  $pt"\ Rp\EU$pN0 00P d2SP P@> Ѝ0P0!!1 J%'mdE'F'1A-@T2 @PSP  SP SP@ `p@T 00S p`V@RPD00S @@R@Pх}(J%A-Pp`g @D A 000 0@@@A-@pT` PPPP{ 0@ @ @"O-MM0t4 P@ T\D RP @ <RP44 00(04QT(0 ,0 4@ 0#~0@,0S @@((@`@,0s0000CP匃0P@PP0 l!41P430 (3Q,#  $ s4T0> \p@: PE ,0S , <(00S<(00@1 $?P-'0FSʆ` P0S -S@= CP00 @@P ,0S ,܍ЍA0 X4P Q8800  =0 R00S' <,10PAPQPa400C0 C6T0S0ST0S0S C 0S C CC$0# t PS<(0  P囩(Yg^`YT>bKJ%k5z0/(0/(0/(-@-$@  ) %G-P`p5T@0S  0S X| U TY0S M0S@ (y1?-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @3Pݍ Ѝl!rp@P=0LLD@rOP,0: S0RP0 00PPP81: S`P% S  R  r)PPp*PPPU r>PP @P(o (7~@-0P  0 00q$Ѝ  h (0@-4S 3/ (@-9S0 @( 0$C-S@t(@-'S@ CCCS@@-p PL`@@0 7/P0 S Ѝ B00(O-M M06@  @  @ P0 0PI LLpPMG 0S>$f vY0S0S0 p0 0X@OpT  0S" P%5 uP嘅eU \ 0XP0PPҧ@ލ Ѝ 03/0P0  _P ⺿P@`  0S0SV SV tP0O.000; pp P( pt M(40@0Y0C @ pW*p 0  0 0000 0p0p00 Y!  00 )0 $0 JP$0 0S p#OP2y Z 2o@P ZG Yp Z`0S< f Sp Sm pWp 0S 0S @V 000 !0)0S# 0S,aQA00CS0" @ T 00CS0!  P @YT Y@DOoB 0Q  i @OoB` 0 @0  0 0 SNT(%(%W0@-M 03s0|c00@Sd9 0SPP RPP i 00Um `Ѝ0S 0S @  0S\0Ser\  0/1@ \0Sp 0!@u0 @Qkp 0S0S9r @\0S.r  @"  @0Shr @D <P@ @0 @ `0x P|"%   T    P  @@``C 0 @` G H D((($  Bd6QG-0@  0cP 0S< 0  Q*u  {PPn   0`P `z !URQ 8Y l RO0 p H0 0W40p LP C u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0pP  P 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`-0, 3$.0 (/0,8 001 42 00$4 `0G00 QP  `Ѝ   0P P y`P1S1S1US1S 3S3S3US3S, X P`P0`$ `<3 043 1,31300`0F00 QP     0P`00S !14!8!<<0!14!8!<@040  0F40  QP 8  0PA0O A0  P 4: 졟 0R  1 eYjhfXpW P0EK 07#;;S``XP $ R,0T T0,0T0 R$CJD0P 2L0#1\0\0Q 0P 0L0000P 0L000h00Pdl0d@x^ ,HMR]_RRaArrAaUu'?X@-p@`P P00 P0E 00QP  Ѝ 0P< !@ !0 P0E 00QP 4 0P^,us@-P` L0@ R0!0!0%^l00l0 ~p00p0Ѝp^ P ^3# ~P L ~H00L 4I ,LP0002_-O-Xp `PP 5 Ѝ00! 0UEQ P D$ JX0 QX0 P6UO-P,M0pPlP$0`P P@BpP $#Pi L$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p 0 0,Ѝ8(| L0 Q$2 q(@,"  P "  @P*"*  P0P S "!"0  0P@P $6 h0P s s// /D_O-`P@M衟 0P0S Ѝ p W  G r0A E00 s0 q r w qpp` TP0P@0 `P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P ]_Br^zR0/0@- PBU02S0P^0A-p`|Pw@P  PmP P0R*"R0R0-O- p`0P\PPX $P  qQ 0 0Q\@T(2 R@0 P" R S C0BTX t0D s   0 TX  R 0 0 n pP [P  J BPTR2 Q PE2tO-X`0pM@PP`Ѝ J0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/CP F  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0!  0eB0 QP 2 CP6O-@`Pp㤡失P0S00S <q.p@q8WO$0S  0S 0S,0 ( 0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0.4]_Df'@-?`XP\@#@3P@T@TpW @@T`L(O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2"00咡 0A Q P P 0W:0 0 0}A Q P PLJ  ZP<0T 0qB(O-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:J( A-@/p0%B?kP0Sp pfD0FS `C wD@@0T?  C0(0 PK %/(O-` 1cMV, 0. SP0 S@0P`00D@H0(0$08@\D0$ R! X0p1#r#@@ ,40@@04 QP r0P@8`00D`H0(0$00` p0C##  ,PW  q2<0pGLL0< SD00S   <0@ 2<00,040@@04 QP (100  RR R0(108H0L0 p0L0F A '*P1  (1 0(11 K  , 8 0B0 H0Pcߍ0H S180S  S:I@(1  0I0@;+ E P(10(10@8 80 0Sb 0@ K /oD000"s R`( $00P `, $0G000$0(00$0D0SD0! 0CD0 0D 㓢"X 0X  PP  :X R: U$0`(00`P0 4h | U?0(00`P^0D\Q U`V$  (   P`( PK/\nG h0x!P0poQ P P0S*0hQh  01 U(0$0 `P0l P P0 00 , P@`  Q .b A0 b L L b @G?LL0CS \Q*V 0 $L0|!s0<80|1 0V4 8 <1 , uL?000000U\`0& V0 0$  \T0P 0P 0(00T0 00 ,@Vt 0$ S1S IxQ1PP|!hR \@8P PPL0sPP|! ,0I|1@|QUP0U* 0" 00 0x 1S \P@ 0I 0000@1lhCPP 1|!R1 @,PP 1@703 0P 00RP U$0`(00`PH1 SRhCP0S 0S \pVR P0S 02S 0S0S 02S\V(\Q|!6xQP 6PP 00I@P s\ ; |1P 1XP PPPPPPL0Is0PP@1K@I,hZCP=PU `|1VS P@ |a``L0Is``@P !SP hPPO 0 1|10|1#40L0s_?00010PP<6 K/\]APP05P'U U0@Ih00h0tP0U* 0RPd01S\0!0P %4QP0%8%\0 P0PEd0U03:\0t(wP P|!d1 [b" :0 0|12P0P`"< ,u<0P I 02S0P0 S0 U$0 P(0S000 000(000 ,@ D00S@ 0,40V=@04 QP<0,R80 6PI 5P0c(Qx-([2Jx 2 ` w    G-P p@r W p\aPP Pp $PK/DD08QP0Q:" 0PS00  Q poxPh`P 80"8 R 00 05 !$x(  < Y     p@-@5%SQ% 5 %SPR UUQQp  0Q Q0(A-lP`5p@ @ 0% Ņw@ŕ\(O-POMp(P> b5S5夢05ET0  lAP05 ET `T 5d 05 !dP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0 < JQP d  d0P Eh0K/0h0 C0 @!,qr0d  01(R?  j C  C,10,1#40L0sK?000/1001001#40>000310 00 000T0 C;(%,5QP Hd d0P{  (R t ( 3 C a[ @-@ P 0 5(0/(0/(0/(-@-$@  q D?%G-P`p}C@0S  0S X| U TY0S 0SY@  (y1?-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @{Pݍ Ѝl!rp@P=0LLD@rObP,0: S0RP0 00]PPEP81: S`P% S  R  rqPPprPPPU rPP @P(o (7~@-0P  0 00$Ѝ  $(0@-4S 3/ (@-B0 @(a 0$3uB@(@-oB@Q23 3eB@O-PMM@`pPP0 P: S3/LP 0rS HB00P 0#0@0@[@ U  O?P  P PU %B00@23MP@ S @X帰张wP60: S)^0"#P@PTP X+ S R"P-P U JT@\ SP@-\P@ UY!PXp!t0#PU0000  @P  EPA0SW ]PPt0h0 +PL&PP |V80% ܍Ѝ   F F F@ 0`( "4`#/ p@-"440 @"440 P"440 "440o! $(0 $(< XX<ddhhllppttp p@-"440 P"440 @ .!+!(!DD"!@@!HH!LLPPTTXX\|`\ `W<p` pS< p@N<p@-`@"QUpf@p@-@P    pA-P@M4Q->C ->CBX?X\<\99> 9>:>C ?n:>CF  0? AC> }C>G mF EnF E~G  0X J~X pW  $$((,S>,y }S>Gt mFp HHLLPPTTXX\\O-P ! "441!"441 $$((,,0@4p0T`4Vܑ\5 S L5spTԀ0,$ $Q p W $wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P0AL 0 0 0B0  0? 4 0 808#<4 0 #4 0 $!4" (2 !8!"2" Ѝp@-@0Sh7'(00S 4 /L%( 00S/L%(00S0`( "4`#/L%(O-M P02(2@0p00 0` `0X  #1WQL00 *K W0B@ RX *10S@Ѝl10ST@Z000@S0@0 ppg@`P0AS4T0  0W (,\SP @T P( 0@T /T @@V@TD00S 800S0PS E@@'(L%(%('(%(,'($(2O-0@4p 0 0\0PQ8"R000U00S.  =`P'0SP Ѝ6  p X001P``` 0(00,0S/(0, ( ,R00Z P000 `0` R0( ,0 0LQ  0R000V00S  P0P`4(0`F0S, (00/PS0P, \b6 P P X00 0$('(T%(p@-@PD @ P`,00S }60 0pp@'(G-@`Do8@pT@@@@u   0@S( li tPp崐0S N600pD !T 4 0 0( 00p0 @'(D'(L%(O-M MP`p X @8<0H儆0|6[<08p|0@pD`LP3[t.[R #,6_ 0-0 I?[0E  0 -0 Q!D 8j 000I 0p`5@[/ `pX0P i0Y I\1R1 U [!     ލ Ѝ 0 Q-0Q% ` p !R   8800$( 0 00000 0S 0允1Ч0000/, Ȅ, 00,004004 P0 C# c.38,P000 0S0 85  0@5 0L0 ,0O0S $ [70$0 (A0S N7 ܢ ?000 Sd:0 0P2 0A40\1 : a8:Y0\85   @5 L0 ,0 0SK w I&10S; ]0 0G 0 000$? 0 88a 00 0( 1( ,0(00h,0h( 0,00U  7  0 2P0@00 0R Q'' 0'P_ȄP8 $(?4 p0 1( P( Ph@h<'( $'($(J%$(T%(A-P`p@o4p0S i40S !SRp^4p0S X40S!SRPj@Pc@A-P`p[@ `$P`PS00@AO-HMQM $#0@2`0F/ Ϡ _0 5Q%6P(0,P\r 04PA`P `(0, 0S_(0,PۍЍ20S,  1qVQn8.#4n4#0 44.4 40P 0 0(0, 0S_S(0,P0```00@DQ"R0 P *0 00 @Є0 03/`)  0 0 0 0  000 0C 0〠* 0l040S b%0 0|>'($( '(@'(L%(D'( %(H%(@-P@p`AMM(h$c H0 P@ s3U0:t0 R0*d F$#@}0P M40  P,, 4$AލЍ %(%W d7@-0 Ѝ0@-\M`PpX @ 90H0T0 `'!D0DPQp*QLt% P\Ѝ#<'(PA-`:L`p`P#3RP3R#\@A%(O-M`@ ) P0F: 0 0@40P$? 0 n622Q p{ q B("(sQ0<30<420S0 P2pQ 04  0R  @P.( 01б  0 4 Y: 10S0<00D0v`e2 `0Ѝ 01 0O20S I20S 0^` `$824200/20S 7p&2p"2000 & "g$(L%(J%'(@'(<'(O-@PGMM X `e8p:0 5 R"0倅S? 0S! 000S<PuZ00 1000( 0}5pH0 \00`0400Qp"Qdth2 " 4 0Y"/P|4GލЍh"0S$ @ L000 0t HP $0000S Z0  03.P0K 0 E r@ n  0 0S @ s-[  P1 (E"$.P Ѐ袟 L000V0 H   00`02  0J$1  1008r10SXeT2r0"0H000H0H 0p 0 S 0 RC 3#004 S 0040P!YD 0(  0( 00  c  0 0v(000C00 S %<   0 0001    0000 _0 !0vs  0Ľ 00S |%W &$(<'(0$(J%LUs?T%(Ih'(ha`%((G-P`M@zHXpAZ 10S t10S 00 0H P<ЍG(@PEU> 1 RP1H I0  PKG/V08:‰ V- PlYFp 08,80<00<0S<00<0ЍFFFF`F V   R0K Q  Q$(X$(T0'(('(<'(h%(D'(,'(G-1P 0p` O%0  0^0@ 0S 0 0 80PS `P` 8UH0ZP000PS0`4Z1Q$,$ (,`(P,P8)$({$(<'(@-@8P 080$(G-쑟`0PSpM 100 B? / PBP 0@8⣶@P|1 ?$h10pA0 G   000 0 0 Z` `1 `#"p(,0(pV Zp`0PQ*dܷ0S\1@@ 0XP\   0^P0d000 A<'($(d'(p'(`'(\'(l'(P0p@- P?@x$800P 0 !SRpd'(p'(p@-X`0SpL0LP@1D@A0S[Y000pSp'(\'(l'( 00 /|'(O-H0MSP` M 003/ ލ Ѝ40 pPࣟ00 +0H00@0 t0 /  S 0V 0 $0X0p3!0S' `3QhQg  0  0励0 0Z0 02+ 2R820t0S32 Q o   Z`"$$+P@",2 R  ! ! t R1D+࡟W000c1 Q5 10000S1H  B/oQ" RK \!B0   +B@80)P:!P R, P XT 10S0Q 10S 03/     0P  0p`V0D-$($'(<'(,'(oT%(BPP%(0O-S0 00㨄RM`PV@#M (, : SL \p(5R<R  P  RSV !0 ,[-x0 PB?"0`s 0 0S0 0000 0Z[ 85x @5D0LT 0 b32 R0僁 0 %P 0 I(0 @([@` 0 000x000 %0P0S000 0U000{00$(<'(DO-4Pp,MW pWhb`p0 00`?00S VA3@30000JT D` 9 @000K) @TT00T S @@S  T 0  0 01 0PV pP 2 000`?0l20SA 뉑 0 '00 'Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0Yld= W  $p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 IP  ,Ѝ<'($(_@- 㒰%s@-@P `⾙0S 0S 0 Ѝp.O-EM` MP0S 0S PpP P 0SPލ Ѝ000S  P k0S 0S 0S M0Sy 0Sx 0Sdy0SP)0S 0S0 08Sd s/2#' 00 " " 0D@1 !! 0T& 0Q&d!! 0J&0 lpP失0SS "04 0 R0  0"? 0 ,¯ R*( ,4ï0A80/R%' 8`<0P V Y0" |i0S ldhbPUt @0S HYDb@PUn ,P0SP@PPDPRH0S  `Cn* lxl/%|0S llL0p00S0P0E% 0,0UA:000S 0S P H1 H0S 0S,0S P   P   000(9PP 0SLP P PP RP$(EOh<](=dk,(Q`O-H0@Sp`M W0R0: 0P 0 H"p`0<"0 S0 p20SW KЍP 䱟䑟  BR 0S#/  !.V  R.. P x!`T  R0 H  gP  @@" 8 < P8 <`mP0 h P 0 O$m RP `  ^ V UV U !((($('(%($(T%(*$(00S 4 /L%(00S0`( "4`#/L%( 00S/ L%(O-M,Mp @"P:$Z 0  0`SEZ ` pP% 0`VP!00 0؍,Ѝ0 (P  X0`VPh0S  0l mh P  G0S, @@z$ 0; ([(+Z054%00! ?0S S00:00/0S 0 S00 :0V00#03  R00S :0S;  0| [6t: 0S R` P 0@4[< Q0 4`?0: :R00^0 B?QP%90S  0 # 0 0 ` 0IP0  90S, ((#0N$0  ZP00 0 S_8Q<90S8 0 V0;R02*h0S/ 8((d0 #0 (P `l80S (00 0(00t 0`ˮ w@ (( 70Sh0 0!7'(5S[/V V:'<V  3 #P  RJSQ< !0E D U0$000(p i0 U47PP0X 0ZP] D'000q@0P㜪P68P"㟬h0S0P%Q_!1Q 0PQ^100 U0 EPP P00t @?1#R 10S0>0 P * Z$0S 10000S p50S $0S 00 P0 t ?"w$Q  40S $0S   Qa 04 0 S0 0 0 0000 08$000 0 #600S040S T4 PP `@pt3SQpQLtQPXd00H00S1 0S p30S* \}P00  0,;(P 2 2 0\00Q&&:0 @00x0S828040/<0a0#PQ8`P%(&(T%($(((($(_$(nL%(}D'(0'(L'(h%($(N5%('(8'(t%(h9!O-p868F4V4f|M,0S&40AHDLT T0FX  %5 $00P尥  0@, RG5@|Ѝ0\."Q 0 P0  0/ SRQ0 ?00`1>`U`00S 00p@30Pp7X$\5SR%Ϡ<# LD ?(0   40S40F SF 4`V0`@0x@S td0,  " 0 x0030SC 30S? 0 S( 3 S? T!. 0 / s\@T` 0 Ń># 0S  0 S\000 T @T`VT0? @`1 020兑A0[ 1QS  0TX ᳧0P0 0N㻩 $000Y 0<* 0  0VT0 pW`@p^W@ R00!03SQ@1:0Q@4a p0岩 00  P C0TS YP 0 0 嶨`P 0  R00* A A$`t'($(T'(o$($($'('(('(L%(<'('(%$($(U 0X%(I_(((O-` @ 0Mp̰̐ 0 0  BRЍ PP U QP Y` @ pQ RP Q @p@((%( 0`( "4`#/O-plMX #0P`X0L1L0H1H D1 0,0SlЍ0S @d0,  0 00@ܰ 0D Rp`T0#:P 0 ARpQ R\tQ `( R @P$($('(@((%L%(<'( 0000@/00S 4 /L%(00S0`( "4`#/L%( 00S/L%(O-:M`PV`@@M90S 0P )S0*`00#0.唉Y  pP 0 WP \)X PP9p`0S 0S ) P00 8 #R0ĸp0,S00000G8 00!"441#0"q    0P@ fcfj00C0U "100S 0z % P 0tM0 S$ 0S '0h0P\7}`{60,S000007 00!"441'p0pp00ppP*0S  lPe 0 1~`]|`PY @ ` k d80< 0 80< 0@0C0ş l0 00 R.*0S  $P  0"pWVލЍ0S 80< 080T5 0< S @CD0 00$001 `P 0S 80< 0804 0< S %D`0 00$`S!  B("(p  ⴁP 80< 0 80< m00C0@' 80R<.PSR# .R #P$PP3P`080<>L3 R0* 300|P(3s 0 0ppW P0Sp000AS񟗢 44S2 002t0S04000^P H2 ;#R0w|2 0#R0mQ" 0S0S@ 0q 8Pp  : S000 !0 #R0 Q   0lFQF?\!\  010 S$ D6C#R0 š!ʡ0S  0R 1 0 00p0P``000C0WIPpBn % <'(D'(%(@'(7T%(PL%(gs $(%$($(,!?gq|O-WM ME0AS񟗁Dl4 hP X7 z㘥D' @P k(7 007@0  6qP 60S  60VF6  X b 0`06`00圦100V4:6 Rpxxx0S/@6@`aViPVo`Wލ Ѝ( .P*P   p 0S d @5p FL 0 pf00@(0S Shhu`%kp(P* 4 0  B, ! ]50SW 00(000]/0q 0S Bp(0G0(SF @pQ(Aa,pd4p0(S9@0W78O,0 S1 #0 R( S000000W!"!"+Wdx&hp2  (  ]/&  ,0 S1 #0 R S) )R * ؀ p0 S( R , M"2 pR)@ W(,`0@'x aV!W"Wdxh A aV @0 (0S $ 0 s00Q P0S"0`10S x10!)!00C0! P0 00000C0!" Mpq0S@0 0 0C0 00@T%(@'(l'(\'($'($( '( %%<'('(H$(1\|L%($( 0`( "4`#/O-Pܢ1EPMQ@Tߍ0S `dp@EDAG@D0 xxpϥ00@   B 0    S,"[ "[ "[S[ P0:000S 1a  1R R@0 S 00"P X100C@<P X  X ! ! Rph0QbT0 e R\tQ ]` h00!{P\ p00_ {000\'(l'('(%$($($('($(?T<'(L%(UO-40$M⼰0p4 `@?#P#\P  ? г ? 0 T30S30X SX 0#S 3S p2@ 002P00 00CSFTY! P 80R0L003030 000?` a2! Q,S Q0B*k2t20S P/ P@B P$ЍS  = Pv?00 1>!W 00S>>0Q#b ! RQ T30 0|!S`0?00 ?rS  R.. 0" !00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L30  ^Z 0ؠ< 0Pp1$(t'(T'(('(L%(U ' %(H%('($($(00S0`( "4`#/L%(O-`lMX x2x0tB0,0SlЍ\r0S Pd0,k0 $$ڣ000Pp@1 0 0D R`T07:!AXpX\tX`Xd  X  @RG꼦|@|\xX %P 10S  0@PPP 00S  0FQ SR  00R x X! 0 P  H 08L`%($('(J%X%(<'($(r;O-oMM@P00 0|2h?0SX0S $5SD0SY8PZX0S $XnS X Rg>`0Vd2 P\20+! `" d" B1d"\000Bh`$lPl0A^000p21`t2\B1l2>V 2l20CP0=SLq Q\20B   0S 0 8$5@> *w > >0S <0 0lS0$5  B11  !`0Q00B1- 00 S  ${܌0S%  봀 -⎀Ḁ$1BP`R!B@ LtPP d ]` PM 0S  <P| *堀|<p<0S o0 0/`0 bA?P0P<5A?\0 =<0T0.L0 ;0VHQ RX0h0@ @08 84<ϡP b${ S Q,0 Sa?^ @{P= (;0S @0 # "@0A!" !@0 ! @ @0 ! AZP: @ @80009J*:8t:0S T0 0؍ߍ0<00<``!.Q  R  `0" |i0S pd,* 0 HH 噡004y+\0#Q  0 X ?蘟 0phS90y Sy 80S 0)S 3S 0S 0 080S 8 0S@(0 04( 0Y $8D8o;\Ş&"\ ` 0 0Ϣd h pB  `bnj"36+?H "D H D 08T<XTRXX07T `V=S((0H 2T0VpC p,00C S=Sy幺{S  +\0#Q  0h倆 ?eY \|670S 8P#50h w$60S 0%\Q\u5P50 S555;o\Ş&"\ ` 0 0Ϣd h pB  `bnj"36o0@  ?! |"$5S8x0 2,2$2(0 W002,0("W04200R0V82b x0R"2  2$S\?<  2t$Sd??P V=SL5s045 p`?ൟ0S/[ 2#Sd2?/0?  (2#0C(2 2Sd2?/0?  (20C(2`H0T SD0X 02 0d0DH0^K <0ASx@444@ 20 2(2"0C(2 2S 0d2/0 "!`pV0: 0dϠ ΌdP \^̠  L \h qzq08\\$20$2<0S4 d- 2!S\2/0?! ! 2!S?pPu?`rpPXd먐 0  0 000$5S `0t63 03080H ` H D /D L$(t'(x%($(<'(h%(  - E m Y D'('(/"'( %T('( p%(t%(,'('( !x'(8 8'(A!$(^!! %($(H%(L%(H'(!T%($("'(!U !R,2 ," 2, lSh2/0^>0Q0^0/I$5St2/`0hppWS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0IP3 !D0 R  "0 0000 0 0/P1  "mb2*g 2,20S ,0 0T20S _L P 2p"S\?"0STT< P VxP2 L /0"bST 2"TS\?< 0 0<30S 2@#S?d?0`#S\P P  CP 0#S\ 2#Sd??P c\0 0 p0S $S00pW`@$Sd2?/0?`$0S0\0000p`\ 2R`嵟` 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7囡!"TpW`l嵏X7 0%S 0\000S7囡!pWO-P`@DDT(p  W @Ҝz""G-A0 5 Pq0#R%%r`!00 0SP 10a *|a4t1h10S 0 0U/03Q0S6 98A 5*< 5000S r0 0@TP[UGVPt0Up Pd0 0S L P<0 0S $($(0K%" %(H%(L%("""T%("0/D((0/D((0/D((-@-$@  ۮ k㩚%G-P`p@0S \ 0S X|S ტU JTHY0S 0Sö@ 8sD((y1?-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  DC-@M Mq` @Pݍ Ѝl!rrp@P=0LLD@rƠP,0: S0RP0 00PP⯛P81: S`P% S  R  rPPpPPPU rPP @PD((oT((7~@-U0P  0 00#$Ѝ  T,(0@-4S 3/ uD((@-0 @(˙ 0$@ D((@-@xu@P/00@-0@S @@ $(y#0QCoS  R7 -S SP 00PP0 0x SS  S R X0X T0TRP0L 0000/TTT8 d%(L%( '($'(('(T 8t0 p000 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/8'(p%(T8 T 8t%(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3 h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5 5d0d00000P5P5H5H5 @ A H5h H5S>S>p@&0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//<'(O-4M@T t儤儔儴pqx+l[ :PdP0_ 0 @ @P @Ѝ`\XP0S. 30S30S  ?0P } P`\2P3#0Sx t#S4l P `0S T/0 CS 4s*0S 0\%R\\5 0C?o""20N`h YT2 0S#P0Pd 4 0U2 ? :010S>,A!Ϡ\<# P  0Q ? 0SU0S 0弑h -0S 0p\%R\P d10S%X~PQ- D!0 08! 0 * 0S g0 0 0@0@4Ph`Ġ``IU* 0R A ᔘl%( P'( %(0'(w$%#('($(8#|%(W#d%(v##L%(#$(8 T8'(<'(##'(x'($(#H%(p%(t%(4'(2$H$O-@9*@0MM08x`HP Z WލЍ80S ֖:PD pA 0: S T fP@888X04HSP 0)00S  "00 7 7 8   吘 ㋘8@ ㅘp8 [WppTpPpT7WL P 7@T lP  ~cH8P 00Η 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p(np2S )7P )2P ).[4PZT-`Y 4[ 0S0A<관X| V.+0R    0,P %Q$ f Q춝C ? xP`u 2S<4$0404047X02P#W20AT2@02 ; r0G6  0  0l  H  ?p0l3& 8 S20#"20#209P` 2Sd#0P\@Q=S00P 5@ ) 2RT0 S @x0S JC 5*< 5 3 30S j0 0@20S 0娖|3 0 S@ T 10Sd"d2QXk 0De3 @= C ,0"0000t @DO.0 @7'4p0 @S葟0S0S0=S0S p/8000D p 0L%000P%X30,vq  *+ 10S G0 04'(\%($`%($|%($(P(($$%($(x'($$L'(P'(%`3%<%g%%%%&T3&&w&&&&&R&'T:'b'$('$''*('s(((A)d)h%())))"*x%(*H'( (P(()()@'(G*D'(<'(l%( %(H%(g**'(**%('(+X%(5+h'(%(d'(\'(`'(l'(p'(\+0'(('($(,'(L%(T%(=S%0S& <0 p0P%<<00*X300 00S T0 00S5 0 >0S ^PLq 5*N> 0:#: 5p1s $10S +0 000S(:P0q0*1S 10S  o0 00<cQdyP 0`r<0*p23 $20S O0 00S0L%r0L%r0H00q" P 000cH00SPFP$s*Y43 20S 0`# 0 00L40q"  400cL00SPs*1330S 0$ 0 0t4pW. 4E ^  \pWR 0SPt*4T40S _0$ 0 0t0Q,%R0%45S R! lm004E0S|PP*`5w50S /0% 0 00(0Si xQ$ D0Sx < 0(%0S^,P*6K50S g0<& 0 08%<5HSR$  H00850<S6aP*t6|60S 90& 0 0@%D5LSR$ t L00@50DS3Pp*F7470S  0' 0 0 7 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*880S P0) 0 0T PYd P4TQڨ0QXڌ [ 0 0S Py*9e\90S 0) 0 00S3 6 .0S0QQ*P )0 0Sl wP`z*p:3$:0S O0* 0 0 .0S .0S  .0S0+ Q^ NQ L x.0SQLd r.0S{v<Q j.0S d.0S ^.0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0* p<$<0S k0, 0 0<0S <0S(L*<<0S M0 ]h < < PRL PM\= 0SP @PL [ `  pd娭@PUVʸ= "0PPQP_PPڒ.P 6   ,P኏,>P8) 3@^ S;H.00 0 S 05x>> >j>pdPW>ppY@>@000PEUP8HLd  BL 0b03"(P P Y) P?0S   l?8 H4L0d P B b"30 S?0S   k0`00p^ P?@ B6P l0x& 5000h60S 1S P FP @6 86 @Q$ V @ 0`P@@  04 8 <%c#!$c4"%S 50S BP 0 0  ``T0  0 0 0 05a(!"4a#Q  &0SgwPh0 $"448#8 S 0SidPj0 $"448#8S t0SjXQPk0 $"448#8V:QQ  /Q R 0Sf4Pg000 4000 Pz c0SdPe 0 40#40htI,0S 00 0 0 00  $4,0S 0 0 000  0 ,0S 0  03000 0  0p,0S 0``&d``000  0`p+0S 0@00o0  0 1 1Q1Q,+ 0S iA 5< 0 !00!@0|!0pCS #0p R0 !0B88#80WP ?`@fz0PtUP0Qc R E/ !0!Y pG  Qt'(+$(`%(3%h%(P'('(0'(LBAL+$(+9!+,1,N,~,$,)$('(,V'(X'($(T'(,,Y)|00S!4!: S  S :C / S : S 0P/@-ՏL%($(%-1A-0`S lhd@ 』T L10S@10S0嵏(1 10ST00S 夏p@ᝏ00CS0P U 00CS0 P PYU AYU0 P0  0 0 SNU$(8-|%(,'(W-$(}%(`-%(%p@-PD0@0`S  0!Pp㊍$(j-O-,1 $1 100 P`p0 ` 崏P 0P  ` PP`P(J @ 㞏PT00 ZT ᄍX ဍ  [P @@` 00'(|'($(~-'('(((O-P1$M0H Ϡ,"ʼn  p劉P ` 0 @w  ,Ԏ@$T ㌎ 0`P$Ѝ? 00 ?  b P 0 0 0?QR0 0# Ϡ?<0  <啎`0@p 0匎P'(--L'(-dO-pM0P8 0PȀ`0Ϡ," Z 0 Ѝ 0|xd@Z ЍO ? P  ? M0@`P'(%(-dC-P`U@ (1w U P0 PP0 0T2`p܀*0 L@D0T@S   8HLd  B 0b13p@" }0S   0P00`0@T ЍP'(.Y. %($(L%(,'( 0S/A-@p d`V F0 fP2Qf00 SR P00@00 0` PЍ$(.(,'(0'(@-0P@T@T3d pL `l0p `̠V W @ 0 0 0P00@@000 Ѝ(($(8.p@-`P@XMX   `P @XЍp @-Q DH0@S T00S H(000/(P00$(O.7[.c.p@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT.$(.('(L%(\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,,TP440S/($0G- DP4 40S0 40S, S0SB 3`3 30S@=S= S*330S X0D 0W`XSHS DsPUU00Q AP 0S ??@P`"\R0"00S7 `r002Db0S) l00S) 0R0E>0*X42910S U0 00S&\P10S & 1LQ X1*dP1 D10S )0 0D10S 8l& $1P 0*C000S 0t 000S d0P` 0؊ 0sGpD'(T%(,'(0'( %(4'(l%($(/$(P'(<'(H%(L%('('(((00T0SpP8Pp$(^F$(,3H3]3R/#G-P `$ 0p@V` 0@`` V`@&!D( `G-@0 4Pp X00000`0 8#8#$48#8X00P a40 "% ?Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@Pp02#U 1!]L `R ` J U c9# S!V Q V3  P! I P` 0 c9# S V!Q V3  P 0 P$` U P `` Ѝs32 30A-1àQ`P |0| ||L0@Sp࠱ P$` p@QL ࠁ PQ s3e 3p@-@P0080P 4 PR*SpL0L LS@04 <<K0C800S   0~3 3 3,0S/`0@-0@  L,~0,0080S 0  K0@~.(33 3,0@-S ,0, ,,K@TP t~@q~4 3O-dMPpU`@@ %88S0@ @84@D2@D1@DS@D50  0 00P U0#03?b[[U^{@D `#0P$0P5Q HO0$0 %~CD 0XR @|"!$"!L0<p008p$0 0H(0 0 `,0`4  0 4$KHP $0 Pd40  000h"P  0p, 005RSUSP3S` ,4,$,`UQ{V  0 00 D040`FH00C34`80E%DHPQ@0 % 8 ,P0e@P,P|3Q 0Q+ 0CQe 0PS %T$PP@ }T@dP P0F{T`@V !}P` !T@0`P`p0?L00T X tPT X\0RP dY|` 0R3<0<0S@p L0{0 (0 0 P  0( [R 1!<#! P <`z(0 0#!40(  00Q80080p0ȿ0T`0 S2(0(0S@p 0, 0 P 80Sʼ0 0C800S   0|`r~O@  = ^$@$dЍ0$0.(14LBAWk44|344 NBAW54, 3> 4G-0,0S0 IP@jz`00qW40S*|Ѝ!  0Q@P   l@Pp4P$ 3A-`0@c,0Sl0l llIPpRQ L0< H 0P@DT@4c> 3<5? C-`0(Pc,0S0 tIp@%Q |0l x@PEU  0P !  0 P P Ѝ4yO 3<5Q X0sC-Ђ0@ P@` 0 00 0} 0PЍp.(,'(R5X0sC-Ђ0@ P@` 0 00 0} 0PЍp.(0'(5A-0PQ N@`p0P R   T0! e}@P 8+4P{%|%(.(5.(65@-,@P,0S 500.(@-,P ,\  D Ѝ.(p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp<'(L%($(27@-0S S+,Ô2 R0 ELh `Q tp PC*{aQ* Q( H<P 4,B 5*< 50d30a3210S ~0 00@ @7.Bp#x3 Ŝ & 0P xzXPA 5*< 50d301$10S I0 0@ d3S+ CQ+aQ# 0AS"NP S0@a3d3*|0dp00S 0 0@S Ѝ04$(.($(56k6P6 %(H%(L%(.(666 @- KohDO-0p M"##0@` @ 0$0ԃ ἀpPs0S@P-# 00" qp*$z9lU tU bU0@p0P)$D @+ P80 ( 0 @0S ,00(# `!$D P P0V }ЍVp FpP` 8i prP `P0V:P0V" cP pH0P0[0$$0 7!$ P l2 0 ! P@  @h0 00$ 0S Y(0,  $ 8yp Cp @K0 00$ 0S Y(0,  $ 8\pr \ @0P`  @ P0 PbhDD%IUI,I7IJIgIqIIG-`pMMPr@P6\ЍTC^t# E@0$4$ 00; ᛫p+p ts@vupP @4$$: S R B., jup $4S ($,40(B. Zup E0dR04<($$4,40 K>؀C$$0 0 00E`d$t؀E0  P0`P 0$4S   0p 0,p 0p p}p p 0pp{ P P 0"Q Rp5M*pIg Z0"IIId@IId@J$J:JVJ@-@P 4B BRP tp 8\4  fЍ@AsЍd@JJp@-@PP PP \.p~4PS4 PPJK6KA- @pP0TP ` Xp@0 p@@PKfK$$ - Q EAQ0 "(  0T 00 /$4 0T0 / $4 0T0 /O-`P@p M6`P̀PP `00000t따 V:Ѝ 1 00 0P0|t`P1 0 0rtP UPu~KYK%K`C$$0A@-kP@- t`R@`mЍpP ۲P 4 R 0 X,KKKO-Pp_o!R0`@|MR(0S00S "R0oU |ЍP P`U 0SIQF (0QSB!RS R9"R S R0A -00S00P0#  7/p  7/p 40  m0$80P P (P KA-@pP`|P 5/p 4 5/p 4 KC-(00pS4` Ѝ$T@ 0 0 0dP 0{0  0 PW0  LLVLO-0 0`P pp@ᜀ圐吠T Ѝ0  0MP 0 0S Gp o@ 0 ,>:LA-P@ ` p0 r@T:LO-`p lP`@`T吐  00  Q  k g@ TY:& O-M80`Q@<0 00 PЍP P0S* pFPP  00000 040 0004 p  p#p 04p  LLLL0s@-ST`@P ?o00SP  Ѝp,K@- iR sR aR p` VMp@-P@P (`5Pp cp,GMp@-@T 40`PP[pp,bMiR@-- 0 aR bR LR( GsR% tR@P 0P0S`100p`(k0 M,tM p@-M`@P`DP0 0͵0,Tq0S Nq qЍpYMG-Q@PM Q  ЍA~␀ p$rn`P phB~00 0 `PP oM"MMO-$M@P`HP 0P`$ЍpP 0 0 0 $ Y># P0*Q  p0 0?Y S0STp Y0 p G00 pW 0np $ mP 000 00 lP o4  \$  0U,S( 0 P$`4 80qp{ Ĕ$'!#, RP P T P R*L0Sg 0p^ L004 0 000 0PL 4$$  1 4  !4 "4 $?.p6 M,NGNeNNNN00S  0@-@C^M E$pE$$0 0z  Ps Ѝ0 @x("(!p"`#XT 80  @oP8o%K%OOPP.PEPcPwPXPP0$ 8O-PLM@p4 1嬑嬱D0 Xtp  0S$ ! R p!LЍfR lRJ  I@1` 0S  HP KpP  M n蠟 kP؀ < nZ f 0o @  )Z  S ` 0 ` P` pPP%0s,K%%bMPA-p`(P@lP0 p!`P @00 0$0@-@P$0S m@mO-p`$MHLPPDT   V  \ D@=x` @SR00 Q ^00S P UP 4 0 T0P 0X0$0sP UP000 P1!!U111}@^P 0yPPJ QPT0 0X0$0 00 @R P TP0 \ 0 0@;0 0ZS @R PP0 V00IP  0 0   0R00 0P0@SP@<.4$$ЍmQQp;TQQQ^QO-4MFTp0X\,! 0 0 0 0 p 0 0 0 0 ,0dVL 0Sk     R b A  [  ]00[$000(00$ 0S 0(0 0 0S 0H 0S0D 0  T0  0  0 4Q% 0 0$ ( 00 000 0,00`4ЍT0$(p 0(00$ 0 0w1#$0 R$  0``O-M<pP 8EJ@`MU 0S 0 0 0@   0@`@ `000Sp`.  0 : J) 0`VT@ ` T0 P 0,@` 0T0 @ `0 00 S0 00 Ѝ  0  0  J)` T'U@ ` Q  R0P UpP0 0S 00 0 0 RU Q T0P|  P0 T@ 0000Sp@ `R*RNRoRQRRRP/0S//P/0S/C- `P R Q  0X0 RU@-@,MP@p`kP<l,Ѝ ( p`TlP0  4QM@-0X@FP HHH0H1m@@M@8P8`@zTjuSSS%S;fQR R R @-@$R R/////gT Rp@-0@P! R8ꌁԁ܁ Rꄁpp B R"S@d dk\0 T pppppp 1 ppT.(T;O- M0`z@PPЍ0!S R {j8P0p (P\4S 0P0$$8P000 8S VjQ QP0 4S ڠ0"S1 @ik0  <03/p 8 H0 0($P  0P 0 0 $ P (, PpTWEVTTU;T.(O-0P`p4M∃,0  pp@`30S,`wP 0!  pT AT fT K@4ЍsT0 0,Sp00 00@ 0>qp 4 `0}p0ᴠ0 00$04S 00Q-$2!0  R8 +R.R+(ԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆ R@d!dj\1R R8 0S4 0S$1 +10` 0`Ypps po 0oO@@  0Jp@@\|oX 8 H0 $0  8 Z$ (, `$U%*UK%<;DUTp0lS|p@ ⮣P0㓄$ *p Ѝ@T r@Tp(BG-pP8M(@ 0S   wP8Ѝ70 060050040030020 0100000.00 ,0> P #00R R 0S T `PP0c# BXP]](Bp@-PP@M `8@ @ `  5/V@@Ѝp(BA-`P$@$p0 !bPU@(B]p@-`0P$@@$ Up p@(BA-PP` 4  04000 00:#:900 @0<<@0 w`p@p Ѝ b` PXv`@@ R0,qpWf`]]]]]@-4PE  884P?  $24P9  ,4P3  &4P-   4P'  4P!  4P  4P  4P  4P YWP  9PADGAZPY =5P @W 55P pK P3PU A"80xx i4P P R2"(|m3P  lRWP KPU  p $ 02#W: (4PE KPP? [1! 2P4 0!xStx *4P) !0xH|x 4P "3P "p3P #\3P m0$ 80S *XP  WA  3Pp L0T Ӕh^00Ѝ胙_,%L%_xD`!`(%9WA ]-`8`E`.T`]`h`u`````jG``X``DD`aaaDw_?NO-@`pZЊЪM Bdp :0S ЍO 0FS iSPC>`C$P Y H5 ЍPP Y00 9PuNP KP0$$FP @ KPP KP (0FPl@X0 1P $0 _ Q4 3P 4P0P 4 P] 0P000000 0S000000S 000$0NKP pJK0P(0 pVPP TxTTA`P&A$=\PP, 0`nqp   R$4=,, 0]qp 0`A4 2Pd 4`BP `ПP @ 0PS XH 0PM @0 SD00H0 RL0$ 0R} ]$4P `$$]$4P`0V J`P" JP P&sJP UP0#8,0 5A`P 5AL&?  0`qpu p 0P2ppro  0P   0P  0P   0P  4 0P  h 0P qP 0P  8 0P q/  0P r y0P 01S 0r/Ss?, ղ Ѱ  b0P s/ [0Py$$Z\$4P(UUpPܓ{ @`P @$$0 ` YqpS p0 < 1Pi <p<P < Hj < 1PY <,P  "0PN  0PH X 0PB D< 1P $ <8 /P2 8 X*05a$ Bp r$ [Pp$4`  0qp$ [W$  HK8 00\!08 00 $00,`(0 000$040P0 0$00P00T0 X0$$`qpU$$[$4P0 00 00"0H00`L0$4`  0qp0$$p[$4P `ꃙ;a,%L%?a;V0aUa!``va``aD`aaa.hDw_ab?b?a1bjGA`UQb ]-`8`E`T`]`h`u````bNjbbbb0@-@M P   ᡌ lp< <V 4\p$N0Ѝ0 cv'iv@-SM@P, 0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍi@viv!iv@-@    >0`( "4`#Ѝ1p@-0MS1`0`SMj@ A. H01'P A!Ax-\P 0`0?oS cP 05P PP(\0 0A. 00`0P A A\u[0 0A. 00`l0P AX XmA\[000D 0y8[ލЍp@5(/(Yw www+wXws@-;PP `P Y M`@TЍpIP  00STV ) Y[@.cbw0 R !yO-M@ P~p7p # !`P"    GP+ MGP8GpP MpGP Mp ,-0P0&h 0R0 0  p"$ -Px 0SuhQr @ L[pgl M0 00! R R R[  0PW p [ \套X (p@㜗W 0g0S, @ h[P@ ` [pd HQ L 40R !d01Sp0S 3/p\ R 8 XZp \ 0S 1@ `Zp Ѝ8cvbwCw pwxwYw7wwwwA-pFF@P@FPU [=`P IG P ;@Q=T 9F*GP@- h.P Ѝ A-MP p,@P00#p`ЍpP  @0 wZp !0  #.wi@-@p @A-P`FpP00LP@?0L  FaA-P`aFpP00nLP@:?0pL  FC@-( 7,P00 Ѝp@-8M@ (P&,P1!% (FP# DL0 Q0s0S00KPP"  kF@;$`8Ѝpl u  K8 PQF`;Vwk`Hcw4xi0@-@BM M  Np 0S 7  /  0(`P(@0S700$0/ 0h (QdP(@0S Bލ Ѝ0sYA@kY9@i>xtxxp@-xM`EPP KP@ VP0P P$K  5 ,pЍp4xxUcwix@-@M  j pЍi@-M @U+PC|0| |$t p 0!Q0s0S04 1p`Ѝxk`dxiis@-`Pp@ @@ +P0 $_@Ph偕J P@ Lx@rEP 4 EWЍp5yk`dx?yQypwky7@- P@<p\ \XTD PH08 DDD$0<80DE ` Ѝ0*dwyyxw pw7@- P@pd d/0P"HD P<0( 88$ E ` Ѝ09dwwxwyxp@-M`DP0P0ЍpJP@UxT@Pd0 D'p<8 P@ PP VÁyyyiy@-$MpqDP00$Ѝ}J`UT@Pp 0 XpL嵔P@ P`@ p$㯔V#yyiz@-BW ЍݜY$z0@-M00 0  PXp `T@P ` @Wpp P0 `pR00bS W>VVU WWPxi 0zIzoz7s@-@`)PP  ,p Hj0Uzp@-Pp@`@@CPH0H HH%#IQ P $UpCyHdx?y@-z@-M T@)PD0D DD"08 0 p$ >Ѝ=k`Rdxiz@-M T@~)PD0D DD"08 0 p$=ЍŮk`^dxiz0-M $00 P  ƓЍiy@-@8ZC P,0, ,,"$C `yygdxpw00@ P/a CRWC/A CR=C/@-{00@- M@ %0( 0 p儓 Ѝizp@-` MP@CP 0I Ѝp X{    H( PWC@8$`9~vi 0@-,M@ P(P0 9" p,Ѝ0 0R0 s0S 0   0$ HPP  0C@7$`zk`tdfx9~@-PM  X@@O[ 80oP0 0 \VЍOY?ݜzz& @-\ @z(P0@0Ѝ  p@@  <z~d7@-p@APP Ȓm叾pPL``P00 00Vt0@`Vm`x\ PX0d0X @ @@@@VN7:T03/`d{`M%Y{{/{%{////0 L0L0/`M%0 T0T0/`M%0 \0\0/`M%0 D0D0/`M%0 d00d0/`M%p@-@pP 200p00D S 0A0CS&0$Pp>P 0@p`M%@-p0/( 0`P/ R/`M%0 O- 4M@@!2T0*  D`3Upď P(0$!pSڰp D@T PoS@ڀAP`@ p00L\pP` R  P Q R/6 0TS $P\(P  1/P S@0S  Tp "SR(0 Sd娑\0 2/P W0 [  9S/(O}ɚ;6e]}O-MMPp  Y p` %  pP$ 100$0 o-T ⦄ Tpl; ♄ Tp Q dT kT8 p$<Q ,T$_X@T rX00@0 0TPT@_ 0 0Z ,0@4@Tp 0P0Px0t 0d 40,@TpPj 4H_TR@>PT!>`P \PPU D1O0S S44b|QW P.Z  P'  'P! K0S 0 L0S 0M0S 0 N0SO0`S PPV R zd/( (%@-,MP@gpP (?P`(  p`0S hy H$P00< <m0 $_,ЍfwD5(8i(nȂ@-P@0 PKG-@>PP0 :`@ Y㔀DpDlPP  wpp H H@@@P@,n2D5(Vs@-@{>@P00ЍpDPDl@P <` wPPu ZD5(s@-@Q>@P|0| |DPDYl@P T` NPPu( iЍpp,(nD5(A-@"S>PP0 `@hDp[D(lPP p< >FJN@@@,4nD5(e@-@ \$PP0P PPsL 0 S@@00 >00Ѝmk`=nD5(r%w0@-M@=P=P =Pp=P d0P P P P 4PMp 5Ѝ0pZD5(7is@-@}hQ ~P L}QHPH`~ P! ,rQЍpmQ@7̓vc>փO-M`@PK Qp pP"(    * aQp% (w( px" <@T t8P3Ql2P\,Q UR TЍ0 PWN@P㱍 $@&Qp P}Qt 0R Pk)P PP ``Ptqttt` R#Q\P PmEP8ЍOMOP\ 0P   Q1   P0! RS} PP" kP0P R ` V 0P `\p\\fw ov8i(iLnzj1=0o& Yvcn:C$Pp@-P`@;P V  =`P 1`1 00p;Tp1p@-MPP00Ѝ`0 00p0@ 0 P DB0P 0 p 0 `P0G-@(P00p( u P1r0`*0PU!V0"R0 "00"SЍ40P 0 , vp 0 @0@-@P =1@ O-`@pP,(0V0S 8LP$P$P 40S 04S 0S(0p(`8P0S$0(P&NO-M00q W$0&00Ѝ`Q Q 00 !PP0P XU 0iP x,,,h4@[T /u@P00 D0800@00X5{8 "10#Z0 N00o 8 ]@ 0YPpG@T 0CS0 0 xC0X0^ :T 0CS00xC0 xRaDPW@DADP7@D@S 00@D@ TSS0Z`@@LTh l ;P/U8 @ 0 0 0`0>vpQykyA-X Pp@`!P00(0P 0 p 0 `P0O-P`,Mp@ P 0_Y: P X 0  0P` 000   0P/> 0@R xeF/  R # R # ,kp b2pJi/X%?A-@0%M0F/S p p<8 Gp- 9`@08p`N/8tS^` Ppx0 pidP0,0L0P0,0T0(`$0N/dK%ݍ@5(Kivw @-&p Iip@-t`tP0S /os" R@ ps I Kp@@pP@@T%p5(O-0P@U` 00Sl1 000xSP@ PpD<1 Q Y uP 1 @ `GR B4`U     @ Ѝ W:UUp@G  @ TA̠WL ΠL̠ 0 B W B,B,  GL%P%ąQA-@Pʰ00QQ00S AJ00Sp0 000xSXJ`PpVJ`   @0P%-L%4 p@-`P M@ U U( 0P0 Ѝp0 00TPTT@ !!0P!!`FPP  @: ` 0A-p`Pp@ @P(ۆ z AMJvfwp@-@P`M  ^ `ЍpO-MMpPP!㶆p`p!t pX!` F/ ;  ≻<1W8@000TݍЍ0P0  R P 8ʾ)0  !4  Ip0x0@0 "' R R000O/00 0P<1S O/,Ihqbwvi@5(p@-`M@Sp !0+SЍp7P    my R #q <Ip 01S 0/S &0 i' 00S/@-@iI/(7A-P@`TpP @ 0SP %FA-P@p v`P  d嵺PX0 000  8p`W廅蔆P%:ij@- M @pd d尅 X<P00 Ѝ0, 1p嘅q9i@-(M @p 凅 Pa00(Ѝ _00S H P02 , paqvˆ9i@-M@ lp 0QS S  HЍ譆/ 04 8 <` S $S HHH S/< S 4$0 ,/(/$/PP PPۆ 04 8  Ѝ蓇k`YriibA-M< Pbp!0000P 0(0, 00` 80\p0@`$`4 <0[GP8100 0(00080 p' ]P0 0 0   :R@p00C⬀0 0p0 P00ݍ@ T0S Pȃ0 0 0P0ꮌmri8P%>Ƈ0@-0Mt @p` `㦃qXPL    0p 囃0Ѝ蜌xr i%-A-@BM`(  XpP 0 P P PP  8 ! ll pz l RUFlmU#0P 6bp 6S30S |F0`P 6Pp 6SP@30S <F 0P 6>p 3Q? FI0P 60p 2Q8uF8 ⧿ p 0S0 $F8 pu p p p 0@ TSPpD2Q <GFBߍ10S ?F10S 8F5F0  `0000p!FPU0``0` Rڬx1000 0:S R HP8E`p$PQ EV pWP ,E+EH0S LE E~E#WE`0Q E E8i(i܈i /( *) 5Ci8iiir{=LSs/P%[_kۣ0@-@PAD-D7 O-`MM@ 4h0P4 lPgE7EPx彁7U'S 0`@ 0 @`F( 0RtPy['V: 0: 0 : 0:0:0:09D(@!!0 P AV0 /C BRV  0  00=C$0Cɟ"!``F 0^l d9EIcCP S@BA`p80P0 p` D!0@"0$0$0S= `D0 P0B'S 0؍Ѝ h(S   BS>C0CH(S  $ȟ"!! CR   ##9C0C"!% 'S>Cǟ>C"" N=C0C00Q0g*S SSH""|!#|!|!|!4#2SK Sp 0SC R< )SS0C'S񟗶(('($((((((((((,((((((((((((((((4(<(D(L(T(\(d(l(t(|(0S 0 th t0` D0$ 0 B$ @^ R `0&S,p$C  pW>C R0 0 C`0S C0S `p000 C00C!唥娀XP0  @ Cp` C0S 8WD 04 8 <%S8C0S 0CC ` 0dY)1 (  `pG0p,0l4値Y$( 1p, sgqpW!ևӅ|HpCyW-0S\ ( W (( ^C4I $( P  #P# ß P# DCpl3I#S0S 6C0S%  l/C ST)C0S @#C,"3P>CHՉOvcPˉPۆ [`yrډ[di߉"*49BKRp@-P M@` gQP0 aPp@@( Ѝpi@-< @P$0$ $  ЍƋk`r@-< @P$0$ $  Ѝ!k`r0@-MP "MA@PۍЍ0@( P+ ]@P@(ۍЍ0@o@0S0S1iSϋ0@-M TPqp@@g(Ѝ01 I~p@i @-T @P@0@ @@1 I \p 2~ЍNk`rA6@-T @PM<0< <   >p~Ѝk`rR 0 /$V%/-@-@ M,00(000 P  Ѝ@Ѝ/P00  @@@@0ë-@-  ZAVA ЍЍ/@-@CA㚪:A 0S/@-5(-@-  :A6Aㄪ ЍЍ/-@-  ,A(A ЍЍ/@-h0M0S@ 0  0000 0 p@@Ѝ5(@-@?Hv?p?p0@ mpЌ(@-tMPP2 P0S 0@P 0 0 00 0XⰣp LiP@@ ((@,P0P4P8P

1 0@t|9@t1 㬤P @ XLaLqPHQ ♤p0S @T  Q 0SP 1>0S @㼪 X⸪tЍ @⯪ @TSS S000 0$0>5(R)4$V%M`/-s@-P`0@00 0 SЍp@Ѝ/0C>S|`!031 0@-Mt 0@P \| <LPP @ (@@ 0ϢP 020Ѝ0(V%5(z@-PZ@0P ,U@ q N@=%uTP@-d0 !X !T@0 60\ (0000/>ShPh0h@-`  !TD0 60\ ,00 00/>ShP-P040#^4<\$0000/>ShPD0 40#\00Q 00/00>ShPL- 0:# ^4 0Q$0000/>ShPL- 09# ^4 0Q$0000/>ShP 4 <# \,4Q00/00>ShP@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00>Sh@- 0 007=P Ѝ30V%A-Psp`@WЍ 2P ,3MP@ p7@-P@U0  ( o< Ѝ0n A-0@nS0oSp@ pxnP``;P<0nS0oS;>PP6>PP'>@-X0 >}<&%O-MM<(0<,0bK+V%k3(%FO-@}MMȐ⨀p 0 8D<P(b((OXU 2V^0E Ÿ " P`0 ,<0SP 1PP <{,P<a0SQ 'pUx  <0SP h<& h%<& X%;0S;008! P   P00@P  0S OP@ ;ލЍOC 0 0S 00S P0l  0;0 0P `p0Ul<ލЍO;PQ& vcݜ1=Ydy7X5(ԕW-p@-PQ@@pQ(0op2P0p6(A-PP 0nS0oS 0P U@P0Dt'"P,WpW7PP`8"9p@,ˣ@P@6(z@-U ;9%O-`Pt p@}00004!444400 ?p0PEU!+ e@ P8FEHFEETFEEEE`FEEF0000000 0hPlwh00P0<490000000p0 Ѝ,%-,"-BMM]@0 P@t00x \ 0!:p0 @vwx0 0/ 0 " kp" 29e44p@-@PᄋPp@(h!0/Spg p@c ꒚@-1U 8;8%O-`@ Pp(,γ000 嘐嘰00 ?p0@DTq oP\0 ZhP<wKh9 O4,%Ԛ_,"@-M@A>0 0D@00 l09pճ0S SH γJ: 00,00 vz8ZUdp@-@PPp@( 0/Spp@꒚@-T :V8%O-`@ Pp(,B000 嘐嘰00 >p0@DTq oP\0 gP<vg9 O4,%М_,"@-M@A>0 0D@00 l09pI0S SH B9 00,00 Lv7`dp@-@PlPp@(P 0/SpOp@K꒚@-  A7%ȟO-`0@P(,p娐娠娰0  >p00@DT oP0 MgPP v>g  7A+O_,%"@-MM0An H 0P0 $@8p uy74p@-@PPp@(0/Spp@꒚@-S 9X7뱡%O-P@M P0B`r"=p+x2 0S00)0x0& 0 x`1p0 +00*`&0`k 8pY vuuPfPMP9 9P$ GP g@P0POOOOPDPOlPOOOOPPUP|0 0|00|0|00|00|00pt`x0 jfP'u[f|:Pw[,0p0Z00t0X 0;;0x0U(~3$00|00|000Ѝ,%f "-MMJNP0 @P:00 |07p0 `t0 0N/0 4 m0@00018l6J44L)7@-@P 0Lo S? 0 t Ѝ0e@-@&0P@ @-@7(0P@@-@ j0S 00S0?  tЍwp@-@PᨈPp@(0/Spp@꒚@-ft@-PR40 0,0,0(0(0$00 0N85눦n%87@-P @!P00S\ 0 9t Ѝ0p@-@ PX0 ɰ0(pQPP()tP5p@56(O-@H `p婰H 4X000V ;p60`FVQp 2@FPV`V0U0U0U0U0U0U0U0U0U0U0U0U0UV0UVW0U0U0U0UPW0U0UU0U0U0UZ0U4Z0UtZZ0U0UZ0U0U0U0U0U0U0U0UVVV W0U0U,W0UlW0U0UxW0U0UW(Z`VLZhZZZ0UZZ40S = 4 40S 4 0<007aE08:d$0000000D30@90;g)04 0I 0(80@008 0dPas0@B (Q  Q@       d20  xc0$000 Tc0 000 0c0$800 c0<:00 c08:00 c0@900 c0,000 |c00000 0c0909Rg01ra0$000 0 0tT0,0wM0 0xF00007000+0s40 F ЍV%{W%,%7(7(7("9:7(z?ENXbms W%A-RMMI>0PC@P@(0L BH`q匁( `L04p60KSh0  R< (Lh03 T05%0 8r( h0^/P  0+kPP 00 0,@.0T0@ lP *0\ $00X 00P00\0|00x00t0 0p00l00d0_5RݍЍ'7(V40p@-@PPp@(0/Spp@꒚ R R @-q/Ῠ0@-@MP`p 03000 4PPЍ0P0 0 040 30P gOs@-`/P0@00 {3P0 2>Ѝp 0`( "4`#/s@-`@P`00!  P@d00SP`P @C@A 04@ЍpH7(ܨ(002P0/0@-@CMP( P41010 0000000 0P 4< 84 H00Cߍ0Cߍ0@o꠆O-M`p8@@PpЍȠ,̠Č Ƞ,Ƞ D<唭4$03 00<D h4<408 b0_,\D0(00x0@E 00K@`p PH00@DP@ PD %4H7( _] O-M  P@`pP0ET0<0p0Ѝ 0 3/X0p 0PP 0@ `RN P* 03PH D @03/ppUPp0PTP@`P꠆ C-MM`p/ ဨ P@1L#Pd8$#4d4# N41卨D0@@ 0@00 0|@pߍPHڀ@Td$ d 4L7(O-`[ 4MP@֛@P :e@P`4Ѝp p⍬ 00t 0 @P  T@0D 0 00$00S X0S00000 wpp cP@0Sp!0!D0D00X 0 000  L0b"!4b4#@0@@ 000<07()'VL7(@-tM {3%1뼪%0@-M 00@08 ‣P  vor_sЍ%2O-P@M$ 0쐝0p 0@4#400#@0@@ @#=7p3 0BPa g@bPphhhhhhhhhhhhihpj0 0%0@0 qp To" 0 8Q`P$oB`0  0P0!`("(0 S Q  n  sP   n_^"! p0帣P0 `((0 S Q 0  sP     sP  9qp 0p0W+厣 ( 1p |~ 0S 0DpSH0p0000S0@ @Ѝ,B%E,K|"fkūʫ+R@-MMCN@800 0@(00 01p dn 0 1"1!1("0P( l1,r 0P , T10L1ލЍ41(14co|٬ˬ7@-@P 0Lo S? 0 n Ѝ0e@-@ 0P@ @-@!0P@@-@ 0S 00S0?  mЍwp@-@PPp@(0/Spp@꒚ 0`( "4`#/ p@-"440 @"440 P"440 "440ᯊ $(0 $( XXddhhllppttp p@-"440 P"440 @ nkhDDb@@\HHVLLPPTTXX\|`\ `◥p` pⓥ p@莥p@-`@"QUpf@p@-@P)&# pA-P@M4Q->C->CBX?X\<\99>9>:>C?n:>CF 0? AC>}C>GmFEnFE~G܉ 0X J~X pW  $$((,S>,ṉ}S>GᴉmFᰉHHLLPPTTXX\\O-P ! "441!"441 $$((,,0@4p0T`4Vܑ\5 S L5spTԀ0,$ $Q p W wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 PlV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00030SUd 0@ `?5*0"ST0T00  B 0"PSX000Y0.d 0@ `5?먠ʿ 0 0Ϡ,00 01#0  0 ! ?0 00C000 xS p10S  ) dϠ 0@ `Ì0 1! ! N*J40AQk80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30d<( <(U ?Ĺ%W% O-MM̵p,  5O_R0ePS yrሢ儒 ?D 0S``/~D? 0?D4PP p؍ߍ52)F) 2@ŒD 0L 04;2 0d04 0^0 00@4T@:T @:T @9T @ 9T @8T @8T@@048#8p0z)4`0S7x 000 00p 0 0`  #0S 0X  00S ``a , M 0#\0Q?9 4<D 0?0 8 @ (,0PHY (0@Dő, L00 /4;0)( 0d0H( 0o 0 R 0r `W4 p({S< yr /~D!""#0ODD@HL0 ? 0 04^0hl 0@DE0 L 0/4d;0 0 0@$ @` 04 <02(=(Ϡ $$%%9 0d?`hl400&0 # @őDL  0?$+4#($( 0(d 0@ `Ì00 1uW%8(d<(`X%pZ%AoD<( <(TO-)MM,0=0?0$8 0(T0[`  b0 RZ QZ" Ϡ  ! 0 0S  BB00㾐P`0/2"0$ 0 ?᪐V`1V`#T0`10F 0ʚI ?ĚB@TP 0ἐ劐똀  00B1  B[!0`0Y3B 11 0S B!I0B ?0 `f똀 0 B[` S2 B Q 0S %Or @P`x1 F084<ĔCP`0S84<$-0BPQ,`QɑRB1ȁ@L0 0 0000<20S|0` ?L4 0H4 0 01zpt'U\#R2\3PPT``0 S.bH1(\50? A00!#4t x0W0(0#T a2!, A3 31 0  P\<(W%W%)P$<(0<(غ1\(<(B8<(m4<(W% <(,<(@<(D<(^F>Ƽ8(<(H<(<(hP<(3Z%ht@(%_T<( <(Td<(T<(W%U 04 P C 0H$4  R$ (  B, @%LV.  R*h  <  X ! \ ! E.?.XT+BA.B,-8 HU Pp0 @40K Pf0 ,p B8d i A YZQ0 eZ 0X R A  pW?΄$t<4Q?D480P@04 0H4(0Āp 2 R 5#< 523儂r0S8d =P =QP 3CS 00 d AQ\ a6Pa`$PhT$ @4"PP`PQP 3$S008|e 0,9$ 0  R0:1P000\P2#00@P` @` 0 06yp00 R00\{&hD0 B0S7d R$ vTP0 dy K  )eZ⋰ 40Sh 0 #$  e 0+V. 嶘<50S  ; 0=S,0Sڨ!0S0 0" ,0 0CÁ!%\^   0 0 0/d A! a,3 1 <&01# H6HH p #PP04SP0 0R0 S  B S0 8$00,0቙0P0F 0,0Sc p开8嘥ȿ+" < Q \%0R.@(00 @DU`40 @4Ayd|70 @R40 `0```0T0哾(w 0 X` p7$[0`0 I9pQ80< 帀 P0x0 0Sx0x0t\0\ 0⨁  B`[dڐ HQ   h ` lS2  B±dd 0RL%WU0   (0 C00 0 0 R , R` ` I 0$5S  l01` p00090S2dŘ0)ST0T00! !0)SP5bX0`P5`S(0d4먰 0  *(000080` <Q c+H0H $%P+H◛ cH0-ᴐR㰑 ,  BU 00<0000T0 10X0岁0= LR\ ?0 d 0  B  R\ ?0   00C 0  080 C  C 4400CS T00C@| 0`4 8 0 RT:  $5SdL $`$`(0V<0S ,4 I d,04  0,4 $ 00`  Vj࿖=0S   0帀0 X#` x0\M`} X\># P 0d?། @ `Œ0 1| @=\%R M0SP+n\`/ `ƌ$  $ k0D.`S`0  0$5S  l01` 000>0S/d0.ST0T00! !0.PSX0b``[d먠    W00080@$ 0C400400T#*Q`?0@$00$0l0`0@hppT:S $S0p0S $S00pW`@Pll倐H)lP00@b8p`0x 1pZ90JY!@@ll00 @ T: 呵@$\`Q  @080(0 ͖ (0d O@ LL lB;  } p0S30S0 000S.N 08C 3R3 0ł."\5\S 00 0 d 0/ @ `.3,00  h 0000P0S2 0,@0P0 20S Q 0S 20S $a 00l:h*,8dPL20SD#(B C ,20S3030404040p3pGVW*\V.PaV.GVC0S  |10 PS1\5=S,/t1?^ E?ᒔ0 0S 04 B dLĒH 0@ `Ì014 ,$0S0S 04 * d ,04 0 04)ݍЍ 0  \0Etp@vS`YT<(jYd<(̽8(սW% <(<(8 <(O-pRMP`b c\@P D!\@4 PpߍP(  pp0S <08 (00,0 000040!04 04$0D0(0P Vph p 0 } Ds 8 ,    Hp Bp [ T p 0p?pq8SkVPr 0  *0*0@0$P ← 0* *0d@edA030<0M0Y0k00zd@0A-PCMMPp`;8 Up@P  P0<PqU00 ## CލЍp@-@PoPp@(i0/Sphp@d꒚R/?xG-P `$ 0p@V` 0 @`` V`@&!D( `G-@0 4Pp᱗ X00000`0 8#8#$48#8X00P a40 "% ?Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX0p0\00``Pt0 0,k, 0S% P 0 yZmS aSMSASB0C0b0C S\TTTTLTTTTTĻSS@U@@sS@ @ @U00 0DT dS$ 09R -"P T 0U8$UQUDT P 0  @@@ X 00 l P Z0S00 0 000 00P4Ѝ|߮@-7,@ (%V0@- @   ; O-@0p |yPh`G0 00000B_I0V W `B@ ᴐ@( G(P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@p@(0P  C @- Yco`/s@-@PH` 000zV @ jYЍp@(@(s@-PX00S@H0`ă5#0404YV @ KYЍp@(@(@(&d10 PS/C-PQ@8MPM``8f aᦒ 1p P08 0 T:86S/ⓒ <6ۍЍC+ 0 P \ ;0 S a8!#4a4# 0^ P;0Tk 0+ۍЍ@(@(@(@(@(O-@BvM`ePP"X 0F050( 㜆,6倢" R 0 !X0 60C 0 x!X00,6&0=,6 0  B 00C0( 6V0:@ !`V0[$&,v?r  Rpp @ 0`7p0 &$&?>0 `L0V&S %ᬐ0: S g0d &ЍO*< ((♐@($Fj\%A-Xa,0S@FT:pPP  0 @1AT@T P @C1@1 S  X R21,6&0,6   B ! ! 00C 00@@()O-@PIMD`?4F@0VD ?`0F  W?0V 15: T*; xW T8 `T 0 LH/PD/U㰠Z 00 @ / @& d &F 0K /\ TӰ> R`$|xW k2+ [S!Qq 0BG 0D0 S 0008cS05>0$0ؐ0ᓊ (0Ӑ0UC(0 ,P(0,   BQ 00帐 $崐0 pF୐0M000 60 6ថ = 0(0, p20740<800`U0@ $p(,<0DHH LP\P`PdP  0T0\<0Tp5T0S\0oT pL<PU P4c ( ȋ0L VR0400$ ' \`$  AŠ ^!p11 0B ┄F0D90$ATpepeC 0CP! ;P`\` :j 4P@<,"  5 000d0p080\00<0<@0008#8(02`40 0C8#8,00L00PC0SNZ8J0 pS` H!*&A 7 $DL ) 0 (0 "* 6 !"0@& 0 09nPp< i@&ڒ0SSx9 R0?00V`pL00f\0.L0 $0S 80S aP $0S <0S@0  0U0h 04 XC,000`0100 p @|S(0R<(0 x0S 0Sp屴0S00 0  0C##@(0,8X $p I PPpuR0 SpG S;P@`8 00S L0S d0 P" 0<4#S + E&," 0@4# 6 K 0 #`H 60CT 00C0CS\: B XW:Ȗ刁XS: ,66(㫱 | H TㄢB ` ,6 0<6&$Б(6XS:0TSL0S d0 dP UHP50S`V=@` S!PTȌ01 210@! !0 ST40##$0Vd$0d$6$[:,6 0&4.hF 0V4#000040 (/`P0SMVPEPUI 30SA V 3PUCL0S \08`0 CY PP1 P# 5h3860`0000096 30APp`<wT YP `W 28`0000vf & !?<#  0R *d h"P P0 0PPP$"n v`Pw!d P  6![!PU:< U*!:0U:0 0 p-L0S]_Ui/0!p D zލЍ@X0@ S@00 |P p,t 0 @-aH@P!< p P  YD0S 1@X : SRQ\7   ȄPP Pj VPrPE_oR00b =ph0峄P0U p ͉P  ȉP@D  3m`Tb408 0 \04 0 80勄408 QP  80t@ 800SPD`A|0 S10S10S00S$11011p0 0 100S|0 RS00 R0 R0S / ҖP ; 0@S 00 T @#P U0  |;0UP<;P 1 $11(1000BT 0`S`Sʔ0S $1S 0S 1S 1S4X0@ 0@w->0  0np^ p`PxC0S L*Mp` p1S?V?`#  *ApT a1S )7pJ Q$1S$A0 48$1C0$S X0 0 X0 00*00SR3#*:Q0<0S+ @DY<0T Q!zP@ T< l +p e "B?;;@ DKP?`|  0QX# X X H XP0S l600S P0Sd0h 0P0 @0D00 ,h0S 'd0S ! T*,000S0 X0S010S"  0C 0T 0#Sx0S1`0S S <t$0S $ 0C$00`01P0S1p0 x0Sx010S(1h0S01d0S41,0S /y,0P 0&::+0P 0  pl n0P!* RbR V000S(dR0 1S01XY$1aP00V`U50!A( >(Z ,rh(G30UH0)H00S:Z( `U  ?  0 S:01SD5 R 41S +,0 00l000 X P00101$S3#SQ4PPQNU  4Q41S 3 #S  RP!RL X ˆP3UP1Q X 1S<11CH0庆`VX  0DெpP(10(00A01 L010t0$10UWP X(: Z8:0C?oQ20S  PPR*? X X ( 02#rL t0 X0#d"d X΃6#0\0:pP<0 01ZPL01 !(003 ($q W 5t:( R"P   (! t  Gt(  z Xha X\abV1t 0A2""Z( 0@R"0P(\0G( 0t cz0@Q!0ZW*>0Cg({R7R]P%,k]5>j/?)CmDݜYw(: G)B%fgfff/URRaArrAa,wa3 X0 X00Q*$0 ?oR 20$ \  X0 X00 (kQPE0!$1$Q R0QH ] 1$01S$0S001 X0,1$00S03$15$1 q5 X@0 0 X(1 p0-^ = C0 D02 `X PP KD =C0 Z(( L0\2#P0;y X00P <0D0001|0$40\0H0#40`000#40d0@0$0 Q  h "    Tp  0t0 3Q0Tx0D0 S 0s0S d0DD00 0hha00,0S( X04qH#W030#W0 W00S  pR804 lp.0V0S  l/ pL T  ~ ԇ0S X41  C/oS" R \0 X 00 @ 000(00H00`00000d00X00010101$00@0 0 (1$00(0,1,0>03M?03)0 01 01100 04T"/@!b$ 04v 08 0#$ #(#< 0h0%: p:>x R,0S00t0T 0o0 00 ST $&?   } p T]  T R 0 Q  0!R R S 0S60610110P LQS*L CQX000| R X  R   0P0 <0B?oQ20S (0 00 25 010P C0024 01000pX@0S (00 L0 H0S   1S00 , 14X0 E?0Z0 \ F?0!0G?00$0z @0S t Z,!(n l x0hXQd b 4Q]   D0S Q2800S#x 0`( "4`#/A-0 0P@M9 <0<`pTM 0;eA@00@- 44@4P\P 0B"" G)-@=B'8S)@-' J %G-@P ` 7!>0P V0 0  PP Gq~pP`0 0PvI0S 4oI0 庁V G),}s@-pP@ 0   X 0TT[ LЍp P `0 J G)7 G)@-044JQ    Ѝ~7@-$MPp  n @1 00@ 0! 0w ))q 1 pl `g Pb `PDpATV@D:$ЍT %7 p@-0A0MP`  , 0 0 010R  2   $0Ѝp@( R  #   $R 0S 0!$$("( 18#! 0Ѝp@ 0ЍpG)>_ @-b pH8H)P@- 0 R * 0 #  @00S)P `00CS`0p S00 P0S X0X /X %p@-`<@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hudu`0Pp <10C <1$0 810S81G)b%(%%PH)O-@ ^"44"P40pRPM=p3 204Rw8hZ\S*(S*,oJJe?Xgffft9zgѤh}@-<00iS03S !$SPS*W*l0@-h@4   L @0 0 ^*$,4=^*@-`0@P|0 B0PU1 S"P X0p0S D D0P8گ 0,$p Ѝb%\S*(S*F(%KC-PD1`0B8! Y!R!tM@p  10S  tЍ000iS00S 00S d `P W @ 0  P & wyP000 p 0pd W@000b%\S*S*U(%S*(S*b%j`0@-@X0 B0@T1 S"@ 0P   0S b%\S*O-tQ0S hhHR @P 0S <@=+b!T0 L< fP0? 4  l\00?^*~*f%0@-@0 0o0@0Ѝs@-@P`P @TZ TT?0 00?ro+"+R  + sЍpR%G-2@`VBMy a@0DXBߍpTW B/ w0 S'4tx'xp r w@PQ  L1b",4b4#0 440,10S 0S Q0000 {'{{gW:0000R%*0S ?0 0S 60 000R*Q p` 0S H`X0`S ! S*x*h*(%v(S*p@-<p@ P(~@P0P0pf% O-l3P0_MS XXTsTC L0D#D0+b! L<*eP L RF0?0H @L c1P$PD uz P R1P7P|_ߍ(S*(%HS*S*S*f%~*9W-^*Kb%Y  hW*nT[`9;n*%j%@- @ 00: ShW*G-@qaP U+ P00S ب0 S00P R GRڀ00S |pP Y XrP Y 0:0S $PS*S*%O-AMM`P@jpP8 0 840 AލЍO/0 009/P) 0`!` n pPQ D D @P ,^rPD {@T TrPD q@D `ࠟటT AލЍ 3 .0A. 4B   R ; 0 0 D J@D k`0 _ 0 D kJe~*%<dC-M Mp8p0 /R @`㬐嬀 G\PP 0S P@ۍ Ѝ00 D 8p`D @P 0V lP`~*p@-0@ @P P @p@-@@O-3tM0 S ttp300RS`3 T3T#0PHC0#S<88tЍO訧($P qt  { w0p`00@ԢԲ?` _0@ ~}W6 ! h`V5VW 5@P p0 ?0@! $\ [X ?0@ HGDq/tЍpJ`1P0xSiS@P 00@ 000 0C0X10S 0`S$Y \` [X[h0SS   80S d00X0\ 0`0>0P![c0 8d0(S*(%S*HS*S*Kb%%^*S* S*6Pq@S*GA-M`MP@pP 0p`$d!d@P TTLc~s< 0ۍЍ Q D D< `PU Up{ ]p0P aPs xZ0S &p T0TP 8 H7s8 [Ey%~*S*hW*=h@-#P@-L@0#S 08v4#S 0/@lb%f%0A-@P` 0 P0: 0tpp ?c0@$aH00S$`,lЍ 0`0V@ 0 0/_ 0` @T`$ EU000 0 0($00S0,00S0(0 0S000$0S0400v_@0 1S0 00j_(S*(%*S*9W%EPS*r*8S*HS*S*r~C-20MS hY܂r 0!aP0 009000Ѝ #PP p` \! T8P p0   @0@D`P P ok  1RQ rQR $ 1 RP P0d0 P X1H ! "D @10S0"(  0 AD@(C@\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t"P  (S*(%PS*r*% /hWS*8S*yhW*HS*S* 0`( "4`#/@-@MQ 0 3/00؍/$7 tSB0@-0@MT[0Q@X0T L0LP H  EЍ0@Q@x*IhW*%0@-P 0hW*%0@-Q 0@T0 R ||:0AS@ fЍH0 DPns( b%`S*x*% j%mJA-D@p 0 0SP(v ` PS Px*[L0@-  Q0 0P ,0~ Ѝox*hW*u%@-0xP 00S@%*S` UP@` 40P , $  0Ѝpx*hW*%0@-0@S 0$P B5/x00SP`P tfqpH0P@`tn 0((@{% ЍS*x*S*hW*%p@-hPh@4S 0SP LLH0P00080 4Sp x*hW*IYPS*L}*0s@-0@SP  40B3/p00S\0  pH0P`@ n 0((`'ЍpS*x*S*hW*h%p@-P,@P@piP @$p@-X0XP0SpH`@P P  @pS*j%x*%A-@ 1 a051q0S :p\PP 00@P@&}jPPm1 0|hpPm#P 0D000A(S*x*DS*S*%CwLT~*C-`aM! L H F 08!  (A(08!Q  0"Px/tX, ,  i F 0`   ]8#`Rp00"0FRt FNdj00@ LS0ЍV*(%hS*% S*[V*.:WO-鸳@0EMSP8a  !0 @|00T*0 ?o2Q03S L30S @3 T<#<  0S Eߍ0S3 00p0"0S 0"p! 0 V V V- w   0 B B B  0h"p+ @20S L0@   0 B B B  0t"   0 B B B  0f!0S  0iP 0 iP. 0S x嬟V V V     {8!ִ!p0S      ᅴ V V V|     S ழx p z     `L (S*(%S*sY-j%~!4H 0P/00S /j%x*P0O-dEM940`SM P < 850SppލЍ90 Z 400RSp 40SppT)9S140404$04렴堤 E\ B00  4 S BPLZ0 S 0 ᔩ՞B)R)  0B. B Y Mpp ph峞S PH[ B P PhBhP u $ R B  fU $SR O Pu  dP_Xt/2 005P 20S )K8g00A,0 S x >l#R QPSÝ\U  a$ % [ )a#0)90S 3) 0S 810S.0S 3 #W3P) RYPER00PES @!U<1<0 PUJBJBGPEU 0S 14S 043P UB-PEx*Y`S*T~*S*hW*%3zRDS*j<aW& d&j%S*S* (%+BHS*8S*~ݜYhS*L}*O-hChs5 SW0 R_`P44)0SW  0PS9S00P0S 0S 兝09Q ?oV20SKUNU5E Q5 IY`Vq``h\2 RE R; R< 4<]820S?,P; %+N909909 ЍŁ01 +"+R ! R  tEUY0+5`LlP d8X $`e i0S 3 PiW 00 ?aqp V00S x0S 905 ;#;S T%GK+X pNx*S*S*(%%FhW*],S*j%(S*!t`S*h*@-07M0@SMWPP P P `ۍЍV0S60S 坜00P 60Si  ""4h42XIhUI004488<<HHLL@I=I:Ixx|]|!I9^EIEI:^EIE""442""442T0ASww(wDww(w f Pi PJ wPb|T0Sp40S dd00fc` ] Z!"441SP""44"2"44"2"44"2"44(2=(,:,T7TX4X\1\`.`+Jh0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,dc20h0005/(0, d20=S" " \" R `LrVCDS@"@ <U#3 (N !0!x30=00 1R 00# |# #X0/80\ /`0d 0 %0L0<040h0T! AQxxpyxyx&9-0CS  夽 R0 R R 0N\ \0Xx0=0- 9!`E S*lTx*(S*(%kS*j%kq%!BZsC- 2 B P000000 MQqM0S a쑟=聟0=P  RP 0AS^{0{{z{{=0=`|0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-RڌL0=ۍЍt0 h0P0`0\0S H,@RYhW*hS*Tx*V*HS* T*n%PS* 8UO-AM0L(0 "S e#r0 (#AC5/0(0#R00 #0Q0У dZ0 (0S  @(C#5/0(0,0S3,0P0?0!#0,0@' OP Aۍ<ЍP(0S #r(0#͡AC5/0(0#r0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  BS 0S 8#R00SQ 00S \0l 9P tl:x3  P8P0ShS*Tx* T*j%hW*S*(% 0 hW*T[@-@0SShS* O-@M00@b 040P<00 0 8 0a  0@ c@ H0LP Dpd`P* ` R  R  R;  R 0 PL RM  R"  R`60S  PPL60S 868PU)-$P"e 050S  P% R P 0 t% R  dd PЍ0HU00L%HHV0S50S  $n40S   PP 0 0 8k h   W0 0040S 0 d |$ R  8/#PU# R y :  0?P e 0x o oW 0 0 8  \30Sc X \T 0 TI"0#P0 0020S  2PU-20S !Pd3 0  W 0 0 8  20S 0 $"Pz0 00e 10S 403/  !PPXW00 0AX10S00S 0 0 800S 0 b4\p 03/PU 4   00p=P hW**%(S*r(%$S*S*x*Eb%X\]l]x* S*c)bT[S*|*l^_D7A-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-;P- !0 010000 QP 0PT 0$M u P ЍPB!0P;C0P|80S050 000 @ 0@0 0hS*hW*Tx*EPS*rW@-cM0S pp奖lClS0S Y_0Sgc0#0,,p R0` 2r 5 0500K Pr5"0C590C990C9000Ph|n x[0S \2d"`2Q090 9 ۍp@-0@S g/t0P0SdP 0@00X` p@044`000Sp p@W.S*B%(S*S(%C-/`$O@P p/@D0S Ѝ/SpPP60 8P000@-0@S  0S 0 000h0@0S P_{ @044000S @axS*B%(S*(%@-0@S 0 000d0@0S 7P_L @000,00S @S*B%(S*(%@-0@S 0 000ud0@0S P_ @000,00S @S*%(S*(%C-0M.S`p4P4A0/SS 姒0 0~U  嗒  呒  l  f  `  Zp  xTX  dN 00@ <S"Ѝ S*l#YHP>W^gpw~W@-8"C-@`PApp P L'"0 S000 ЍW00x*p@-BM @P`0E CR V  l^P0FS `0 AS #ZP0P S00@$R!Bލpx*A-P@`Z<0 pZW !Ax*@-cBP ! ?O 0SHP  jP!0DPP `@hMPS 001F0S; 0 00d1d00 `ZV$@1@a0T0 0d Dop萎*y S p@-P@U U  0< $p@M  (% P 7P P / //   -M M? ;Hۍ Ѝ(%4`00CS`0 XX0 X /%O-pQDMDЍO{M@xx`pP W200 RR00u0PS00C00@@ Rp@T+ W-Y* U U %   v\  %X}0.|    f\  X.0 Ѽ $p W8(% *b73<0S/@-@QPM PЍ@ p31Q``X00CS갩p8hhh"2PЍ@M !0S S/   d0AS&@ XHH <840 0SPЍ@~   0uW1hS fS501 0400030020|j0CS PЍ@2=01 (0<00$0;0d 0:0090080070060 050040030020Y1jS$ $QMQ Q FC<7(2 xVPЍ萎* y  Y) = \ n k x    ߸  q  / N V  x  O-@`pR 됎*l% y p@-P(@P VPp@k%0S $  R R:0@- m*@- (0 0 0 0 0Ѝ uP P P nJ@-(M0@ #\S@3@#:@ (Ѝ  7@-P  Q,XQP Ѝ0 i@P .GPP #VP**0@-@QPM <1a! 4aSaD@ @$0d@Oo@ 1e% 4eeT# ! "Q  R eP Q ,PЍ0T%< @%(T h X%T @ ,P" $ @* Q0@-.Pd0 @X!P@QR00 00* *0s@- @R`  P.VGP ,nP0S ,gP|Ѝp l0!PU U 0< 4kЍp@Ѝp@l%**@-@T T 0( (O ЍЍ@+Ѝ@*p@-@"1Q0P Tp@@  p@0 p@7`CO-\M00@0"0 0(p @@0$@,0@bAPP PP  @@0OAP``yU]\Ѝ`P0  FX y RAx   <y0P  byM  4\100 0 S00C00  Q4P p0 <p 08pj0M x`00CS`0 X0@T:\ЍOlX0 X @  %l%@-00; Ѝ@-0  3 ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝ%@-0@ 00 Ѝ?@- %@-8.@-aAMp@0WP M0dqXaX!0TL0P 00 ,Aލ Ѝ`0001!! ?t0 !R  0GE@PcG  ZG<T0 <j<@D0 H0X0X 0 DDωؔ*IW9W]BYv*|ݜ @-f*0@-6S <ؔ*)@-GGGxGm/l`t@P" XKT E <A4Q, ;@q)6*;*@-O V1%0@-h@  0@ 0\0CS @CP%p@-@Pp00Sp8PU``p840#U:0X 00rX0X40P80 0X0p`P -7@- 0@P00P R*00B0 Ѝ0@Ѝ/O-dM@P UP@DU 0 S wOdЍ`p |0 J0]0 0^`!0 0  Q0  .0`  V0BwP UUP P%A-@`Pp尀@"!023 U 0 ]wpp p SwnP@T0S0/P   ЍsY-,Md H0 $0@0080000 0(0( $$0\ )%-7@-D`P @XT@H R 0@A  000 Ѝ0@Ѝ/l%yP*Jp@-PP@ U0S 0CS 3 00p Up@ TT 00 U}, ,Up0SpP*d*SKA- `(p 0[>pЍ P @P  PP 0D>pЍAt01Sh0 `; 0X2TpT 0` 0S ` F*P `xP*l%vcY& C-q@1MS0`n1SP1SdV1 묁XV ЍCVR 1S  @1ЍCCV,p0S) S S OX    OX  VЍC   O X ` TT ЍChVЍP*l%vc(%ywaXJH Z4 0Q 000/ P*l%A-|AJM1MSh=`pB0 `PS c40`0 ?=p0S JލЍ;X P0SA7J.H0 0A1$HpL  $`0P0p0 P7=pS9 Lt0S8m!10 &P*KG-`Qp1 `S1S@1SHV$1$ 1SV GV1S G 0BVS0  夠D@d0SVG1S Q 1S  < GVP*l%vc(%y 5J-C-a0$MSP@D pTp0 GPP 1!@ @0 <p!o$ЍS    0S  0S0SR0SpT 1S!0T0  rq 00 BT !10!sr 000 10 0( )00 0 !P*=O-hb0MSP@ἐ opTp> ,pR,0  <p[Ѝ0  0)[ J0SD  3~R0S@ 0 ;poMpT 1S!1T p 0  T 1!0 00 0   $ ( !00d 0 ,]0 ,   0$0(0!00d00 ,I 0  , P*\nC-0P80圐 ,MR/ !!~@P`,ЍC`@ @gM(0`0$0F Pl%d*P**O-\M`7MP@谟Q% 0rS P @0 0 0000 0 0F0P    RQ  \ЍS @0  0P@*A-O-JM M`@pP/I3 <)I0@0 0C?oZ20 `4  Sc/b8 TK'1X0 0 04@XXXX4S @U0<+084;<00U0+;40@:@#TRT 1S  GR:1 W00   @ 0t3p0,H7,d7X ,D 7,<4 7(倀  , 7, 7  , 7, 7ȩ  , 7, 7똩  , 7,t 7h  ,T 7,`D 78  ,$ 7,4 7  ,7,7ب  ,7,7먨 ,w7,s7xX 0 ( , Pf7,Db7 4(`^HQ PY(HV W 7  0D# / E34A@pS tR,h87,F`7$R [Z 0WSV XQ;X PD0XL4EH0 1HL00 1`00D0 6p)L0X 10@s~X娆4 0#R0X00Cs 1SPlX0@sYnW 0 0D30:갠Z 0 R(0 R P G4岰 ȅ.[WP Z-  0 0 0P:/00DJލ ЍW@! Z H05p00DH0S  00 @3SH0GS*L 280S0$RY 0 00@0P0@3A4/ 00 @3S`T1$04S# 403001pP  035p Z K0 S0!,sP40S0$ 00    $ $ 0``00040 0 0 S 8pz'0S 0R 00C0 0( 0R RX,( P ,( FH0 4p0 +xH0 4p0 l h;㨀H0 H04pp-K0 SpHpP  H04p 0 0H0sW; 9pH0pp Hz4p0pH@P0P  p ppH0c4p 0H ?d*m%YWvcm%P*y>*",%0:D±AR\ev*l%O-`ԿqM=P`9@Pp Up#*p0T?SpDp00S5P.0`0l/809` R   1PS@U @`  >J00 14@7J0 ,&@@<@%@b9P0@0 p @0XW!3X0 S7 JRE$t=@9@P 8   L8@8@kGP T ,.9P  ]GP+Y =y-  0S&T (J 8=80T  0SJ0S P,GPY@8"GP,T  GP GP0p40 GP0p40 GP GP0p40 FP   F PT  I 8 804T H 0SI0S  F P"T  I 8 ᦞ8 T  k RI R!P 0:{FP:TZ 8@80 Ro aBQ*$dddddd4<dddddDLdpddTd\p  `080ikklgj    p5p3p1BI 8 : 8X 8 0S /I0S 1P00: <00140k0!S0< 2  y 0G0v9Wx)  I 8  8X h 0S H0S R0* 0%0%00140k0!S0404@Tk0,D4(DT* H 8 8X |0SH0S ` 0!  k40S0 $S01W40Su  kW01Sj4@T 0G?oT20S0G?oT20S0G?oT20W0S hMW\I 0sWp0;p0030P.&9008`d `@AaRP8 BZ@804@U08080S@00 @ c/4 4 6@ @15p8 80 @ @0Y @  1=0 ! `0400<0@0,1pH !105 "04qߍ 1PS 0 G 0tH0c?D`D05p`H H1pH0SX ZGH-0A1 Nd! `0 D00@0`qH1pGJ !10`100CS$$1" =6@P qߍOdoob4S @0404(0 0,0c?0040(00000, (4p0p;W,qV RT=00D@ {?`P0=S "8 R  xm?P 0=Sd "8 R `  D_?P 0=S x"8 R  qߍO( T V0@40,@p[VD@70S 1SX'  APP `V-t T 0H 0(0 0,003Ap06/00 HX 00( ,p0,S(` T'&F Xqp F0"S Fd P0 SX0T R $00Sc SW S0G&P00CsL ="C P*ll%R32.s0<SXJv^w  A_# ? X s     m%CH  !5!*KL!^!d*0P T0LP0PT0p/pWWm&000&00' T0&P0.T0hPhF0SY@@T T TQ0P 000@L C@' 0@0& 000.00<0h 00؂A`@PV\PP P\0p/p WqߍO F0S0 0\0f0 00$_0000s@-@P   x l ` T H < ,%%&"&0&O&j&}&&&t0p@-@PT`B P  Mp@0۲p@ $$*g&&@-M @ fP   PIۍ7p@-IMM @`NPᩲIލЍp P0 埚0 l噚hP 0S 0S0 0S  P7'7'$*@-M @ PDkۍ00 R   P7$*H-p3MM@@PPXY P?0  4)BP00S` ? BP  LP``V / BPt2  ` 8`P_ H2P @AP ,3PP0 0U,00P`0SW J1!P J hPP J1!@ P\10S P 0A0z 0\APPPUqWP P 0 V_PiP`ZZE_oR0 $P  4S J P t叙60 `PfaV7\'_'$*i'4^s'''''''% (R(*(O-@M M`;@j/p" P@@@ p p0Wp0Y:0S @Pm ,ލ Ѝ0W@P @pA0P 0Z 0 p 0V9 H1Z ]P Z.$ _pZP Z. 20Sa000Z0 00V9 0Z 0P Z.p 2@)0T:Z_P Z. p$|dRvcedA$*d( ((@-0`0 0:PP 10@PT :P Ѝp@n0B(PP 2:Ѝp%jO-dM8 4@00PP0CedЍB0P$0  $Pg U  tT^ Tb Tf;@07W000 >D00 0S0R0S ,0 @ $0`@T[*X70P7P' 0L7L0H7P0D0$00(0 0ZK*00S 0[S 0勴Ot  䆟 0P\p 4; HRp H Pd$6@0p6pV01@0`6`V00S@D@6P00@06(V0>X1Bn80S 04 SA(0 `0(0 0@0 0,0S5 0S2@ ?= D0F@p_ 0= 0<=0p0@P 0g 5< Bfp P4 0p0PHp$?4 $;Pp FL$?4 ;$Xp H0 0<D000@P 0! 3X P@ ȟ 0E=@ 0 ?= 050SR 0TÛფ0S?(0 0 @C%  pc 0p`Hip ?4 ;P_p ?4$;XUp X0P H@p?o 0< P0 <0 00<000 LE(0S 0D{ფ0S?0=  `Q 0`PHpD ?4Pp `; p9 0X@ C?4$;`p,   0 r 01H008!D04@p   0[ 0 0@P CϠĠo 0<? 0y< 0 s<D0x |)z)))@**3* *B*BY*) B)B^NO<*Y@G*K`*j****++/+@-2 9L+%G-䐟`DTp  PBTD PEE$U@X #>P00@>P 0-40 P @  3MDPE@DL*R 7p@-P@Q0  0 p=P @0S \#Pp H80@ 0< 0p R$x#xm%*,|+,s+s+s+,@-83800S ,0 0$p  Z**X*@-@L0@3@00S',0, 0S00 '?***|+\*C-pQ@AP@pM0a00 M0 |0+ 0#=P @0 @0kۍ Ѝ0 000nS% ?S aS@ 0@TpS qS @ l0h fs@<0 P@0 @;@-*-%*%-L%*5-*X-Tp-$00S 00S/**A-X`0S L00S 08P8@p0Pp00****@-RP@tM  d P RQ ğE R@S% h4` R0Pt@D\ <8    Q(P   CR @ 0S $ LU? 3\ P000ßx^;0S@tЍ R Q$P \P! P 00^`\ 1Np$$ l \ VpH 0P P0 P p00$0[^ ! \^ $^``` 0QD p1A$\% lH` CQw A0Q  $QTO 0Q D R QH ]QK p`1A$`VR lH` CR B0 pp\^ $^'! 0QD p1A$\ lH` CQ A0Q^,^ ]^Lpp ^0q?\QQ Qpp,Q ]Q P%L%{+{+w+s+*4.PA-@@P@T _-@ P`p0Slq d0 @ P,0< 8(0@Axm%j*vc؈|+s+P.A-@P@p0S0P0`|0 R dy R 0L 0S @!P@`T !s+h**xm%r.(s+,,P@-, 0 T|+.P@-, 0 H|+ŬP@-, 0 <|+.P@-(@ ,000 #|+*Ls+.P@-(@ ,000 |+*ps+.P@-(@ ,000 |+*s+.P0p@-AM 00@0 0@S, ,1 AލpS> 0S0!C:P 0S0>PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&04 C:P|+//|+ //|+|+/G-1MMP:, 44 1ݍЍP0$Cu:P @4@0 PZ30S Scs 5@PQ / 3@cs0S0S PU~X30S5 0P/ L30 003 0; 3 3Q0RQ300?o2C&Q20S  2 0P0002@0 0R R00 R P ,2@"000 H 22QT100?o2% Qy10Su 1@P0001@h, t< 0PQ0S0P,P U Q 0S 0S 0P 0! 0 00 00QQ000?o2%Qx00S  `0 0WP00080|++/* X***|+*|+|+ //** |+7/PG-0JMM 00`0 0`S+ @1 JލЍS2 0S! >9P 0S0<PP V0  t1t p1 R0 0S0Q&Zp% 41 @T (1(=;N;V;^;f;;*;*`** ;+; s+|+%;/**/9*O-iMM`0\DdMhlNύ,($px@<8t0 0P@0:600I/<p1 $'8('<,'0AM? TN?@DA! $P 0S hP,P 0S#TtT>0S~\0s`0sd0sh0s0Sl0s lI'T>0S0 /E3P:'7'>0S 00S01S  0TO\ 0 -=0S ^P' 01Sh=- )0S N~) P$->N 0 o)00 r Q /p>0S-@> pR*` @,0 Re|%P<0^ 00|SZ `W0Sl<0L` qZ N LN= = }BL,$3 <@0S  01RS  S ;+$q 0S 00S M? 尐0P{ 0Sx }&PQ#`l|{@P@ 0S :s2PT@#V :Fk+@PU ٬p@p0S01S p0S\ < 0 $P$P $A%P  0X!S/1T1P1L10h0p X10L1S 0S TAT# 0S $P  |Su0 0{0S 00S P @0T1%TIYIύS0000!Ra @@$Q(a0000#'89010a/106>pP W_'ۭ0 |PlPl0S(!$|e>PTp`HVv  0i_0P0/3Pt90S 劭PP@i/U`, ( $00S t i?/"80S00?o 2K$P P0 "P70S P 0Se%P 0S]%878G`4W#P@3)5707P 00@T " t&P 00@T " e&P 00PO k=MpL<DFdP<&0l')P<60S'Pp@T),!&I&&5u`V;df 0( FY & |s@6 hl6@T M?0h0,%$14^@(,!&N50SP P4$& &`p$4Q&&p0耝S``\4TTPX 50S h5 h @ T&V 40S (5 0@ v&T q&&p zP40S 4YPCl040P05$ 04PG  P 幓00 R @3000@ @p`P@Pt'$@Pp`@"  40WP[= ȐP z2Q00S I[ [ @0P00DP 4P 0*S kz`Q0-S _zpQ P0000 /R *R0 Jz0Q@00000S1 0Doz*`*w>4=>=*e==* |+==(%2==d*s+#99 >:9>>;>q>{>P*>>> >Y***>*+**d p*/9?K?Y?\*`0=m?? ??'?l*?//?==?& ????@-t%P%&@6@]E@n@}@@.@@@@ AAAIA$AAtA1AAA(|+*B0|+B'9Wp dd HB+XB*`*uBBBB,*0CB|+@BBܷC *(*0*=C **P 0, qD0_$D0qP 010Sq⥧ DP #PdP tP yPykx00x0P P P `00 "P00S S 0SX 800K?CS3 U 0SpX2 0 Y 00S +U '[G [(!$"2STy"02Q0S I?00 t2 @SI@2 lx0SD30= 000Q00Svz30 00 Q 00S% 30S0t03W0st(4@VZ HqP0S40ppx|LhH4\ Rʤ4$u4R P 4D! 44pd0ǟs d#0d00 ExPU>  g%PDxu#0 0| a 2| PRx h#0"0C?o2? a#"0 "|0A凐p0|0|0 R ;R |l P 0|0|0 R RU 0S;0S(0?"( ,0".x0S ?$0$.U0 P.͡"͡"..R0m0"R0.͡0 V$`P$PPx0Sx0S60S#PP . L&@000.R08<0#. 0 x(L HǧpHL T P"PPT #P V  R70S 70S7P #8x0S PEU0S Lh!1Q!0!PZQ= 0 Q0 F#}8 8pŸx U00R0SG PsPq  k$P  P$ Uc e490Se09 Q `T) Q0d9 FUx9#A 9R-sr Nᗨ-!0xQ3/Pѧp9@ȣ  C: R04:P;\<` ;d:h9E#0S,: 0R.IN0S 000S 000S 000S ߦ00tiލЍ0S 03/0S ͦ00Y @p`@Y@p`@s@- P@>%P  8%P0P [Ѝpp`P  %%P 0x FU 0S S TP 0S  ( %0PP Ѝp@:; ;;bC90@-Mh 00/P P10S 0S00 0 Ѝ3 qQa @T0 S 00S 0s 0 :+P 0 S000Br@ T dMP 0|S 00 0S00 0000** L `*`**@-P$M`@ 0000000zpO0P/S:S TF@M  Hi `& 4p0/0\+@P/:W+`P v@ƥP ¥$Ѝ@>/000`0 ?@PV@`00l0@@DcT@@!00@0CcS1S@99=;|+PP00/@-  (0@  000 @*p*@-z  t0@ d00S X0 0Pp L<0000S \ @***p*@-S @`00S T0 0Lp (8 10 10S 8 @**p* h0@- X00S L0 0Dp 00 101000***p** -X0lM@ d @ 80 0p ߤ *C**@-0lM@v0 0 00 0rS sS ld dd XR P0 0p ,d $**p* |+CCC**C@-`PP@ @0@s8#80U 0s8#8000@? P VU 0A0T00Ѝp00CS0 S0 S 0 /O-TM|0xp0?W0 h "? $p0pW 0ⱥaP`PV0W B@⣥@ 0040RD H 8PZ0S= S0D-0Y 0  ;@P)50S 10#S -|0pS H1 R 8aR 0# tp uTЍ 0 0/`V0 į $PP0S 0#S@DT|0S "P\0a#R"0 0 " *@B*O-@BMMU@ Ac_? 0a>0@@0`P5 p`5刵P<;00CS0E0 S(P50S5U <% 00e  0We S00G00S,+ 0S 0 S Z000S800CS0PP00CS00h `q0 @P00CS0 00 0 s`83 ap0SS 00   00BލЍ@d3@<30S VW@@ c030!!30 V S$ " R 5U Q Q$Q V RV"d 00H"0O0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U 0   0ZR]@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/p*Ė ` |+p***t*****+ D|+s+fP%L*-A-` @T ir 0 ЍAЍ/0p0$ P xOP  h0h 6oB0@S yP 5/*,D|+p*Ė ܷ*4O-@sFM M`  @  00$0p30(0$ 0,@30P S W0 (r 3 @30 @,Q(2@@ಟ@aGT  q 2 x3 0 PD0P2d )P x"xd d0S 00S D 0@d ⠣ PP dⳉ@0S00?o2 Pᔡ 0@6136 D01@夢pp x劉H1pwD0(66S0d00 0d0⁢( A 0aPS lqP P  0 00S 0 04OP@ 0 @0O0@,hI 0@Fލ Ѝ耯*P*ND|+s+*> *>>*gD*9W*DD0O-$GJMMs~0`WXg700S00p  94PX 660 9!Pl`60 0 0H097S\4640S# (X6&0S0 0]%Q0*P! R % BR$5N00E0S P,97S9 5N啠00\h%h0~0 RS0$000(0000  0 PV 4 5X l0000Y4tN40܀C XSX t4000C 0h00d0$ 0`0 lT CP $4T!>\ 0h0d<` ((0# $0$c#!$c4"($ <7 $ &R 30 R0S R3""44008'0PT3Xi97S JލЍ000 00 0S   0pJ8'P\20 0 0D0 0 a pt 087PTɇ97Y^ SЁ 0S [R0sO0010S ;7='0:7<0?70>78T0S,0 00 0<0 1, &P!1 R  P 0 0ZP 0S 0097S0 Q0S} [[YX  SS000 00bJp*****Dd*<**D*h**D|+*DE1E*gE*E*E^EEEE*F0FOF}FFF@-2Bp`WLM LЍ@ pPk  pe 000121 0S<0 ?!tq(% ( 0R0 0SZ=9Q ='/?@#b!"/p80S 0#S 0(60 8ўpp 0S 0#S І從 p尞p 90S0 00 0 0ğLЍP4n堞00**p*MbGp*FF0A-Pr@L0 @2T` R ] B P2  Q  ,\00EE?AA?1 R$!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 P 僅 b0 PP  s01S 0 #T  +p  6P\P000STRۍЍ0*^Gp*|+GG*00@-$M00D 0-P@`4`$\4Q00P4@T D40S@ 440S@@$40SPv40S3Kl 3 e3K$Ѝ030SCP RN|PDhX `3 0 HrP@-50003 & `P@#R000- 00 0嗞CP  t;P d2@P  H 2@,2P0 S R0S S @T% 1Ao0S3 1o10S 1 P5caX10S  P01S 0 0S PU P 0S 0S h01S|% 40 /|+/ /s+r+r+s+E**G|+Gp*G (|+HG*x ***HA-MT8   ?$<8<(@ 0P00(8@@P8@80$080SP 8Q  Ѝ 00-S0S 7 岝7 嬝770SK040080<0x7t 0F@PPdGA` X P8 PX<7,06~P1,@P7`P0 P P6Qu AQ ,0 p,0000HQn w r0S h6 80sl<0smLFPR0040Sg00Sk5$  0  q 00|S  0<P,,0S;L5@540 +,,0S | x5H40,0p,0PP0: S 4 84 n0 0,0v4 P4 00S,  P 4 000S!@8\@48@0ST4@y LTPҚ@00S 0 000 4 z(b 4 R4$g4R P 3S6<0s <3`V 30S 20S`2`30SBr, 00CS0~,pPa U㈂S 00 0 0 0CS,0"p,000q002`001!P h40S 40,3/0,0@00@X1 R08P 0 SJ|1#0 ? 0!$V $P0000@ V,00@ $000@ 0b0 0 0 , 0P$P00 K0#F8h< d,0S 40,3/0(* |+5 *0|+ **** H5Hs+s+9W**p %(|+//=|+*20@HG/ s+7|*WH++gHh*|+4*HH@-EM @, 0 0@_$(0,0D@P,D0 , <@@P@;0 0;00o<<0S?;0SW 0004 8 + R<00S0 @0 PPKN|p,14S$X_P $00|S $呚P/$@10SR -0 SN $ T): (1RS ,1S $00-S0S : !:$ <0S $ Eߍ,0S P: 40sj80sk4JP 0000Se,0Si9 9 9T00$0S  T$ (T/00P90S 0 S$P$0 S$*P$D 890S<,9Q0SP[@P=<0S!0S' T+80S (P p 88(l80sSp8  d2Pw00S  <'Pl0`,,0SP 7 7 R0YeV,1SC$|hP!7,!(0<7 <7 (0xp(0Йp 0: S 0&0&0\7 R,P7P'PP;e$00|S 8$(#((0S$ ?l6,! h6 600$ ,((0S6$6R P x6VL6PU 50S 50SP5P50S~ 0CS0<0S 5  (p( Q$,0%p,0(0q(05P001!5PL0 SE4R00S 00(3/0(0,,D0St4 S<Q 0`40S 0 4R qp Xɘ%&0$Xp0pw4P@$P4  0|vkpP$\<0SC, 00CS0,ppe WD0Lc0D0 W(s=s 0 @ 0(@SsP`n T00 0(0FsPa( 00CS0(pW P @`( 0@#0 ? 0!$U0  S0  , 000CS0,p W@0S, (00@ U0,00@ 0 S81(00@- s, 0p (>WD!000hwwe(., 0pf$P01 0#l~@D `嬘TD<.00S ,/4$8 (0S 00(3/,(* |+T *0|+ */*****p %G** H5H|+*|+Hs+7s+(|+G(%*HB+3gH9W20h*|+=,*&IHBHHx /0lD*QIoQP@-X@ L0 X lP P~@ 0  *|+^I@-@0 !ЍI0 Qp@-P,@P@peP @m% - BR0 R  P R v@-T@0SHP00 0R  *|KK*@-T@4SHP04 0R  *C9KY*0P  @-t PU @W p`W VN ^ Q/(n%O-@p`$M T oTP $ЍO+T @@@@DT#$Ѝa$1  !Q@ h QP $ЍOa 8S 0S P0 0pP  0 P AX 0 000 03/0 00 +T:*C86LZfKK(n%L1($Q!QQ% Q( Q Q QI @-Q Q("^*  ^    0!R/\^^ QQȃ((R ( R (@ ^@ "^  Q(/(R ( R (/*t%p@-H0H@8D0 (8080$8P  Up$80*+**@-AaM(8S B0 S 儖0)DD+ P p p( $8S 80pP U 0S ,8S zB (8S HF0p 08A 8$ 0p3/48S 0S 1 D0R <4 Ѝ* *+%PL444 L P/@-@P$#P  NN@-@@0sQ,00p l0Cot%*O-5%0 MM00/ t ,B0 @T(0PPZ@T= P [ 4 0 0 l!`Y0  0㴻P P@ !P@0I04 4 $ 0 0#`应`Q೟ P N  Z#Z3000 0f#塔` : FZ 0f 0T#吔`< )00< 3f0 #0` U  S  RS00 "1f 0;#;Z0S;#;0 d)"?;#;0 #5;0?;#;0@#5;DET"M0`Sf Y0a 0P[ 2QW"0 P OP@P ! 0!R@PƮ00@|!fU` 0f0@R *0@V1@P9@,@*@(@&*s+j+Yj+j+/A-p`P @uXP0  T  `00T  t0@ R   `FVx`00CS0 ᰾ PpTL000`000 0 ST00TT%TC-pP`A@0尐T6  00@)ax0@P`0 \2L00D P 0 Ѝ*+?*TT%TT**O-MMP @ 04`0  T3@`T P 8#8T $ 30S- p Q pWp p@0P00E.002 P E"|tEPtoލЍ |pp0@@T o@ np@ To010PS  █ 0$ 0/ 0$ Wp@O80$S*F>C0S  zX$ (0Q`$0SZ=9Q =)/?@#b!"/0 0p70S 0#S [0AS  T0 0000 0.p 0S 0 0 p@@q0T4T okP<00 *T U:Up*Mb>4p@-@Pp@ņp@-P`L@P@ 00P@ 0S npKvoU@-@LP U@-SPU@-@Sp UP@-@PV*V0@-PlMQ@00 00 T  40S P U00 P L0 0A 0 sPIcsPI 30S @@@` < X P `(P@ 0S  嘼@P@ e   P@Z TN T 3V 2 @0 S7 x@P l0@P/T2 P 02 P ԅ00 PU '  P Ņ0 0PU  zP lЍ̇/m0S ,@P@$ [0S @_P@ MT 11@T  0P 0p`VPP)000Np0 0 0@Q X%P@`*LN9***233oV|+TV%0TcV&303j+****>*+**j+j+7@-P 1 Ѝ0Q0S 1 1>P !-0 CRtA R hS0R L1P 0S0%,S 0P 0S 10S 0 0@ @0 @0@0 @0 @0 @ 0 00S 0P|+*s+|V*i**X*V**VŬs+s+s+Vps+ls+VLs+Hs+Ds+s+(s+$s+*00S@-@0M, U 0❵P0S8T۵@0Ѝ0@ѵ*7/-A-}}PPl1LAd1T@3|1|}|-|+|0!P0)}u.d|||+{@| U 0S S 000 *T d   T l}t  10D0 S B/o" R  0CXXw%9M+%XYY+@-M{P Pppp p{l@PL\܍@}, HP |܍,0 < !+>YЍ+PYoXw%0@-MP M{P%@W0@SۍЍ0@WP551d dp{PPTۍЍ0@|@ 5y| , ۍЍ0!+fY+nYPYYYp@-P hhA@PpTTd}Pp@8@|YYw%̊+p@-P MP)P @R0ۍp@St`/}@P`ۍp@|T l! (B(R< < 5| ,0ۍp!+Y+YYw%YYY@-  )z%1[O-P4M$p454p=0~0`P@p0 p5%$~p0G$t `V V  Q$0  P 0$404``HEB|? 0l$l{d5P\k pTh P`T@ T88u04 U! R ! R( ,ztS)`S FSJ (9S /S 00C7'pa0CSD C D C hE C C XE C C C D C E xE D C C E E P{ES 0SvePS03@WPz RPd M@Pb 2 vP:00T2 PPV  PR `,PPA |`2!00:L2 2 0 030S@ 2/ P' ",00!0 0 ȡs0,P   1 T T@0!0!!00PP@ 0  R 1 " l z0S 4y00@T0T@0 S090 0z(G T+x+X+Њ+̊+7 t A-U0S7P@@P|x0Pp% /Q4 d Tf`PHeDpM@u0S+ 05  (5@$5 5 5 R- +5 400000@T ,P 4 @Ѝ0400/S@yP v v vd\HLxPH 0SfQ d0S gp=0c gp;0c0S00: ndP|s R  0S \3Q 30S th: hRdPX30S 2Q P Xo2: @7dP 2 : /dP 2l!: 'dP 2 : dP 2 : dP t2!: dP T2h,!: dP 42L<r> 0޾4Ѝ0`+w%@-`0S@ uP0S 0000q20\ @^`+`7@-0Pl000@h R R  l R  P4Cw03/ Ѝ0Q Pw%c0@-4MP3P4Ѝ01<18C8S sA 0 9 0ko Dpq<O4M0 hq,0E R ]q Yq8P 41PP n0(0S"=Rr00EShg g |g g g g prdr`\XT HrKw%Dc̊+(%PccVc[c+b!aclc{cc@-0 q@2̊+c-@-R[0 R   ЍЍ/ +-@-B[p-@-A0 R   ЍЍ/ +A-ARp`P@1T ppP`@DO-dMP@ nPn0P0 0 8,@(P@  p P @ `804 ,0S[  R>,0SUXM HG P00P,0o0,00娂0000Uj @k xk k k k l ,l ?@d To00 S @. @ C< 9p0ЍCo0z%eef'f.f(%p@-MoP! 0: S0 0 S P@` 000vЍp mp P @TPT0dHS 8$     +4fP^ ,KPX #P1 2P 1 0X00\00`00G?000x000020"00@k  P0ЍpnP X1 KP4 P. P ,1 P 1 K P1 K P+ 0P$ P 0 P 0 P! 0P 0 P 0  0 0 t0 h0 \0 P0 D0 80 ,0,t++2,7@- ^lPP@0PS0 P xP0S00UdPPP dd0SP0d0(Pd Ѝ0ht@t+ mJ0@-@ ShS0CS    $ , (S 0h i0 hЍ\XTPLHD@~P0ih0(t+!$'܏+@-MM0DP 0P00P00m5~{x u3P000tS ä0000000P4PT L4000,P44 , %P004P00430S 30S 4ST4STP 0S0P0 0S P 0S0P0HP 0S00$34P 0S00Tb400PP 0 00404 0000404 000( 04t04p0$0`PPTTPd D25<P`Q0`S PgP!wPpPQ0pS   BPgPta \XP`L eRPP`4`K0PSe 50S 0 ލЍ04,1P 0S /t+*V-0%"8^+Y4+0,bNw+8+33>W;`D+6`9;QMxJw9Ccu^+@-T@5SH00S< 000S 05t+Կ+hQ ؿ+ 0 t+hQ 0 t+hQ 0 t+hQ 0 t+hQ 0p@-0x@Sp d00SP H00SP 1P0S05pؿ+t+hQ Կ+(+/@-0 @ t+hQ 0 R/ xt+hQ 00S10+ 0 it+hQ 0 bt+hQ @-x@5 h W5 L P5 0 I5  B05t+hQ 00@`/Pz%p@-@`P X * @ $ (   Ept+hQ D0@-0S K00ET@YKU@괿+t+@-@05 0@t+@- Bo 0 t+hQ A-P/o"`bp2qp -@P UA1p PU||PHXU`X8/pL V@ P@T*U A D =QhD t  0 0A.0 00S/ᐔ+pp@-@ P 0s  l1@pHz%O-@`嬐0娠T$0P ?990 VYvT00S[   G1 RP 0g@ꐔ+˜0z%P 0S  R $ ,0/8<//ᐔ+hO-騔M`VЍ0(tS,  RQ0$R00:?002P?00" 2Si@V !sr% 0S 4 30S $SeP 4 0 40@!0`000 00 @ ` 0 0 0 PP00p @@0,t(dvyf`p{V0 Z$4SR@ 4? 0 qp0dt1 0Cw RQ%0$0@R*0 R    @ @     "  @@04 S*0MPf1 qM   10S 1[0?0S  9f0$ $  [ 8dCB/ᐔ+G-pP`@@P#0c  BC.B 0$0-Bd P 4040$rTG{h++p@-`PUp4 @ P@ D4p PdT 04p 0 dd0@p@ꐔ+h+ 0P/ᐔ+p@- @@0S p@P BbS .S 00CP U2"cS T- P:40BS ꜔++*p@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0SP@uR  @@p蜔+Pz%0S- B 00P!P* C\/p@-@P& P`PpQ P @tPQV`b-PPN0Sp PppTz%{%B@-lddPP0P 0S .40!0`,@$!$Z3dPs@Po@Pk@P@0 0  @P0d-P_-P xZ-PhU-P LsP YWc+Ù+ovP%+ 0/᜔+ @- 01SP0t  Qhha`R @ !P0< 0cQ 0! C꜔+b͙+љ 0S 0S 0S 0S P////// 0S! @-@PPR0 0`aR R S R0/@- @P< T t #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* @!A-!@RQp0p0!? Q0*=#=p00 !f?0Q 0*--p 0!? QP *!p `!\q?`p`ĕ @?@@꜔+0p@-P@P QT4@pTT@DQ`V D@T0t0S :@꜔+ |% ؀% Q 0/᜔+P@-44_,P@P @ $P 0 b0! KP0!T0@T0  T03:T03:T03:T030# S,,A #c!4,!0S ,1 ,!?   $C͙ȕ+љ+ %00P0bA @SP//D%A-RPp @:`jTЍ`lP 0T0 0fPL 2P TP00T0 0+s@-) @P 0S PPЍppP Ѝp@T @P 0S  `(00 0PaBLcGOkp@-@pP Pd0 S P @<` Rpb@0P  XeP P / as +s@-P@` 0 00 BSЍp@-P`( @p0` GC Ѝ+@-`@ (8R808Ѝ 8 0 CS  8 0C 8q++p@-@M8S.0 0S R(0 (SP8`000 0C?URX B(0 8 80C 8 0 CS Ѝp 0P.+؏+s@-P@`8 R8 R8SЍp 0d 80 S08O) 8 0 8 0R0S08@)+؏+p@-p@XU 8PE`V` D0 p8Soppp+p%@-P@`8000 00C?UR 0 R00C8H1Ѝp  0P 00S 00+؏+7@-@8 R 00 (P 00R0 8 80 8(80S  Ѝ00CR80S 0Sʹ(08+؏+(080S @-p/+p@-|P`@l0 R(0p0CR0R: $0 p00+p%s@-@g@`P@T  @A@P Ѝpp@-D@0S PX 8P 0 pp+p% $0 ((( ( 80 /+p% 0( ( ( 0 /+p%C-@!ĀPp0S Ѝ @`0S 0S  80 8808' P tPlP (8 (0꜕++7@-D@P@@00S Ѝ0 P+0P$/+0S/p@-@PP` P ,@20 00P@@00p@- @$P $8 +O-,7,G0PS`M(X. Q008(X 8" 0S0S  P0S08 Q00((XʔP  PЍ0 80 8XU080H?oP20SЍO$Q 5Q' PpP0@S, < 8 T d ` ж $ $ ȷ , ȷ ȷ  L eP 048048XPP0480488080 SEC0488S0S S 8S0S S lj0488H04880S "048z0480480P48m0488S 0S S8Sb0S S_8SY0S SU048,04880 S$80 S E80?08<0$48X5X3` @R( B WH`X  EP` [H80S 48PS8P (]088 }80 Zt2"8Q WD 0`48 D(<8RqDPp4@P 0480 QZ`Z ` 1弁 0 0 0 K Z@P@ 8PX@ 0"ST  H,P 0`px%t%0 ,0R0S/0@-MPP. ^@[T' p z]P 0: Sp ;\\ \]X L]HD 0]4 Ѝ0@ Ѝ0p%9Wxgt%%@-@0 700000  0  x0  h0 X0  H0 <44@,00+ȞӞ hA-`0P@@P@p/00j 0S W @T T A0+֞9p@-`@P 0Dirp@0+A-p@9 `P0  P0;0 A3  f-0@P    P  %X A 0+ڞ@-x*@$p@-Q@0%S!S0C Sp Sr\  h \ 0C Sc p /S 7Sp!p@,,p@0P S+S@ AP Z0S0pp 0!00p 0p@ 000Sp} p@y.0!S P Z X00Sp HPDp@h00`Vp$:p@w$p0+p+4+YA-%P Ah0qp   H00S 8P8@Sp` u p`H++(++G-@8 eC T00P  00`p|| 00ST V0 000S T82 +++0PP/0+@-0 0$ Ѝ%p@-P(0S 0(0lPp@j0v%P 0S S S p,P `@,`Y?o2(0pgp0+@-@0@, , ( 0+p@-P(@@@Tp8T0O-e`TOT0P?P0$M0?00]0 !0 S - ?0 S V2,0S4-$!P I P 8?P>0S U P s>P \0S80 S% W,"(80SeVaPZeVN0S4 S2 S! SN SL U UQw'*P "Y 0S:x"" "/S 7S00E.U S`dP$ 0SP0 Pd Pa 00T`P ?V *0FcS 0  t   h d , H 4 T  P 0   @ H 8 $  p 0SP0@ _U0 0Si U U00L Z# 0;0U $;0U ;0U {P+U U !UR00-UR000@0#P  0 a0CS00 0 P s0 0 0P 0Sa0@S @P 00Zt 9" 0V0@0S" aEQ0<)s90U 90U 90U 0S3 PP 0 /tPUU0E S񟗧 8 8 8 8 8 L 8 8 8 8 8 : 0#0'*U @U !U<80S07S <70S07S| ;07S0v {P 0#0CS>/P;l0 pqe`Q0 S T'0!R0?0,70S ! | e`0 S &0!R0?0  !R0 0!ı}60S!R0 !R0 0!ıj !R0 0!ıa 60S!R0!R0 0!ıO !R0?0C50S `0 S 00\50S 0 S 0   Xw'x!R0 0!ı en!S eR0d 0!0<0<]P0V0S 0!ıH4 KH %$ A>T40S0S+B @ T4 qP+ 00!R0 0!ı;030<0!R0 0!ıt `0000!R0 0!ıb``0008++̿++7 T hjt+@+ǟ֟h+(#/̏++Џ+h9+ȿ+؏+ +j+T0` PN P f 000 0.000  0S  y0 ?0P0S 10S 10S P P 0 P'gT1P0S d10S p10S P P Y0S % K1P0S 10S 10S P P.P0P"% $P.0  )!R042 0SD20գ?0/0 \"0 S00C0 2 u!R02 0S20գ?0/0 "000Sy 0 p30S080O?00S/᜕+p@-@P/!pO-pSP@`MP)P80 `0@0 Y:X  80#1  X RH W0H 0Ѝ 0S  R  P R  AR  QQQQ R  X180 R    80 TP UdZKI  P R:p@-P\ HPV@^^'P gP dP fPpdpT ^gP PP0  0S0A0p0   /O-PR p RPP @䠟PU4PP0p0 Ѝ S@0|0`P`@0 W0S ``F0 S0S P B0 0R R@0B @-P@t+D @-P@x+d 0 Pt+ 0 Jt+7@-dP@ BPYP 0S  2P Ѝ0t+G-,2@T @Ѝ`SPSU P0pS@CR`P 0@uqplS uSS?Y W ^S0 R MR +R GR  SR 0SSk SER SnR0SdSPX0EP` 0 @vT cT eT @ Vx@T@ @ ?   @P4++P7@-@P KP P@ `P (@R Ѝ0U)Ơ@-H@qq (  @ 괏%C-P1M0PS; 00S7 00S@/ `p P@P  0@Sd@ 0DSd@ Td@ 0DSd@dT P PEUЍ@̏++Џ+@-  srlP 9X@9`V , olR000 00 !Ѝph++O-@`PPPPpᤠ夰0F R ЍWpV R  0A0Pp@ U  PPUP@QpP RpPꈏ%%p@-@QP v0S R SppQ0 QA QR P/@ PRP/@-@P h+P/@-p@0@-M@P2_@QP Q10S@"PaP! DP OP AP dP cPoP qPdi^0|00SQЍ0 Q0LP 00qpQ00@\+V0z%G-pM0S @0PS l0`S  HP 3PT|#80  0`pP 0S ~PP200U t2PX0hR0@p T H2  4B02P 0S IRP"!! 1P NQQp:000S Yp 1W10Sڐ`Q t(P00 X P00 =P PW  P;PPTЍPP00S qP{P ``  YP Ph+d++H+l+,+X+p+(+ hH+7+P @- 0@h+00@-宾P 7 @ꈞ+A-P`XpVPU@JTP0+ 0 h+ 0 h+ 0 h+ 0 h+p@-P@@P Pp@pp@-@K~`PPpVU Pp PpC-@M@p ἐ @PXЍ`PPPOY04Ps0SEh+@-0@0S T@h+@-(@0SP00褞+%@-@%㶹0P 0sS@ @G-`dyd@p00CS0 Op PP 000 P U 0D IS  WMOp@P@- 0P>GA-@=0 0pR`@0S00 R0S@00`P0S U  TP@00ꈏ%%O-MpG`@ P1!Q[ Z@P[@P* 00p00 0HPЍPP P : PT0T VP/P  YMP00pWpꈏ%%M@-@:`P 0S PP Ѝ@w:@7@@pH0H 0P0ON w@N Ѝ蟝9M@-p`P@ Ѝ0S P PPvM@P T0P 0p0O#PNPN@NNcG7G-p@`P@ 0S JP@0S0# CV* UR@ R %S #SP @# C V* WR   R %S #S 0P L@h+d+p@-MPPލp@ 0@4qp `,6N `P|` 0S:T  W0S 0S   M 0S*PwP@+C-Mp|1P0S ~s \1RPMЍ45@P,A 1R@<p9p6p``0000 0p00N M밐@@`V /7`MV @w0SM 7MMP4+]T%%f}{0A-0S@`@RP0L N@p`P{M@xMvM4+1G-0S" 10S`pP 0 |R@C0 -R H|P P(F@1 PPP0 cN B` 4MV T" P uX%X6MP vT@@P@T 000d0@Ѝ`4PS@v0S+4+00S/RA-p v;`P% 'PڔЍA@P=@:@@@P0 M@LT ЍAvЍ4+0@-MD P0NP@@JIDOoBLЍ00@-M2@P0SP i@JYK  NP_@LЍ0@T@0: S *H@J+A%Q%@-M@NP͡0 00oЍ/9M@-@P P0@/R00S0+h00S /pp@-qp DqpP@ TUpp蔔+@-P0P03#0 R/ ꨞ+O-4`p@P08V `20ST20 S/ R 0200CS$0S 200CS QP :8QP .`V1 `)[`Px0Z0KJY)Y @ PVL1L H100 ut 010S1 10000 0000Sqp@PX  PPAP qp Z / 00 ЍO+ `V ꐏ++(+|%+8+h++ȢH00S <0P/000S $0@///᨞++(++'G-$@p`P *P@T 0@T@@XJ0ZsP`X G dTy T 00Szꐏ++G-p` P P @P qp@PV00SЍG0AdP0 00@ЍjP@P 0qp@P ꔔ++A-p`qpP@VЍAm0  0@cЍ0P  P/ဒ%0P  P/ဒ%@-P@p@-@PplPO 0S 0 0@S8 00C0Jp@J  B 0h+%+0/Ḟ+A-pP`@T07@=0 "0UP00 00(@0@000 P @   0S 000耒%+P// / /00//000// / /O-@P,Mut@PЍ30Su200 ?QuPp0p P^%a`V0TDp@ P P``0t TV 0@SPm!! g0P@_ P10S 0 P00P *.t10S``V P PH p ЍO(100pW r 0`P `V˯[: T` P0PPڔ0[00S0O Pp@PT0@P_@z0 7++Ȟ++ܿ+ +Ŀ+ ++O-@p,MT0  ,Ѝ@ p20S2T0T0 002000T000PP20S CBP U U P PB p 50 P=P`lP ap 00 000 000$0 0 P0$00P+H1 D100%* X#* 0 S$0˯0 {pP` P0 -P00S00S 0 0 00S00 PXH00SP 00 0PF *C++Ȟ+Ŀ+ +ܿ+ ++qpp@-@P Pppp 0 P P @0@`@@PP60@p@P@z%H8z%O-PM@`P"@@T K0000 00 `F=0  20S1 ЍOopP ЍO" 0s00U 0SqE Wm 0x!`F0p!0`!H0 0@0Ѝ00Z 00S 1 0000@0@ 0qpP@ pqpP@ P 0`000 0 000CS% d00Si`H0`0 0`0@W̿+آ+++(+@-p`qp P@P 00S h0 Ѝ@3W0 E@P80 ), Ѝ@{ p`v Ѝ̿++@-  Ѝp@-CP p@d_ }P@ qp@`  Bp@@QQPpp@9+p@-P@`P: P pXP@000S  p@Z̿+A-`pqp\`qp@PA40 P0T0A To+@-04 ,    00$++,++@-04 ,    00(+ +0++$1Pp@-0` S@pP@SP@P%P`P @@R 00SP 0S@P R @@Pj00SP ꜕++O-`剀OE@KEPTPppP wFT sF ߼ ڼ eF cF  @+@-xt@P 0S\00XP 0S<00   ;0艣+P/ 804   $ ( , 0  R 4 /+Ŀ+O-ap0PS$M1A0S 0!A   W  R ! W @  000000S FPPP  0$U/`P 04 `0 `04 4 Z `J P0p0PWP1 P#P3*0  Z0 0 Z Z`S ``$Ѝ e  a0+Ŀ++@z%8z%e*P 0@-冯P/+P @-@P$0uP/+O- P0  V1PU(0S 00011C0SH(PꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S 0(R0SH0 Q0H @`ʈPpP "E E"ETP0(0E7PH00C10H00PP(0+ ++ ++؏++@-(@(0S&>C0(0+G-tAp0P 0P0W0S %> 0`S@U `0PS m庫P 0QR00 0R 00S W 00S0S 0  00 0   0P00SX 0  00++ã؏+++0 0@ /+d0, R X00S P@0~0/0P 0/ 0 /+п+ 0,  /+qp/G-`P@Psp p倐x X 0 V 0V 0U@00CSʠP FP 0Q@++PG-P0P`Pp̀@ 0@D P "V 000U00C@C@y T dP0 0C J0 Q@ @D 0@DRC++80P/ R/0 0S 0 /(+ 0 R  +ǣ+p@-L@ 0Sp0dS 0p`$P `r PUp 0(+ߣT0 0Q 0<0< (., 00/X+(+X+A-APU  ^%(`P, `(,, RP0`VU, ,0 0 P ^PQ p0࠱ P 0(+1G-P0sUPP@PP0Ap`@`V R0 XWA V$ 0 0W PS 0)P ` AY0 0 v W0@TP0  0` &qp .@PWP tA ` W0 0M0  0`qp @TP+(++P0G-dpPU !R00 RS@ U W0S Q0*P @P P`@V0 0 0 /0 00r  0@P`Pl`@W 00 H0 00r  0@P`V@(++G-`T P@pl0Vs 0SP@`A P@tu TUP萏+00CS0 S0 SA0 /O-0P-SP |6(Xz?p)?X?Pp?DAP0S0@ 0S 0S%@T >>?S??+nX DB / 0 ЍOx`P @@ {@H 0A ( ?>9Cw*4+G-@` $ PP( gpPP )@yz  0Z`p@7P@-  0S 0 0ЍP  R `ЍL P008 408000000000ꉏ%%*NP @P/ 0 /XD+0P 00/++@-PU  @ Ѝp`@fPppQ 00S0\Q0S 0S@V ~P 00$Q00i+@-0 S 0*( (; Ѝ * ;ꄧl+@-@ #薿+P/0S/P 0  //  04P/l+ 0@-4  9 Ѝl+is@-P@`0-S0 00C  S0 ` T00V H`  0@0A ^T00R`Ѝp蔧O-P$M c4P 00S S03/040$Ѝu40 @PDsDD 0 R @@-PG 8$PP 0@03@ ZFdaD[@T[0SO+P080N0 P 0+S x99P/Pz@0nP0Sn@z@-P00 0+P0P0P aK[  0 0 @ =RP    B  dfq000000 CR 0G pG HG G HG HG HG G 0U?o 200S 3/P^ U [ RR00S4@:0 S 0uP,00S l++p+ڧ@-@PM @PUp`0@ ЍU  x  B U R  )00 CR I J 4I J 4I 4I 4I tJ U0S U3/U@pr 0  W`00SXSX 00S000JU= U U 0?o20 0U. U U V `Q``Q`V  `R``R`0ESU U U ; 0S0 0 hiPS Ud 0  @0 ^000W UBQmب+@-P`@000C S p0A` V0NS| 0CST00 ЍT00V <` 0S ̔ 000S/P/++@-`MP 0S H0 D@0S0S  0  03/$@+% 80S/S/ 0CS/$긒%O-@0MHa  R S? 0S 00 ЍpW/$` 0 @PP 0 AAQ-P $ UQ@0  U @@Oo0 B Rp 0 0S X 0긒%@- MP 0!    a7 Ѝ0|@1m7t00S P1T 10S100 P1U0S Q0#S 4++@-4+@- z Ѝ@-P<8`ᆭ@ჭ@@p0 `H8 ЍA-p`0y <0{g@P(y 0g 0TghyY@?p@-?Bc`0B$T y`pd 0Wg (0g 07gKyЀЀQ'.A?p@-D`DP@@Tp80 0S6P 0P pt%<+(++p@-PP@4S 044`40 R:0 @0 4p<+t%;+p0s@-@@d`D  X0 Ѝp0U4@PPL+<++@-@@PC-?O @T!p0PM0` 0㞬0 0 f 㖬0@pU-00F`I4Ѝ0C-PpMo PoF 0 @ )R(0adU-00D@I4ЍA-0P@MPЍ%P pj@0p0nS sS dS  {@`D@P O @-  R$00320 P00S@$A- p 4@0TP` 4 0@T 00S0@0PS h00SA XKP0@00@'400S A$0 <+(+,+++x%+؏++p@-@Psr%j 0$p艚%<+p@-`@0PS t00S Y 0@S @00S p 00S 0 զ(+,+؏++0C-0pS`P ҫ:000 Pj@-l0 /o"P@@P [5@T@U S5 ЍP +8+@-@P 00o/C-MD@ 8@Y 0 0rxY@`Y LYK #BYf DYF  @aIY X` p` ` ` ` ` _ _ _ _ _ ` ` ` _ a _ _ 8a _ _ _ _ La PY0 P00QQqpp40SPL0S > P ; Pe4 P3 qp P0 PPYs 0 0TY@AYhBIY dd H_ c dc c H_ H_ H_ H_ H_ c H_ H_ H_ Td H_ H_ H_ d bI0 SMY Jb b b H_ tc H_ H_ c H_ H_ c c H_ H_ d H_ H_ d xb H_ H_ H_ d Q0R 0 )qp  82~P0$2 R P B?የf %qp]0[P P01P 14P 0 0 S0:P0PvP40 P \ 0 0 S0:0P SA Pu pDPDD0P,|T+h++X+ +l++<+׆DY0Sꤚ%l0@-@d00SOoBL0L0AD0<00A400AA9 0 $++T+%؏+++l+(0$00A00A0A!؏+++% 00@-  0S RP @Q@ R @TP@S@ @  TP@PT0@q100s@-@QP`@ P$P ]10T0 ᱧ/`@姧@0T T0TR  QЍp s1P  h++O-MDH RQ. `00DPH@@0PE1p? 0@0JQZH0 S50 S  0 000H00D000  0CPЍJo ^P @AZ@pPh+%0 @-oP/ 0     /h+0G-0@S ?PT X0 000S@t0 qpp` m @00CSꨞ+h+L++1O-`wv@ !00S ЍO00S @ἐ00CSZ# ЍObqpP Z S qV Q @ Ѝ@z%8z%L+++@-4@cP@ - 0?o2 0@nh+p@-@P0pP0h+갚%Ț%p@-@P800 p UT 0Spp谚%O-$!#ut$ `100@_0 rs Y0 @P0s00V 0S (000X 0 00 :000P"qp P 0"ut R0 @P`000@_ V0`p80?V `Vp ` ph+Ȟ+0@-MXP @tu 0 P Ѝ0@- 0 00S@h++A-0Q@Pc M 0SFPI2'RP  /P20S 0S   Pv|r0S0S 0S 0 00 0pP`! VN8qpD1( Pq0S 0 0?0Sy10SVJW 0 Vda~|XJ7S V1p0X  ~| ~|  Ѝ000 0000 0 PP`` 0U0C?o20S 940 Ph+p+h+1,+++P@-(匘$ 00000S@y +4+@-({$ 00000S@Ly +4+@-^(i$ 00000S@oy +4+@-@P XVPSHP@LIFCy Ly y 1A-@TPP1 2*' .,! 0@ `Pp!0S0S 0` 0?00Y 40 (00S+Ly +؏++`++A-` pP@ᑢ*0Up0P Ⴂ|*@-4@P $0    0 ,%+O-bAMM5.p,W Q R ;@P Xb0S0000AލЍ0!S  PA>04S S S0\0@S  0 [Q0J0S 0  C}  Q? 0   ^R000 QR S$R 0C000S0`0000\R00000%+O-pQpPpWCM Cߍ@tcPSTp`3`#`C \\Hs PZ PUA (3T 0UpP 0S @DT2P@ ᝡᚡ @@ 0 X 1+ BT@ ++T@"0S 000wP @B?1P SQ@ 4 Pp 0Q 1T TP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S P? ^0p0000-+%b%+P%gDv0@-@ᱢP媢P |奢P l堢P \团P *P*%@-@P DP P P(@EꚴO-P1M0SM A0 ЍOm` 100; 0p `wx@PЍ0S  0 ~|00 0\ 0P 0S0S S @P@P+++Ѵ0@- LLPR^0S @T 0 B+%0@- LLPR^0S @T 0L B+%0/+0/+00S /+@-)P 0 Cw+/@-H@ p P10S00PЍ+FP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-P`p?P@P$ ?0P0T0S@ s@-0P00`a0C@S@ ( ( 0 ( d ( ( ( ( ( ( ( l  ( ( t ( | ( ( 8  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 g \ [@Q`V1!0 g[0F?o[\20S7 @`^V`00]QQ! ]Q0[Qp.GQ 5 p`0W]Y0`QV0 0 f\Vp0[W` W nW \W`Rp0 V0++Op@-0Pt @R RP D D <@D@ p@, @P%++qG-1`Q@P〡 ``0pW 0 p*3PI H1@@1`0 (Nf\W R T R 0 0P@ 0 p0 [R .BQ  [TS[Q@]R  00000T[@T[T@  ST  SR(0 R Ѝ+++D+00@-00M/SP M $S, +S00, 0 0 9S$\S @P0 0 e0IS0@S0 Z00ۍ Ѝ00@00 S00@++͵O-@ MTЍ0tS bS rS aS @{S000`Vp F` 0S0QU 0W0 0冟P 0 PUP @0@ `0 0pe2pPF'+|+++O-`?eMM蟟_0 PXV4 ?/0 Le000 R?/0 | \ T?T/0 X R  Qꔒ \ ܔ 8 (  R @      R @0`00`S 0S @@@#S ;S 40p0 @00 岐P % P 0S @,S @0S 00@ P 0S  00@dV = -0 ,Tp` Q> @}Q ;Q <,0 d \ @\\ dB0110@\SS838#0 %=pC P3#0 x< @P 0S 00@0( (p$ppbp2p"0 0, ,q$p W 020"0 20S$000 S(0Q 0Sy @;S= }S So 1!0 0v, 0(0, 00 0U Qp#$p000p WH(0S  $p Ua , $ppXP (0, 0     囱!1 !( 0ə0 $p,((,(p,p|  +P%+++ A%s3߶i+ 7\:+#A+ ĸַB{:h%ɹA++[0 0 (\<0< 0 L"a00eݍЍG-@`@[p圀P䘐U@T00S Jl0h0CX0 0S0 0 " P+++|+0+D+@+p@-P @%000P @pL%@-@ 0  @0L%0p@-P`PUp$@P 00CS06Yp @Xp0 X+G-p`dBd 0S2 SQ S$PUVP(00S S  $P$0, `0000 00!v#PQ $00P0T00, PP (00S(0 #R nR0V ,0020#00$0,0$0X P( T0R #R nR   PH \T000(0V0(00PP P 0\$T 0\$w 0(0V0(00 000TPr+7}+@-@X0  0S 0S00CS0kXp Xu0 o+O-(DMX0`SpM00S 0S _3#X0X0\030 `00d0XSXP 00CS02Xp X<X u)pP0 p_0 X PލЍP2 Wp0S "0!P 0!P  p4S "!0p0p4S \PP WP } 00\0!P|p0`0d0S00d0000S 00Sf "P00 2 02>_00S +&+嚆 P0 -_+0+0J\a"J b 0x!" P*_"\PP TWH#P\e ( p$ I!\0p !C! 0`PS(00"PX5000.|0\`0P l000S S0P@ 0 P00 00 l9(00(04+%c?,+$+7,+Ļͻ'99W@-@GP ^P@-@@P ^p@-@PBPp0 ^*@-T`@PP g  0*p0 * Ѝ,+@-`MQqM0S000@03 0@P0S K! 0\^ 0 0S S ` 0JlV"@P *0 ! PV 0600ڍЍ0+++@-@P  0Sx ^ `p\0 `  {:0P S w ^ЍЀ0+;G-Ap0吁0`PU , R:(,=0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0   J 0 0+P%A-@P p0R`*W00 * 0P P 0O-/MO00PЍ080?PU 0PH0\\e R7 0SP?0 C0R 0i Pi PS4 0  PS>0@oP 0 R >0R*$0 0HP0S40P 0 R 0>0R >0 0S> 0RR0S0S4 0 S=0@oP 0=0C>S񟗐갿         4 d                        Ȳ \ ,    P     @  ` H   d ؽ H  \ L0 R: L `0p嵔0080800400SX<; 800 4\04 0b<0S H0S]P80S4PU 0`  E8P080 A E4 }0T P 0  004 0 0  0 ;840{ 0 :0R᜚ <00s 垌0P 0S (0S 0L( P2S 0 Hⓘ` 0S0`V: $ 00@ 9@Ƙ0S = 0[  H0$,P x0 H$0`$ [49`0V:( $[ X` 00C 0 0P0 8 0R:`8  0咇 `[ p |Z\8P0  R:H`HH8K @o` (1 S:` 0   0 8Z 0R7 800 g04 0P<0S HqP0800 $aP80STg04 0*<0S  80S0p4  H `P <000F400<0؆04 <0S V 0400<0(6 800 xV04 0<0S tL0 R: L 5 `0pX00pY R  Q P5 50Z4000  P 04`Z Z 0Z 000 G 00 00 V,дZ0 0RP  0 0 0 PQ@ `VpX 0  `F0P  ßH`pL(L<Hp(L<(0000S c04 0L<0S ` P/ 000Q00 0  0`Vp P\   `VXp0  `Pa 80S0s "p0  Z04 040P0 P 0S 00P80S0s"p 4 040P P P R0X3@0`pL<0p<q80Sn4Xk 0!p 0`R l0004 0V^*00000S(0!0  ( S0  0<H ! R0]P0' 0+0+`++++(%T%Jht@i+ߴUY+_H+ 7Y%++F+`+0 0K0$ (1 0X`PH`pL(<Hp(<x0h0<0 0R0((Q 0{Q  +Y+p@-@P`Tp0wS {S sS 0p P 0 D Y0`@p P `7G-pP6`}PV00X01@ R P n0PW(AGU !R <BPQ4 p \ p   X    :R 0SP0S X00 0P00 0W 0Sp: XPP 000BS ᜽z+p@-P0@0`T P qP# 0S 00C?o2S Pp0S000S000V0V@+2, 0@-MMP+@P  P;X p43X+  P)ۍЍ07H0  BR R R /%%@00CS0 S0 / r%@-,A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@hb+0-01S ^00oS^ P0\ S0S Q0S R P0S0S00QR H,+0@-  `Ğ\ @ T\    %R    +H,A-\A0 5S <0S 300,!<,P a q 0U&%0 ! R8  (P  0  ,P  0  4PP rAՃ00\P P @ 00, PSH, +%+p@-@0` T  t;d lP`PT p ᗂP000ST @%%+Ӽs@-@P <Pp<@P-@0?SP@P` |p Ѝp/P@-LP 0S S @`0S\00vV/@-V4 ]%@-0@<TQ T00 I0001S R0Slp@XTX` T@0$ @H4-T(8  @,$+el%H,s@- 4 T%7@-@P  0S 0@T 00 Ѝ00"S p`@-@P  p UЍ蛾<0p@-\PP%0ATp \ 2DR "@DzwAp0h% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//L0L 0p@-P@!@R0 U0 ,َU001pQ,D,01//00/00/00/00/00/ 0  /H6,J4 0  /H6,`00/00/00/00/W00/00/@-@t<,00/@-@L, 0  /tK, 0  /tK, 0  /tK,/00/00/00/00/00/00/00/00/ 00/00/(00/500/@00/?00/J00/g00/!00/S00/u00/`00/TmI)gb@-0  0Ѝ@-@  +@-S, 5A0S04c@-+@-  S,e @- 0O, L, @-  B,J( 5A0S04c@-L, @-] @- 0q?, t<, @-  s;,. @-  r>,( 5A0S04c@-zt<,< B@-rTK,< @-  jQ9,< @-  at:,< @-  XS7, @-  OS7, q@-F|K, e@->D, e@-6D, e@-.D, @-  &T6, A@-K, @-  R8,  @- 0H, E, B@-TK, @-  Q9, @-  t:, @-  G,$0Qa A@-E,@-@DAP d 0CcBY 0@-0 |1<Q, p@-,s;,.q?, cB?,@, ] @-@Q: @ L X A50S04c @  2P t03S |F Cl h hd d`00S  0< L,B,JO, cBO,P, R8, 8J, @-@ Q?\  A R 0$b @<   B ؈P \03S x Ch d d` `\00S  E,G,t:,Q9,TK,H, cB3H,2I, R8, 8J,p@-PQ- 8 A50S04c p@t l/ @\⊈P 3S/ C, A. pS, cB Q A8 0 0, ,( (B /K,T6,t:,Q9,TK,Q  $ 0 F@ 80 , ,(00S  /D,H6,R8, 8J,Q F, y$ $ B /D,t:,Q9,TK,Q    ( 4 FD \< <8 84 40 0B( /D,|K,S7,t:,Q9,TK,Q 0 07( ($ $B /S7,t:,Q9,TK,Q Q QA /  K,T6,S,cQ Q QF /  D,|K,S,/00////00//00/00///00////00/00/00/00/00/00/00//00/00//00/00//00/00/00//00// @-@0@+@-@0@+ B@-TK, @-  Q9, B@-TK, e@-D, q@-|K,+@-{S, @-  st:, @-  jQ9, @-  aR8, @-/08J, B@-PTK,0S00/ @-  Ct:, @-  :R8, @-.08J, @-  )t:, @-  Q9, A@-K, @-  T6,A-T`)qW 1@P |A倂0 ;Q,A-@PP 0S v`/P  &/`1S0dP /P 0p RW  /`@-@P;K P | m0 0mm000A-@`\@*T<0p " RG\<0d$N R 2h%@-@ @K@-@@-@@M@-  u %p@-@PUP,HPP( *abP , 㕑,Qnp`MvLvnH@ Q PP , 0@ S< 00p +,h%O-,M@0P0 T; R0AT{ 011!0 S01  R01;cP ,0S  R3/00S 3/[1P PP n0P 0 0S_`: p` 0 011S`@S0` $0vP$0p^$0P``PpU$PeUP$0S000 CL R RڰDPCPE_ C B R@ R.c 1  pdP\ 0 `p0C0CS0V`0Z `1Z0Z c 0 000 0i 0 "P P V`x 0CÀ  S CUPPEPE_P0 {P b 0 00@0 PTG͎P On1 0 z 堀 Q 7{:!?@!0CS T @ `!0 R$P0g0w0\PP7000ኈRP0!R0c !ġ1S 0C" !8C8R11$`V,(Vtpt0 zP v+z f%`P 0PSY &I 5fn0 an i+dd7\ Pd50xPe%>kHV S0S 400C`$aH1Sb !0C B/!?1!1NSRPNQ0^ B08C8xP00S11:zP`PxP@a@1S/020* (P$J @@P8 0@S$  @  P d3P?P <P >P PP P [vP P1QKH P y~1S'ʰ1 P ]qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P +%w,RSP%,L% 001/ +P0 R0// +O-p`*@PP [ ! \ 0P @ Ѝ000 0\"<P 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @ +P/D0 R/0@-A1 P yi@< 㦄 +O-Bp0  W .l0p 0009 Ѝ`(Z 0S yrP [00010P@P 0S 00@ Z 00 XrP [0S [00000 00` Z0S >rP [ [ 0 0 00U0 P0HS0SPP!r0 00$r0S r+C P w[PU n0X!0C0S 43 000 PE_[4+VUUUP% @O-,MPZS  R0@ 0Tp$T` D =0X0 0S 0h '|ikj@qq q 0P@0@00t 000$0. 0DSDU0E0U00ө?0U0 CR C 0ER 0 0kqY 2 lk 0  Br4BY Pp} PC ! PZ P P# 0STkpD EhPE@ @kk,j@P0 0 2P? P AP7 0JSI1000 C 0 E$ 0\h 0$@pP1Pp1 W 0p00@0p00@pW E@D;hPE^|pGT@D¹0 X@P f{~P@U@§$0S 0 B0KZ00000S 00 0 0?{,ЍO)0XS 4+a&P%%A-pP`Pp `p@p@0T `P@ P P00004+@-P@Mp 0c `T` P@@Ѝ0 00z 0 0`p @s^Pu ,@P  %4+'Pp@-@*TP0Ps D` R :P 0S@@A@p %4+@-@D00004+0yn4+0n4+-@-@00   Ѝ@ Ѝ/-@-00 }  Ѝ Ѝ/-@-  } ЍЍ/@-@@7@-@7@-pP@`M,0 0(L  0 00`Ѝ@- ЍYO-,M `p@Do@oVrT0 0aP%  00Z`b 0S_ L00S[ c}P``L00`T`P0s@DO@00X 7 pPTXWpKЧp0 S0pK0 0t@PE0p00 @`T0 0P0 0L00H0T CY  u Ff)zAf?fЍP00Z00S 0S |L0PPUP#P3PzuP 0 Su뜰(JI/h2h C0 F0HdtY`p JIphh4+ ,@-,, ($ "ЍY@-P@`$0 0 S 0 00`Ѝp@- ЍY@-pP@`M,0 0r(6 0 00`Ѝ@- ЍY-@-00[  *Ѝ Ѝ/Yp@-Pn@np4+@-7@- <@tBr$CN\PU m% pqM<00h@PU ]%T `q=<00000S$$ Ѝ0L6,cG}ED,EX+%EO-`CM@PP LqL P<Cߍ@ &@ f⺡0@0oP̐`V { H`PX [    噡  =R @ᐡ@ +y `{xSEg%۷1@-b0O-MM 0p@%x`P2 |PP* P GP 0S0 0    :PtPT}P 0 Q0 0CPuۍЍ70P 0  0  0  E,00S/ 0P G@-D,Jk'-MM+ v+L i+ v+0i ?P  >ۍЍJk0@-@M 8~1@@#P @  P A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$*@P3P/\P+X@P'@P# 0P ˉZ@  0S 0_ Z'P @P0o,m& )l*00D,Q,JJ,,@-@M }0@@?]#P* 0@j  bP 00*!R00$Q #*@P  [0S 0` 'P%(&*ЍD,Q,O-`M 00[#*0S ` 0B00 SS@@@xp @(0 S0 0`0@x 0 S:uPP@ B 0p00Q %Sg0S iSD %S* dS $$0T !PsS$200P 0 倠ಠ@Z4!@ P %Q0@ 0S0 aR7 cR 03/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S  0! S 0 @S$SS0P @U:U 0 tP%7@-@ PU K! Nm+800 Ѝ0llP Xs 3!L m 6m|1( 0$[D,E9W%J5J@JYJvcp@-@Q`T0000P0S   0p@:D,L6,7@-@ PU  l700 Ѝ0PP | zld00S b|L 0H[Y|0 ,c L6,}E'eJvJC,vcJ%s@-8Q`@l>mo[}s cglochh cg=:gac:}i 0 An@Pxx?9^P DTDbb ᕇW}Ѝp,7;%JO-M`Pp o 0 0$0 T"p@5 ЕE  e0S  $^P R   R0S  \$IXP *lHP %l^p@T Pb  V 0B? $0]I$/.P  6@P  |600hxPXxP]; P  4X; ;0S ;P ; |00|3$"0ߍ[Yk3 <z 0~"!031<00  <00!0\<0(    \00 P,0 0 p~?"!!03  PM &p WU $ |WvT2P ||=z0S$P0 T0  (SR $1P Hk 1 X@U$2@tPU z2 P~?0WC( 0P 0[0 R0SQ ĭk0S EP 0a{0SP @ v 00TP@@ $2@@JD,̼%ptbtJf@L6,D,LJg KR8,KJ!Kz `PWUU S Y 0%S @S, B* BGx& 0.R> 0 0pP600Zp@P 0A0 0H! P:iWy00F (ASz d_)dtV L_y2h@0ЍO Ѝ/KK-Kjht@,%K0@-CMlDPP 0S .Qg@P 4/pCߍ0 P(p \+[+G-p@ 堀堐PB`AT:00Z W ,/Z 000 fP EQ 0 @KP%A-`Pp >p@ w ,po kP@Z+A-Ps@sopl o0S DQ0Q.SP @$ $*b &b\+[+@-M 00PDP W o 0PDP I o p@ ( -w {o  PUx@J*  jo```p @*PPЍ a a`!iZ+%ix+Z+8i(+C>O-MQ fc@Pc``0S srV:=80$d 0w-B$0B. o eE o0`Q>d0 o@400Ir0 ,nP40,   TTr:@WR?, 2p0/mp x#|3 R0:P'P o P @0a Xn on@P  inP@; 1sS1lSD;"00`&a`P UP@;ss@P,Rn*0x*0wt[sP\8 0\8TY0 yV *0z*0}\8t*0|q\:VT* Q0:$DR@* , Q9ʟP \ʟW艟^ 0/HU>H B0C   BPT ,<T@Y Zf0X649 @p A\)0p 0HAlp H0S[, ,)A0$$ (@P @0 H0@H0Alp AA`LVp@hv8 Tu! HPuH p |0P p0 ?\6S 0 S88@P =5( +(%" [7S |G0 P~0'AhA\@P G@P 7T'TP\804'8\8P$G 8,m8  dP0&08P 8Hm8 4cP00 60&S\880\8P 8m80S X&8P 8l8 cP000S\80\8P0S\80\8@n08E010 ~{qP qP |qP lqP qP HqP 8qP0:4X:4SU 0 PM 0$AxP!@6Ờ4SP  0@?S @P xl 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   ![0S1 fpP 2@T renxHeHp#0l0S T 0S `"8do/3S3 V\ #C?00N?C0C ]M`0  0@F0@`VP;A?;p@`x080C4r@,0,_P$pQ0S $o Y0X6W5S $ ! aoX9dXF0S@0 <Y4!S< " 0 t0 Vo iLL6,%L%HLzP%%`LrL\+DJ, oKK'[+Z+++Q,K+x++tPLpZ+vc'LiL+'MLLLLMMM:MHMKMPMeM;NHNTN+NOOO*MMMgjMMSP^PiP-9WPPPPPQX++Q3QKQQQQ[QQ0X6S/\+P 0/pYC-鿏P@,MpCpP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍcBQQQ@-p`CM|@oPlP#d0RXPP @ W<0080 `0(PCߍcBY RTK,P:, R L,@-@) @E,@-0  0 P @0@ T280 /P $  ЍPK,N R8,C,k0@-0@XMP70  0@ P x x0xP t0E@(20/Q   LL {2 0/R@, ,@qЍ0\+N PK,R8,E,PJ,kA,@-MQP[o@P  >j :jލ0 00S@\0\ \}@P L0 (0< 60, 1t:,'PJ,Q9,A,T6,K,$RxK,WR@-bCMX6S XP \8lP)XT20S H22\6S 8-2020"(e2PPr 10 :4S / |\@aU 10 q:4!SO *00 0 Bfxc||22@P) k1l Y\VTSDP0S 4!4I,!,E0S  =  9,4P7\6S 2/U ,aCߍ 0 B\+`RQ,PMZ+mR9WX+~R+RKMl+R'RRLL[+RZ+R gR+S;SOSRS$S0@-P@ T\ ! 0C @TR 0\  @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-p@PhM 0S'hЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/0 \ P0//!01000/ 00#0//O-ap$MPA@T k hP00 ` 0S 0S0S$Ѝ@-@MP M{p! *0 `p Wd5\\ SS=S 8 d3R 0 ,0 ڍ ЍTT TTO-Pp 0@0M'"pPP r`ĐĠ0 R ! PЍ 0L03/P 0 8k놁0 2k  @w$0S P @Z @Z`D,-Tp@-P`440@0S- 0 p@.@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 j 0j 0@$0S @;Z$0 @6ZT `@0Z @,Z@j0S0C@ ,$@ -ЍD,BTja7P P00 S lS, R ,0S R : 8 80R:P#3///@-M`p@ CPPЍPP TylPTP0 pP@$U@@=T @ @y0 @PST`aTX0S/p@-P@ 0000p@ O-p@P|M YP+`P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 100,`00S/0 0T1 00 0<000m0tpP <@D0Ep0 S aݍ,Ѝ\QQ0GoG`FhP 0000!9`P 00S 3/p003/NaV $P 00S 3/p $aV P p0 PP pxb.;9/ 0 PPpxP;".5/0 #X R1   U :c0 0uP`lqllV b +PPY  D}PQye+"Ub^+?"PPi!hP# hP hP hP  hP hP UxT aU  ]UP (u`jV nQ,R@J,T>}х7\'aVT00C-$q0` MPA@P00  >C0 1/P0@0 @P@00003/Ѝ003/$gTO-PUMM.xx`@4P6j.z2jQ_8Il(!XpWp$[ Z T   70.07 00P00@\#Pz⌗40,[Z4S =U?h400C2<7\4=1 W =7h400C26\4=1 0 00  000000pp  m044040s -14s[w0 00 00000 0zpp 0440]40s -1tPw003 E "a5@ UݍЍP =2 ,XL=1຀P0Nc ⺀ h \  pw00$?00[000ӧ?&N?`/'"T4`, 4@ TP40S N?/$"@T4pWH4 0}10  A ja "ea aa04 1p$ ,01(.8,40001A  B6$1 (11S)104 $q,0(84q,0$1#Spy 0 0t ^ pWn ,ܒ@p#s0H$100$4;f2P p>؀Cl $10'0$10!H00: 0 0G80C0(1}1S 0}1$1S!> ,! 6$40`040D,,% R7@%Q,@J,p:,D,YL6,TYPP  (00/0@o//BO-@P MMAE0*!Rp0)Q`U0 $0 O  P  Pp ,}* (0$0 5$(pP l4\,a ܍Ѝp @4 S40Spp0 @0 4p0SW00y , Rv  000x;8,9/Pc 0  x08,;*' `%^%\%0S W%U%  UލЍQ,V9WL6,VVVVYBWbYWD,X+XEX^XX~[VdViVqVxVVVVVW[``VwWWWWBVJ4XXXXXXKMO-@AMT MXp P`L @P`T $wP```PP@Aލ Ѝԃ̓C̳ @3 (4@$80DP@<@T@X FP \>430$3 00 12 $02(408@Y P j딢娂   t20\8@d2@DDAT P2P"PP墶#P <2 8%PI,2 $ '20)ATp !0 P&!)%0 Zx#P@0SW K0S0@4 000@0x;8 8/P6  %P ![%@P 0   @$$0 S@pW:p@(XBVRX`m KYYY*Y>Ym m۶RY<xY(6,VQ,7qY0p@-`M2 RЍ!,^0P @40 PP@xp0 ;87/P  dPB++ $0@-"@!P0(@+@-$@2S I02+O- >PPPBJpPP   1`PP ^P@Ft$र@`V*~ ЍD x+P *P    R0SP pPBNDP%R@-@00 vP Q P 0YNЍU C-PJMM pbb 8b@4PTdHP`YP8 Yo`GFWI A`P 0 000!00P < 8<1P <08 <@XNo<0S0 0< 8`PW 40,01@ 0101@00 0A00000@ @@,b@0S7 0S'8JݍЍATP0 8 RT<0$!QQ@0P 0 003/@<08 S0 S(0S 0S8j(0S003/@<08 S@@J,X Ⱦ%[ 0S/p@-@P` !a(0SQ 003/@Qp@g R 0@-@`pP4M0S4Ѝ0 0L03/P 0@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> ~oY 0@o/b0 !!/+10/#_p@-@4P0 `Z1111p+O-P@p`АРа0* C  !0  Pa0+S   +S 0P,SR0B `p@P X 00,0` 00000 Ѝ+ Ȥ (  0@-P@M*._a1( 00 0d0@00 0T0@@@81 0 000@9P( ߍ0$ +O-P`@p4M 0Sp7P pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+   Q 0S  KY0 0P  P  $04@H0080pS,000TT0 0X0$0\0(0`0,0d0A- +R 0  0S 0  @0{0t00 00S 0 0&0P0 0`![0R@0O b 0 O  R*? 01BVa0 ,E)Zq d@edA +Wh(Z+p@-@PyP p@#pC-pPAK L1`90 < #R `)0 S 071DH<LHa@YDP YU `1<P1 YU `1LP1 YUP1 `1YU`1L0H `8 ЍC(0(0`9`90 0+KkYYP`@-M@ P @oЍ@-| 0S lP \0 T0T 0PP0\L004 80<U( Ѝ ЍD,.ZxK,t:,kPJ,a\Q9,A,@-t@Mhl900 0X00. B00 0Gh $0l !Ѝ+p@-L5@0P Lp@;SZ-?@-P @  R , 0$@/Ѝ0@ Ѝ/gZZ@-0  0E P L0L L@ 0< <@x0 $@ЍPK,@ R8,kPJ,A,-3M M T.=P0  4ZP Zo3ݍ Ѝe4-3M M =P3ݍ Ѝ00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PDy@00( (0P,qD,|K,ZxK,S7,t:,Za\PJ,Q9,A,@-0  0 P <08 0440U000 0 NЍt:,ZPJ,S7,Q9,A,0$ 0S/ /+0$ 0 S/ /+00 0 S$0 10 1/++11<0@ Q !@-0 " !/+0 10 1/+@-7Mp*.\( 0l0d 060 P0008 0g@(97ލ%$ +0D D *Q/QQ Q/+%@-@0@ 0 0SPЍZ@- @0S00xK,Z0@-lAMcd@ |T qP@P@00 0p9,⸫/MKAߍ0Z+S,[ [@-P@ >0P  7ЍD,-@-   Ѝ Ѝ/-@-\0X0@P D  Ѝ@Ѝ/'["[KM-@-\0X0@P D  lЍ@Ѝ/'>[O[KMo[[@-4P P P[[[@-@7WP@ d#oa@-0@XP$0  P00YB,t:,Q9,@-0@XP$0  P00YC,PJ,A,QA-@@1@#PP1P#T|p|` bP (B(Ad##=B:B::\A\,C,7@-@P @[ 0 Ѝ0[%[0@-EMP@ lS KJP0000U ($$0p:@+Eߍ0S, +5@-hM1`A JSV@1`p 0 !R  )K<w!0 00 000H0 0 00 00 00`0`PPpHR0H2V!KUp:` JX (R(Y(J%ߍ[+S,vc \ %/\Z@-@P !0`RpzWP PP t 1P`pZ T.)01K@0HPZ@T 9\ Ѝ+K%@-@< 0@- 0 Ѝ0@- 0 Ѝ@-0@M00 0000 0Ѝp@-P<@0*SpQ WPp@%@- 0PP:,TK,O-$M@p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$ЍF\YH6,vcD,I\xK,R8,g\O-,M@UU$PHapYPi $Hp`V30S` 86UppGWT X1X!XX$ 0 `   #$ 0VRR  S  R U 0BPEPB$H0! 0$000 0  $0 VSS00P0#02S `F U ApT @p$ yH`,Ѝ\\A-`pP?@P!T hPP 6/eAbG- M$QHAP`pP Ѝ0 0 @`0 VSSXP$ 0H-@- 00Ѝ Ѝ/  -@- 00Ѝ Ѝ/4 A-`@PMMP\ `\`ep@ F43T0(3T$$c3TW&  0So 0CS+PDS0)  0s 0S9 0S r0S 0S QN@/P% 0 `?0 P@oH2@P 000C?o2h70 o0`F(D90SލЍ!~h7SUPg1Q! @F?@Foh!H1PM0 H 0M('  0S 0S| q0Sx 0Su QN@HP  00 @P_F? Q. QFNj+]ik\\:]S, ]\D,|K,^]k]+%g;cB RYE]fK,T6,r]Fcc-MM P  ~P  {ۍЍ]-MM P  iP  fۍЍ]s@-gP' `PbP S%`x0S X  } @IP G@TT6Ѝp]x0t+R/ @-dt+\0X}T0PyL0HuD0@q<08m40+]R,] W,]R,W,uS,94W,P@-@ 6@0XC,p@-@M L(@H@DW0 #,0@@,0H 0@Lh@Pp0: S (HrOP xO tO܍p,W 8WA @@^PP@Dڸa <TUPP?8 1!\8<7DQi \1 08808@TT OoBQwP@10S nu < R t00 00000 00l0pP@ m(vt(0@A!t:,QPJ,Q9,A,8, ^\x D,xK, O-0CMSP0q `@e0!`-0`SPW!000 @@3/@P CߍW! 000Z 0SX 0 @u{T W  00 0  0S h00S X  L0W0 ! ! 000PK,R8,RR,^;^7d^8J,^+7@-PQ@0  R 850 000^ Ѝ0-S  ^^O-HPUM@44Q (V U$ğ0*S^P3s0샟C0`*V`*# 0SPEU@c A@ UPtLP \JXGLD@1 U(:$ AP;P $ 0RP P ^ 0 10S 0S= 0 1S900 000S NP,0pG00 0&2G4V 00 a 0! 0 0R R` 10 1000pXR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 .UQ U@P@T Tt {a\D,^R,%+^&^5_a_}_____`,,^PK,^]A-Ph`hp@TUTU *P  WP`d%7O-@MMp\@ @P vPP6P  6#@ڍЍ vP vP #PPP #PZ/`P5 u0O LP0=S@  : ⿩PT P @P  ꤠ刐P@ @P K@JH Fw[7-`/`/9WS*0p@-4 P@S0 Pp@@-G-`P4 S@T$ `V! p0F&04 p0RSP pPp Pp40Su p jOPp@V/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ PmSP  p@*@-@ (@A-P@p`p0S 0pp RA05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0epЍP9@7`勴p g}p ^ X 0C`NV90 t@T  \KPLP <P @'6EQ}DpYU`}G`@-@M M`p;@ p  PpR` R`ۍ ЍA-@P RpP` P  0QP|d zd@@-@M Mp;@ `]p P0 @R`VR`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPM00/00/4\80S0 S001/\80S  00@-\\@!SR0(SS QU S!0$0S\  01p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q  0P!SR:p040080SS P Q408S Q0  040S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4  B(B(Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X 000/O-0@p 4MEPPp`+04ЍO$0 L03/P Ѐ0 P p* D@ Z[H * R T Rp L8``pp 0SD0P 004Ѝ, [ 0DJ,O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R0!S,0S p0 p002#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/P H L  O-0s(0M800PS`@p0  p00 $ 80s!3 0Kh0@l0S@3p 0d@` H3`R0000ЍV0V*8q @ 0L03/P 2PR b0 0 0 00D0@p,02 ,0( {KHL( 004 < qK0(0`( , 0< dKP23U 4t0p 0P0,080SOP0 L T00SH0S_000q p0,0 8 T8 000 000  i8 I8 00000PX O0 88/MK0 PpQXQ Q(0 00 40p`[`\gp ,0a X0S l^ 0$0p0 0(0  00 408p` 8 0x ,D,a| ,CaY[aC-hF`0pSPlM^LJ0S0J0 SJ0S_J0SJ0SGJ0SHJ0SIJ0SJJ0SXJ0S@J0S(J0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 lЍCV ( cwJ0SWCW@L 48P Q QI0 \3003 0J0 # lЍ3003 0J0300 0$p3 0I0 0TS(0p`@  0  SH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S pP`@0  D"  zP0  s R>0  H0L0  H0L0  H0L0  H0L0  H0L0 p{ H0L0  Xt H0L0@ @m H0L0E (lЍCd !SH0000%0P pG d 9/ 000(0W0 x ,yz{}~ H  Y}aaB,D,a  a( t aaaaaaaaaaL C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``U0 0pp07/@-M0@ 03/P 0 00000 6003/ލ@-`,MHP E@0 0 0PP@00 RS THP pW JP00P00P0,Ѝ @T@0/W/0  0^EH P00P0P%0@-$M@D0X g 0P 00 00a0PH0Dd$Ѝ0aO-%,M@PV `c\q pT^pHZP`<< ,pVV !R "2 V pP P`!V$U3b$U p 0 0 00% 00 0 0000M0PP X,Ѝ a\a( C-40PS,M80S,ЍS S S !S S i@P `p䐟`$`X 0 000 00| 000 0 00 0 0M `PhbD  ( O-P@0p (AMP U  ! `<#0!(p<#UP <qP :D00 P gP 60_0P0ZX@!T 0 0 p `@ABGA0  0!$C= @p0  X!-3 P0  0!D)P &`8GP@!@3@1GT -`KT@D@`0@@< 0 0K-K0 0@`0P .㨠嬰l 00@` PHAߍ!0P0RPNYB,x ,*beb;O-d5M0 04`00 0A000 00``` SM0S 8@P 0P40 0H03/0PSp,0` p p0C@ 0Dp000p`@0St@P p1x'x0(11PP ! B B2P"Q%,0/ ,0R B/"J, J  P8pP 0 Rp#p0x1Gx10q000ЍQh2  0@0D  V 0$ p0pC 0@D @00ZD 0S , S00000@3<0X ∡0L0 3/ 00X00=C0H048 <0/?$x+U 0S  T0Pe0 000H0P0 F0PT0S x AP 0S4 `Q00Q0S 0L0 aA3/P Ȑ0 0&003/f0F0P ! E 0 >( $0Y(00$0 S(0 0R0$(@0D 000@ RD 0S8X"a` 0"0'000 x H 0>x 0 \0  0> 0(ӱ 0>Ȑ 0 ɱ0l010h Lt0hpI+H-+ - ? [`*pV 0 TeU 00 0\T e0 4TeT0P0%0 Q030#Q0S ,0 A, 2FMkp 0$&(?00P`3/ !0P`Q/V7P S(0 0L$0 Y(00C80 4-,cp@-@P0 p@7p@-@P`@ qopc   @-o@-o@-o 0P/-,0@-PM  0PPt( :@ 0PPL'D֍P08P0ύP 00Ѝ0@ic1,c@-`@A-A0J?`V=p$X"0 bPPЍ p> C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$aQ,9$0pQ@-4宻㖵 #"T R0//s@-(@T@ЍpH80P40 0003/@P偻i/@-tM-PP@" @a0 @p@P  /0@T@pT 0 @ptЍT|0t dl0l p PP L @3PK,cc d1, dd,d(6,9dGd/@- E@BndS///@-0@Q0T@o?0 \ 0P000@-@4M0  =P0PU90 00U0 00  044Ѝ01,//A-pP@`|VT0S0S H:PH0P$1U90U0 00X0`p@d1,0SR00/p@-@P'8<0P4`" 6D0# A0$!4pD,B,A-<`P@:Pp( 4 A1,@-p@-@M @<0 h厺0S X&`P0PP0FV 88 0 $܍p]^tK,xddd1G-1`PM@PM/1|!1x  pqpql`PdL@<H0 [ߍ B@P B]B?7 p4@P 0=SB7?A@ B?@T@  P 0 hd,P L [,<  \3[pSvcdL6,ddd71A-1P@*PM/1Xp1T P`P`  P  <0, ,,1eL6,3e e#e6eNep@-0M0-000`00P0a@P @T 1X 1T1D 1 SDP1 1 ЍpYae56 0@- P +C-`CM P@ `};P pܐ܀0 `0`90S1 1 Cߍ5S  |up pP\ ``X0S  @810 1t<,es;,6X,eeee fG5Qp@-P@+1 1  pS,1p@-P`壸@P埸0 p@*fp@-P@P P.1 1 p6f2p@-P@11(1 P.11 pEf@-ĸ@6fG-@ZM,h:T+R@`r夒T5 TH Tn20$0@TPp"pp(`pDBhP0Sg Sa  @: 0` 0P@QP 2']PP ZߍP ԿFP !080 05P |!(t1X ( 6 0T( 6 ᪿX0101L0qo0!(P PM?00P0@; +F; 0 0 & F 0  000 h $@m%1,WfS,s;,t<,X,D,/affL6,f27f3,,* E* A-P$pA|@P a-@T 6 Y0qP( 0 $#P  0B* P &2@oЍW\\Nm P+w< 0 g9WL6,%gggCgugggh//O-04pn@T Ѝ@T@T* ^( P@ U [Y  [ XY P$UPE P P@ @$0"/Y,O-4Mp(tZ,Pf@ P @ %R000 000V0 040 V0 40A$V@U0P@0 0 000 0 U000 Q0#02S4Ѝ;0 0Z   R& S  P@0     0P @V0V0 ]40A$V@U0P@ RN RK RH  R ࠡ࠳ $,( [Q$[4UU [ 0Z0P@V0V0 40A$V@U0P@ 0 U00U Q Q 0   }(0@-4MP!! 0  P PP@4Ѝ0@/@-@ @賽gp@-P@/5CP `@ H00P P `Ra BQQ pQQ 0@S:p @-HR0RH #@-00@-P@04MSv!1P4Ѝ0 P*   P +0R0#@"*S Q 0RY,0p@-@ ^T00PUPU' \$ST ^np 2@Q.^U@P@@ $ $ 0 00C 0p0 hp@-,@P70P ;pA-@H`HPpFT00ԗ@"T01 PSD1, 00S@- /1,p2,C-麋XP(p,`0@( 0 XWaV V T0   ߽ ЍАYĐY R  U:0V @ /@T0  徽RhWhZ"Z@-@P 0  姉兼@肼\hahh0@-0@S~0d T0"S  @0<00R( T40 1,Y,Y,G-錑P0`STp@Q 0Q02@1;1':X 4僴pB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $3 Q 0S T v/ 0@1 00 00R"1Y,up@-P@mP000p1O-0@Sp`P 0 PRQQT SL0UȰС0r 0 $R 0 0"60(Q $R30, 1QX#  E vQ 0.0   R @R `0` `嫈 R [ R# Ѝ 0W1Q:P 1,hphhp@-P@P0Sr!U @ p(0"PE0U055403 0(2#p1,Y,Y,40@-0@SXDP0@Е1,A-AP0`SF!U @ p0䀟 SV Ѝ@4 U(0G`P `4p00 0@05Pp0P 9H pQ `00 P/0'p(0,0`1,Y,Y,amh|1A-0`Sp@P0 PQQD R<0 5 2r 0 !Rv?000 RU  (0$0X3,000 1Q\RP 0 00  W1Q:P01,L@- @ⴉ00S T $̲@Ѝ8@nO-X0MSM2"呇\0@S2"`0Sb2"d0S2x"h0S2\"|H a-0ST壸8 80R\ , I0pQSPPTP  @⧣@b`P. @ \00`0d  00h X 뜱;S/ʐu!@0lP@_opRݍЍ RQ8 R 帷0:S 000a 1 00 0 0 0C0 ;0CS||ՁPphhh i%i=iXiri{i9WiiiiiKMj*j^P%i jip@-\P@0S Q0 >q   R@CpY,O-BM MpPT0G@P 0` ;`( !pPjX0 Pbቹ@Bލ ЍQ  0 0\0 `0 00!$0X4X00 $00 0v0; S\ P|喺P +RQ 0P \Q S0Rʨ0S R4 S / S S"0S000000 000000>P 0S  + 0 R$ ? ! 0$ S 0"`0S 0$ edA@jO-$6#Sp 0 .P` ;+[0.p0 d00\ `0h0|0 0X\00 P$`P`l0 (04HO000 00 00p;ri@-`X0Sg0 劅\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP U &0U Ѝhhh i%i=iXiO-0TM,0 0000 (00$0 0P400! 0p @@qPX_ TЍ@`DP 0$0S S H0!$01R < 80#.80< 1#$ 0@\D0 0L R0HL0H0L`, @R0 D ,`0^  $ $0 p S `S$0q0S$ $ pQ ʈ10Q02p1;1':X h(0ž0\CPWPSWP 0S0W0S0G?o2\0S p2 `($0 $0(Q $'/[  0S G v*40p1 0$ 0 0 0S 0S 0$ O0B"1 0"GY,uO-M00D@TЍpP`Ра@D0SW@ 0   0 0 `1/Y  S      Q R  0@0 00Q0 0`p1/P $Y,A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-㒴P@`p1S 3/P P`VUd0PzT0P0S@000S4000S(0000A诶 Y,$Y,8p@-@4`4P0Sp@蟶10S 3/@$Y, Y,0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 P   `‚ 0S0P000`i 00//00/00/00/10/Q@-@@L 0A0003/Pg@G @1 7C-B`0pSPEM;00C,0S(;,0 S| 3,0Sd,,0SL%,0S_ ,0S,0S00$ R!000< R%0pG 8d 9/ 00`(0@߭ 0t)( ԭ+0SWV V V W `W Q 00000 0+0 Eߍ0000 0+000 00 0Sl0 0v+0 Q0 3,yz{aB,D,aO-Pp 0MS 1[ߍ0L00 3/P @0 8 D00S4A 0ST0 0 0 0000P@T 4/@@10 "+` 0+ 0``A0 R .0 00T `0:/P `00S0V0S #+>V F 3 / &>0!C> f`'0 010@0`Y[3,D,Pj7O-PM0@0` P8" ݬ `(b0   S00 0*p!ᬵ0@0 0*!ᠵ00p@嵬 k@^i*@x妬 0 `!儵f㝬 @p0 8!z4哬(!(p 0q`P0 R  P(Ѝ 0p!r0i `Q `OT0 0-p @ Y NT R ` @YB,D,acj3,jj4, [j;A-@0P\03/ p`W@@P@ᶲP80BW  \W[0 V  0  !   0 00$ 1 x    l   C`  0SJCT L0L LLЀ0<D@3,kg 0_ oS jyjj s@-P,`@啳01Ѝp3,p@-0(M0P,03/`K0@ S:000 00 0 0 0 p` 0A0d^(Ѝp0i @T O-@M4,P  PЍ fP 0   -< - p@W0H03/0PS`pH`pA0`0PP 0l S"n?\"2I0C 0 0 000 0A 0 0 0岨儥0S o'00 L0P 3/P X0P`Tp`\0p0 S8墱P 80 S ,1 0, S001z40P ≡0L0 3/00 P0 0000 00 060 000嫦p`@w0S @, 0H03/p,U@<@0 0S001Ѝ8%Q,D,T R 0@-@80q  003/P4 04ЍP2 @-0GM0@00@3/PP$0SP #`p0 000 `p000S 00@03/PPPGߍ/A-@xM`D 44+0Pl00$pp0Ph3@P3 P p&0d$0\ \+T „P 0X*0L08 3/> 0101 00 060 000pP2& 0ⶢ-'p0S 0h 0Q*08 @,04/P,qP 0t00 0S001xЍ8%b %T R O-@0lM0$3/0H03/2P0`PqTW0pZU ``A0pP 0(3/P^ L*"##$ 0H00 40R! H 3/0L8 03/pB 0L08 3/PP; 0 R8  #1/1L"P#0X 80T3/L0 083/p 0倰$0Y 0㙮.8 0!$p  P `(;/P PlЍQ,O-5P0MS J?0SZU 0S\5\%\\||`VM L%@T dV4u45 0,5@0$505d 0F00000@0@0qp`5w0ps,p0m` 㘤80$4@`!0 ` 40 0,0000 000 嬧0$10B0\$10<\0d00h00`@ pl0)00S< p0e PÁx ,p3 000000 000 0 0<0pwp` g 3d,0CẤl0S= S@: SN@`$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS@` 0ST 8@P$2Q \Ѝ@P00SZ 3/@@OoBS k0&00f10@!R|!@!x|pPptРt0S|0X*@I@P TQ 0!@x 0T:x0S@ t@OoB@|0xT: @Q,kjD,3,W Y RY08;T T Y, T o S L6,-k>O-UM< D X$S080L44@p᧬P ᢬`Pӭ Uߍᗬ0P00 P,Tĭ­03, 040S 0R@ <0S6(1SJ 0J ,HLAP4#0A 4 <#H@; $إե 0@PPR @T "2B 00P 0S 3/P,00,02, 0SU@0%0cD0pt d2R墥& Y8P Z㘥,H! L@H@<#pPpT@儥P :, #@ #,0p40#p pp @ძ #   , x v#, 40,0m,0h#P1: 1 !  &zJ @0 000000 0000 00㪢pp DzD0S#0 5Q7[T Y ߬ݬ۬0٬w ٢Ҭf Y,$Y,Yj`k0T ikkjO-p/0JM M`@ 0 ppɬPP+yP) v0S% r0l"`ɭ!`\ p/"20P T 0CT *0C/Q 00P'@᦭m+ P:'?0  P+0: S `Vu'>00ꨰ  mPJ>0@0/S%0@!|+ _ S @P+ S P*]P 0/S`0oo`bS "p"0&000 SV+t P*+ P*;P'@9'@]4Jލ ЍkvcI@-bë@-M @iP(0  @P  P   "88S 00b"!4b4#$("(RSЍ O-M` PPp X`p㴠崰#PЍ0S @ xP0  HpPܓP Xp0   @唫k~k-l^G-|M `P`P PP<n+@P@b 0 Ь@ #٬Ϭ@P/+Jf(J.0㳬 +JWJ.0T㤬TX 㝬PP~D4 ᔬPPu$+J70J.ᄬPPe +J' J?` mPPN+Jtpll40 0J>P 0 .NP UT CލKP@Y+JJJPPp0J.)@+ P h lJ>PR kkkkkkkklklVl#l"l%k%kkk$ck/00/00/00/00/0@-0@4M#|0$P 0 P\ ᙫP0T0760 P嬢 b@P q]4Ѝ0D,ZB,4,O-AAd2M(0!0PB(0 0000m 80sS0`p(00$00 0?00$0 s 0$W h5 0R \%X500H%`I0,0W45 #[ 5P00 0`000 00ԢW Dӫ`4D 0S_ @X%SYeP X:000` @@`r@0S 80< 03/P0p80<P OЍpv'80s @0D 0 0Q:8`0S}0L0` $3/P$ & [P Tp|Gork 0$ Wt @3P3 y0 D Q%0C?o2000;00H03/WH0L C  a& 0X` 0  1#`00;000Q!|  (P R`q02;0H0<2Lp0,!<1H0P``t!P R0$ 00 00S c!P V[0꒘ 40V!P+ 40Sp x, Sp ,0 08q ^ Q  Q0 0 0 p0, 哒"000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`SppD,YlB,vcP%׷Q,^G-QxM|0`Sxpp0 00 P  "  "Ω 0@T0P S"TPu@&x"P@(⽩@@,0STѠP@0(@"尩@"#Ǡ,"P@&(⥩001 0!00( XTPP(!0〈P@0p00+0@080s 0=0 x ( T IXxЍPU PP@@P ~0!P@(\ 0 h0pP@ 0 400t0S00XT媴00P0 PWP@0(l 5@lM @8q 3/PD,lalalmll0@-)M@ᇠ0p \*3 +!@,P0 f*P _- 0 F  .0 0Ѝ0!0P8q0 S+P ,P %;B,m4,A-@  "(0MM"( 0P`Q2X1200500@1081$ 001@`,01000 1800 P$p 0PUp 0S0p\'Pp,P(FA(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0, $  O-P`pp400W)ZYp !!9pPR p 0  0 @p0!Q 0S  008,04 $0T0 0X01@G$, R,R P Q  P 8qT00PR840  R RP  P Z0000 ЍpO-p2M04p@$rP`uPP 0  S{n?2@|1 01x00 0A000 006@llyx0ST(ᔥPPM p(P01ᙑ!P剥0P(0A x 0`R b ",0(x  B!  ! ! 0 008P0h lվ(0, 040x0?o21000Ѝ0~᡾ើlQ,t op O-p@ᤁ夑夡,M0 S0 0000 /00㣟0S,Ѝ/S  /00`pPU0(`P p嘁! PP PP%0(` 1`    0`40T 0 ,0X08`▣0100+ P 0 0 P*ᮥ`D,QvO-pP@\M4 `儰\ 0 SpU  0  Q $0S  0 0$ pFP(9\ЍO*.U P0:0pQ ",^T ^ 08 #0`0000Y(0S`l ` 0 Rp`H03/0`0 [ 80s P\0!0000 SPU0$U00[P 0RP  0 ,p0 0 P  RP P 0$U$p0p[P0P0[}p P 0PQp0[x?[00S' !P0 !:p000 0RP 0 1!ƒ \ 0 0 PpX0 0S(  0R 0 0 !0 SP0 0PU pСZ050Z0* Z%Q Qp 0S S0 0 0Q0000 00000000 \Ѝp0  ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0S 1 `R <$ P` $ $P 0 Q0``T R T  R X `( 0S0L0( 3/P <00S D0SS000(( v L0( 3/P 80<00S (0, S004 Q00 `( sT0\qAQq0[[m8qiP U ^[p8|Sʜ0 :0 F[p㜀  SS 8q 0PUp0pp R 0S  0 gp 0    DJ,@Q,D,^O-`M,p@4 00PVY pߡpPT Pp0Z:`PU`J?ERUA x?x/xxp00#h R 0  80s0`F`pHU p [h0S 00  80spHY pPp Hh0l0 0L03/, 00Y:pPp徢p0兡0P80\>ЍO,p0H03/,0$$ (08RPP0$P(<00W]:< R3*,0pp0PP UP`p0$0$ PS(0(0$ 2"0$,0 0 Sn@DS g0S 0 `p8P0V`:40S00004000,0(X~ $0(0c1!0$8` 0@00D<00< R:pp8`Qp< p 00<<* `8q ,0,( 0L03/0 00 0`VV0$0$ S(05(0$ 2"0$,0P p0a  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0Pr0H03/p0@08P0D00[q*p 0 `<080sa00^ <0 0SX4p0 @0SD0  0 H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00  000 0W 08  1#'04 000P0 04 Q000 p0 C 0 1/@P0$A Q 0 > 1/P@P 0U:@1S<1@1 @0> C @7PU ,,\0#0<8 00'  0@'00 0 X &%, 嫖(姖00 , (0 0嚖 (喖00  (0'X0凖0H僖H0P00T00LP X0X0 0008500 %  % %P,  (P 0 %<  5 000000 000 000㰓p 85P,0|XX& 0HSB(> $P A$ 00S H @3/Xv@DPH0L]!YZY03/ 0 0;P0L0 3/P 00S 0SPX003/PXr0PH03/ 0! P5/P%$%$)@0 Q.p@ ZG@-Q  01/ 0S 2"jX$Є  05PP  0 Hp0  @D@0 ᄐY70Y= oPPlѕh,0 SOPP p@H0 0H008L0P 3/P `0 0`00@80P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000Q,D,Yp408;4 P ` Y,p @ o mXm 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PWV`4Ѝ R00S 0 //O-X`P@ < b"0800 c#  p 002   0 S R( 0S% p q' R Q0 2T 0 < k+800 b"p0p00S    $0!0R!/S01/5,!0 /5,$1p@-S@ x1SP $003/p@x1P$1 0SO-@0`PKMM0((0DpH0S >I @0 0<0o- %"{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,fppK܍Ѝ(2ᩑ(0S*< o !80a&@@ꄐ o'O-`0@PMMhh,00p 0S ( 0R> 9 H= 00 0 <0.%"@~40kP`0V,p0U 0000000 0 0000000 00 p`ލЍ,ٍP,0S*< !,00C#X0S000C0C0000S0 0,0A$P5, o@-@-0  !<$10(10,1P001.@-@0 0! 0O-4M`@(0T`X\d0hpP 2"\ @ @,0;/,0P R7P ᳙Pp2CF p W 2  0 " 00 0(0 0 0w`Iẚ(04ЍO/P4ЍU5p@-@Q- $ < ` x P 0 Pے40 PpՒ <0dp@P̒80 P<ƒ,0 P(00 p!m"#m%&p@-PBMV`@ᮒ w  V4 X | 8 T P嗒 0P厒 wBߍp`僒P00S}0|`x40Ph`r80PSV80  ,X0S(!F@^ 0PV\0 `0S 0@`Ed0Ph0S  @l0S @tp0S@  @PL`!t0P3mm5679mm:;X=>?@-PAMV`@  V( H p 0D`qK0 @0S  3  /8`V@ 0 Pܑ 0Aߍ(0S l 峚@d,0S D 婚@00S $ 埚@j)m*X+m-0@-AMP@0Q*( 4 X p 囑  d  q0`N 0S (0S    ,`V HjAߍ8w  @  q0`N 0S (0S    ,`VP W $0APN 0 PH0 PtB0 P<0 PH60 P40 0 aj7m60S O-@MU M0Pm 00x R# R0p]娥娅qt8`  0@0S D` P `  PC  D)  #pW00(0S%ⷙ$B00,0S$⪙$B0000S$❙$B0+ 0 p0B/̙Pp᭠ C"U0S1 `F` 됣0p⇞ 0S  `,pYV o$ <`婎 _0`0"  Vߍ@喎 0  0S   `pV 偎 0  1 PS !r 0  0N 0S @0S"@_ ߍGH<0040!005@0Fo$ 0DL03/00 Eppqr0S |!0LD` 0S p lp8`Y0a x 0QW 8 <0RFO  0  0@ /-@ 0  e R0Wh 0Ӗ  nn1=Wojan7nnwo;j@-x @K+0 @0p0dZ @~ o@-D @8000(0,0000dE @~ꐯop@-|A`0PsJMd!   01SBt D P \ ͇Jߍp@0P 0 0PP@Ҏ`(PVU@@ 0 (O0 0(0 00@0Ṏ(Y8P(U8#n,P0`0PP` %o./X10p@-aPM,0$0Ps@!   0(✊$1 SP, P ` |  $ 0 < P$1P$\PЍp 1 ,R,0S$0$`@VTPP 0 0ܕ0 000 00P0F07P07X`@P`@o@<` @`@ %o5, X   O-P`0 t 0 00 P0 PP< 0/S  !0⻔ @@ 0/S  ލp1?o21QUx1N0p,!@<1(0@`1?o21P 1?o2 1 1S 1SoIOVTPP 0 z0 00 00P06P6 1S 1Sp`JO 1S 1SP`KO 1S 1S0`N \RQ,XO-,MbPp@gX  㔲K_ XZY  x 8 x @Pp40 @Pe@ ,ЍPp&1`SPe 1S !N !@p@d  0PPp1`SPe 01S  1S0I1P/S <(↍0(0 00Y0SvU `P  ( 0S `P $ 0 SX2vU Z xY $1 0V!7 0  0X!p⸏H1@!Q$ތ1S  0Q p $ ܏'p ӏ00!15:% p ǏP p Q 0, ($!p p $ ⳏP] 00 8a4Q101S/ W,Ti,@J,kYuplpSp0S@0@-S@00 0S/Xi,0O-P̲EM 02@T PP0 2P  |1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 )pPP2@0S- $P* 0 x0D 0SPR,i,q W,Ti,TR,^i,qA-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T  @T7 @pW4dpW1V 82# @ R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0R,i,R,i,W,i,\0p@-T00P DPPp0AS@  1SAp:,Q,@J,0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""(Y,l0\ Q0/\P ^U Q0000@-(Y,0O-`GMM40X2@TL2V 00 0 0000000@@@@ ~0hMp@c<  P G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0@W 47 `4|04 VH0 <0G, ,"B@J,o 5,0@-PDM@T P08 @\ 0@  Dd  0 0DЍ00S5,0@-@DMP/ P0, P\ 0P  0T   R X  0S0000000 0DЍ000S5,p@-@Q`P@M<l@P   T0 0SP@Ѝp@螉0 @00 D0U@Ѝp5,17@-@SWx h Ѝ0!|P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0yP<0 S@  0"{080#{0,0${000@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp!@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $坯<  <Uu $0$ZP 0|! "|Ѝ0Q,[@-80@SP`4Mc00 0ԉP 003/00$1U Ut  4ЍS0 000 0xp 7/( (0 Z]qY0p@-PQ0M0@$ 0x`0 6/8 ͉`Px1ax1a1S0C€10Ѝpqp@-@P 0WP  岉Pp0S@}p DP 埉Pp0S 4! B! /P  劉Pp0S hP R 0L v 4qPppqq^qmrrO-uM Mp0 Z-H0cS_ C#0SSzB0S 㪆PBؒ0SzȲB0S z2 P     P x2@    PP2 HD     Pc00002x @@K @P@ PHPP< ,Ih@ ,D@,1 01P01P010R0 0K000 0`$}p@  Pye} 0S10$1S10 0Suݍ ЍP`HPj Pi1S |!R |㔧P  %5,R,i, W,Ti,R,i,W,i,ti,8i,Xi,i,i,` d 0 Q,@J,Z@-@F00S @PmW,3r@-@PЍp$QU 0 `P PP> C  01/P (00 H$L Q>Q,80S @-0 S/"m GrG-`@Pጐ匠X0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`@8  VT P $Q,$00S U 0 |1 08Ѝp P ቭP P Q 8 ᤺ P u ᾭ <P 5,A-M|P8 U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `pXM@0 803/PDG 0!!0#`' 0 3/P"#"#00 03/p 0` L03/⹬ %Dp` 0SXpH} 0!|1 01!R0<0S P L3/0L00 3/P @0D t0Rv`p0L00 3/P @0D t0R 4 d00`RP  w00p 0Sw`5," GrO-pRMP`b @P D@4 hXPpߍP(   ppn0S m<08 (00,0 000040!04 04$0D0(0P hVphsp 0  DX 8"Y ,Y  Y Y ņp 忆p ?   p 0p?pq8SPr 0  *0*0@0塷  0* *0d@edA030<0M0Y0k00zd@0A-PCMMPp`;8 ᄼp@P  P0<PU00 ## CލЍ /O-^sO-@M M@P;B/$@d`P@܍ Ѝ$ Lp `~00@Q)D@T8 R( (h0( P0D04@tsT.4@0@T50@XsXXT0 0 0A@ yP P vP `  000#؀M~@0B  00# h#00002 (p(00#,P{ X\ 040RPt`d 8<0RPm,u|0( SDl<P p#rPX@h X @ 0p0#dcP HX#DpYP >$P7 #P.0%# D0S(0 D (Eg#\  ( *@00#@#000@6( d@sszssCttssssNtp@-@P # #0S S }V00 00$00(00,00p@-`00MOQЍ S 00W@0u t#0$P (0Vp  P0W D @0W  kW0S U0ąA-P@\^ 0  `04pX T fu0p04 4`X \^  R  0  `04pX ^S@-`lM8PpV0 00! ! 0 ( $PV$8 80R:V u@#RD$ͱ{@PV008P|0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0uetA-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* %{PW000 0 0004P 08000 <0S $0R 0$ A 8< Q\00DJ, \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ p{t@-@ 0S PO-VMM00$ 5%H50S5%P$ 0}PP VލЍ5 $08|%H|PHz@P THz0(,0@D00<0P P {zPL 0 ` p`04L JP 000  0S`PD00000<000<00a@08`0S XU 0 L   q|0U0Q0SpPX X `0S ` ` R|` L|0P40 `hP000W@0<00D0t`\P0(000,040S <`*Pk`yPP H{(0S,00){J` D 00pp<00008``#804S``V $P0pp`0 0S 00PP 0 P0 0C5$0屖 0!(00,00@0. 0D0`$0500D0;僲p0PUP PPTPk|P 0X`vxPPT`-zz0S 4 R 000 0#0P 0S kد뼀8 0<$ 0S P 0$ 08000S`P -|P`\0S0P 040 Q\8<0 Q\   {P`trS,tu6,uScZjqZTZ|d@-鉝 0P 0PS,W,-0,M$00 0 00 00 00 00 0 00000000 W{,Ѝ,]7@-@ P000 00 000 0 0 0P S  Ѝ0C-@pM P`r n0 0h0 00 0 00^0sS̀@ oP0㓔$ p0lS|p@ [P0㓄$ p Ѝ@T r@Tp$G-pP8M(@ 0S  e wP8Ѝ70 060050040030020 0100000.00 ,0 P #00R R 0S T `PP0c# BXP]]$p@-PP@M `8@ @ `  5/V@@Ѝp$O-M@ 8` SFf* "R] R^ Bq/rP X" u u@-P Q@0Pp@P0 00噍 0R0 ! P0"<0?020x 200 2P 02020200@4Ѝt&u8>p@-tP@0S0S 0DHSTPSD  p# @0p6,i,08S^/y,, p@-@ 0(  P0R0PS 00Si fppC-@NMMPp< Ѐe@ @@0 p p`r@;@ PPD rpOqLq 1NލЍrydG-xM` @pᜠ堐$P@J!0@P 0S PU 0 R<\1\!\\>00S 00" !PP0 0S0L0H 3/P HL 0RPPT $0RP 00  x@ 04/@xЍZ Z Yd   ZY < q @ qLv  uqnUA-P`@*P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 0DJ,O-`p@BM MP/0;@( Pp@0 Z@*0j 0#;$  tl P!14"S; [ \pwo@ U01U01Bލ Ѝ 0mP 0 000 Jl RZ0 0J$,{$00p 0RZ 0oS 1 SR 1S  RS1S1S `2B@?0Q 0pSTE 0"0S@0S@@nP9 Ppn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 0 pۤY Ƥ 00pN pLURX@-04MHpL` L1L!LL<P@n@P* T009 0R0 !?020 20P000204 pIo@4Ѝ 0S" $0Q00 L03/P P P003/t4u>A-P2uSvw_10000“b\œ@FҁL@$H @A- P@ \T@@ 8ž\ @T83g `Č `Ȍ `̌b` ` p PČpȌ`" " 0`q`1~``Pa n00`T08BJP08}?0@ T\ Qp`82S @4008 lŽ~?`?̌p0hx0R @Q2T0S X 22040TP 2SXvO-P`\M(@p4000PS}2 0\  \^T 0SQQX W@\Ѝkfb(0,F 0D6!!S 0(0,0 P PQTU Q8b0 RW(4 0 P Z P\ T 0ZbV0V0Z 21 SR 00(040,`80Q!`00 $0rq? 00((2@ 2S01  $ 0iPMW30M@2S P  SR q? r?Ⰰsό(0 8 0 R    X 0P@TP@@ 0S$2$"$i02#38( R,00W? ve< 00 (0$0尰S4 ( 00q?0" 2o0,@4@@P# 80  02 S02@0S qSP >m@D0S 1H R0!0Sq?r0 8 S  o07t (, ^\  Rx0 ,:"0o~ς,ఀpȌ Q 0C0Ʊ#80±W,0]vv"WTdIGluO-`M40P@p0V00PT8T(TT9dPV@8:ЍP  0} "UࠓࠃR^PR\ "ς~Ⱀ, 4  0S 0Z000[ 00S 0PSVX7 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@2r/40q?0840800s (8  R    T R,08 S000f0D0jPD07V50Qo_P0"Pyh0S SP lhԇ 8 @VU 0 o?0 R S+ RQ  0^/ o_S㴒!P% 0 8 ,0 S0000IY0X0\04024 0P*h0S PS kh兇B I )1! R0 2<0C00$@" ^(P0T0^X0\0Ph0S SP khQ0T2S2Z 00CjPR"? 01@22]UV 0w?20"S0 L    0 HL H0P LY0H0PSB 0D  _$1!R0 P TP XT\ 0 S 0SX0\04"o0P|h0S A<SP khֆ<PR#3P8H0 01H2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0{, R0 V00/vguwDJ,UdIO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8N"V0 P20 4  0 P $P "#"#0 0D00 {P 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0ꬖ,O-bMM00 Q@ 00".;ڡ`PPbލЍ kp H6 P 00@ r, W 2S 1S<2<"<< 70w   &      0S!?⧻t  0  d T 9  ePTRUiL&HRQ 0 1Z!*??  @ 0Y!)?? 0MgpP  e?XT D ,  e{i?X T Pd@"tuUs@-RU0 6@`d0T `Š"; P0H0z`04 oЍpIw~ u]ws@-@P04P00 U6o0S  `VRUp Li0P 003/8_oiViЍp@i}rk u@-@0MP M 003/00; ⬠pP pg`P  hhiۍ ЍO-p0\M0SQ `sa8Q P0i P0b 0@>S@ P0i P0|b 0@SP0 0HL R   ?  ?/Z[\ P `@10d ἐ 09/0P@\ЍXQ,G-` p0@PHLR0418S ^ @Z R  0\ X0?Pࠡ࠱000^ 0 G/Q,>0@-@0M 410810!`0 P0 0P0P`0 I0PU ! 5/ᲸЍ0Q,^@- Ii@ .h@-"@j 0  $jgYy%@-@@0s`h,00p {e0CoX%,-$M ?0 0 h$Ѝ0-4M 00 000P4ЍO-pOMVFi "(piL6 `0`00( 00R00 0000CS00S0000"R 0ş `0$0000E0S 0s 0SOߍ0S xP \8eT50S@ @%9h@45[07 5ʗ w 0 LdXd80d$xh4@4Y-IP IYڙ$8$壒I x$d l$2[h@ 0Pğ RSPS0 10$080d@h0( pR00PZpW= ❔ 3@P0 GD3P@U0P0@ 0P  0חEP@0 U  S  Re8 "10i 0;#;Z0S;#;0d|."?;#;0 #5;0?;#;0@#5;DEp"g<2 @ЀX02|d 0R$080P$0 0 0 ᡎP0X0'!g@0S80d!g@1 08p lf"%+0AC%U[0DE0S00T!0Xz $u 0L 0 G 0 ᫖0`P0P  mg@`<80p<P d0 Xgt Sg,,ح,,,\cЭ,7ȭ,Y@O,QYxOO.AOO,O@~OOj@-@7@QRG-PP @ R700pP:<`X:00X 0 gP;@-P@`pP0S -S :S S  000`  0 0P0 ЍU0S00T  NPP%p@-P`ep@  ePeV@70@0pp@-P 4`ep@  sePe@p@-M@ fp$ ЍG-`p@T/  vPP* pP- @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0p AI @-3M M 忿p 3ݍ Ѝp@-P@&@fp PppA-@Pp p` j 0W0 t0WpX U`0\0P P  0h0@ fЍU0 0  FIMYȑБؑ@-`0tM0F?oP2p@ p1f epd'f@tЍ1ep p2Sep D0V4 - Gfp"ep0p@- @  p0 S " 0PUPUp@wd0 S  0 0S ldjd0S   0 0S ^d\dlz@-@0   zd@0@-PM 0@     )dp||OЍ00 S   000 00P0 PS0 S p2yzC-p@PM$MU `0S@PE8  0P 00ۍЍX700S @ Q@BPE@C0 00p 0S 0#S u@UX z#@-M@ 4 c0S\ۍ p@-@$`P_aPp0 @ `P0 002 0pj0p@-pMP` 0cp@& cp!  cp cp  cp  0P <  p(}pЍpyt c|z  p@->@P`ypp0D m  ,0lp 0 ` p, p@-P"R q@ ^ Pc01p@@@dq N @c02p@px0@-tM0 p@ Y !cpPc@tЍ0G-QM700ۍ ?  Y Q @`V b@pP`A-`R00Pp@0STa@PT  Q*R@00 S   0 0S0 S *aP `bb ``0000`0 @ 0@ P@-@ @E z@-p0M0@M0$ ,p Ѝ X z/p@-P@ `N 08 l, ?U\( 0 0 008 , @1pp@ YQp@-`D1P:D11S0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:tatbp1CaT10CT1T1XSa0X11Ca\10C\1\1`Sa0`11Cal10Cl1l1pSa0p12,P0C2bVabx2,P0Cx27@-@0 PP! P1 0L1D8@ @@   (   )    ,  Ѝ0@ Ѝ0@-b@ aP p 00d @H 1S70qa%_P 010@ z 0@1/@-@`'L0S 5 P 080H0S S@ 'zpdc@-x!@RM Q|0 x.& Ѝx1Sꂒ0@-80@@[@ P@-@ !aP p 004" @ Q 0 @$ zX-MM+ 0ap06S , ۍЍ;04@ z%ap@- B@`p  Pap@ P 11P p1@ R  &lAQPEUQ T`00CS`0 XHc0( p@X0 X {(%%X@-@T 0S h@G-`P`.H0$ :0 0 0100 & 00 0sD00,PQ 0a(!"4a#  0 >Q & Pp W  g080P040Ѝ 0b"!4b4#0 0S %/%p0p@-8P`J04  :0 PH0 P@p@P@  @Tp@p@-@QDA$:01`%p4*0 ,HPTJ4*0 `VT0: I0 ppps@-@4 @1`  l!1P DQR0$ L Ѝp@%P P 1 p Ѝp@ PU%P P0pPЍp@ 0 F@1)#90 -1S Aa a 040}_p\ @1 9@144_041 ЍpzĮ%p@-@d @11P`PUp@0 0S%P4@1p@u]}Q@-p0@SPLM 0$M0@(pY 00 p0 +`P  LЍUtP @ t; L U`  P10L1?{C-@pPP`` R  0 "j0 0 VU   ЍCG< Ѝ 60P!LA-`@x0 P ЍA , 00  ` 0  01PU 0! 0SHP ЍA:ET 0S 80 +P P Ѝ=UaA- M@`i P-H`p$a PD 0Sr PPUn 0 P8`V,P b HEt ЍA$dU `$T;080SI $0P   > pR0S Z U6 A ЍA U. 0S V ' L0S p`MP  ,p R ᭠P 0S Hr; 0S )8b$ ЍA& Ѝ茓p6{ʓdc 0@-@ 0PHH0S$ `@l H0p@-S@P` 08PU $00P   @1 08006? $0080S  p, Av p p@{@-@P@O-pP`@టT(  P 0S!W 0 8Ќ# ~ 0@ X(00U0X0S @#HX   a@-@aMa0@Dq 8PP_ p0 P  4 I]phhlЍP& P P' P, 4iP5 P!3!,P@1 0 P P` [L!d10B0P1]t tLHkp\ Pʦ{|MV ,4>bF^lt @-@4\p X00D1 ЍP 0\{A-` 0S0 00@p-WAPP8 0S,p`p`\P{C-q`@  @P00 Ѝ 0S  k(0 S   0` 05 pPd` @P w0`0P@d\ ~ PP 0S 8$0$0> > >0S **V  0S T`0 S   0001  @  0S L BP0 S   0ה{ 0C-MM000@!0O]p00#Pā+ \P`%pQv07S 0 S W T0 0d!h1 `P1 ލЍ Pp P # R؀ؐPU [  0 S   0  pP 0 P1p  P  0S 0 P |!0r@-@+p07S@e0 S 0VS@ |A-`R@p@M PP U m700 @ЍArP"R 0S 0 Fr>XU$  *ӝP 0S <0 *7 p \- <0- <$V>P  *@ЍA@Ѝ2|ԕO-@PMp<P  5P 08A` ЍO0&P `4001x@Tx ZP1L@T@11@1Ѝ$@P000 @-@T X@P`@`   0 00V`t`J@ZL3T#`P3``s^p$#$3d @11@1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 P  0  X S ] p 0 0S@h0 0 X S  F p@11@1v 0 cP  0 `` 900b : 0( @10S 0@66P 0S 08  * 0000ST 00S \0P 0S 0000S(00 00C00)%!*?d}@->@T( "44p P`05"@"44 0,W AL L0 b"!4b4# 0@> *>@D Ѝ耼p@-x1PSMD`8"%@P/ T0x18 " V@5t1;0%00`0 p 0%S P  @dY@ l0S T`sWPHl|A|ЍpxA>0S$ V01@T t1S L j@>0S@ ?`t1S  Y0 @ |P 0  @  B.(0h%p(4#t1S *D\7|О 0 R/ 1/ ,p@-@`TP\@@^0S\*\P0 0SZ0 5Pk9 <R0p\@-`pMP@ Z (0p``FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$qL1L!L%W@14!<41Z`P(@ 1!0S0S0\,0 0 @T0@T"V@P0\400 (P p`P,00@,@0S  0 S0 0@@ |Iʚ;Z/G-@PЂL1L!LLN%p0`81(!4qP,000S5 \L0Q  HޡPPL0H0L0 \ 0 S   00S000@0P `pP0P0 UPV `pX |IsJ@- Ѝ@- 0 ЍP@-0 $q@000Q 0S0@0 R    R 0700@R @ 0@00 |@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p,p0 000"# ЍMb@Bp@-P(`0 r$PUPUR PU PTP,PP@4P`P4\pQ@ |#P@-0 H$0TP0/ |70P0/P@-$0$ $$5$@008< D0 }JA-(MP` 1U0@0$00 $0p@000 0<0S Vp(Ѝ8010C>S@( ( 03(00@000 0<0S80 p @ }np@-XU@P WpPV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHVHPLPp0 S   0|V0 S   0sV0 S ,  0jV0 S 4  0`V@-@@YVC-@PM `rP0SY 00C01@0S D3/H2H"HH\#(PU0ST2g0S R,0 S ,  003/40`0P4P!0  P0HS 0 @Rp00S `ЍH 00S0`   R 0q   QR("( `  PP U 0S 0 SIr 0S Yo P0S 3/0s0S 0S 3/ , )}@-4 0i$@ i&p t@Ѝ%@-`AM4 MsPp 5W0  Vp@ mU@Aލ Ѝ4F P ڣ# "P  RP# 0 ,$@4   V`%%-@-   Ѝ Ѝ/@-MMP`@Qp0  [VV 0CpۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-   ЍЍ/-@-  ЍЍ/-@-  i ЍЍ/-@-  ЍЍ/-@-  S ЍЍ/-@-  ЍЍ/-@-  = ЍЍ/0/`%0/`%p@-AMp Tp@ PA>0 dSV 0@0Aލp P 0 4Sd`%70/`%0@=V`%p@-@PP Q; @ p +VT V00pp`%% V@-@P:9@@rT@-@p Tp T1S"@`TV@-@M    e0 Up1$0Ѝip@-PM@`   L0 TUp 1@ R! 0 p`Ѝpii$0 /H0s P/0 #  //A->PXMUV0P0XЍU700p@ `R|0 PU B0>000 <0  ,> "PP> *Eꗟ@-@T>@@-@T^?@0Q/ R0 /RG-`P M0(0S @ P P P:ᆽ`P 0!00 0   "08S0 00 Ѝ080 00S # `pP `P0P 0iS.S  `P4P 040:SP%O-[M `F/@P09`0PpP G Pzp>$Sp[ߍ0S00 0Y 0S 0Sa0PP0 $ /P PU0SB0$#P 0PSP0SPP@\1S<@d1Sh1 $^P=d1 S S RP@T1SX1 $LP-T1@COoSB@$TPe!P"d $ d0s0$PD1P `1 $%P@\1SPö@@00STATl p1$0P0; @T$ P p$`0P0DQ@PE  ` $ 0[$0E  Pz h0 S 9`001P d0Sp `0 D000S0 35S S  CR0UX LPS y R 02 > 0*@1 U48#88 S R p ,S 0 S U  R P 0?D0 p 0L0D0}>D0 Pc 000H0@@@5}i@0@-@PDM QP@T 00!p@DЍ0U  P @0SA-p`P@MT]@Ѝ 0S P 0S0Q   <@P @-000Q/P1P/$0/0@-@PM  1 UP 0 0pЍ00 Ri~i@- ` R@0$Mp0 PR  RU U 1 # 0PP  R@T!@T:00$Ѝ R @R@-@p !p !p`Q-88 Q  8A Ō8   "  0Q5ã0ã0A-`Pl@P─@Ѝ ┚P\PPP0 q>P {lpP & D}O-P@0p"S0W"SpGP Y 0@s` P700 ЍY\ T00W YT X0#0%: T X3#: 0\Sf0`xSmS0SD bS S\ Tn C R<<<<<<<T0 PT 0 0T 0T 00 0    00 `` 0S& T  90P`0 NRU`0S  8T0 P0T0` P%P /0 S S /S/P0/S 0 S S/0/@-`RpP$M 0SU/ḹ@P 0 00 0  S0S h$ЍU I7PP, T/00DU T7L]O-p VkPPx ЍO=x`P TT ЍOzO@@ Y3qO9kPP  8P9 0QA0 Ѝ ^O@ `@p tN0P! 0 @ 0p00@[   =P 0S j@PCK}tA-@P,p "O` 0e SP,pO$` PP(0e S$O0(0$0PPO-4M10C`p@XP~S񟗕 0H(@XpXP(@d|H   X p  (      L (  8  @@XpL4  | 4hLh `HUV pP`p $PL P6P L6P L&$ !xP`0@T\0S\ @U00 @ YpP00p:7Pn  ,00P,Xc QPH0P50UV H0 XAPL?0P N 0g@PPA t01PKP 0 Sp 0S PM0P1H0P 00U  ALP{UH0P70s 0B'pPgP! .R P^0R77P0WU  0pP IHRPEU H0H1S}fiHP5H0P00/U 0P0HP0$ ,0 00 0 O,0SV  PU ,0!00 0 ,0 S@  PU D168`vd0b匒000 0 PPP00 0 P  p@0  @P  RPU] D18`vd0b匒0p00 0 PP00 0 vP  0@H0P:0H &P P0P<0UH$ 0S! /߶`P /ڶ`P00 V /0P0 Q0P0<0i000H0P60_U ,0 00 0 O,0HS  PHh7 0 apP 9Px 73P@H08SP7SP-U ,`P 0S$ PUA 0 9pPH0P580  x050,08$ 00 0 ,00,PY `sP`$8PhXN7008 A $;84@AK0:9PP88 0A  ;{p PPH0U4 0 P 4P 4P*0 06S 06S0P90U1 ,0 00 0 ON,0HS PU H0 XUPXzH0P;00sH0P90mU ` PPe`,ḵpP sI`PPT0%L AKPGH0Q7;0UtQP< P0Pt14 PPtQ- lP0Pt1% Pa xJ0PPx1P|H0P00 U10HP2P0HP2P 0HP2zP xuPHP \gPH0P00H0P200hU3  00pP>0S;7P0H0P20H0P60H0P;0H0P80U6 D18b`dr00 0 [P000 0 QP0P0P@ 0 @U D18b`dr000 0 2P00 0 (PP00 0 P p@U =៴PPB ᦽPH0 SP P00P<00* ᏽP  l ᆽP PV  4yP   sP   mP  gPkP|P n p($vpd 00\%Lɠ/B9_i%eӡCyg 1=Jqj`]yǢW}Biyϣ@ ) ]BCX<z@Ҥry̬ŬѬk٬n_W}  , p 00pP $ ( H,8  5 P  4Pc |ȼP  $p$ ~pP (( ( H$8   P   P< 塼PH  ,嚼P,0-00 0/ K,0S` |P P$/h`P萄 #PPV00 ,0 00 0 K,0S  wP  P ($pP/7P0HD H(0 P| D6$ H! (0D&P0 ($QP/P0H< @(0P] <6$ @! (0<&P0U> H0 `W+P`H0P20H0P 000PH0P00H0P00H0P 00{H0P 00u(07600P2  *P5P50S00T01=5 =5YPHPUU D10@0P@d6`&P 0SoP:U HTH`dPTqP,U @1 800PP(0 00 0 J(0`S,6`( "4`#, ,۾H0P800 P P0 0P0 0P0 0qPH0P10H0P10H0P00H0P50H0P50H0P00H,';P,UPH0P90AK&O\0U`0@ Z7 `P<(PAK⚿OAK'OAK⡿OxP  ,00AJ,0 S PzPP Pq=ñP;IP PPp`L PWX)IP`PPph IP PPpj P6IP PPpf P$HP PPplD PTHP` hHPi |HPlHP!`Y < 0a0   : Vl?o2=y OW `PHPc ,HP <HP` PHP` dHP` xHP ` HP@` HPh {HPd uHPe oHPe l hHPe bHPl \HPg 0VHPg DPHPl~ XJHPlx lDHPfr  PgW ZP0&, ⌐PP$ FPRPP00HPpb obpP  R3  R0 0,PSP00,0P%00 0$0(00XH`  p ڼ@  d7Z`0PP ʎJZ \0PP?Z Z P4ЍU i`P00,0 00 0` H,pYd`PP$ 0  p` 0S:YPCPu  0PH |0P: FP`&|6xvaPPUB h1PH6P06H0P"800H0P80H0P7 00H0P70U 6P0Pp2p2SJTPxH0P00rH0P70lU `P 00`P@ P ޽PPSPSpVPp нP |˽P~qPpP8H0P402H0P30,H, 4P,%H0P20U  0pHP9PH0P00H0P00PV 0U0F; h}  PU \0@T$(@?,mP%GAIOT:^O-pУ`P@80 P 0WP0| `gVD1\ ЍOBR$ RZ< 80,040 ЍO ЍD}d}/A-pCPPH,3&7,00000 06T06VD1@!0`00 0:0030ԃO-`S0$M; @ 0QpP  80:0D10  0H 0Hp00   |    P0 U  * 00$Ѝ%>?d},A-PQH1`Sp51Sp:1pS> PxD@vDTtD`fd6S?`nDhfl6S@hhDpft6SApbD|f6SB|\Df6SCVDXTDAQDPD1pPIDGD1pP@DX  zP T0 STd6,`0Cd6l6,`0Cl6t6,`0Ct6D6`0C66,`0C6O-MDM` 0P@ E 00% _Ep D +8 0 X 0 00 +0,0 P#Z1HD1E,BP0`d6$(@ڶP4:؍DЍ@0t,0@04CDP0/@,`6hv2d62`dl6t SL@,hCpvt6t SFpC0&h6l6p6t6t"&x"6688@ p448!0 @0P 000S <0080000 00-0¹0@00S 0 S S0P\S @/@,@@000SS 83@ P4400  C 8?o@20@0<@8@,0@p00P I000S)0' 9 MPQ0PL Z7 DpPp@@04CP00 0#R00Sr u0 0=$0W $0@00S 0 S S0P\S  @ :0@  l p⯌@Pd0pAlq^Pplq @ DP 0S 0P  P 0S 0P ߺpP@z@0 0#R00S ϺP W<0080000 0  0W|0S 0$: 0000{8,@ՅSh0Q//Q :///G-p0@0P `P Y 0 0 `R:SC3@"X HGU( HG賸A-TpW0 RT`@V0 H0HS @sP X X| |00 S DD0P 0RS 1p@-P 9@PpWA@-@P 4pp7P@-,0, ,,/Q 0 T,?p@-@P,0, ,,PP pHP@-(0( ((T0S@i⥲,OA-PQP0  iU0x ` @T Vp 0S 90S@pW35p@-@Pp PPpT0 p@1@-0@XT 뗻0@0T0S@-0   eA-PQD2D"DD T0@ pR008@10 2T T'ʱ@Pp t0 t0 x x0R`5PP P PT T0R88wP `(|0 |0T T0RfPt05 t02 88[`Px x0R p,0S #p0S p0S l PV T(P`P+r"7FUA-`P Pe_@T  T0pS'@p@-Q M0  T0S0| PUx0d tPe_`@P 0 < @  Ѝp,yd|O-Pp@4M   -@1 0A@1'P  4Ѝ B ᢱ@ᔣ唳T}   ᙱT0 RD1 0800/ P T8p X0SS 90SS⦰PT0eឰ`P| 7 |0T T0R   P  @88UPY0Sx x0Ro jɰT 00  XX4P  ^P T T0R88#P gPp0VS teo @XXTP8q @PS #ႰT ùP 0SS,90SS(PT00S@!D18,*:SR  m p 0S 0S @ꄄP@-;000 0 0S r/00趩P@-Q000 0v 0S ]/00趩ƄP@-}H0H Ha 0S SoB/00趩ф0P@-D0D DF PPp&/00趩0P@-H0H H, PP,0@o /00趩p@-@Q0  RP0 0`S0@ SQ0` ?p@p0 p@Y0 p@mnmp@-@P0  QP0 0S 0S 0P 0R !P BR #p@&LP HP p@p  p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S r0@0 Ѝpk/0h`Q 0000P 0 궩@,'A-0S(0@0`TPPQp_ 0 0t' d Qp!/PU00PP L0L L2 /00 t 0bR 0c30@,0P@-808 88 Q,0 (!>000趩,Jp@-@PQpg>8WG-`PM@ P ` ep, 0 3e ````Be1pW`0쀟pW% -e뾷 0 0 >=@ dT  @PЍ00C>S`"P!@03@000C>S`"P!@03@0|p|||-3@- P jPp @: p@Ѝ0@ Ѝ/A-@RP0p`@0S p_A-0Pp`@S:0SS 0  RT R0 X `V1S* P a 0@DpR: Q ꨪheyO-A 0MTP` 0 {~C@PA@@ 0@1 0S  vp 00PĀ P  P P P P P |pPp 0S ` Bp P61@ R <8p 0@1#?I00 & &)p H0S% S% p D p L p $  p   pw L0S p0$0M0p L pe t0S@ @111ʬ01Z9r=p M ⓭P=  p@ dlPG0 `dX$kP|$| p+ <d p.#p_@t p 0S P Q NZ T  =p  #=pP_ PZ PU PP  P PI X00S 2"Q`` Np  Hp %P 0%P0 1`40  3p X00S1XppW@0h1SP,rS&p@Qa a! pT%P `V%R pr0S   pg !tp`p0S   D pS 08! pJpPD 1 R 0S  P6 Ѝ 0Sp pnꐅzdcpQ8 "ʫ*7CQ\ezڪo7jkqp@-P@pp p@.RRA-P`@@pH0s  S  U@ p@@@dW0S  R H R U@ p@pdcQ/p@-P0U@ST` ʴ00p ὬP@ @T:pϫA-P`1pSBT  p@|Ѝ d喬PЍA!R @00  @`@p@ @bpV 0 !p@y`P pa0S pxh000#40  @LgD SP @: 0$ꙅԫ٫K @- @0P P$T00Q  <DPp@- 0S @0\`0S4 SP U \ @ 00p.S0.S0_S-S,  00  ?R̳"0T0 00pP%P `00CS`0p S00 P0S X0X /XA;%p@-h1@SPTPPE @p B⡫0.SSPP X寰P H媰P 4偫P 0  .gPP04=_p@-@P'U^ 0 p90 `90 P90  @904,,)$&#  @       90  90  90 90 x9p@ P NPj ]Cqx~ĬˬЬ;ج@ 0(ƒ -\ tx Q^ ,\ ,@-QMM@pPZp000 8QލЍA. !. d0h 8p`0SPE@Ep 0S:0@0DO-4M\XP $0. VS`( (@P74Ѝ0S  P@ y 0P@,p,$0,PGY P,p0[1a7k00 P,p, R zP 0 0 9, R, R0S ` R '47>0 WP 0 0 p}9,0S0S ,P! "`B,AQ !!!~&   P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-`P@MpVV:U 0U00E0S00T@D@@V00ЍPW"0$?S 0[ `W R``V?R0U  P70 0 .0 IP0 0IV:D X|0 0 @UR  ES`O-@`0p 1! Y*QP T WV700 Ѝ%P@pG`  B00T W 00  (P     \Eo   ' U/U$\U0 T WPPT W\%0P00PPpG@`T W PpG`P%C-RM MPLp`Hp= @?p5 7p V=p c> x7pT=    0 LIp P1 Ip I/   tRލ Ѝ     0@I  @pP0P@T*2p0S4 (p`@T*T 0 h7p @ p   ⬫0#$$("( K7pw @  ♫0\#$$(B(   ⌫0,!c#!$c$" +7pW @@  y 0b"!4b$#  lI    .0I/!P4 I/7p. 0S @00SP%86p߯007KaX&A- @pTPM ѧЍR` R 00L0S 0 -0 0p0#0M0 B$ 0V 0  05/O-4MX@`\00 0S`pdP (0S:0 `pp20"4ЍO 0  ,   Kp0,0 ,0SCTv ,L;&p 0"00m,H44ЍP U0 000!0  Z 0,`Pp000`!t8 p PE, 0 S(0SU $0$00 (000 $ 0S *uP @TPP@*@P@`/0p@-` (M00>0@SP  '0x Bnp0 ᥭ0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 *TT0S (Ѝp0 8P 0T0S 0PTSA-`儂VPPFPP2X@p`E1P 刂"20 V0  32PRp@- P`3p@ F? 4P2@p@-`@MpP!  (  (XX( 8p3PU@ TD700@ ⤨Ѝi///@-M @ ⓨ/PЍ00 3"p 000)00I3pxx000@ 0T0;3p@D 0 0" 0/3pN p@-Q@p 2101p@1p@->`FMV ٬0P0Fߍp@PF/ Ⴌ9  0ΤT01 0 `& 0CP 0*>   9 ii@-@MP4@ $⿩P P@Ѝ`Q@-<0< <<0SSL`///)|ϭ$0 /Hp/@-M @  p000p0@0M00@-P@,M(    b P2p 0 00S p,Ѝ08i(p@-@MP  `  9  (P2PЍp:iC-PQSM M 3 #  2T0S2"`V2"@p@"ᾫ0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@q120@ 2T@@D@@0@L0 X:   @L0  XH@L0   @L0  XP UPPEPP@ D$("(X0p`Sލ Ѝ  ̦XH@,ϭd C-0@`p"M 0 @@ 0@$@嶔p@Ѝ P@ -PP @@  0⢔@p @@00 ( P| Pl  (wȡX 0@ T*00Y00/ @T@ꐏ@-`@DM pP@  ᢪ  !> U 134  4R2$ @0 kDЍ0Ui@i(0@-@QM P wPp 2 0"20Ѝ0@-]MMPl#/p@ P@P -R 00@]ލЍ0S0S Sz SS wR@T Hrp}@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0 HA!>50H \00pY/0S +01S XX20S0 0 000 0 0p*wPq>S Se  W@gPa`@PU b [NPK 0H H"O@0Tw?0SG HHM P N0\<00S6i@9@-40 000 07Ѝ䤏2S/2S00/@-@@孩V002@-S0@0 @@埩V0002S q/ᬏA-@MP`p @@9@@-@P= P.p  0p X0S p .Y.@! e /p x /p 6/PL /p +P Ѝ@cqB@llBpBfB@G-@p`0M00PU  *.0S1P   ₤ P崡 00S V 1!o0P00 0jP0 PPP0PU:000000x Ѝ@-  / ЍgBp@-0M2S`P@x (;VP@0 \(Y/꾨00ލp@ 괏B@-P`2$MS0@p0  0*000%TPЍ 0p`l-$Ѝ@-@- w-@t-@-@pp /p`~B 0`( "4`#/p@-^@P TY00p``0@D^I"000œ\p@Tp0,R00@- \!Q0 # R0 @0QRO-M@@00@0Ѝ`1Q V00Pp0 , Q :@QpSI YB\> \ lP lP U  Z4\[X\T p Q*S0C0 +P 0 r0  0 @S2T0@cSc@-@ 000}P 0S00Ѝ@-@ 000jP 0S Ѝ@-@ 000UP 0S Ң Ѝ@-@\0S \0\0@-@`q0 t`f,0`0@-@08T@N0p@-80@P$ >Q! &T┢01 RpR 0S TT0Q  >0S ( p@,080yT꣮A-p`KP*P@00<000S@ (0? Z@0K0cSc0O-GMⴀĐ@p[p0 00KC*P`PS d0S  GRW ( Q  R `)Qh 0 0000200> 0BS0* WW 00 RS00T+ $0K0`C8`0$0P DQW Wd\ h P FZ <($/ ԡ 8 FQ @ p$Q DQW R <0S @FT60 0 <ⳡ @W 0FS80 0 |妡@WWW 00S 0 84S 0 FS+008$A 8⌡840@W]0  0FS20 0 y@8 RN  FR3   f 0FS70 @00 0", Q2`6,0d&Rj I0SZp0 ?0S< , FP081#<111% 1+ WZ W(,  PW:@QT; 0,S P T(, "   PW: ART ,000D0C00s W00FS90 00 C8#<ʠ@73S Y 0 FSM007# ෠730@(1S 0 F0S=00(  ⥠(100@ 0S W02S 0 FS<0 0" ⌠20@W00@1 0 Z00 FR P0@ [2Sa P 0 FSQ0[0 02 0000[00  W 0  ^0 0FSst0p0p95SG 0 FSg^009%  /9E@@6S _pp0FSS|00xK |6S @000DKP8:Gߍ0P0 "9 0F R-0    @  0FR000S0 n)   ڟ0 000p00, 껮cSc25׮ɮ79 A-PR1!e@ `ᱟP0 p@ R1 0R00 0N 30 0 0P0 0:0 00P00;0 00P0060 00P00ЍP 0000t |0 00gp0 00[p0 000$|2_0@-`0i0 MSPp$M 1 !p (p@ţ0S i `*i@ 0 P` @QQ050 00pPE&P4  ۍ$Ѝj%$p@-`\@T  PP\y0S \0\08  p88 t0 |pvl%@- 00806PP@ `V@ @T %@P  ᪞00ЍpO-IM PpRPHLL `PR x%@P0*IߍO(0,0(600 0|400` 0 ap00,0 PS2 V30a2@0 0 ,0T<`0 P <C@PIߍ@<0 Px iVT` 0X`0T<0 4`Vy<P꼯@ѯO-@pP`Q`,R尰,P2,ES#P㔀U`,@ ,)P), Q 0S, ( `,P0ꨐRO-m00"`p@PT:p ЍT  X ⢱00U *N"0 p0R0  ⥝ @;0 E)p  ;  9)p@Ψb@-RM M000 @`TPC Tp@ 00 0'p"  up ۍ Ѝ D\; (p UPU p7@-0(P  Q S0  00 0PЍ 0S 0#O-04MS@ h@@ p0P 0_0? 0o0  00 0z`P3; 0T0 @ 0P0 00 0g`P 0 $ ( XkpP  ,ڜ$e(b,8_P`@ 00 y0>`P 3 0 0S0@0M YL000⣱  Q*A"00/P 0$00S0(0 $◜0 i `( ,⍜,0$ `S  S S0t0(0s $(,8rP@0S 0h0 0h0  0304Ѝ 00 !0`PS @ NYM $A ,=,0`S P@,0$S  S StQ0P !R "R h@p( $(,8P@YO-P0M@040`0`p 0 ##p#X; X8l0S,0S,0匒0嚘 2S,08`0嚘 8d6S,0t0嚘 x"R㌂0,80,0H00`2 S,0d6S 9 0`pߍ0 0 0$p $  0p 0 0 0(p $09 0p $9 0zp$(9 0hmp#0z0,@04l0| (40[pl#0k@0"04,0j 40Ip]]dk,0 !P !,d ,hS  R,  P ,  4! 0  0, }R, R 00'0P ,  B, 0 0 !P ! TP ,0 0H0 0 0,):^Ls@(wp@-PUp@0L0pp@- P# Mp@ 0` 0 ` 0q%pT$@ Ѝp ` 0c%p )X` 0[%p  Ӟ00; U100G%pG-`@p 0崀SP$H` #000 0 0 `00`0 0 0 `  $8r 0p000d4H0@1y TH"ЍG<0 $8 000 4@0S4H000s$8040}8 S 000800S#UQ 3T840S'0KQ x3S40S,d0S) $0P%h0"N8 00(]S:/Q 3S 8|8 S0 Q 2S 4m$*8 00OH0S0SZ h W 0R<0S 0SL2H2H000s8040 P(24 P28 P20 804 00@0S0i 0.0 0hp #Đh` 0HX"  P0dh0Ѝ0S,1,1 PD1 @18   00S  0R`V dp`ЍGF0p ЍGꬰ˰Ұ??9x&ֱ0.ݱA-@PT R0A 50p8` l0 R 0i0aP 0S <0S $D7  j? 5`0  `a" ``]"0Hp00` 00`8000   K"00 0$008 % d0h0AO-RP`p@\M@P; 800 #3P 0 RT0 3p` h@@N 00p 0  0 @P 0~L !Y P 0 {\ЍL0S0 0@S@0L0L}pHP 800 B2 R 0@T?O|PO T0dd0S  $ P $0S0 <Z- z 2 0;1C<18#<410,00000400<00@0,0D00 <$@(@ A8`L@P@T@H0!px us  h &hD! (",$0("(  0!  9E  o@ ` (",d `(P   0 \`I!vK \N04S1SB0@1X0 37S1 [̐azD~CDCײ @-`@pP`0 h0X T6S @d0 0 < ` 5 0 Ѝ@$0  {[ p@-PUp00CSp@0@ t$5  (000L0p@/ ꈩp@-P `@p800  B\000D I0<0L00p@8 % Hl [0A-P`@ 0h 0R0TP3 t0@1HAp` @P0@!(0 A2P $   W %Ph0h hhl 0d 0 DP0 $Aꅳ_1 2 īC-`@ PR0  R $ RP608 p4  6ip@ R PP  P0  lHI@!D1$?'((700 Ѝ@ 0a60@-@4M@!(040oP 0S 0 0P 0! 0Q00 g 000 0 0 4Ѝ00 vn4  4Ѝ0@0p@-8 PR@  \0P   0y,Hp@{Ppp@ꅳG-pMx0 P@@1D!8 8C0m2s pЍGm0t&x0 2s 3!p PU P 0P`00P 05iH00P0 0a`0  (!0(10LZ.  P(_ t0+ 70I (PF  0 0 `PF@ L`  ```0 A ЍGR   0|P(+ (1 ( H0(|!x>```P( `"(1* (> >Q  0*⳸   ЍGl  ЍG80   0S 0 0g0 ß Q  $ S@000s  i`Pqp 00 P R  K h0 00$0C40 040800 8꤂0S06 PU R  ` h L0&0  P@ ЍG0p0 F|0 $2  #0Sk 0Sh 0Si$2  0  d0S  0R/.0/6O-0M00PS㴐 @pT0`S 0 iЍ> R*_P 0S D6S<ƚ Hƚ[  S1  @!  Q 0 S:500 0yp00 0  0 S 0 0Cs0tt0S0 PS0L00 (!p 0 3 0 0 0@P0 [0S?60@ 600 0:p0 |0 l ``P L 0 S\ 0@1i@6P P0S0 0<S<0P0B!0 0 3 0 0 0P 0S6[[00S40S>0 @0 PP   fWl00 0P0SS0KSK?3050$h0 [ i0 H4 @SS  00Cs00Cs0 > $P 0 0 0S  0  d3@0 R@ $ D 0R 0S:0<0@ 0=0: P0 P3 000 000 0[P00S* iP )   p @ 0FZ600 0<P0  ^0S * @P ;  p@1 v000H 0 000 00 3\ 0000@!0S  0  0S S0 rS 0 B0Sq0 00 P0Pc0 8[ / l .ꗶBYu6f+>3EVsRA-P@`/ 0l A`0R/ 0 D0BSpb ॕ0 A꿶$O-`pvP 0䘠1@T ЍT 0S R T0 S> R *F]P  0 O@C-,M@pPP Q0 ,ЍCPE fzUZ`0@SV 0SS "448#8UL:`aVH0UE: 1#ĠČ Ƞ,Ƞ\9 U6:1 S31C S0 0 0 0$  00,P   ĐaV Q Q%  !V /  LY,Ѝ "448#8 C!B0N4S@-P` M\@p0M000 p 0S LL  ۍЍ 0S`V \@T$Zp@- P@ P<p@0S0p@\0Sp0p@g@-0p ;M4MP@ p`@ `0協0<000C$00(00$0C,00U000`$0 @`4`8p0p ݍ4Ѝtp@-@PRT  (@1S pRq 02p 02{02p0S 0Sp 7@-PX0C @P 0S0>8 Q'Q'+  A R "'     0 #0 Ѝ0@}pgPF@G t0<0t00 0 8dxQY Xv ᳈P шU ⢈pP ĠZ 0$8 0  h % < K  M<~ꄄ,*8ep@-P @p`401S 00S ,0S (0S  -0 @T 0Q0 PSP 0U d0S0h0d0p@걸 0dP/08 /   0S/p@-@T PP@0p螑G-Pp`P@Ѝ0F @P00 4b@P 0P000000 000i*.0  $00 pPPX*0 fp0S t00@ s8P  0@R 0 0000@@ꬑΨxwHH̸s@-@T`Ѝp`PV08,*:SR h0S NH$`  P (0Q,0Q   `P ;800000( ,0CP0S  0h dd0S  $0R  0h0d`j0SHB 0S/0S/   O-MPD0R8<`@H 0P؏00ЍpP P͏0 U@ UP R R R0 2P!4Y@PЍO赿 p    @@0 0Z)0 0S SY00 0000000Cs ^@UЍOe깑Ψ0S/G-P@M T 0p `倡00 0@0 0 @e@ЍP/@-@TP@40S   0-p@-@PPP $pyP0" 00p  Pp@ :R R @\R @:R@H,P%P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/p%0@-@A P:^|^00^0S R  B:PP |P0P O-CMM`\4!SP I SKEpWG X0P 0A@ 9P 00o@@;040S0  00,0 0= zpP 0 R0 :R00H\4 00 0p0PP u 0S s HCލЍ P ;00 0P5PV%0 00/p0PP@0S!+ ,0P R  0? 0SG @@P `P0 0 P000 SWB p@DW:SZ @\Sp S Spp00T:CP@D  0ST Qp00@0` Z@S 0#SS XP@@0U u:00h00?P0 0Q :Q0, C B  RpG:R:   H J B[$00 PC P[P$0 @D pG H   0S 0|  @p P D$0Br$0 =r0h @E 0S  D0A00T*yP 0P:SZvH,p%V@-0  0 Ѝ@-(@ P H0 0H,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ Hv0Pv Ps @ kH Q0,P ލЍ -v0P P 0@PPH0 PP U L P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0S@Z\R    B{:R|R  H,P%Bp@-@PDp@NG-p= @P@ d+Pv} 00@^S0S:S^ `00A\S`0S:SQ 0C^ 0@0LT1 0L\TS`ASBC\ 80bC ^0 0 0 0 R@Ad>PPd @0:SS0AR0@A #P Pd : A-p= `P@ dPPd0`F 00@0S @AdPPd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P |P`,$G-Q0S`pБʯ PV00b ``  _zP00CS0 G Pp0 0 S  W00S(@ sP   , P aP00SW  X  R00S 047σ,P R   S@T P R  ` ЍR `,,h,@0@-0S uP \P`,,@-@SP08G`,p@-P@PPpEFPp`,@-@=P  K(0@87ST`,,p@-@ PS P@p p@-@P  $(0@87ST`,,O-pWP`@P @ Ѝ0S K P 0奇P0T  RT1@ S //////0@-4@0P DP蠵,/O-`@0MS8 Pp04@``F0S|Xi 00$0S ( ğ0 R 0 >80H@`@C^3A40LC32 0h  2l 3 p  !dC 2ttt 00C0'0DS 0 000Q PxP+ | P,000&0900%040@ 0 R0C,0*0S'0\00C\0!\000$000S0C0@ 0 BR0 0S0C 0@ 0 BR00'000(000)000*0000000[& 0  3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00n Ѝ0S/1>3 !/0S 000/h,0S/A-0p @RP:``S * GP`A 0 PQ0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-@0SP`(0aL T  $ T $ Q0@ 1pC !\0`0sA-0p0@P`MⰂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0Th,A-`@0PS<0R"0!31<0S 0R0PP0S! !x000S!!!,p (E0PA , (0 ,P%L%H%A-`0 R*S\ ]\ tpPB@T Um nPrPp% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00h,< 08 C800/`Q'Q!//P%A-PRp 0@S` * "EP 0!q PPA-@P`p0 SV1 V00W W0St<@D@D@D@AAAAAA@dAAAAAAAAAP 0 B  0  B  B " A A`0 F  B  B " Az  k`PpG  B0  BZ`FPpG|S`FPvA\p@-P@0`rP@@p TpQ 00//,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0P`%L%H%O-P 0R@M ;m P&  4m P 000Ѝ 0@  CPP ЍO 0 PS@ t 0 00<00S*^Q000800R ]R00-R Ȗf0 S*]Q -QR\V0]Sj- 0 S{:0S00L6000S8`V 0000060S|p0@W Ƞ@bS ,0Sh40Se$0Sb<0S_(0x[ f 0(` pc0@`F `@ PtUg 00C0b-Q [QR:Q =Q 0pS: Q 0R00`S0`000-S]S0`S0`0t4 R*000pBW R:0`S0`00 S<*R9 :R6 ]R300@  o0p pBuP 0S<0K[$ BP    qP p$0  0$ 峠0S00``0R00`S0`000-S]S0`S0`0=  R:0`S0`00 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S. W0`S 0`00S<0W00Z0S Z4 0]BP   pxbGx400!0pᲠ40 P0`S 0`0 (B(  P  P : [i 0]S~! R, V08C8 0  EB#ЍO %h,P%p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@P%L%H%A- @00P`\UC S:0S004000 p4\U R[U*U .Uy 0S0 pS xeP JU @0p W1@p(` ~0 S *R \R0)S ) \ W 1L  e0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  <t  3 0D #OU &)2U  0  4 000p0^00 00]0000p0S* *Q2  0  BG  B   B0;  Bu  0S> 0S 001006PX\QV {RS0050PS<* ,R9 Q 7 810000  U0 R     0 S *R\Q}Q00 0RR \P 0}S |0<0S 00,000$EoЍ[Ut`h,)>{P%A-0@pp`?Q $0A  R STPRPRPRRpS U UPRPR(U^QO [Q \Q PUOO{Q |Q020W:0S00500 @0P U1@P(` "0 S*0)S  ) U 1L  0 S:0S00400P 0)SP  0  $  $ RK*0?S{S*C\Q@{SP H$ "!,Q  R  $  U   R  #  ?S l*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^00 0P0]0P0 w|o0W:0S002000 <Q >Q xp3PP jT &UO F^{S0 PSp* ,Rm  1000< U0 R  !   00 S*}Q00g 0RL}QF  ] 0  BY  B   B0M  BD   B0@  B 0  B5  B  B " A 0000S 00000h,P%0S G- `M† PQPEUkPL@P 6U: pPp P P$ @pxpo0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D t000Q R:0S005000 S=:  ] 0A0o>P  H00Xo p0 P>3S, 9S $S S <0R pQ00< 00u04|04040 .  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:0_0P 08 BB0U0 RB@ Q U B!U 1 EU, ^ 0C\!1LX0RU!U! 0>Q% Q% QS 00 080Se 0S  0H 0@0 @0x00 0  0S >Ѝ0R 10C/TUUQh,lL<87Ee,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0_P`%L%H%0p@-0PSQ@ʡ@8QD@ p<0S P pP0@H0DH@P(00Ppp@%L%H%O-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T 5P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  3P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R P%O-P`p,@ Q+ V >\# (\ \[ \G \S `P \[ \Y P @\` \ \L \06\ \ \; "\^ \K \ 0M \ &\y.\) *\ \08#8S00 \ yN ^0s00 0@0s08#8Sy[Y00>@4N5>5. P`F`FV0@0>N>0> ^0C|0>@01>3 St 0O-4M\0@0(0000$00; , 0X ; Q 0  PX d  P^ PZ$\( P ``SP  UEF V pR p@_UP\ v H_VPpu\ @_UPN wpK vI _VP\p?Pu p$ V  upvw(ppu vX  pX X0X w u P pX 0X hu v? @_V_U^ X _X 0_V3 Q"$, ZS ( `X A 0PX v_PUPPPU0S 0P0004ЍP%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0 X7  IS~ S F S 0>#0DϠ2@ 0o800 0 fX IP0 \P 0 p @0P  0JTP 0PP@ pP@06800p 0 -X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  _/P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R P%O-pP084@#8 W Ѝ># R, .R`" Rl RR Rd pP Rs RZ  0=P0 BRz R Rb R 8R R M RG "R Rm RP n R &Rz$.R7 *R R ("(R8 R z  ȠLȠ \    r8    r ("(Rz  SZ >  E   R P RpG pGPp   >  e  ># !>c V  >  !># RHO-4M( ,  4 \0 0 0$ (0 @ 5f  0 X  0R  a0 Rc  R ] PZ   R    ``R  ,0-P0 00,0 UE F V pR p (B( _U RQ v     _V Rpu[ X# (B(   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  X p^X0w u ("(R X pL0!u vS  (B(   _V_U P  X +0  0_VX P R  R5 p  ,0-(0PZ& ,0 $`0 S,0  `0X  $0` 0Pv  _PU PRPU0S 000S004ЍP%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0x800 0 oX7  IS~ S F S 0>#0DϠ2@ 0R800 0 IX IP0 ?P 0 p @0P  0-TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-4M( ,  4 \0 0 0$ (0 @ d  0 X  0R  _0 Rc  R ] PZ   R    ``R  ,0+P0 00,0 UE F V pR p (B( _U RQ v     _V Rpu[ X# (B(   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  X p@X0w u ("(R X p.0!u vS  (B(   _V_U P  X 0  0_VX P R  R5 p  ,0*(0PZ& ,0 $^0 S,0  ^0X  $0` 0Pv  _PU PRPU0S 000S004ЍP%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0x800 0 oX7  IS~ S F S 0>#0DϠ2@ 0R800 0 IX IP0 ?P 0 p @0P  0-TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  p(P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R P%O-pP=lMQ W @=QR 000N0 00`0=0`S Q00R0f  Z0,Q{ 4 Rv 8Ys <H[V01S0xs\!Q8pp 0,@004H<@ PP  0TX\  L0`_ Xd 00 SHZ1p0 0 0p,rP 0SD0S p0 0D0p,aP#D00D0=[Q 0 0R < 0KS:^'P [  0SD0S> 40S,0@m440S 00O, 0@ R0R00D ;0Q0 0D0,`PpD Q*0 J0p0,P 0 0D0pp,P 0S 8 D0J0C0? 00S0@P, "@ Q.:400  R04P \HP XPCC HP 0000 0D0,H0SPHAA0 S0 Q00R0W  Z,Qk 4 Rf 8Yc <H[G01S0xs\ Q 0,@000X40H08p<@P0T0X0\0 00SHZ1p0 0 0p,P 0SD0SA p0 0D0p,P"D00D0-ZQ 0R < 0KS:O&P [  0SD0SH 40S,0@^440S  004P HP lЍ, 0@ R0I00D ;0H0 0D0,vPpD Qy*0 J0p0,9Pp 0 0D0pp,/P 0S 8 D0J0C0? 00S0@P, "@ Q%:400  R0CC HP 0000 0D0,H0SPHAApQ00R0f  Z,Qz 4Pu 80Sr <H[V !R xr ^Q 0,@0004H8p<@ PP  0TX\L  `] X 00 SHZ1p0 0 0p,cP 0SD0Sf p0 0D0p,RP"D00D0Y Q P < KP:$2%P$ [  0SD0S; 40S,0@A440S , 0@ R0I00D ;0H0 0D0,UPpD Qs*0 J0p0,Pj 0 0D0pp,P 0S 8 D0J0C0? 00S0@P, "@ Q%:400  R0CC HP 0000 0D0,H0SPHfAAp00w 00D0C1S 0D 0C1S 0D B! R 0eE%-Ѝ///@- // //0p@-8P00@S PpYP pt,7@-4P@0S TP Ѝ0P t,@-@P 0S X@P/KP0 0 0/ /0 0 0 0 0/////0P P@-  /t,P P/ /O-$MPpLWH_ `d@P1!$/@ @ T0030#`W00SP 0BMZ0* 9# 0  0  2MWp  pV $Ѝ 0Md 0M 0Mp@P. `p0H P 0@0 $Ѝ`d@Pꙙ%`%\(\@-PQM@(p,` U00 V Sp0`rЍpw`S0p`Ed-00Ѝ00 r0`0EW00 r0p`0O0O-M@0hwh[ PA  3FYAZKW  (F #FX%  F FV<  F  F h FX E=ЍVY PZ, P E EZ  E EЍ P E[  EW PX PV P PЍO#####l##<#\#""""T"@"O-@Q00R0`P00M 04堄堤0 p 0ᎮP R nR a BRrMT1   oRl XPM Ѝ  WPY U000T000 WP[Y U070T070P WPY U000T000 WPYU000T000 WPYT000U000{ WPYN U080T080j r@ WPY9  WP  WP  ~WP_YK U080T080@ nWPp  hWP  bWPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l WP T WP !"h! | 0  t8(TppC-@PdM0H`>SHP@@@@ P$P(P,PPP PPP9p "`!@03@0 p@& 0 Jp@ Jp@   p@`Y0  PJYPY0 PYPdЍY00O-1MM @`D`  H "(0 p C.  PpV@D;@8 (0Sp p p̱̑ 00Q$ P %0!pWp@ t0!0 P P Y0S R4Y0@01ݍЍ,Y0S PEPU R[ P#p 028D<4! @ P0 0W0 R 0&0h,R @P1ݍЍhL1ݍЍyFtH gt0@-P@M 0  PJp@ ;p@ P 0 0Ѝ0 o Ѝ0A-@@`v0 WPP0P! 0pp p p0`p0X0`Vp X``pp0`p0X 00@pC-@PCM4 /cGP6 0~p@& ` qPlX000u6 0C.P F @4EP @FK0@S VS 00 SCލpx@@0SG@`0` 0P@0 W P@1:4X?0@0@-X0@0@( p@-QMP4@SMZ TE /GPB QP0s+ )UP QaP 0`pP @ 0@OqpG H p@ ۍЍp'0si/1p0" +O@0 P@0  P@1:W?0@0p04@W0#S0p@ W00WPW@PD`%@pHP@-pP`O-$(Y,PSp@`3U-00ï  0mHX0 0 0eH 0R0*V&( 00`#`0{0q04 "x " 0xkP@r`U0@-DM@ P, 0P0#L` ACP/ @EaS 0LT/1 0S2 0"#DЍ0ꫪ*O-((60 @`$M00@=+@ I\b-0@?o2S00/ 0 P 00d 0 uQS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@?o\2  y 4YP$Ѝ0 0sx 0 P$Ѝ0@Pa (P aP (P0 )P0CS 00}P P p R4000.P0S0 0S  00000S |3R3 t 0S( hRf `#S\ QPV PM 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#4XP(0S  R $ R`d$  Q 0d 000M# d 0Md 0M% 0D%MXP 0dR  ^ P Q&PT8XP #8XP20 P0:($^0<P0  0=R$ $ %0h00@D0 c 0L0 2  .ΌS1 $0 d 0(L$ Q00 40XP10 P0:P0 0<R$0h00 0XP0  0C0  BQ $0 h00$%<  q 4  $  t *) l'.%""""XP @ D0 0h$% 0S 0000000XP00$0Sx"xXPXP0(00XP(0$QeXP 0RP[ #0\ !#/1x2 d$0XP2p rp t t ZXP  0 R9 P6#R1 & E%E R)  \Q%8< &0# &d\0(0 0V$ 0$0 h00% 0C 000 00S P00  $0h0 C\0 @00D h00 0 H00 00S \0  $0h00$#& 0$$% 0%#PP # 0S !#/10s ad 0 Kd 0 |K$O-MPpVP0k0RP0U`0 W 0 2c1  刀?00@P/ 0v> 0`0?d000P0?T0 04 80?<0 00$$%0000 000\ :0\0P? 0TP 1 dP /P~0S{ʴ Rxʠ RuʨQr003 0Sd `0?#0S/" ES}> `00d 0O@PD0 E0@ @8 H0X`P`d 0p4 `FQ@ T PQvNNh` @D P[^0`0 0tx|\dPl`p@< RW S S|\?pTlVh0SdU`0S\0 R{z  RRzd8@0>C 0C0p0t R@ix0S `O0pPt`( 0( \00PJ p'?0! P ό 01l"?! R1 R?U0v Po 0NJL7v~@ pG0/ QP pp 0>JRl h0 Sh O 0 qp`P  0qpO0S Z R@Q @T N00 ߍ 0N\ xqp0 L 'pQ !'/q S>P: RTP\0 P0,P0  PpJZP S 00@ N0\ 喼`N0S0W0ZS 0#\``o d`~0\P0? T0u0\80? <0l0\@0? D0c0\H0?L0  Z0X\p0h \N0SL R<!pgQ: ß `Q.: ,PKz0@P  ß刀dSah0 ]ZP 3pv0ps&N@(@\ P`P ?/& Rß%0Q0vt 0W0'I 0" Q0P"0V#0,m`V10& Q#Ό3à\!=30S ( 8L^9 0( 0qp2 PtM#00M0SL >\|_ РR30"c01 2c1Zÿ sR MT00M0S$ 0M0Q 1&`P 2&>`\3à\&=3sM0 0} z0eMT00\aMT00dplP)\(\ ףvɻ @-@ Lp0-*TXat X00 R 0 R 0Q/  /  8  DQ 0@-0P S@@H  ^ 0S  Q 0#0S0 0/(H  Q j.0 0#  Q/00Ɠ\ 0@-xPo> 0@" \ 0 0 /A-@P `p@P@0% P PPA-\@`@P pjNP@0& P PPA-\@`@DP pH@P@0& P PPLO-P M `P9 p젟P nP P @@ %  P P0Sp , Ѝy X p V yG  0p0`0pSlA-pPQ `@Q rP 0@DDB(000S   @- M`pPPp) K 0 ٹ0@0S K0"S" 0p000S0 7/ ЍK0"S1Ds\0pT000S @ Ѝ1Ds$ S, @-@ @O-p MWP  pp2S=`PL MP@C GPp G ,P HP6 0nS# p= \:@P00Q Q P R  \0 HB"A 0 0@00oSp\000S ;9` Ѝ, S.,` DO-BMM@p+KL0  0NP::PP  NPn00aFP PC @@`KO0 PPv4p 0P0 0 PPh4p h@P! T 0dSPkPU0 Pp` np~  0GP @PP0 PgpT  Q P J 00BލЍP/U ` P pAJ0SR  BPBލЍ B0H0PP0 3p>  4PsJ00 P 0qBl! 0 0 0_J0D0  0^BsSJ!0 ifT00&:J00 P 07B|.J00 P 0,BqPo!J0`0  P 0Bczd@l,0@-P@M 0 P@ l3PЍ00@-P>@M 0 P@ W3PЍ00@-P?@M 0 P@ B3PЍ00-,M 0 @PЍ--l0$ S   0/ 00p@-PAU@pI?( ( 0P 5/pp@-P4U@pI?( ( 0P 5/p,@-,@P 0003/@-@P 0003/xp@-P?oU20S@ 0 0 03/pL8p@-P`UV00P00S@p$ P05/pp@-P1?oU20S@ 0 0 03/pp@-P`B@PpH(@0 p@/0pp@-P@P p 0 0 03/pP-@-M  jp@(0(003/Ѝ@ Ѝ/ @-jp@0003/4O-`$M ؄P @9<0Sp $ЍH0,P@@  4/ $Ѝ4O-`$M ؄P @0Sp $ЍqH0,P@@  4/ $Ѝ!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////\d`@lXH0x|lXH8$O-DMh0P 0l0U000@@ S`p S S G00 DЍ>00p0S 0pG00 0PZ0G"`  0 `00USXU Y <00p00C 0`0 Pp(V ` BPE @@R> 3P 4U * $0 0 000 Gg$0PPU  <32 7[`< YI  Ih XR3"^P<^P `0U 4@ YEX: Q7V ` BPE @R> 3P 4U *000 000 0G0[P % < Y` `0<S Z>03040p 0R 0DЍPU *@ Y,PU ` * Y@@ Yp;00,d;00(Y 08 P<0<p A  FQ$ 4p(0,00)Q!*AQ V S @0S Q~ FQbQ 0 `302 @10 0[0 X 3 "R Y(0H0PE$00 @,@S 1>03P041U * 00 0 00G0Y4 PPU`<03`207$0SE 80P0=S @Z? 0  $`4) Q(P(0 BPE0`,@S>03P04U *00 000 G0VP 0`PU4 Z [PU`1401` Z$``0fQg [  0 L0 ,!30 ` l:. @3[ X3"30Q8<0 N Y(0H0PE@ ,@$0R 1> 3P 41U * 0 00 0G40PPU`< 3`2 7$0S 0FS 00000S800<0G0 P0 PU`000 $``<040 0B0,0<PQ0,0(00PU(040FSY0$0,0@00S00 P<R00S,00,0(00U(0 4 @ZR  4* 0S)P(0 BPE ,@R>03P04U *`00 000 G0=XP `PU *Z  [PU *<0$40@Z7  4* 0S)P(0 BPE ,@R>03P04U *`00 000 G0XP `APU *Z [PU *[4 0S1Y(00H0PE$00,@S 1>03P041U * 00 0 00G0$ 40RP`PU*=00 $<0400PU=0304800<0 0GP00PU`0 X00S4 0X+:Y(00H0PE$00,@S>03P04U * 00 0 00G0x$ 40RP`PU]*#00,00 0PU#03040, 00 $0[, 0S)Y(0H0PE$00,S 1>03P041U * 00 0 00G0;$ 40RP`PU*=00PU0#$0%=030403$05,0$0 ` <040$e,0$00y,0$0u00@-MB0@+Ѝ0p@-P`M0@ 0 4/ЍpG-PRM^  `UpP*/a@2P T1000< pp Ѝ80S 1 000< ppC0S ЍĠ C0S 0 < @0000< @ ppoC0SjC 0 dC 0 %L@-$$@M Ѝ0O-EM MaX@P+p `E@; M0P@*T 0 M0P@T 0 =0EAP - -UEލ Ѝ C 0 Eލ ЍC 0  @-@` pMP:P, /kM 0RP  rR' rR  P   P @0CЍ0rS\ 0 @Ѝ0 Ѝ@rB 0 A-`@ p@ 0P/S /MP @0 Sp  0 SZ' =@p@-IMM@`PP p 0: S p0 0rp IލЍpiB@O00IލЍp@IލЍp\B0@0p@-IMM@`PP p 0: S p0 0Ap IލЍp8B@O00IލЍp@IލЍp+B0@0h0@-P@M 0 P@ +PЍ080Q 0 080/p@-@PP`  PP u w2P  p@)YPPp--00 M (0  ЍЍ/*@--M  Ѝ Ѝ/ -- M=M<P 00  0 ЍЍ/d*@0-@- M@IMP  Ѝ@Ѝ/O-,M `@RPP00:A!0@00Ppp0 0CS7  PY P@ 0 @YP Mf!,Ѝ)Pp@-(M `@P% (Ѝp0 00 (@p@-`@PLpp p@p@-(M @P,0, 0 `% (Ѝp(@p@-M H0H 000` Lp  Ѝp@lЍp'@p@-(M@PLp `e%8 Y(Ѝp@-@PT T  ,M` @Lp pJ% >,Ѝ '@C-,M pP`PEUP0R@@t0 0:2 0U @P0 @T HL ,Ѝt&Pp@-(M `@P% (Ѝp0 00 %@p@-`@P#Lpp p@p@-(M @P,0, 0 `$ (Ѝp@%@p@-M H0H 000` Kp  Ѝp@zЍp$@p@-(M@PKp `$8 g(Ѝp@-@PT T  ,M` @Kp p$ L,ЍD$@ Q 80 @-l880@08 880/880 00<P 80880# t/p@-@0@00S 000 Xg t0PP `00BA.L00p@3P, 8#$$  @<,O-t3M0@ 0P `k0 `0D$p@ P P00U pp0 0CxY 2ATT00  RG LD@D T]:[ 2 00p0`K  K0 V0 W8 P2ATT 0`Fs 0RB K 0 i 0 Bc0SH J@0Ѝ V0& 0 M J 0 C0pHXB0SG 06 Jv 0 B, 0 B%@ 0 B  BJ`FtZ  0 B  BJ 0 v 0 m 0 0S J00l" 00 @p@-@PqJppp@ 0RS00 /p@-@<0<00P  @SJppp@ T@808 00 Q0R00 /@p@-@`P3JpT T   p@pp@-@P\ \  ` @JpTT  p@p`@O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KD Œ Č Ȍ A`| {@p4  W R ? \ QQ Wt ,0 000IC1100Q00, Ũ Ѝ0 0 00{@@-000 000 @?P80@080@-@?P80@0800-M  Ѝ0-M  ЍO-ϟiM QP@ȡ̑qa  P? `K͌U Pul? K͌T Pi(? F͌(Z {P\> F͌(Y iPO> C͌ 1S VPAL> JB͌8W DP4> ̌V 2P'= ^B͌`=@ 0S078p H0PH `P$ P P P P P(| PX P@8 (P PD (PP PH PxP'( Q780L0x100C40S0 00C,0000h0000a0P06 ,0P0@`U 0e1P U.0q10 `00V0q0 `RV, 0U @ `dp少Wl` 0 Z Piߍ`0 1 S  ,00 0! 1S 0D 0| 0t>p00( P ,,0$ 0 @< 8P!P H, $  B @ 0S% 00P00C1 0@S3 00 Q!1 p WQ  pW,000 p0S,000P$0U1p㔠 0 W oPp~80Sz004 0R0031800S@@X!0@< 0S00!$0P 0S@@@@T0S0 0 ,00C00P0X00Y,0 0CR0@,00`0QQT d!@YP0 p00 W0 pWW0T,00` pp少W䰍 0 X P0080SG^p!f p!:|rQ R 81 R 0S ЍQ  <00 Dh0 T  ЍyyxD0h 0̃ S/PxG-TP@pxMk +¹(@($T 〺0CS0S(v3ズP 40/# ଐ쓟薃蓟0尐:ؓ局㴐Г%LȘȓ㸐͠x帓尓H p|xtplhd`\X8TAD`<@Ã4,(($ Px h2101:|@ R 0S 1810S \ЍQ  H20 2C8?Hhp( .(P U (0Ѝ>A@<^v8#߸:ܸ0'ٸ#ָJ #ҸH#ϸp-̸-ɸ`_Ƹ|øop㽸r㺸y㷸z㴸{㱸@|㮸h}㫸$z<l`y!tw+!%,!-!.%0%`&i%j%k %l%m<%n#o#s%t$%u4%v,%w%x#p#rd"ye"z`"|`wDtvp@-,@_@k( @B.T(PptO-pǟM 7700Jm6儲0 `0\W[  p p PP " pTPI\$ 0P s 00bRS 4T D600/O 0 ;0 $QPBPq 0 ;0pt 0S 004 0 s 00bR44 $R P|%|5  0Ѝ p PP'  4P 4 0 s 00bR 444500/1QP p lR Ĕ P  $ $ 0T0\W0yS vpP 0@    $ `004S  40 q 4Q0PQ40@ Q  000r0  cR$W0< SS. p: @pP 0@  N  $R `004S 0040 s 00bR $4S4]0P"0 0Ѝ0 ;0*p4S  200 ?cS  20|"0` py P20L"0` p 0 $ P 0 s 00bR 40 ; 0p1 P- p 400s440040 s 00bR44P 4p!4 0 s 00bR L/o 4"<10 p 0140 s 00bR40z 000 ?c0`000`0000e ` \( t0t0! 0% ɵD8 x<̅A8 Q|H (p@-P@,0 0 P0 T TTpO-T4P8 `0$Q@DMh v :Q{#R3Z 300S 8 TDЍ!  Ppq@ pzo0@ 00S0:3S*0`00<00 P @ 00{Z }x8F 4!  p9H1D00<00  0*$8A,0 00@p@-@Pa;ppp@p@-@80800P  @M;ppp@<@@- MP*OpP 0@T $T` @@TP  Ѝ<V>0tP0 @P`@-@,P% H,P *PFP0S)[P& mR R@0R0 1BQ;RS S0 CmS  ;S R R0 S0S PS0 C;S  QR0RRO-0uSp@` Md`Z|P @-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@Q!80-^\ , 0 B\ 0 ^O-J3dS0 dMbUSU^ 3,p0CQ?8 <3 Q7S@0pP 08 ,0p๥3S/ 0P0p3@ 0 00 p) , 3, X 0 `0 =dЍ|B0 9dЍOM/O-*,M0pP2U 0! @Tg ` @p$ $RTK*:0`SQ p 0 ᯤPP,Ѝ@`00S S@ S0PV%0S/00 04S,ЍO@0@0S A0Q  B20RP 00C 0PV 0 0 0C0^0PS  P@0 C`PQO-DM 4P3 S-0S*U= 000  0@ 000@Q k@` p PJ @0S 0!PЍDB P 4A " 2  -ЍP0PОP0  0 /d: D0D M000S :P ЍЍ/<H0H M00 0S :P ЍЍ/404 000S :P /ᔜH0H M00 0S :P ЍЍ/H404 000S :P /MDD0P  P 0 ЍЍ/ᬛ@-|0| 00@T 0J#4R |B0pQ 8@-P @BT808 000S :P _/ȚD0D 000SP:P4@//ယ000 000S :P /,L0L 000S :P @-p @/A-0 00pW* Z3$SP! #R`@4Sp`3@Tv A|B0tQ 7AB-茙-0    hꤘ000 000S :P s/xG-00 0Mp W$  ` 0 Ңp @͟PP  0  Ƣp@  0-@Ѝ@4P  P j/p@-JP }3S P`4`30PV  0s3$ S"0坠P |2 $R 0X0S 0L3 |20X #$03p03ppp3(p@-jP 73S @P4P砡30@Sp@虡A-`P\ J3S%sW" PR@P033SĔ S*/W 0B@ ^0,  W0p,030!C  ! L! \0|! c0000WP3PSSpP4Supp3PUpp@-@P PX0:|"C0T0XppG- Ѐ\-P@p  `6P LTL!VW R T VW  H000S3;0 !0 0O- M0@DT  =pԡPP5P( U9 ЍP&` U$ @ءP  0 x0 gh `  @RYd ` ` Ѝ Ѝ0 Z@0@0h @-?C 0@   @ ,(  @@訑PA- Q@PP% pW# 0 0S0_,]000 R   R   R  P HF4B`T `TX *P Q Sp  QW02'4p@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S GT00SpX@ |'(@ 8Q 0@0ppp@-Xa@P`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0p?pЍT0T 000S P@ ?# Q @ $080///d@(0( 00Q0/@(0( 00Q0q/ċ@A-T0T0 0PRp @`?`,GH舋@T0T 00 R X@0|78@08Q0@0/ @0 00긊@0 00(ꔊ@p@-`0`0P@T X0:|20T1S@0?;@0]<000080S@078@0wpl@P Q@0?30R @080///R\/R/p@-PS `0@H@?GppP X @0*|"7 8@08 R 0@0/P@/*p@-|`@P`P X0:|20T1S@0?;@0:8000080S@078@0 p計0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/Xp@-@ P0P0 p@$@@p@-P@ p@p@-l0l 00 Q@P00R ^ p@ p@@p@-D0@@ 00P $pp p@\@p@-P@$pp p@p@-P   ` @#ppT0 T ^ @ p@@Ȅ@p@-@`P#ppT T  R @ p@p@Rp@-P@00S ^ p@zX p@sO-`Z`Yp0Sa0Z,0 0D | 0 00P0qpYPY0 0CPxY0IS q 0P0/ 0m@0Q /p@-@PpP`P0A(, ,1C B00P00@UpP 0S 0@//P 0S 0@///// ///O-1!000, S 1H`?c``PD % AAp0@!qW0 8 0| 0qp@W0 0C@ P @ 0@ll 0 00@k@T0 ?o2R0S P/( 1  //xH-(^,0R0SQ!R@O-A1 0@ 0MR03p P `ࠟ, @ 0S" ß#SßI00 0C ```P  (0R0 (000 0 0C00T0 03/p 0PS@  00 Ѝ\jp,(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0Ps (0@SpP0@-0^ @ 0 Q@R0O-P M@ZU``J0S2  P0  B( T0P0 S `-, 0 !S Pp0SᴀK`Dpw0 `| 08pP Ѝ0 P0 00 S RP Ѝ,P e,0ڔP 0X p 0 ``F0,0C,(`aaA0  0 U  0p0E4屔P  p`, 004@J 0U` p0EpPT   PB  0SQ 0 0QPC 0$ 0\R R 5PT 0 B 0C G-8@P Pp5 0PUPAP0S%X0#P 0 `0UPV`C ` 00 RF `C`V` p[ t1 $p00S9 0PAP807`P,! R ! P3 ! R. ! R)  R 000U+Q*P0 `0U0PV`  `SW Ѷ`x0 @p 0 $pXPD0U0P`W`PEPpd @,PQ8 0 /$ $\/ P/bPQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U E]pM D10 0 QT$ D 0R U EKp; 0D00  Q P@$ R U E4p$ 0$@ P0*@0B0TP @T 80@Tp` 0Qa @,PQA-p0p`@0@* $ PP r@T00T  0Q@\_ P/ 0S, 0@- \$@T\8x ƌ8 t @,A0@PU 0P0U00 S00/Q?XA-$@0S00â?P2 0\-@ 0T `ApB 0S#0^ 0S0pW FJ@ 0 0 04@U/80Q@0@080/A- p0 S B0@( P`0,,0A0C1!0 0#0`S@( X0@-8  PE? J0R|B8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M 48nڌ`pᾐ@Ph 儰到᷐P,c őPP0` Z4$ 0 X01800a0 `X`F$pT`   @ H | P <L06 t1\ 80` d h l p  ЍP47 { P; 0 Q" Q 0IX   pp VP PʮU Ѝ@ Ѝᗒ @ ᓒᑒ@ፒ ዒቒ @ 儒႒ ဒ~ @ A-0QM@PP(C p`QAR   B P1 \.X) P$,P4PP D0 D0H0RH00 p0$`P!b@0RЍPЍPY@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-@M@ 0HP`JUp`_WNVPED  0  PI xL1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IPIP ЍP @xW(,0@-@l0l 0 \ B/oM "0  mPP 5Ѝ0U@@-44@M00 RЍUQP-D00M  ( @0:ЍT8 /00@-MN 0N00 P@ 0 0E DЍ0O-0 0p@%Ctp@-APQ@`R }10  R+ 0  0O pp!R!  B(B((00(!C R$C1Sڸ0@ @Tp!Rڸ  *d2 00000S % @T @TUpx00 QPڸ0 Pڸ  4040 B @TC  -M 0ЍC- `?PpPEIP$Y/ P@  N @DT`F࠱V HX $ P 0CA-A1@`P0@00 !p Q% , :! p!t1pP0 0TMT1 0@00@0P8010 R00SAP-  0p 0P (0 0@00 @0 0pP0 00 0@00@0P  P800 00L  @08@0@ ~tdA-@`Pp{TV,1 @ 0 @A O-/? dM$ 0*#R$/@ T<  ( ` (`RR(080@80@K @ ?0Ss$?@P? 0D000D0 RW (@9D000h0S80@080, 0S0$ >0(0 RJ, 008C8S^? 0"  @HDHT,0Q0 (00S<0S (  R( ,  HL ,T ,S(0 0 40,100 180<00,0 10 l=$ 0p0H |0D00H00^p  0H SL0HP1<08 0,0000],08 0Y 0Y 00S0S0A0P<08 0,00 1 1 01IY0Cڸ P0D00 L  /o^" R 0YP@o00PP P 00P P, 0 R S R  0\ ɟ`V 0HX 0X pp 0 0 AR SsP  P ` P  V  0R  `:$00SYD QS 0C00 S40( 0S(00040 0 S(00 R4 000:3s L  RL   000Q00 0\,0(08C0,Q 0,7P 1 11RY@ڵ0  R1 8 r ir$0`V 0\U 0HX @ 2@ NN Œ Č Ȍ N LL\oɟ`VD@ 80`U 0P TD0D0 R 0 R PP! YR  Y; $R  0E0 p0   0E t D000$R $ <7  eD0@00!R Bt <000V  0 B0C 0$0P<0X *1d"0@|6$  Z 0@P`< 0P8, Tp P$T000 @0pG 1`11QUr 00S400 <0pD0 P 0X *1d"0<0V @ @50S  V0A0 0C0 R d1SEdЍ꤄ 1P VUQs 0    k<$$ R 00S0 d?3Q@A`pPLp@` 0?3V 1pGW1QEP @?0D0p00L00@ 0@0@00 XX0ᏈP90L0S S ?(080 ~ <00  $20 p`dЍ80 00@ 0Cq00S02$ 0D000h0S(00S5<0 (0 S<00v<080 @0 80^R00C\0Rʕ@t& +,1$ 0, QRp! <,\`@VP  V@P  P0,p, PQP.J q <@,T`V@ \> ,\xhTtD t L eV@ P0 , PA,\,PY AIa,@IpE ! W   P  X,00,0Q00 , BCR4 R0<084 00C, 00S<,04 00@0@0 0,00400 00 S` @f` P 0, !Yp, 1@S  Y@pL ^P0000 00S000 00 0S 040C04 R00CQ8(0 00, PEu1 PAj0, \ p(@0<00  w 0PU@`0V0S 8Q004CQ0儃V0F0<00DPA `P | <0`0PL W H2 D| p3$  D0@0 0Q. R+ dP(  %P d1S $ 4  tPp:U U6` p 3`FV EPEE(0,,P 0E0JLp0s  0E = D000P  UP00 : ,0R<00,P 0 0C 00Y 0C040~ p(& 04&80 0H0D6,0@0L 0 G40 pRW0P R  Y RH RLR)0 S+ 0PU0a0P@@ a lF ,@DPQTP lF@ P0E0PE0PEQ8!A00 00C,0W<0p0,p,00 0R0<0 0,P0,0 000 0 0WڭL 0S 0 PCD0U0 <000p]P4/ pQ, S4S Yô4SQV H5S4X  8$`@ 0 `]D 00p~0 `P00P9  n0D` 00 B0 b0P P30 0pU0 P'%PO p0SL 4S 4S Y00ôQ0S8 L5S;  \0:$ @` .0 `D0 00p!0 `D000P : 0D` 00 B0.  00Q0@0`` 0D000P  T P"  $ |;@ 0   D000P ;$  0 q R! U <$ @D0 001S U \<$ D`@0 0PL5S 0 0RU <$ @D0 00LUD`q 0 0L|PhoSPk4SP 0 00@D000$ =@ \0 `C0`   *D000ȔY  p F0 {\o`D0 0H`0UPy D00 ! UP    `>$ D@0 0` U000 D000H%RQC    `P?$ D@0 0H`U0P0PU# 0``U @P @0:0x?/0 P, @0HPH,p@-P0P`@0M R    80x t00 0 000P80  H000 0 B/ 0C?0 0 Ѝp 0 00@C-M048lp\` d0h@`Pp\P  Ѝ80 800 0 pCB`Po_`PЍ @-@P @TG-1!00`0DSHp0?sppS-, P !Q@QT:!80|0Zp@U0 S00? P R!R0 S   0 00@ 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP0 @ @T $U0` V P`厂Vp`=0P 0@PUpT` @vT @pp  ! !@-@P@_T R/A-p0,SP` @T @IT0`SP R0Q/ C0A "" Q/@-pQ*P`@ 0N "" T0 "" ^\ 0L "" Q\PW`@@-@@@0S oP$0C$LO-:z0*Mp$P( , pPx x00^b Ss @@lRXapH\ 00 4@Y @A@0 @TI Q@@[@TAP i``FF\W0^0  | aR\ |`Q'lQ"  @CP(L ,4QT S$I@0S 0P0$ 0B$0xX0C,4Q~ @CP ^a S_ʠ80,40SoʌHh@` 0 0,` $P,04CS (` R 0 KR  8  80  ppP< `' 0(@Z q @@lR@A'@T 00P0S[ y0P0$ 0B$0@'  00Q5 70,0' 4(0P0K0 F @& $P)0Sx600S00l0S$ 0 S! & ,40Q$0 lP,0S  -P$0CP$(60 R(,Ѝ 60( $0(0\CEe@` % (00 S5$%P0C (00xP0S  P$0C$@D% 04 0,@0(@Q 4000XV 0Q[Q $ Z 0$0C ,0(@ 0 K[ZP pP40,0H$ , 1 10z D 4@000 P ^$ $@$#` P(`h0 Rv ,,Uq  P+ #  t# (`$@ ?#R WG( , #\ $6 (`  P 0(`$ R  ; P $`@ lP " 20,,40 SN   P20$ 4B@0S  0P0$ 0B$0 $ 00P0 ! ı 00(@S7a` 10(@0 T0!0@Dx P(@0S  0P0$ 0B$0}`,0% a`0S 0P0$ 0B$0 i`,0 \|ptH@,$ 0ܷlp T ̴ȴ(ܲH,O-PsP3pLC@00 S ̚400040c`(,P Zg34@2`0T5"0C S402P00S00h0S000S200ʐ  0@DS(00S 00lP 0S D2 4204@,P0T0hPr RP0 @P 0( 0CS P1 P1040 ,( G@P,P  Q@1(`0 R&T !P @T 0 R 0 P'  u 00 lP ~@T00,P 00( 0  04@S]CPE@DSP4@,L04Pl _00SL004P ,Tpt|@- ,(4 00 踬@-  ,(4 00脬O-\1\!0 T *⤒Y|20`1 50!Q:|20t0`1=Q,00S|20lA0 0!Q:|20h3h0 s0!Q j0!Q ܝ t/p@-x0x 000@00CS0 S 0 S P00FpW|P00p@-0CS@0 S 0 S P00(p9|P0p@-,0, 000PVz@pp@-PLz@ p@-|0| 00@0J0Q P R, !Q0000h@0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0PQ`@| zpP 0 0C Stlp ,0A100A!R   A BQ(\ !1C K" Rw   IK5 T0 00Y?3 0Pq gvPP| 0Y0 00 W0(@p ڼ T D H0W D@ 0 ( 0C P8g$Ѝ00$Ѝ>T0 S80 E 10@D @D  BT cp`$ЍHȏ$Ѝ 00C! [ @ D0 |0p H0K002 [ @T @5xT @ @j 0 00@p@-@Pppp@p@-@80800P  @ppp@@O-5\M0@p0y`Plr Pu0P 0l X0P,00Y0(0Pp0@STI5*PO`(PZ0pP00PEPUA0 (00SR , *  ` P CpER2C.-,0T R8 ! 0,0 x x4(p0[lH0`(0(00S(0U(ExP`FxPJ`xP0p0C0   S `   PR,,(0 !R0!!ر$(PQ,0 0R!1P10CP E" R|  KPE X,0V(0 ,00P` `($,,0@D$8 0 40PU` 0,a00C 0 Sd $ 0 (0C0S00 SRj (  = x0!( Z ’ 0pH000(0`0Sq P#`p (``(00S0C(0wP 0`F S0p0Co0I! U 0H 0000 1PE UwD0|0 p v \Ѝ"P 0],0T R0P,0 p `~ `v \Ѝ` v tP /0 0rh@M,P   00ЍdЍ/4@0@-\0@X 00 MP p T  Ѝ0@G Ѝ0@p@-@\ \  M` Pp T  Ѝp@(Ѝpt@p@-P@ppT p@ pp@-`P@ppT  p@p0Q /0Q /p@-00 0`@P0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00\O-$MS LPP`0X p H0@TI !  5/ 00@T; $T <RX! "! ".Q  R > 0tP 0 0 H 0y00 P  0H8#8 S R0?*@P5/@TY$Ѝ0H\  8#8 S R@0刀0 @P5/@TX  Q" @-@ RM !R "R pPĜ\  00@[Ѝ/0Q " @-  MS S PpP$R (@2Ѝ/-4M0 Ѝ(@-@000M, @ЍЇ0@- 0\SY ^S9 %@@ ,S'Sv{cScX0@4Ÿ\C110N00000}00%@000@0>{C0)@@PA 00@S801P00A 0@@100CT00C0 S\S:S '000L0d%{t\QO-M  q\PP 0p p00047 000R0pp  0`P p@ ,R&Ti \ @ @   R_  QS%R +NG\ TRQONMqpJIHGFEDCBA3?>=;9876543210/.-,+*)('&%$#"! ?   R Pcsm 0P0Ѝ% i^@@ @ `f`00 0 "!.Q *Q0 0 0RS@  RP%p0 @ % d^ @d  @  R z @    A6  RT d @    A   RyP%p0  %@@c   n  RTP%p0  %+c @@ @   < 0     B0  <0   0 @@ @D   Tp P0 S\R$ W 0`C0@ T$<0  0  p/> 0000   0 0S0\S 0 S0 h , p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0|||l|A-@0MS0H0D!0@p0S? `+ 01QÃ!1!1"b2cP0A @ 0L0L  00210BP 0 pW$P@WP 0fSPЍЍ 0 0ЍN\ gA-@0MS0H0D!0@p0S> ` 01à ‚0  @P0P0A 01! 0120BxP 0 pW$P@TP 0nSePЍЍ0"0ЍlkLܑ >C-@0MS00! 0p0S2 Pl 0R`1H $@0!b4!b H1c$a1c0@` 00  0#3c`10B P pЍ 0<0qW X $`0sSP p`VWT 0S oPpPPЍ-?L@ *S0 O-LM 뀐l YnPH $0$ 0[0 : 0 @PP: @P 0S  R 0[ M #[ =[ =n`P` s000`0||tpP-  [Vp p  RR soP X,     PnV n0PS9p H0 1$ @ 0ph3hs#112cp0@0L@3Dc#112c0A0L06`b1a`@50Pa `0```@$@b,`Hp`V @T 0@0 EnC= 0P@@ :n8`VP00LЍ`, 02r#!0‚ƒ0p0@ 0200A0!1 120BჱP0I `@005`0 T!2H1N $@0!b4!b N1cq1cp0@χ 00  0 3c`10BP 0tS0cS0S``d0@0` 00 0< `}0SQowȍ <N g|kLl >-?L *Su O-@Pp`0\ %\0pS sS lS@ 0\TT1DW &01 CR0@CUPO-pQ qM P`@? 00S040H P$  l0H Z0   RT0P G@T %<%T 400 R,A*Pg p 4 @@TP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+pmP" 400p,1S$ 0C-11@ X 34 00Q,*P 0 op 40P4qߍ00g0\ !0D]SCBuw~}~z00D Pb@0A?S@:T;X0D  R S񏐀E~}|{zyxwvuE9rqponmlkji.gfe5cba`%YP`VqkP`Q 00040hkP,I 000XK -00.0\0 l 0\ @:  P160@00-00.OW 01 1ऀ01p@!R1 0BS11ऀ. pB=1&@DqVTwzq^L6$qW pG=1!T0q| ~T0OWq  !!pq0p@,@10D RHp%!R =1X@ BT!g <X14 00Sb*,Pq 0 m0p4 040O R   ?R ;R   PR %R0 0p!OR#0S'S ! 0S'S'S@@pAT8 @D=AA0@a DQ! 1pP1S 0C-110S R   ?R ;R eRQ  PR %R0 0 0000 0 B10 OQ R}R0  R}R}R@py@a0D RA0DSI13 DOS ͍!!010pSl0@0l0 0St00t0U1S= 0C-11@ST@400 Q,>:p.kPAT @Dp=1AP VOT=q00=1@Ap@%c`X] ẇY(V0QXPKPF@oᨂAP<X9 ᆮ5@2/QJ AQF Ap(080H0b0PA `0  P0=0  P 05 ẀP/Z P   P' P  p! Y    p p 0@0 0@Ѝp@-1!000 @S/ 0SpQ @\T 0Sp Q00pPUp:`AoobEU@@\S@@ T 0SpPx0Upp謡A-`p PPU@M"R& \cP !0P ᴀ0V00  p000 00 0ЍPЍa p000O-@0P 4M 0%P `c`Y6 p| PP  p Ac0P  0M c` +PPbP c0 0 4Ѝ 1 cc0,` pV 0(0$0,0% PH, , P AR   0S00SPq `V  [㼢 P"0 0c0L@ Z$ H0@0D0L0E p,f[8  ` 0 `P+ Z+  RXEEhn[EXp s[ "`p0S   p`,P p`0 0$5c 4Ѝ  p`R0^K0 0XK0P 0U` < A-Pp ``V@M(R, ,bP$ A0` ඀r000 Pi00 0a0 P P ЍPЍ`@-0P pW@` MR aP 0 `7 00P 00 0 ЍP Ѝf`0O-*LM< <, , 0`P |(PP0|0@P00 zPZU PgT 9PXPLaP  P T 0U 0, PPP! 0p)$0 0 d)0 4 00HxZ 0s 0PS , PP R 010#.R00SOR9 =-@P#(`P @yHDHt 0n P DKD0 0SP P*0 & 0S t0 '000 00 n0P0TS0 P0(0P$0`V (0$(0Q$  a(0$ P7 $`Q^ @Q ` Q0Pp )\QPyY?%`V`^Q`V `@VzP 0 &0GS(x  0P]a  LЍ@0@S hFhvP @0f  IP@ P:0A PEA/PVrTSRQPONMLKJIHGFEDCBA@?>=<;:\a76RZ3210/B-@+*)HVRQ@ Qw, @  @, `  `p`p^$ (05 4(0h(0` p`` `` `` `  (0B(0``#t 0 S00P3 ( L0AP ,  0 80T80( 剑T0IY【pn 00 0000000s0 P]`hFhvHDHt8 P0n  PPG 0S00 DP=0 5L|P00000 0f0 P PHDHt0 0Ps 0  P0P0 D` LЍ?V` L0  0po0 v{0 nsl< gl( p( !`Ps$ Ќ   t , P/`$P00//ᰃ @-M@F0 ,0!1l!1"b2c N0L 0 0@@0$@B!A@C0PЍ赁N@ g P0`0K?//Ȃ @-M@ 0 0C B0  N\00L 0"2<@0$AB@C1dKPЍkLP >$0P00?//܁ @-M@0 0C@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$$C!d!b8A@C1nPЍ-?LD *S p@-0P0M`2m@P 0Ѝp\00  R 0S"0Ѝp G- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00 5܋4@-@P ^^^ ^$^,^^,00!R  !3 001/3001P//h3(@- M`p P0P0@0Ps ᜁP 0ᑆP Ѝ 0@P ЍlC-@P,MA!DDH PNp`@\ }Nhrq]HL8/#~\H3  ize6t~-s 0R>*_ri*'?*SRQPOLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  $T "=4<"!00 0$ ,Ѝ0^0 ^( <;0 0T 0" P 0$ 0^0s ~^ :0 0T 0" P 0$ 0c^0ڤ:0 00/TW  Pf 0$ 0c^0P:0T 0 0,"P::" P 0$ 0c^090T 0 0" P 0$ 0c^0ڤ 0T"   P 0$ {c^\  :MT"9" 0Pj P 0$ Z0c^0 0T"  0(K0c^0ڨ80T 0 " 9"H P 0$ 80c^0`80T 0 "8"5 P< 0$ %0c^0Z80T 0G"8"" PA 0$ c^T  0" P 0$ 0c^0Aڈ70 00r P88T" P7 0$ 0c^0*$70 00CT Pq 0$ 0c^0^60 00-T P' 0$ 0c^0|60T 0"6"P 0$ 0c^0460T 0"t6"P 0$ 0c^0050T 0 "@6"P 0$ 0c^0ڤ50T 0"5"}P 0$ m0c^0\50 00T" jP  0$ Z0c^050 00T"3 WP 0$ G0c^0r40T 0_"5"DP' 0$ 40c^0bڄ 0tT"  0P 0$ 0c^0840T 0"\4"PE 0$ 0c^030T 0"(4" Pq 0$ 0c^0ڨ30T 0"3"PW 0$ 0c^0`30T 0"x3"P8 0$ 0c^0>30 00T" PZ 0$ 0c^020 00T"| P 0$ 0c^0mڈV 0 1T" r P 0$ 0c^0420T 0"T2"Pf 0$ 0c^010T 0"2"P 0$ r0c^0Qڤ10T 0A"1"oP 0$ _0c^0\10T 0"X1"\P 0$ L0c^010 00T" IP 0$ 90c^0q00 00T" 6P4 0$ &0l d X t ( ܎ X ? č h 8 D ̌ d `   0 X  Ȇ t H G؂ l , Ǥ ( ,  Ȁ 0  4  p     ~ p @ ~ ~ @~ } ~ } @~ } } T} t} } } X| { { \| l{ H{ { ${ z z ! @-DT| x| ?0c^010 0 0"T0 P 0$ 0c^0X10T 0"l1"P 0$ c^!ڤ T P 0$ 0c^010T 0"1"P 0$ s0c^04 0T"  pP 0$ `0c^0|20 00T" ]P 0$ M0c^020T 0"2"JP 0$ :0c^030 00T" 7P 0$ ' 2T"!00 0$ l30t30 2T"!00 0$ 30 3T""00 0$ 30 83T"Gu"00 0$ 408 x3T"rg"00 0$ D40c 0CTV!00 0$ 40H P4 4T"B"00 0$ 404040 \4T"."00 0$ 5050: 50 4T" !00 0$ T50\50 4T" !00 0$ 50506 45T"$"00 0$ r50_50 |5T"!00 0$ ^6060 5T">!00 0$ ML60/ 6T"i"00 0$ ?60Z 0ᛉT!00 0$ (60 6T""00 0$ 70 70H{Tx!00 0$ D70iLy 0gT z!00 0$ [Tn!00 0$ 7" 0^PXT{]"00 0$ ^ 09TL!00 0$ @80H80 8T"@;"00 0$ |801 `8T" -!00 0$ 8080F80- 8T"Q!00 0$ 90B "00 0$ !00 0$ ~"00 0$ xz0P h)al9 nt90 0!00 0$ d"00 0$ ^90 0g"00 0$ T!00 0$ Nᵈ!00 0$ D"00 0$ >"00 0$ 8"00 0$ 2"00 0$ ,"00 0$ &"00 0$ !00 0$ ၈!00 0$ `z bzP  ;߇`p 0'rP 8;"0St!00 0$ 0S k!00 0$ 0S b!00 0$ 0S Y!00 0$ 0S P!00 0$ 0S G!00 0$ 0Sl >!00 0$ 0SD 5!00 0$ 0Sc ,"00 0$ 0S #!00 0$ 0S "00 0$ 0S6 !00 0$ 0Sp !00 0$ 0S !00 0$ yPs 0$ r0S !00 0$ i0S "00 0$ `0S !00 0$ W0S !00 0$ N0S !00 0$ E0S "00 0$ <0S !00 0$ 30S< !00 0$ *0S !00 0$ !0S !00 0$ 0Sm !00 0$ 0S. !00 0$ 0S !00 0$ 0S z"00 0$ 0Sj q"00 0$ 0S h!00 0$ 0S _!00 0$ 0S{ V!00 0$ 60 0x60 0H"00 0$ B"00 0$ <"00 0$ 6"00 0$ 0"00 0$ *"00 0$ $"00 0$ "00 0$ "00 0$ "00 0$ "00 0$  * 0pP D5"  0pP"5"50 04 @@0 40 040 0t4 @@p0 ӿ@4T0 0ʿO440 0O30 0฿O30 0௿O30 0ি3 @@0 X30 0y!00 0$ 3P0 02 @@0 uB20 0l20 0cv20 0Z\20 0Qm820 0H 2`0 0?I1@0 06!00 0$ 10 0'10 0Ll1 @@00 81 @@#0 1h0 0D0H0 0n0(0 0z00 0t00 0׾;P00 0ξ,00 0žMv 8v s u t t t s ds r t r s lr r s (s lr hq p p r p p o q Pq o p @o o p n n ŸA-P@| Q 0AA M `4660@ pG0?p P0C`Ѓ0\?  P @PX P0. BP@T0 ) S PP0C0C0 QKQ0@* M0  0, l@3<\0 0g 0+|P@056AP@ 0` 0CP@u` p p0l8 `0{P u@`@: 0ЄP@@@0 Yn?A-t ANL\0@Po>\DQ; 00P \QHTL a`0  046P0e0(#67(0a` ۃ 0 A03\ \ ANN1 0QU^꽃l Tl /P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BV@1 V @D 8,0400G0, 0 40@( (8/P840, 0S004R000@-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0$ R(400  0@=0U 0PE@T$0S0  0@4=0U 0PE@T$0S  ($  0  88 (90,K  @Uv 0PE@T$0DS, 0 E0@+@<0U] 0PE@T<($(<,00@000;00SD @x<00 00CS:0S ;008@ Q;0(0 S0(0@080t0 890w4;0U 0PE@T0S  :00;0,@:0000 pC0 0,0S P<@@B0S 0*S3 W 0PC000000 00 0 0#1<0 S@0@0R0 RR<,0 0PUS0S00)9 0 <0 30DЍ  R S R  DP?0 P 0pBS 00 0 C0 S 040U 0PE@T00  BR00S  \ 0S0($<,(<0$(0 R x800 90 00 80B4 R,5@0 000DQ1  P !ADL B \000D0S707 UR00u0 0P <@@I0 (S0 ʆ  P<@@ ;TU 0PE@00 S  SP S= 7威@D00@T80PE@TULQ60 Q H0 @S0 0CR*ʆ+R h6006000LQ`D0ʆ;460\0T 00T :0PE00@SUld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@Tz 0Sw 400h50Uu 0PE@T:0ʆD+1 0D0@D8+Ua 0PE@T:ʆH ;0 H @D;8^Dp840WS Up1 0Wp!WC 0 0C 00 00D0PE0CD00*Dpl `R*$0ATU% 0PE@0 0Rl @Dᨁ:R (0,00C 8 P0l00X0S>0p0P0?0X00 p0tP 200P30 R=0 U 0PE@T20H?o20$0S0G "d2$($B0#22cR<0S 420020 0L$Q   R D Up1p!W)R0 D ! $ R D ! $ R$!  $ R40,0000 100HU  PE@T  ( !X% 100X100+000;8D@Dt00 R  B0 D  0P00Wg g e 6?7?8?=?>?N?O?5?b P?,RM?a H?A?L?^ J?] C?pZ BY 9?:?;?0@\4 @Dʆ+8_04威@D0E D0BT4p(8#W" d400(40:Q  ;8D@D _ 0;=04HL0  : 40040 0@S4Dp0K Z0PE@ZU8tgx|p@p ⨃ ^):l0 0:00pZl0 0S 0X00\050P0;T0500 @D{5威005@D0 ;@{ 60050@ 00l(4890 (8(8:0;p600P606l 0XZl0PE@ZfUx 0C00Se 0 000 7 0pd41q岠pT*UR 0`4`UV PE1q岠@pW0`8@DQ{8D@D+8tgx|p@p㨁T7L0Q0 PpC$ 8(89v0@+Y\8@D 0w@D(208l0P0 0 0P00<0@@30 0`pC( (0R@D0+S(0,80080 0X0S>0p0P0?000pX0t0 04P4. `900p8 (89IgSR: @3 0@0J9@0j900900 pC \ p 0T d \ 0h gP P:00p0 00威@DpC:00:0 0S:0:0 pCtp@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000Ph@Pp`W2@ R2Q <00 0 0S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S3# R0S  l0pS0pCp)x0 00 0P,04C0p0 p0 0 0 30 Ѝl0Sl0@@@e:S???8P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPYP 0!(`3/@PR 8X8  ( 0(3/PI 8 S(!OP S>0Rp:oRS B P T  B T p X0Bp  (08#18@p 0BS.  p 8 "d P S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?00@C/O-PM@ @㬰(0U 0C0 0$SP $Cp`0 sRpW-(0p p0Ѝ0` Q`V00p=J\S 0W0T0S30b608#8P0U 0 CP0S 0SCU\! V ! 10T2 0 T 0SЍЍ0D?o 240%R00S020,0@0000,004@0D?o280(00<000 0 0 0C$0 0S03@05 :^`033N , %0! '05 %0 %!0(P<90C1P RP@00F3 0S C 0 $Q B("(R$AVG  ` V$  \ F Y( V F(*Q BR  BR^ : 8 Q  Rb4 %Q  R\<  BB!   S @1@ <01( 00 040$0$ 0 08@, 00SJ G O-DMX03 0\0300 C  2 00!8ӗ1х1&=  tx l0J B0x t HH^Hl0:8HpXT`!Dp4`ᶐH@ᰐ00Rx0 Pl h`0 \0S8 B0l0\000S[ tCP`tx0l h Rl R010#P60 6SB \0P8 Brl0\00PЍl8  Ƒ R0Ƒ0Ƒ !  h0\0P8 BEl0\0{00SЍ!  O-d $M tD4Yl 8H0XT0#D04@@QH0  ,0BA?C0CP`PƘ_p00B8#( Ƙ#<0Ƙ@t30 B0(1I>RD30+"8ӗ1҅1&=  `tQI Y 6R06XP0l0t080T@V` l H 0U#@H@0 Sl \P8 B0 l0\000S}$Ѝ806&6 &!9096tl I Qtl 1Y^ (t0!SX R S. Sl kP )l `f@A p400D`H0` l @5!0 PH0 ` 0 ll R1#\ Q \P80 B0 8l0\0n0P$Ѝ\P80 B0 %l0\0[00S$Ѝ$  O- ,0 IY!0 M@p䴟0UYZ0e&P* U! Er:\l`T`F Z PUP!Y /ooW"Z  ]ZW  00 #4 B %B B  0BV V`!0\ 8  #\ 0  PE0CU`0`\  Z  BP 0 P  `QP ,8\t06 A,0l06\0 `QPl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \ȷ6&S06l0R, ` 6V`!VX\, Q* 65@ 0CP!P 1RW G/o"S W  R  PR#P`1`!WH80  O\00\0XPl<N^ Al 0|&lR &&0R8  0C j6,AQ  l00l0&l8 j, l0BP0l0\P`1`!W 80 \00\0c  PR#P" 0S $0S 0S P0X*SES[SgSqSS9 C0//O-PM@`?o2P0S}@0S0x S t0Ss0,0S$ RiL0Dp 0CpB 4*,0lp\p v`FP0*SWtpWT 0r ,00VpG*0*  00 P  t0S"l8P pLpXTD@4H0P  ;. 0`RH0`0t0l t0Sl  l \  60 tx`h  00Ѝ* ЍA-@P 0S $0S `PcpP l0t,@0S@1VTU@80C ^pp@-@P$ 0S! $0S ?`PP`0 S0c``,0S`  *00 00(0p`p 900&p@-P@P pP,0L D0<00 B@C b0\ 0 1 0|0:l@\@t@Fh@H@x ` pp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:`k6 @cU@ĠL Â0 6PUWtPPA-@P P 0S $0S p`|P0p`P|0A-PQb!Tc@pTe?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`௟0P 0X 0@S P X 0S\\ \((PX\ L\  RH/Sv0S[Q gQ 0St0S 0Sw RH R .0 103/0@S0S>0 X0S S000 00#400 03 0  0#400  0 n0S0c0?o20 Ѝ0So |= 000=St *S/0Sq00 0 0&S+Bzl0S =  B0#2 2c0# 0l0Sl q000(0S9QH K0t0 0 0  R 0,0S0Q0Q0$ 0Q00R 0000 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00Q P p K 0S  0PESo p W *PG ళ0 ,0 SR0 B0Ztp 6l8&`6&6 &!909&tpl0pG0Qtpl0_ Wt0SX# :Xv| 6S \0l S8 B0 l0\0/0P0S P|X> X 0S0(0 Ѝ0S 0>0 0 0 0 0 0 S0 S00ӈ R01q 00 0SEQ1X P7 R $0SS@ ~S  z 00#  #800#"0 x0 0Ӳ ,0 QR 0 0I000S'  0 0S0   0S,0SQ9:z RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:L R+0 B0j00,0S!  Rg  S 0 Q)0S 000#40C0q000SF 0 B050#  #800#"0 IQ#V\ R8 C0 l0\000Skp\t0Z(l 8`pR B  ^L 6ƅp6ƅp6ƅ!909&6Rt0l 0C t0l St0 SX S Sl 8`p0  X 0Sq0 B000 B000,0I ^ ^  Y Y Y Y Y Y Y Io^ᩒ#Y@KP``0P0@&ƅ&p0 ƅ0 01I>  0001&=  &6`Rt0l 0C `pt0l r\0S8 B0 l0\000S500 040\` B  *X6I &R \ R80l0 C0,000K  |0 0000 B08L0DC0C Gt0S*l0\06\0l S8 B0 l0\000S410\ R80l0 CLJHFDB@A-@`pPStPB T00V0SI0S: (0sT Q 1@0@!A00000 |0 `dp( 0S*t l00\ R$6S S L D0 BC ˴060@D0 0!1 0Rpp$p@-@*PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pSz $0Sr wpViV`F0HSr0FSRnZ WkFoY㫲[dV @!( `4/@Pk * @ 22)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fx00$0h(0 ~ Ѝ@ @0  000'p-M 0 0 @ЍA-P@8PUPb8 `d 0x!(3/@PX `!@Y 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P- @ R* D SR$ , 8 +, @@ &L DD ! 0  B6 0 &-;> 0$+0;/T O-@QM R0  P " !#4"  Pp L` @ *@+)0 @$ %q 0 1Q`!;  Č ` 0#:  Č (9  Č p'4 6" Č$ !Q P%D R ` @!A <Ÿ0# !Q#4" Ÿ " " 01Q"$#00# " 01Q"$# 00#0# !Q#4" P% 0# R#4!@ PUTl RR, 0R., R., 0#00R,. R,.0#00R., R., 0#0PE,4. U#. 0  A  @Q   " !T#4"Ѝ\ !" R !@ -Ppp  H ` 4   C-PRp ` P  0!\0 0#@B .P@18R0  C @$'8 C-PRp ` P  0!\0 0#@B .P@18R0  C @$'\ @-@Plp`hPp@` 0!đQ0 0#B   @-@Plp`hPp@` 0!đQ0 0#B   0@-1@4P\0 C @$!0 G-R (h Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H#7cHN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq$R' @-7Fc20L c! ‚'b "0C0  L A R,A B<P C,0@P @@ /qR' @-7Fc20L c! ‚'b "0C0  L A R,A B<P C,0@P @@ /q/ U/ 0`0/43|5ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O- ş pjDMWP@TĆP4R DQ- NP0P4 \ˀB XS-ʨ&σ pPpp Q-Yp& B&^ ScB C 00 p&P4 À fXQP4 !\˒0C`K P4`ˀXT$`; BXKT$T;!P P PQ͌Q- 1^ 22 ".A `{5P4pST.0J`@T41\0 0 00P 00 p0U !Z㲰_Q=0ⵯ00 PQ !  W Y ^PA ׼V БR"S & &  R[P- Y> 0 Ό KK0RPKPG 0 QR0C Y> 00 B 0[0000C01 KR  00N 0 @ 00T00s P\ R @02^02N00 R0P\DЍWP 0 [Q / !@LY0S F0GC$FpQ@Z p J  =A-P@^1RPA@D0+}n@R- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O-鲠 MZ``00RF@P!kΎ  R: Q@1 R5 ৎ@0`0@#4``06 RcUQpPv @P0d1h Q&8pDFh R00Su P`0@ [ ЍZf0p 8ZC8 !.P eR&(B(0 @`p0p00@`#4pp06PE`0cQ38fC8N@Pa6x0UGx#800P``pp0P't``pvApgTGxGx B(Q"(`0@APP0@#4PP06cR!0C 60S 0 S  P[`0@J R+=ʲPpeW6`p8C8000`p#406PEP0cQVA Ui@DH$H0 APP 0#4PP06 cTB 0C@6qppPg6Q0#80A6`00Gp`p!0aUQ6A S4 @DH$H0 APP 0#4PP06 cTB 0C@6r `[0@P`0f ' B("(PV\PAV B("(06OO-ʀ6kn@SMN 3003P0030 0300300%10 Jb ^@N$H@@p@p. BnS.H@Nἦ6S&00H DH4P  p, ! Ḁ@b T H DH)& B @@$D @F @dXDH&DHqZ" tqN.r@jTHp DH'x&pp@@p$D@F J @d^DH&DH0CS㎀ޕޅqಠ᷀jB^@N$HI @@ @"$ &J bX.H@Nἦ p#Rs `D0C8#8JO6S@ἦj 0c QA.P`kNP!``0C0aR! 6Ѝ@ἦk. 06Ѝ | p d X 6@-S k>@@0 #400k.06S0k. 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&蜹A-`*k΂@P8#8 Q.;pNp!ppaS0 A0 0  8#̠  4##<V0 0    *60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k΁6 S#H$(<0  PDHP@ 0@#4PP06 c^ 0C6 S0Ҽ60k.@PP@0@#4PP 06 0C6S S00k.@@6 0C600 6 k>@PP@ @"$PP Ɓ0O-p0@S M,0S ─&]P+(+%0 N. 0r?010S#@P j600&6 0!R1Q  S030#Z0SkΆ&0!2 R8, C8000 #40&0bQ3 B8&C8(K R!"(B(k>  0 #40编0iQ3 I8἖C8 Y("(98C8k0 00#40编0iR3 I8἖C8@! Y98C8k.0 00 #40编0iQ I!἖H30M>0k. !Pn\ N ό Y.NP἖ p m 00`" P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 00G. 0R0 0xS0   0LSI>W&&&& Ѝ ЍO0 &k0! R2 ʸ006N.V e 8C800 0#406 cQ 0C6 C8&!἖8C8἖28C8἖ t p :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&   p@-@P`h0P `0P F@T @m000@pVp*(@ pyaratcid@-M @PoЍ@oЍ@-M @PЍ@@Ѝ@-M @PoЍ@oЍ@-M @PЍԨ@Ҩ@Ѝ@-MpP` @P è@Ѝ T/p -Ѝ賨0@-T 0p@-S P@0 C`'0@/T @p蔨 0 p0A-S Pp@0PC`'0@.T @x00u0p@-S P@0 C`0@.T @p\ 0 p0A-S Pp@0PC`0@.T @@00=@- MP .p 0S @p0@Cu'`.V ` Ѝ 0 0 Ѝ Ѝ@- MP .p 0S @p0@Ce`l.V ` Ѝ0 0 Ѝ ЍA-Mp@P `P {.p , 0S P0 C4@ ;.T@ Ѝʧ`Ѝŧ0`0Ѝ辧0@,T` Ѝp@-@lPo0PPptcidp@-@`Pc$0P p!00ploobp@-P`!@P   @Vp@-@>@@-@8@@-@2@@-@,@%@-@&@C@-@ @R@-@@p@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@3@-@@G@-@@`@-@@x@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`p@P   @pp@-P`^@P   @pp@-P0`PJ@P   @pp@-P`8@P   @ppp@-P`&@P   @^pp@-P`@P   @Lpp@-P`@P   @:pp@-P0`P@P  x @&pp@-P`@P  f @pp@-P`@P  T @pp@-P`@P  B @ pp@-P`@P  0 @ pp@-P0`P@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-P`t@P   @ pp@-P`b@P   @ pp@-P0`PN@P   @n pp@-PV@Y(0P p&0P 0pgntsp@-P`@P   @K pp@-P`@P   @: pp@-`P!@$HP p7P U &00ppatadp@-P`@P  _ @ pp@-P`@P  M @ pA-P@ X0P @p'`P  @P`*gntsp@-P@ (0P p0P 0pgntsp@-P`,@P    @ pp@-P` @P   @ p@-@R  @ p@-@"P $0P p00ploobp@-P`@P  # @} pp@-P@P A#@n p@-@"@@-@"@@-@"@@-@"@=@-@"@[@-@"@j@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@@-@|"@@-@v"@2@-@p"@K@-@j"@_@-@d"@x@-@^"@@-@X"@@-@R"@p@-P`@P  m" @ pp@-P@P "@ pp@-P`@P  K" @ pp@-Py@P "@ pp@-P`h@P  )" @ pp@-PW@P c"@ pp@-P`F@P  " @~ pp@-P5@P A"@n pp@-P0`P"@P  ! @Z pp@-P0P@P "@H pp@-P` @P  ! @6 pp@-P @P !@& pp@-P` @P  ! @ pp@-P @P !@ pp@-P` @P  {! @ pp@-P @P !@ pp@-P` @P  Y! @ pp@-P @P !@ pp@-P0`Pt @P  5! @ pp@-P0Pa @P m!@ pp@-P`h @P  ! @ p p@-PV @P J!@w pp@-P`E @P   @e p p@-P3 @P '!@T pp@-P`" @P   @B p p@-P @P !@1 pp@-P` @P   @ p p@-P @P  @ pp@-P0`P @P   @ pp@-P0P @P  @ pp@-P` @P  _ @ p p@-P @P  @ pp@-P` @P  < @ p p@-P @P u @ pp@-P`p @P   @ p p@-P^ @P R @ pp@-P`M @P   @m p p@-P; @P / @\ pp@-P0`P( @P   @H pp@-P0P @P  @6 pp@-P@! (0P p0P 0pgntsp@-P`@P   @ pp@-Pu@P @ pp@-P`j@P  | @pp@-PZ@P @pp@-`P9@ HP pP U 00ppatadp@-P`q@P  @ @pp@-P`@P  . @pp@-PN@P h@pp@-P_@P X@pA-P@p X0P @1pP#`P  H@P`%gntsp@-P@R (0P p0P 0pgntsp@-P`@P   @Dpp@-P@P @5pp@-P`@P   @$pp@-P@P @p@-@Q @ @-@R  @p@-@0 P %%p@PPh!0S c!pn\!0N@-$@@C!eMP 0R @-P Q o//  0S p@-P`@`PPpuP p@V dV P 0 o@-0 $ D @-P Q @̜@ @0@ a0 ( (0( b0 $ ( 0  @-0< X  m0@-P M`0! &"@P 0P0 `  Ѝ]$ppp P`   @J$ Ѝ B$l>(K@- !@P $0 0 0 ІA-pP !@P |0 0 0 t`!PP  ᄚP `0 000 ,0X $@ꄆ`  @-@P Q@ te-A-M pW $P0 P$@P!`P  0P$ VЍAЍ/ЍAЍ/ 0 0t X ( EБ @-@P @ 2#p@-@P x0 00R0 PV!0P Q ! p@Zpp꜄ p@-@P `0 00R P4!0P Q ! p@pL P/0 00R /ᐃP/<0 00R0/P///d 0P @-od  QP  QQ !/L P/ 0 00R/ሂ@-@P \0 00R   0P Q c!00P P/00 00RP///܁X A-PPM /o000"P R Ѝ R0 p 0 p `P 0 S  R L  # pP` "  00ꈁ d X A-@PM 0 00R ЍQP 0  ppH `P 0S h P # pP` "000( (0( $0 대   T + P -/o<0"00^ R  R/P/D0 00R /@-P no4 P/D0 00R /@-P Wo~8 P /ol000"\ R RP Q 9 Q1 /x~  fP 40 00RP /}d fA-$0`SM"P@U Ѝ P0P pP 00  0xP S ! y@P d0 0 0 @Ѝ4 PSP  *| J 0 //p@-PQ& @R 0Q: Pp P  `0` `0 L0L L0 808 80 pH d  D $ p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@  $@-@P@ p@-#@P  PP 0, 0p] @Z p@-PQ`@  ᬖ 0 S S CPQ 0 S S C^Q<S0S !S0-S0F?o2-Q0S0S -S0-S>Q/S `(` 0 S S/S>S C\P `Sq 0 S S/S>S C\P0FU0 RZrbPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0l(0S0$00>S`0``000 0pL L0L H0 0`uC  >R00p @ P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- vaoO-d1KM0 `p 000Y 0,A P @ Q+ U SaPP 03/P 00  @04/P 00 0 PhPPKߍP@ 0@;/ 0 @QPKߍ< G-@,9PPD aq`p@@0 S S   CQ R@<S,  mP   gP   aP0 S -S@0-S>Q@@0 >SS @S@=P@ 4A-PRM`Pp`0 @T- 0@0W   WV 0 /R C 0CW /RW  CW0  B/Q p!@C@T@!  s;@04D.0 0P 0 S* agp@  U 0@K0@ۍ? 0 ۍ٘ 0 ۍ S0p `P^D'p p@ C-`MxPW@P5 ,p`H 7pB pEe0R:p#0 `%t00p*  00 0tp" 0PPЍ0 `t00p  Ѝx@LЍE@@-@ s@8@-`P 0 0 J( O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`_a P0 p 03/V@ 6/T _T T @T@. 0S2 03/P V 6/_0S @0 R 2/0P`_ P V 6/X3 003/Iߍ 0 0C/ 0 0C/ 0 0C/ 0 0 0 |0 l l0l B0C/< ľ Ľ   | о \ X E 4 4 ; ,  p@-P@PP  P $0SP  R PSpd^P P ^PP , `PP$ P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0hP 0 $ \00 Mߍ R00 0 0K/댻 8   0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-@  ('p@-!@ (M  P l  ```YP(Ѝp<  P o(Ѝp脻 T $@-@ⴍM4'@-$@@ૌ',cp@-M`PB@0 @80Ps0*0 00 Ѝp+0"Sp@-M@`!P0 Pqp 0 00 Ѝp 0"S 00 S 0 P:\03#/S 0 P\0///A-P`` 9@P (spP  @P sjW@(0( (0 ,% a$ X ( 00 S 0 P:\03#/S 0 P\0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00R^ /P/0 00R / 0  Q0 R* R0:/- ^ : P *0 S0*/@@/ / ^P $0 00R //]P $0 00R //p]P $0 00R //8]P $0 00R //]MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/\P/l0 00R / 00 0  S *0/ ɒ\* /\P/|0 00R / 00 0 S *0/-  ^: [P/|0 00R / 00 0 S *0/-  ^: [P/@0 00R / 0 0 S /xZP/|0 00R / 00 0 S *0/-  ^: $ZP/l0 00R / 00 0 S *0/  \* /YP/l0 00R / 00 0  S *0/ ɒ\* /YP/|0 00R / 00 0 S *0/-  ^: XP/@0 00R / 0 0 S /XP/d0 00R / 00 0  S *0/  R* /WP/d0 00R / 00 0 S *0/ R* /8WP/h0 00R / 00 0S00/ \: /VP/h0 00R / 00 0S00/ \: /DVP/T0 00R / 00 R /! /UP/h0 00R / 00 0S00/ \: /`UP/d0 00R / 00 0  S *0/  R* /TP/d0 00R / 00 0 S *0/ R* /lTP/h0 00R / 00 0S00/ \: /SP/T0 00R / 00 R /! /xS- P M /o<0"00^ R Ѝ R ЍgRP/L\ /  JQ\/RP/L\ /  JQ\/LRP/P\ / Q/S/Q\/QP/P\ / Q/S/Q\/Qp@-M0 P000 00S Ѝp$0@S `0-S 0S0xS hP T CP ЍpwPRP Ao/A-PP@8@Pp t=0,p0P4080<08P`p @@Pc@HP@-@  0`@-(@@ ⮇@lOeb@-@ @O-4@T `,@@D¤@`T PpQㅑ CPZ P PZ  0 0 %4 H z @-R 0P< P 4Q ,  D D0D @0 0 000 0 0@S 0< p 0p?p@A-`P 0 0R4 p+40S @40S,0 PP@pp?A-@P 0`0VpP0S P @T @ @0@ <0R/8@@$?D A-PP /o0`0"Q@@T 00R p @P @T @ 0  0R/d>X O-@PM 3` 0R PЍ4 00R80p  PP @}`P ЍSP P3 e 004Q\ ]4[_ P,10Q1 0尉P0ZUPE Pm 0P !Kq 0 ,0傁1`4 <0 04 <0 ,XG<XIXKPUF ء0   ỂP"  0,S<SSL<PP  ,0P`<04 0<0v100 U. r ,P<PP_! p,04 `<0 0P4 <0P 0 |0^/l l0l h0^/T T0T U0c/=ht;h̔ Ē   $ ԑ G-@S ` VP p P  000 Gn 0 0i/넓 4 ؐ -0P M ?o@2 ^0S Ѝ00 S Ѝ8@-PP M @1 0R Ѝ`@P 80 K Ѝ =0P 4 Qp@ R(*, S1  A!-p400C40<00<0+)h h0h d0s/fT T0T P0s/]@ @0@ <0s/Td8  P Fؑ , H |  G P/?o0 2 R0S/00 S/60P -?o82 ^0S 0 SB/6P/0 000R/@6P/0 000R/6 P -/o<0"000^ R  R/5p@-P^@P 3P 0 03/P DP @`p@YpA-`P @P!pP $P pV 0P  pARo&ꨊ p@-P@PP  QPP p芊0@{녊@p@-@P 0@( @-@0P _]P 0R R@-P0S /Qo/808 80 Y$0$ $0 Q ď h O- 0S7 @`P. X0tqPptP 0 nP  hP X0UUUB!#1<00@.B,? VP@HPO X% XP0@#r 1pP 40S @,0a3, 40a@T:8 408 6p@-P80080p@-@P 80 0R@ pP0@p p@-@P 80 0R@ pP4@pp@-@P \0 0R@ pP`00S@#:p@A-@`T 0p0WPP \000P0000@S 0< p 0p>Lp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/ 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@q| P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pw80 0 @ 0 048# /UUUU3333  ׆: S0@- d S V Sb00Z r - w-!= S @^ >S-00 @Sx00: r-w- 0 SPD !S-00 Sx00r-w-0T! P8 P2 P8 Px 0    0Ss00 P! Ss00 @ Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-oapP`8 pP3  ppP$ 0A0o`@@T nsP0=S AP` AT BU !{poAU{ 0 C-hh"h2hM 0 PDH L0TPm PX`p ㌐吐唐嘐圐P(lp@Z pp  lp@e 7$P  0p@] X04S040p0@S400408<@6(4r(t(0[(Hp<1<0 00D00 0xVp&(X %z0S  ep@ k k @Ѝ#OoBЍ@z00 k k k,Z ,Z ,Z \X LX O-p`M@ quP-TPm +T@`0 0Tj W p p?  0pk0 ik P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R Lz "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@Py0T0PpL p@-BR"^p@<@Py0T0PpO-p`M@ tP-TPm +T@`0 0Tj W p p?  0j0 j P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R y "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@P)y0T0Ppp@-BR"^p@<@Py0T0PpO-MHP@Q@0@U P0`8 P0"0 @\`$Ѝ 4R2x"00/xP`!0 C$ЍX0 00T0 0P000uP00S< 6#R0P` U03[0<0P 0$ЍP`!0 $Ѝ?/%1R5%%;R:*%6R1!%?RP`PP` `0 `PP4 `0 `yLN M L L lL @- M|id@` @0S D <0 0 |0 30ЍЀ : 0@-M04B@ Ѝ0 0 0 9/mNA00/ᔞG-pA`BP@)Q" $Q J?XP 0 0U B  P1 XO-xH,M@p@0d8@0 S00@8`p0S $( ( jP@0+0C< W Pp  q 00 AB0 0 S 00PU-0 0XF0-SPU@~jP0-S 0!000 ,Ѝ ,Ѝ60p p -U0 ` :U`< + B R 0eP00 WU E :Ro 0S000L6L0@60`u0v`  60  ,Ѝ60Pu `0 0PEPCP0 S000500S 0:S 5 ?0P;R0S00BX0<L5 000500S 0:S 50uW 50 0+ C :R :S?k:i  0S`0  :R 0X0! $ 00Ol40`4 0$  R<$  = d0P0x C000Z p @P @`pp@`T  mP/qP 2Q z  Q Q 0@RpT`0Sp @@z `S 0RZ0S" 2 00S 0:S  X0 S2 00+ Cgc0JS0S9  00 S P0S`,Ѝp @ p1 00S 0:S  < 1?0 1 00S 0:S  Z 0 10S$000<1 00S 0:S L w00C 00S0 0 00+ C0 0 0 00S 0:S R t00P0+ C10<<,TD<w I I ԛ\u DHG Tt F ls L<s hD C 8C B $p > > x> > |> A-P @`0#03v0a 0Vp BT@! o 0 0R ! 0 pP   FQs0 p `QPA-``M! PpHP@ -P& 0`0p `` 00`0 @P YЍjs@00Ѝcs0PTR@[sPXs0PIRs@Px0 0 X, p -0   X4 < Q0  B0 BQ;  B0@-M 0@BPЍ0 Qp@-@ e00QUPQep e00QUPe00QR! /A-pRP`@ @T T !03/pWG /p@-@PT 0p@/pA-`Qp@P RxP0开D00p 00$`,@(P0Rr 0 A-P`pP@P< 0U0! V WppP`P`xP' 0 0 00㼀@$P,`(pD 0W xPxpPpV W XpX`p`LPPD``jr00[p||Xp@-0`@1PSM ,0S m$0S m YpЍp0O-M @:-cpP` 200S 0S 00*  0Sx " !?P(` r0S{ 03/ p" Pr0X S 3/ $" PqU0 00 P     @ P 00  00 UPX Y$p1UAh1pP@ X1$  P1, H1 (0 0ЍXq  03/w{PP 0HgЍq0S qaf,@q0@0꼰|q @ $ ~Psq40D0@-S @?d0 P @0P M0 0001 1 002dFq 0 p@-0`@1PS ,0S l$0S l*Appp@-@c00CS00 Pcp,P--M  T@Ѝ Ѝ/ -- M0 0? ЍЍ/0@-0P$M Rp P0@S&  S$0l0  B!  0$Ѝ00l L000 I0 PS@$  ꨄ2 S 2 P 4000S$/00//Ѓ1 1 A-ll 8MP4`P. D<  Q S  @2 hkUp  h $@kpU 0 0 40 30#8Ѝ@p@ pW vmP\ 0 P  @2kkp,@p@ \41 P 1 - M1 ЍG-p`D!D1 0!M40<80(1 pP4|@P !0 0 <8 304 !ݍ0 o  0 @pцP@T PCnt` 0 P8T\|PmP @T@ᦆ壆o C-!1 0!MM0<800 Q P00400 x1@`,|P@p4 D1p | P4000 $ ( ,  0 0 pprPP"@T Cn؀`0 P8T{P lP @T@0S  .@d L0 0 <8 30 !ݍЍ800.(hX p0 0O-ğFM M 瘔dčĝY`p@TX ( 0K0;d 0P0S  0KPU  0 P(00 RP A $ Pu Pp$5Ug ,Pg(,,*RP $"U , Y "2 0 d4 30Fލ Ѝl 0P1L lPkP9 / VyP @@U  8=V< VG 0!00  Y1 <0 3Ptt(0$0SP / y 5吵80@0$08px s@P!  Prm00S. m0=S0`S/`V`X`V `ሀp]Pm0#S PU  i@$4 0 |4 30ݍЍ800C80ddm@x 0 PyPVm@ ~Px 0 PyP 3 L =e 7e0S800C80}  0PP<0MT#p`80 7eh  p]h0W0$@@00HPmp0 pPھ0 $0xC 0P U0Py0SY SW (P0h  ,P(h  0P h   P`< R& D0@Pl70  0 0<80<0 S  P 80S 0  0   <`xPᵔ P᱔ Ptl0S 40pd8p t) 0( ( ( T( <( C t& N & % \% < d% |% C-T`P! ȠTM,̠Č L ,!,Pp 8@  #8ptDx00000 00  $(P!Q P,P[PdP0 @` P0 0 L0 30 TЍ@姂 (@z 8l: x8 -MЍO-@`! p8\M#< T 4!48P  #8 ሀ倐儠0000 0  $(,0|P80Q ,  cKP 0S 0 @M 0 0 T0 30\Ѝp_0 @@& 4@ 8 " " hH"  -M}ЍO-M蓟 Ȳ Go 0g-0VP ZPf 1 S Sh x#@ l# Sb  000 S SU S0 R R R R B RQ@  BQRS 0 S1@+S8 -S\QUp @Ut 0SQu 0 p0_o 0p`R0+S6 -SH gPPUpwa WP]% Pp@ S S 0QUp @U4 0S[Q> 0 90_o 00p+SR0S @S# 0&PP [_opR0S @S* 0PP` F_opR =_op`RpP pU/| h0 0 2 30ߍ ugPPyud xLDR O-Ÿp2 MM0ȍP`&N 0AM.0; PY \V ܰ + $b0+ TA 0  0 0 0 ,@P @ rP3H0: S8 1!0 &O%  !d1 0 8 30P ލЍPP@P 0 pP .%100S1!0 &%@x RP \0S  S 0 0 &0 0 &H0 |0| 0 &0 pC& H(z ! yt !  Xhdx x w` wd A-0M@P`p )i00  0>P @T@T 0 PP 0Ѝ @P0ЍP -|| $M! 0 0 0 (0 0 0 30$Ѝ t -xx $M! 0 0 0 (0 0 0 30$Ѝ A-@`p GPh  0 p 0L ^aLQWLALQ7L \  R AAQ  R C`0C R0 ą S: C    0G-h@P?0 @RP:T !2*00a00q,,` pQ. ?`??p  S*! P* UR*0 QS * 0U000?0R*00x?Rp1?p#`@0 80S0 ? S*: 0 T: zyyyl \ yxA-P`<@<0@p,00 ~@h0@-M@@ 8 @0 >Ѝ0x -,M$0 0 00d00000 c7P !4 0" 0,Ѝ w@-0M,0 0(00@$0l0 00 0=7P ! 0" 00Ѝg 0 < O-`10TM0L000!008 0000 00 00|PPS @p`1000 p@P< 0+S+0S(( P,$ 0 ( P 0$,$v,0Sq" 0 0 L0 30TЍ0 qP .P"]g 0 |H P 0  ,O-!1 0IM010pbtpbPPQ @`T )0 `@P; 0+S+0S(; P  0 e P  0Sg" 0 0 1 30Iߍ P dPL"f 0 y| h h h0/$s0@- 0 0M@Q000P 0 P " 0S0 0L @0 0 0 30Ѝ0!YP@ =밾 4@-@ 0FM M 0 `0d40pኆ PPd@"Ꮖ+ P f0@~f @R@ 40 0 d4 30Fލ Ѝ̽$@-p`Ppp0dM 0@0\00I Ur0 (0 0 \0 30dЍļ]4\4@-<@<M@ :^0 WЍp , `8 #4`43Z!R //0@- 0 0$MPQ000 @0  @" 0S0(0T H0 0 0 30 $Ѝ0)PP {밻 4G- M砐 pP E$e P;0F W08p;t0' T CPP!  T0@To0e0@e@  0 0 4 30!܍+e0@eU@ 0P P]Qp x@|`̺ 0- M Ѝ@-dM @p`Phh0 00\00 =0 (0 0 \0 30dЍ0O-@ϟM @ \`\` ` !`!b")b) ` p@?P+Td+PPh d͌P% PLpbx"n.'t *|bt' n* )fPldA, @`@p` iA$Hh(@Di!+f& e,)h+tf) .M `'`k(+eq `"$x`p,k$"eq'f& ! p*d (+ fd+eQ,P)P|Pe%(}eT(nူd. "   d)dAk(+͌"$g. ,k"  @(읉@l @&`g!,,@@ fH&g!"$D ! Li,fd$@gA .aH!*$DL aD$p(+- `j* +i j+i(P% `&b  8``ia,ah!&dlad&!'@$!_%4P_$! "0%q0 ?p0%0?SP@@g \L0gS@pG"# ` *B0S@@:`F A[p@- ! 1 0M0 00 P@R00 113R0 0~? S `` 0~? S U PE0"0 1<3R08 (0 0 0 30ЍpH l P0@- 0 0$MPQ000 @0  @" 0S0(0T H0 0 0 30 $Ѝ0)PP t G-p QM稐  P 0E4eP<0G 0S08C;t0' T DPP!  T0@To0_0@_@  0 0 5 30"Qލ+_0@_U@ 0P PWQ@+p p@`("$4 0- M Ѝ@-lM @p`Phh0 00d00 ;0 (0 0 d0 30lЍ<0@-@P$ $0$$$A  0#EgܺvT20O-tM@ 0Z p D00HP&0P%0P4Zg& 0. "8 bnf+%0 " <(g+eK.g;@$@@dJfKn"f;,D͠eˌb;$e[ 0#H0cpmvmzNS ꫠa0< ' c)`0a.neL *0g+e; " -l`+0.j;`0#h0c=g;ࠀg{`"n a 荠i,`ak&Dl̠jˌ #j8b  m ` n 3i`Hp,c{n p'p}8b{@P l.b+ b*c@@$gX `m$fi&ak-P3 j+k[%@P! c; j@KlK.0+NN00NlˎYi[m4 6D=30+Li;h!L`L` *k0ꭠg d@ mČƌ͌3kˌf+" d,mČƌh+͌03e;#hˌ) n T0荠 g2 Pfl{ a" a,fk`Hhekb( b,e[P@]a[h& h,aa4bf% f)b+ L뺠+I╓Ij૗Ij k` d *R0 00//|@-M Pp @G`P`W0D>S 0!31000 FЍ>SH 0!31000U00U00{/-p@-MP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( zD3 3m 2=Q-C #XA\#\ !  +A R   R  +S -S =S000@Rh-+@"      000000 0@-A @0RuS#WSRX0CSH6 ,0!0R \PSPQP\     0 T 0+S -S0I@O-`VLM 0`8@ (P(0,00040kpi  `T @ NT@T2h7 `000000$  0pa0HSvctsrqp<nmlkjih/fedcb,T00T0@T`@LЍS!  "=X  R"   P:0$`|T @ $mNtT R$ "@`0 偡   Y 0 S:$`ZT@ $KNRT0S$ 0"0C`ኡ0W X  0 0X ,X +X@ 0-S=X000$00 0|P @X B R񏐕~|{d]hvc`S  Z0$`S P MS RV$ "@`0 偡   , =Xx +0H?oY20S ZrW 00 X00 Z$`SP MS0S"$0 ""@` 傡 0T 000 ~W  z ;xI?vI0t0rW  n |0S 0 S3*-P"+  @ LЍp'}C~p=X   00$`_SP PMWS0S $0""@ `Ⴁvq$`GS P $9M@S0S" B`01DsP{0S00LЍXp+P-@ 0 +0B XR R  +0B 0+R XR  -R  X@PPQpv @-0@ M  @M<p`ЍP 0 @-R/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`iAP+eAU PU  0  P@P PPr\P \000p@400OR0PigHRP0 , p@-0P@`T X@T0rS PPpp@HFP0+Spp@8,p@-@PrQ`  0  P&<0P0 `@p 0  P+0@-hA M@0 @c0P0 <100S-Gp@( P BG 00 00S3000 Ѝ0 0 @/<Q@Gd0 00S dQ00@ Ѝ(kxD  @- P0"!(0040000010`0d0(0040000$ rd0JY0P%Q%0z$0A``0 0A,0@E `0@p 0 s`N`N`L2@tꜸ t GzGl  p T $  SQ ̳ O-0 @M Q:Tf PU# U* U T 0^ S^ЍTPU U U R? ^ @00@Pp`WPPPP P& PW P`0 T`P0pW 0 ST:0S#`@0Q @ 0 pP W?[*!]-E@-M M0čK \ 0@ $03/L D0 0 4 30ۍЍ S$0^]G-`P``a V00 "5E@P5 pPI 0SH 0p R0CÐP0P1 U  \   1`V*o`Cq<pP Y  !M9N 0   1  O-``ş MMMčDş尠 TDp`0NT/*0U@@ R R 40B?o2 000TU 00 S0E0 $0S}0000Sl\0+$0E$0 @$0 2/Z$0 0@ 40000,00F(0 03/P   0S00*  0.S 0 S R V: R  R  ,$0P8 $0* R  $0TP$0 ( CQ/ 31 C10 0 0 P000 0000S  0P80: S 0l" $2 MލЍ Rw 0  R v P EZ$0x@T  R c00Pd0G*0 ;PU 00 [0!^0 0@0SJT@atS?**DQ[!-]h # O-MMQ@`P8x9  @ -F0S @}\ \ [\ {\^! N\]\@ \  ~ލЍ @ ]RRR @ Q+[S0 S]S*S [0 {S &,S^Z ' B0S00 &0[ 00ލЍ0]SS 0]SS }S^NZ  J B   E  A- 0` PpM 0 S +{\ @ \ {\@0 pGP  Ѝ Ѝ0}S0S ЍAJ 0 @-`M Mp0 00000  , 0 ;\@ @T0 0 ލ Ѝ\ ; \UPUPY^PN @PUލ Ѝ\@p@-`Pp@PTQ@D PEP@DP t000p0 S. *S8 ?0C\#S 0 P/0S /Q0 S 0 0/@-0 S@#S@3 S S" S 00 S "S0. ^\S 0000S \ 00"S 00 CR S 000 0@-QM M 0P 0 0@050 0l2p @EO0   0P0 p \0 0 5 30 Qލ Ѝ0D04 P 0]\ XGx 0 hF؜ G-hehM` p #S$H0 P@$ 0S $P @ 0SH0SЍt `p/0@S 00 40   0Sy dtdpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 7@P 000#3R0 T# 000@ !@P 000#3R0 # 000  @P( 000#3R05 " 000 0#S RP@0 S006P0@@0Ѝ0 S S< ?P 000#3R0 " 0@00o ?P  ?P. 000#3R0% ! 0 00R۴Ѝ 000#3R0 H! 000 A 4 0 0 ~p P2rF<00@0SZ 0 F0SK,'7 0 0 30 Ѝ ps?0|0p Ⱉ p@ / ?PTpZ/ A \#R `A \#R aA \#R fA \#R~ cA \#Rw bA \#R< YAP#R  XAP#R WAP#R4 \AP#RI ]AP#RE ^AP#R8 _AP#R1 TAP#R UAP #R VAP #R 0S:V 0 /@T0S C K P< p0/@0000@/@ c0 QT@9/ R@'E00 /0h/EZ0ST 0 E00  0EV k0S @lE00/0/PeEP0@W0 X 0# @ @  5/ "0   @/@"0   @/@ / e``2p@<L 0808Pr4 0S E00/00/@E@ Pi {r @/ d5{D000`X 0SCT |@@ Hx0@/ 0D@A  $@/ ;08PP@08P<0"@1@I0 DY0 @0S0S0  / `00C0  / @7@4@14@{-T>4>t p <D @  H  0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF$pP P ЍpA-A@0`S'@@Q0+pPpPP >@P  Bp0 @BAQA3M@ -p0 $p0 x`D@p@-p`pP`P[@T T0T0 R@@OpP00D`DdA-P@P`@p60S |@@4? R"@`(A?@P00C0@@-r 00 C-`\MP]7@P- 0S|00V $"$ UpЍ ⍱0P  $ R%pȁYT༘ 0N|㠁0ఘଘ|xxঘ0R1 0QG B&Q&R-.4 p0ሀ Wtq{\ SzڙHvP h  ܅ t L 4 L У   0O-,,% BMM $ %u  %p 000 0000+ 0P 40 4-P P@\  P 0S l400#S \ P 0S 444d0``\ P 0S 4d0``\ P 0S 30   \ 0P 0S j30\ 0P 0S j`30X3PE0 +:@3@c0P`0P\ @P 0S =P0[[ ?P200xS0xS0Sd "L2 0 4 30BލЍhR@P\ oPl 0S <200#SE \ `P 0S 2R0P\ RPW 0S 100xS0xS0S" 10 0sS)0wS&0S#|! x1xQ0P \ *0P 0S 1jD10\ 0P 0S $j 10 ! 00P00 $ 0 000 00^>P/ H @h< , pl, ,D @Ԁ  `4 (t L T x4 p@-hPP0S P@L@@p@`@` 4P@௮~  A-`P`0 $S Rp@@>P TP@P 'P@0 "C 0 p@0 0>`-0P0 00 0`_0 ` 0t  O-0Ÿ M p a @T ` !1 0 2 30\ ߍFPW 0  op L  :`P: 0S;p00P`P* @@0  Zp@ 0 ?P 0PpW*P<   ">0 "C 0 9p@0 0N>`-0P0 00 0`0 ` 0LO-0Ÿ M p a @T ` !1 0 2 30\ ߍPW 0  p L  `P: 0S;p00P `P* @@0  p@ 0 P 0PpW*P<   ">0 "C 0 p@0 0=`-0P0 00 0`K0 ` 0$p@-L@`P@ VPpPpP&P n p@-L@`P@ PpPpPP n p@-L@`P@ <PpPpPP $n 0 00 }-H- M0S000 0 00  00\100M 0 R0    R T8 00 0 0 30KH Ѝ/0-H- M0S000 0 00  00\100M 0 R0    R  .8 00 0 0 30KH Ѝ/D -- M0 0r'--M  v--M  A-`hpQpP @Q pPD@( 0000Ad0P R   0//8O-ǟ7 @T@!|P;P { 00pUP0 B@T@!8@,@0@/SL 00@-@PDM  @000Sp 800S DЍ0p@-`Pp@ P /p V U ph p` eb_V᏾@Y@,` ؛ 00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc268270EG2&1H01./ "(0C0 /07 ? P!Q/o/o G-@b^?b ^) ^ @pBb&`b4')0V4( X4G1Y 1. "( B1 /0@ Ϡ P! Q/o/o G-@Pb5U?b"6U3 7U @ pb0g7i 0G1c h48:4904H01> AOA1AN1 @B4+B1+bD01/4 6:  /0S0@-#/A BR?R0463R64b0A3QBA b3B .00/A BR?RCA A2" #@A4#a01#000P-+0R J?S$S0c03! 0RJ?S 0B3 B b0,PP `B@-1800p@-P@` ,<Ppp@-P@ !<Ppp@-P@`D <Pppp@-@PP p.P )PppC-PMP`V ⬻@T |00L3Ѝp :  np@`$ ఼PY 00 R ',@-700 0S@諽 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`2@ :P PXY  P @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍyPP @@ @;0(@$0倸@xO-鰏DMP`00 0P0? 000 00S 4 T/ @p%S{ @0@ R0`S 00S S 00(4//#b!!"AK/ "bQ3:bQ#3P . ! P0 00 0 0 #>?3c112AK? .## .cR 3:.cR # 3 00 0010!00C0 0 0@ 0R PR0<R0@@mWjp%0KUSd,ba`_^]\[ZYXWVUTSRQPONMLKJIHqTy-;(>=<:87 -,+*)(Q4ih".{s(b 00 000; 0`0P `DЍ0@@0@000@0(p,P8 h0$ @PCp1 B9P @ T$0S* $ 0(p0,P$00@PCp0 '9P @T$0S $ 0 `0 00 0V$z[0@$ 000 GR +Rk -R 0400``PW:S 2a2c2SOR0c$000` 0(050 4`0tU0[04000000 @Wd0`nW`pW\ 0, 0 09 0I`0 844 40W0C`00B 00 0c0 4`0@0@0W%S0NW-|=0 `0r WD;0  0 p0p S00W0 0` 0 0 0U0 ^`0 0 0 0000 M`0 00 07c0 4@0`S0G 0X4 ?2c111400 00 0000 404c0#0`S400111v>C 0C40  /"b!!!A0400 0@@0@000000C S0`0`0W0= 0@/ @7P /@  7P` 0 0` Rv40W010 oWm 0 0` S0pYWW_ 0`0N00J50 4`0  044 400C`00> 00 0440 4440v>C 0C`00+ 00 0x40 40\$/A!b!b0C`00* W 0  0 0  RM 0s 0 0@0 0 0vP@ @ P) ` @aJaj B  B0 UR ZRU R   @K 04# @ ( 0$04`L(p,P@ `W0` (p,P@ `W0` "/#b!!"A0K/ XX"TbQ:L2bS0#03 p"10 !A 0  40DSd040ռ0 MR[ 0@^  @Q 0 "#^  z K/o "0P8 0`0000C/< 800A Q`A`0PQ0N#όF0 0  D[ 0 80< 0A Q 8ȴ`P 00`0 0@z[3 0@P 0 TR RO ` @D0 CR :P)\(\ ף,U tT QlO nN xN l'$IPJ LH QA ALA ` \V6JQu8 @ 00 (0b$0 00\00C4PN00P0?2c 1A;S40`2ca12B @0@000@V@ A\N A R$ M a@000"b"b"$ (0(p,P$`(p,P$`40 @' R$ @  R 00@ p4`0 p 0P @0004 0C$0(0` 0p0P  @000 4 0C$00!0(0 ` 0 0P 4 @ " ( 00 b$ k 0 0 0>p@-0 00M0,00`P @  P00Q Q Q 2 0 l d0 0 ,0 300Ѝp <勸 ,冸 偸zLt,t,t,0@P/ P @/G-X# `p-V@P0PES  R  D0PEV R  SS0@0D@R@- 0BAs@ @Q 0CR M1@O-` M%VP0 A @&P;  &pP< ,0p01S Y& Ѝ0%0P%P 0 0P %0 0 ,=00 ,E1 0 &xRQ0@- M@@ (+PP TU +10P Ѝ0< Ѝ0!1 0 Ѝ0G- MMōhh P N`p Pp> @P<@ X0^00pAtA00Ol00 TAXA\A6 q$@P0,  (@ @@P R!P t `0 0 5 30ݍЍ@00@000@0K00   --M  uЍ Ѝ/ -- M0 0* ЍЍ/O-,R @p` M R00?y^# 00P @ P j00 P! !  :1XP<   !VP WE V[X0 SPpp` `2(!(1 00.# Ѝ`pP2 PPSPpp`00"0XP C0PP00 # Ѝ `f` ᾲpP V ᷲpP `\@-@ M"(0S2 I 0 `0( `1/qpPp0  0 0 PUR <0PU" ЍPPTp 0S  0CP"P/0p0@-P M"(0S<  0 #p0( p1/qp@`03  0 0 @ToR <0@To{"1`VP ЍP@T` 0S  0C@o{/T 0 \"r/ 0 S"0 R/p@- @Tp0 Rp0 0R0 I P 0S P0? c (: 0P0 50 S0,P ,4P (8P $p@!eEp@-@$PPnQp@g~@- @@`Q@Z}tp@-,PPS S@Lp}@A-M 1!00P00S   0 XR  0S= `@@p@ X8 CR71!0A0 S0Q\-*L\)\ ' 0 SX   "Q \ #R.Sa A  00C "\ #R Ѝ`0@04  R  *4 8/L 0X\S 040:8 R РS /\xB@-@`PiLpL0ppD尀 jT  =   / @-P`@G.0 p@-h ` PPPp P p@PP3f]UJUI1 \l00p00 %00p70000   70D3ox2 HoПon=A-q@p P`Uh !2#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@"00W L!P0 $@ 0V0 P100S) 3/000PP0S 000S) 3/000(np00 0p3/P WPVSP 000SgP0P 000ĞlmL0 mllA-PP} @%`Py qpPg  00Rc<!"#b!0CaqV- pW 'PWV $00dqp0ST100S004 ^",1003/P0 0$0 00``0S 000S+ 3/000(P`0003/P 003/0000S PڭP0000ꈜ/>3(kjpj`j=A-PP| @O%`Px qp Pf  00Rc<!#b!b0CaqV- pW &PWV $00dqp0ST100S004 !,1003/P0 0$0 00``0S 000S+ 3/000(SP`0003/P 003/000$0S LP 0$000Lhh8ph(hSR: G-P0`00Sp 3/0Y @IOP U T 00 00 Y @IOP B T P00 D0D 0 p`P/hgȗ|hfSR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP T P00 D0D 0 p` P$/Lf\HeA-@P QP P@`p\P0`P ׮PpW (0"S Ὥ(@00@`O-PM M Q0` 0 Q /Q P.00H #PPەۅPp/Q/ Qq @P /RR.Q7  I  B R"/  D# P E  p P  * R,  R/0A?o20Sa/Qd(?0 V0 P/0000 Oލ Ѝ DQ .PQ V 0y/S0W04ʨp !=PU6 # \*  #(/QpP V P/0P000ލ Ѝ ª`P ``(00 (>00 (00(?00(00' A-Ha@P`; >#04QP0唪P= 0p0W& 10p p:W@\ 0 \S 0@ S @ 0:Sp@:W W0 0T0P  <00' 0 00L,0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/`_0@-@A\  \:^|^00^0S R B|S0 0:SS O-ǟM MtDčpĝ!^(,  ^ LG@`V 0P 0'  ȩ@P 00S D [ & +0 00 ) P> 0Pv0 0 ` R0Pp`0 S Wp :S \Sp S Spp p0Ui*R0+  ګ P 0`0 SWZpP 0#SS  ]P 500S0 005$@00400= pP 0:R@h @R0t4 00 0p<W`P/ vV* v):00d00Z  0S mt00i:SZ P0U:H 冪P PE @P`< 0:R` ` R40 F C 00SpG:S:0D 0 I0HZ 0 E0   0< P@C200DpTpPETg$H PEpG@D@P Pp@$$@ 0S 8, E0AU0:(0@"2 0 D4 30ݍ Ѝ0 0 0P@P ⟨@P| ?x2P00PS0. 0S$֪` 0SRO %0@ʪ%@00    <Pᶪ00S00S\S00 R{AP8 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@N0S't!D1 0 8 30H ލ Ѝ  @P 00 C 10 Y P ٫@P @@PP P @ 00   0uP 50 0Pm @j І( dl@ p@-L`@` 0PS y0 0 00p@   ؂G-`= mPP d㰦@P 0:SS   d: p \SP0* Q@ 0:SS ^S0S:S 0Q0P@ @@d P 0:SSd@0Q @PA0n0S:S 0 C\6B C2RBYU?PK<;:9876?432802.-,+*)('&%$#"950+000C^/!000C\!P& P0 0 P0} Ppz 0 P0v 0 P0r Po Pl0 P0h @qPJP PP P >P|F# 0P0wA-P= `P7 dpP9 0S:S@@c0%0:SS   Q0@@d7P pdQ@ @Ap`&pP@`@@@" 0@0p@-P# YP 0Q @0XS@@<,00A ^a ARA0AW0AS70ATppO- AM Mhßh3 00(0 00SK @`p 0/04 PPO P8T   Ƨ"00CS4%210/.x,+*)'&%$#"  o 4$k` f0:S 84Sty"0Su"00"2 0 (0 30s K P( BKI8T 0:SSa0㼡44 440$0<4 0 S BKJ;4$ / 44$0C 0$C0$ <4$0C 0$CPu04BK I8  S:S1 R5 0B44 R0  0R!0100M P@@x $0:S084  " 00ULPH000044 x0& $   d_ l ] 0 00 ܪ-H-M0S000 0 0 0@  00^100M 0 @R0    R L00 Ǧ@ 00 0 0 30KH Ѝ/5뤪4@-G0 @ @0t xl O-@`,M$Pᢣl20 R^ 00@`pR 0 QBHP Z p P p J Y J PP0 S"3#:  U(10 r# 1$4S!1$&@@x!00P @MP0S?"@!1 0 $0 30= ,Ѝ100S  U r pP Р P 5SX0(, VT00#    PP P0Ssd|Gtxw wX ˠ@-(@M@@0=PЍu@-Q@0M 0    ",  0$0(0T P0 0# 00Ѝ 0Ѝ0-$M  00 0倥P$Ѝ0-$M  00 0pP$Ѝ0 -M 00 0 _Ѝ ㄦ ㋦0ユ/C-@P sMXp0^pAtA叡0Oˡ `0PP0P0TAXA\A\ 0 $@4 (0 0 1 30sߍT00   O-ϟ MÍ$000`QY 0`/` ,  0(0 0 0  pP0'%Ypp, 0S0 R .> 0 3 30 ߍ P0 P 0 0C 0 S 0 B `0 zR2gPLKJk^~}|zyiwvuts0q,+*hfKa]\Zw``YCS000`0C0 PC 0S 00 0A@00S0  @DT& = P0 P 00CS0000@ 0D S*v0L0 S00D0<0 `I @H<8L 4  BPR '.\ 0vpC0j M:ZWp! 0`P` ` PPp+@MQ^T\RZYALKNMLKJIH654321A@?>=<;:9876543212/.-,+*)(!  UMP00CS0 000pWP0  P)S XR    0 =$ 0$        00 0P0 0C0000 S000@WT @0 P0@ S0 B0 0 R P00S000000S0J >. #RR 0@00T0C0 0 >. #RR 0000C T0 S P Y 0 00+ E ` P BR  V *@PNU 0U`0P0CS0V G*@P XR P@P5R*`P P0@@40 P:D0U0 S BA RP  Y*@@ @P`0ESF 40SF oP 0@0CSPF00 400Tw: `8<@DV*T  T0`0 @Vi 0$0P 0  P ~l$00p400S P0S> 0$P0 00000S @ P BR T *@P+ E` P BR  V 6* @P P @0P0CS0 IU` P BR V *@P`W(00S H00SWW00CSp0P o @@PPXYiU nU` P BR tV *@P0S񏐼R.0ASL`0P0CS0@ p= [P2V0*@P(Uy`0P0CS0 @p& DPV*@P0NS`0P0CS0 @p00@<00 0D@ @@H PXU  SPL00@900 0& 00  $  0$  㰀   +  00ģvX 4  k,f p 0 P 0 0C 0 S P `00@00   <00@<000 0P0^U@@00P080800,H0U 0$40A4 >>0@<@pD#C8`0-S ]Sh S\ P4 >>08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0o *  + 000@ 0`0 0@0Z @40Sz@@@ULP  M +PJ >PS40cS9 P 0@0CSPF00 0 0P0CS00R*P00 P P0 P P  P BR  Y*P4`V "P 40@04`V P  P00CS0R00*``PeS?L00v0D0@a PT* 0 P@@0P0CS00T *P00`: PT*`P`T$0TPPXp$0\5000 00S0P0S#T 0@0 0$@P >. #RR  PR  B   P 00< P0>>03SS 0PU0C0000P000) 0S CP PYT Q 0$@0 0000C P0(P00@0 4 (P4 R*`P PV* @PM p  P R*0P00Ym`RP  Y* @P$@`PPP0 P 0C0P0P `V  0S P 0$@0 0P0 P0PC PT*@PS$0dxPTP$0040pX` ἟ P 0  B0>>@I  vZ0 mp P p0S P0SYw4Y 0S0 00 0 Tp O>>03SS 0S0P0C0400400S dPbV`*0P0@`0! 0 G VP: 0 0>>` BF  vo0 p 0" P p R`80<@pD00@ 00A<@pD`P 40P40 S 0@00& PyVw*@P_ PoVm*@P$00 Pth$00 PV*P@x PY* P800C0800]S0 ,0 P  0PkP80p0H`80v`Yp  PVP0 0 MP400P PT*0P0`0< PV: `8>0AC  * 0 v=pY P#U@DP$ 0S0&TU pP0 T  P@DSP U~d0C 0P wp U@D`0S0 09P0 S  A-@P`pV 0 Q0@V A-@`P=<;:9876543210/.-,+*)4'&%$#"! #       0 D R R Q  R \000!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0厙$ P 0` S^?0@00 0  ፙP 0J ZS 0  0J ZS 0-00h10000 ,Ѝ0\r  `0\s  `0\a  `0S\000000 0``0\b  `0\t  `0\n  `0\v  `0\f  `| @*P 0_ Z0\  @`oHxA- Q@Pp`! 4P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 AeL A-@P`ἘPp$T0 pAP_T !T '0DS%(0$"0@ !1 0 O-,,ǟ WMTǟS 4Ppခ儡@ X s@(0P(0 b` 0P,0 0S00<0h 9P80 P  T. (`000P@Tp` U T 1 # 0ᯘ0P?0S0Z P`P P5%0 7e(0@FDA T @! Li`֖0P$0  0 0080S V L0$ 0C BP$0a  ? * 500R  ` '40$0R 00 00 00 "00@\0000 tpT) (`,$@T$ 0 7/P0@0$岗,尗(宗<嬗$$3 0 T1 30Wߍ@0SP@PR,00,变 0S 0S0  J0S ,0` 00D0UN pP00 0 0 @ `Ƞ06ɌPp@Q^O  ^* 0 309<80 Q*@P0000 S00S0 00 0@80@ SR0 0@0P$4,2(04 02p00 GR 0D 0 ᭗ [P@ 0S0_* 0  ភP0@00@ 00$L⥗p $`0a 0S 00S: @0@:8qp$0qp!  㫕0P0, 0<00~s0200C@ 0@00 0 c0 0 c0 0 c@O0@<0$0Tq4qX l  $$nT,T h   H  ( @-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ iXi@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝܱhhp@-@QM`P0  0 `Ѝp0@-@RMP0 w 0( PЍ0@-@M 0 00 Ѝ-M $yЍ-M $(kЍ@-@ M00000h0 @ QD 80P @0 0 30 ЍZf f@-@ M(0  0 0   @"D <0P @0 0 30 Ѝ+L fe0@-@QMP0  0 Ѝ0| 0@-@R$MP0  0$ P$Ѝ0 0p@-@Q0P`0M  0  `Ѝp -M00  Ѝl -M( Ѝ8 -M $$Ѝ 0-$M  0$ЍP`p| @,0 <5 S; S@T @bT V,0`<,0L0`S00/S , @  Zpp 00aPa@  0 @QP p@-t0t 0P@0S 0`00Sp@8(b(_(](LxA- 1 0 0PS`@(M @Ppp 00 @0b P& 00CS(  p0 0 0 4 5;1(Ѝ 0<080 " 0 (Ѝ0|Kԯ x  0 0 =<;:9YCCV6/.-+)(4k^"#}{G E,T [n 4-$= 0 |0 30~Ѝ,PϠl4 @0 P $0(@:, #"0,cR:,c2S <  @@͟ 00C L``C@ @r  ^^A!/3b112A0 <  ̟ 0 cPp<5: cP` ;0!3b112A0  K0 S 0! [ K 0P Qd; Q00dP  ᇇ [ 0 S  R    BtQ1:0/A!b0dP  g [ 0 S  R   0  ``: Q00dP  C [ 0[  R   0  `k 9 Q00dP   [{ 0 Sv  R pd d9 / b !Q Q00dP   [\ 0[W  R Q8 Q00dP   [D 0 S?  R 9 0   ` -0 S00C  B1D8Q/0A!b0dP  ᴆ [ 0 S  R   1 '(0 dP0  ᚆ [ 0 S  R  1 p'0 dP0  ၆ [ 0 S  R  [ 00[006 Q0 0dP  ] [ 0 S  R 0 01?2c 1 R11Aãd0Sâ/d0CS0c0(6dP 0/ [ 0 S  R  08  8   `U80S0 R05p0dP0|5 0 [e 0 S`  R Z 0 0  `,N0dPS004 0 [A 0 S<  R 6 [4 00[^-  0  `! 0S8  qp$   xqp $ P 0# S! -R? S30 [ K  S Q \#1P "`aa!B! #<0 dP0   a 0[ 0 S  R   0  `1   0  `x`0  0S0  P P v [ 0 S QPt0` 4j0 S  1h [b K 0P[ QU0S 1 [M K 0RF Q@UP 1 00 / b !Q dP  Ƅ [' 02-`-Q*lP)\(\ ףm @ $ t~  * ( p    l v v Ђ nn n \n Pn $I } l} D} S  R  1 h 0 dP0  } [ 0 S  R  8  0L08008<00dP@0 0D00H00L0 0X0廀! @ [ 0 S  R  0l0 S0Cڜ [ K 0R Q0S  [ 0 S  R }UPUP 4B18" @ $08VS` gS 0 `[ " " N"N Ϡ$0B!l0 8 040c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0l3dP 0ඃ [ 0[  R  o~ P 3Q00dP  ᘃ [ 0 S  R ,4`0?< <$ d $0<  1 $<0 0  dlA-M`@P30p40@0000 0@pPP T p0EЍ" 0 ЍT 0 @-$$@M ЍpC-pP`X@X@ M ~U~@0@0  0 @ ~ Ѝ,8C-P`p@XX M ~4~@0( 0  0p@ ~ Ѝ8X0P @-DQ4  ʝ<4{ h0P@-X  S H@ @0( (@ ੝z l0R0 @-\@0@PQ 0 0 0R B/@D e0@-@H001UP0P  0!0D 0@-@D001UP0P  0!00@-@LUPQP   00!0@0@-@D001UP0P  0!0000/ȱ/ᴱ000/ᠱ00 0/ጱ0P /0-@PQ@0/0P /0P /000S 0 00 9/`-  0  ^^$  00(mNAP   A-`pAQq@#0F P0啃Ï@hC12c` P@RH00p`PPUTp`t_ Np@-HP@P |0S,000@ p@ ||LG- p P@`| `FR00C0A10 0USU 10p   t i|?U0T!P 000<10 i100 C0B100UU$0 P 0000 0 P 00000@ ` #|0h P 00?0P00, T\Ȯt4lPܭG-@0`萟#䀟 P #Qp{ PFR00C0A10  00 0UPQ@pG@P H0&&```8800A @{Ĭds l@-(@@ @{0@{輫G-p`}P# `Q@@PppW@Q`Jd X 0Paa}{0O{pG00wTaXa\aX@Z_r 000 D.@-I,@@0@P0S@茰A-@P匀@_}`P(p0@aa9{0Ou{ZO00TTaXa\aXP(0( $0 0  h 0p@-05S P{P0SZ sX@ 0CR\{p@T P ZP@{p ܩ/0$0! 0/p@-$P@~P ~$~P ~p@~p@-@M P$`0.&vP  qP DDN00S 3/Ѝp003/To o C-$`0DMSP 0(p0 0@0$ <PP 0 (05,00S 3/DЍ 00,00(3/ PP 0S /A-M $P@0P ~00 `pP {Ѝ00pO-hdyM(p`|0PP ~ |@Po 2 0z20 RF )z0!$@ !  000 4L  00 0. $(p,`Z PQ 80 03/``p|P"  !0 0 1 303yߍ         ew}P s}q}Peg}P``e&PH$Xxk `k 8k k k j P00/|@- 0UM 0H`0L10Np! 0H1~@f~pPf~0P`p  S 0#< ,0 0 L1 30Uߍ豘%xp@-MP@;\`P`Ѝp )^P [P  [P 00 0  PHO-p`@(,[PP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW u{P@@d P|00P WP [P  [P 0S SyZP p@sZp0p@/p@-P@{[Pp >p@[ [0@- MP@YZP Ѝ0d[P 0S00 [0 00 S /p@-P@5ZPpA[P )ZP  $ZP p@Z0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< KUP7 mYP P (! 1 0 3 30?ߍ(3@ R. R  0 { p0S W0% p 0 | 0 z  R+P " R]] L] O-DIM@,MI͍$$J͍@Pp P0`S S  p80$I= $0 2 Iݍ,Ѝ RJ- RW# " "  J=00岰h +4# 4J8#8  z J- 0SnJ=  0p0SO S UVZ J=00p,:0 3 00嚯000J0 ,0'QP @'0Sj0S  0S0s S0S UVJ= 0 ( J=00peYX O < KTP] m0S m 1b"!4b4#"R8VUJ= 0 p[pYpU<0J8 0J=00!| 0 +Pj 8J- 0SJ=  0pS Sq#< mJ͍0 pp p 00SWL2Sp S SJ=00Y0  SP pJ͍jPp.P\ [ $[ D X O-ğ MQdH4@0P0CS,v6)('&%$#"! 9 QVW00 R04 0S SQp#3 0 0 30Ѝ#3 0 0 300 HDp@`ЍOmVW= "44 8 T# #8By`P'T%0SR0S # $$("(4 "8#8 D)yPT QVW00RTD`XT 00" 0 y 7W* P00Sz "0 xT@@? 00z!D xPT`!0 xiT 1i #Q]0|||Pp`P 0X! 0 xP030#?Vp@D `0V0 0 xP030#?p@D0Q0 p0ĠĐp `pP0 U 0`@Dm    xP030#? \  vxTP&VO g0@S00008#<tx'' 0   0 P'x 0 0 1 30%Iߍ [: JJ Z"448#8WX 0S UP 0 =0YPA-@P`p 0 p 0P Lp@-MP`P@@P@T 0S  R0S P*@PЍpP"PЍpp@-PX@tH$H[p0. AAS0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0R00@-d!$M""00(  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S-  R  R R R/S /0S S S S S/@-^/ 0  00S S/ /0S//0S 0@-P M@P>0 PRD@60S0S 0S Ѝ0/0O-BMPdEV 0 껏4 xA-X!X1 0 M0000@S8 S* v`V" p PQ 0S @ T S   0S QRp`Vx p0 0 0 30 ЍL00 0  3]@-`QM @QPp Q Ѝ RR fPP,8#<8#8U R R  P0R  Ѝ  R RD0 P 0  hC 8. G-`@ p-rPP   @ @ !O- MHPP00P,`0 ZPE0 PT`Pb0  03/PZ @BU0 0  0 2 30ߍ0P0|0 S0$0 0  pP$$p>00@,0(p \ l7<2 L520\0 |0 S   S  Q  RQPP  XP[S|0R0Q0S P0^㄀S_   0P|Q ,0 0S Q0S %=0P40  P8m 4 0 B  Y0P00[XX 40<@ 4@Ḱ@PD`XH 0S0PS  R R  R + `P0  0 +<`QQ Q`0S0SP;0SpW :7pS0$00|04<@p8l00SX\!t0(S 0SB xpp=@,*,: ( $*0 0 *40 Y? ,$< 80 T 0 d342 D52P |0SM0 S F SRCQ Q : \Q^3?oR20S Q@P 0 @pPp00 008040`e?0(0X0@S񏐎0S Z@Tt`WpV I Y 01P@0P0@pTPU j0P0 g帐`nP 0 @@P@$TPPlt`0S 0S  l t0 p0 |0emP$$l  0;P"| R 00S Rxi  wP 0 !0P00 0S p 0 ` ,p$P00y@T0 0,p $PP` Ѵ <kP1x00x0 jꪅP@0T00T0@jP 0p O-xxqLM @ p PP0 0PF ``0S S S T@P `0S `(0( (`P00 U `V`V 00 v`V0S 00SU$@LЍT G-`M @ PÇP p ` @D00 0 ͇P <0S0- `ЍoPfi0 ఇP Ui@@DNP <`PK 0  8 O-ppŸM  ! "4P ğ* $! ğa @#, P@dğD 0"0#P 0Hğc>  !,$P,$ʃ  $ "0P$a @ # " `!`&@ `ßj "! @ ßa  # ",@ ß$ 0&0# 0pßc> `!,`jD@LSPP"P%P8CeX@ @#@$@#D 0 ,l̈́ 0 !蒟$ `ab``P P%P"`X @ 00#@E0`ጒ`& `xŸfm   "0X"a 0P 0#PX0 ,, @(BŅ@` @@$@!D`dM 0 0#0a `̑`& P`VP0p: NO0hV@Hp` E0S@@:p`F A5p@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@Q/l G-d"d2 0M000L2L"00 P00;  `p0R @  0XS@@ c00F 0P0~뀝B0   4 -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/؛p@- M@b Pt00h` 0`0 `P@@X@I0@T  ЍpG l @-LL1 0M` !000=dp @P   jdp b@ 0 0 0 30(ЍbP@pW @@T PU 0SP@DT?0@0-~ixp@-@P0b(0Pb(P,P~b 0p0PP 0P 00 0p`00dP 00 0p ` |   / 0@-@ 0 0 0 0 0 娘 0 00@- 0 MP @00b 00P 0 ??o20c Ѝ0 3 00 0 0p@-@P0 0U0 0pp@-@Pb0PPa(0Pa(P,PpG-`0PZ pPS 0@00 S S0 S S lPPB 008#<48#8Z P07 @P 0P00S S S@ 0AS Ao@PP 0S00 00`P  ]`P0@@ h 8  O-@ 0Pp M,0(S{: (T_  0 T0V 00SR 0 RL@D@T0`G 00SC000@D@D0`0S, T0X  0!0J@0`I 00S$0AS0060  '.0S000 $  0S& 0p@a0ppa(0pa(p,p@ Ѝ`P  (,@c(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ02p 0$  $ 0 . Ѝ0O- @TULMP$` 0 @@"PE$R^pPA 0 @@P6$PPU 0`Q QB QR Q% 0U 00S{ $^Pb  `0 @ 0" p R  R/ RY R 0 @U pJ` 0J[I0 0 LЍ   @QA@  0U` (⼐p 0  ,  p0p 04`W G`@u @U@0 @_LЍ@0@_LЍ `^ P@Q  QA@ PU ^ QP @ p, 0S QARQ  R  P@ P@  A X% X X9 p X) T( QX X X0` `@`  ` `  `Q@ @  P@U`X_ S_`O-P M<\`@p     $$[`0,`ĕ(0[`3,`XI0-0(ppP pHQFp0v&UUp`+ `U( PV%Y5X( 0XQ #((RP P54PE2PE1PE`S0PEh PE:`P4;P Ѝ 0 @^ ЍX030#-051-0%!0Y" #((RP P54PE2PE1PE`S0PEi PE8`P09P P:04  P800 @-M^p0 @>`p7 P0u0)0`p @`10@^t 'U 0Px  (P Ѝ00_Ѝ^t 0 Ѝ^ A-'Qp@D P`P0 AT00\ / @-\ ,@\ \ Q :\ :A- 0 ' 0 C-P$0@SME 0( P04 q:C1I;p1 B$`00>1B- 0CIR0  R0000#809L>01  00LЍ0 0 0@-S@ 3/@]O-P@ MX Qs 0`  @`f&AA! B B&"`F`F"f&AA! B B""`F`Fa&AAu! B L B \ᧇ" 0\P3 L0 1 0T0p0`0`Ff&pGpGt'PEE!0F0C!6# G B("AA!0C0C1# B B%"AA!0  Ѝ QLr`0   0p  J K`f&pGpGt' B B&"`F`F"f&GA! B B""`F`Fa&AAu! B B Z0ᧇ" ZP Z Z 0\ 0X 0T00  p}0`Z$Z4 Z0 Z2  0 pl0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[`'&%$9"! 8* 000 @ @  @0{0000BdABdAndA@BdABdA`p`P00 N 0EP00 D 0PEQP0兀ಀ00PE0 0 4$A-`MPpM&laa`GQQNHH0   @ N 0*Ѝ Q O-@`!0PPRPPƟ MM|čƟU tL<006X0P40 0 060D06h0H0t60P0l60T0p0,0D6P0< 0@0 0  ZP?o0 2R0S <0`1  @0` 0` 0V T D\T0h0S85080,0e?Ⲁ|5 0x0``VJ X,0L?Ⱀu@5 0?X& Y08 \PT,0? )R 04d`   VP,4 @+4 0kpp4 0aL4 08W04  0 `NY0SIZP W0P40Z0 [#`3 0 |4 30ݍЍo` H0@$]/0S 00SU<0`1   [  (\#2 0 |4 304ݍЍOYp$开,0!?0"(  \X\2T080XP\`@d[HHX:xT `0!$4$(#d"(dhR&h. V PP[ [ Z0 81L 000 .y*ZH0 HXXP\`@d l0   VL0  P0 @  [Z0 0L 000 .7* UtZ }[St{{ ` d h$- p g g |8 l l \x wp $ @ O-tM@@ `cVPPk0 P p 0 0  04$`18 $S, %ἴ0 岕   46< 04 (V 60A>< 0PPU R800 0[`1S   ;`1S0 0  0PL0  0P9P  PP&0  0P0  0P0  0P0  0P0 0wP`1Sy40S{ < PA0ppW  0R 0|Z0pW 0pW  0R| ,0iZpWg 0pWb  0R4 00VZ pWHpWE 0 PS 0 DZ`1S   %0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P  0001p 0001p 0001p 0wt1p 0ZHYL YtЍ tЍ 0 /0 0  0 0  00 x0  @0@T U Ѝ0O,0@ 0P Ѝ0TQ` t Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D R000T H0 0 <0 30 @Ѝp@Ѝ/.0 T/_p8c bO-PM`@P P  @ p <0 Q  ЍSv RSPP -\00 +\00 3P0 0  R0N1011.\ 0 @T@  R㞀( 00 S #3@  R\ Z 0S#30 "#T$P+<0+80+40'<0'4 0(< 0(400'( ((P p 0R0p b 0T00@0 P   0R00#3@0 PS \  R#3 000#3TP 20 T @ P P 00 S #3@  PR \ 0S#30 "#T~ {00H 000J00  0L   3bO-Q0 dM R   $    (   0 ,d 00 $Po$ 0 JPfZZ 0JS񏐹$?vs8p|7a>^vVi('~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      ]P_[ 0S .Su 0Sr 0So00S.Sbjh9ZD =400S 0D)0C ( 00, BOP5D0 Sz@ 0D;pD+0S0k `〠t0`Spb 0S @0D+@T 0Z4  0d 0 uP8(= <0 2 ݍЍ词@0(080 YPP 0 0P0;=400D S/D;d 0D;x700 6P( 00, BPH 40@寍@08(0 0P D;0B& 4Q060d 0 PD; Rp6 00 B$0#8 (0$00(0D+00pCW``WD+ 5 VJ  0PYW0 PN 0 0*PF5 00W0#80\5 D0N0C0 .  . 00CS W0A 0PD;`0DkV:Z`0 D P D;.$0F cD;|d0`d 000 hPD+0D  d 0 WPD D .D+0 D+d 0 CPD+0D;`V spD;`V0D; 0d 000 'P(00p,P`C 0P0 P 0 P=400SD :.D; D+D `8. D; 0D;`2Cd 0~0 PjP:D .D;b0D;`d 0e0 PQD .D;0D;0d R0 P>D -D;d 0D;d10?0 P+( 00, B;P!D0` C1 PpPU\ Ԡ P`/U00 FzP0PE0GS g0 mP<0 P6D 00CS l& =400DS0&0C =400DSn 0&0C xD; D+ D ` +&D;媠0D;7Z0 qPDD +`D D +D;( D0`0(`l70 0 TP D p7B!?C0 SA0 BP=P D440a +0 1P=400SD c+`D D ^+`D;`0D;p82 0 0 Pp0 D $P D;h`D 0 P0 D 0P D+0D; 0Pt0 D Pm D; D h 0Pa( 00, BqPV=400SD; R,-4 R i0`d 00G 0 P3D+0D  d 6 0 P"D0D d % 0 PD; D+0SS ( 00, BP 0 jPD D *D;D *D H[D *d c1D;H[0D;D#=400DS 0d 0;0 0 :PDpWD'  1R0̠`` 00000=0 0H+"H = 0D;W00B- DH 0 0S 0 P( 00, BP 0 PwD -*D;m0D;`d 0v 0 PbD *D;0D;0d c 0 POD )pD D )`D D )p`D;d 0D;=0D _-4 R 0B(. -4 R( 00, B6PD+Qa>A?C0 S0 ~PQ=00H+C"Hkf=D+0 0A`D+Hk00 ^P=00H+#"HkF=D+0 x? 000#80l0 D;0B/ #0/0C  D;0B/ 00Z0D:H 0 P3Z 0 PD;`DkpW@ 儯 0 G1;DR5f0 10"300 0D;D+0S0L p〰 0pSC 0S `D+`V 0[6 d 07 0 P"=0 10"3- 0;D0000;D020 20;D0D000D;DD= 010!300;D0000;D0+D200+D;D+D+D=0 !  ;D+D;D;D;D;D;Dz D;0B, 5` pPWW t P`/U00 F3P0PE0GW 0 &P0,0C Y(PD D T(`D D O(`D;P0D;;2 0` hpPWW t P`/U00 FPz0PE0GW ݻ0 Pl=00H+ Hk̻D;-  0 `D; N:d 0Hk[0 PGD; 0SD;.* `X*X   D+@p@ [0 P* 0d `00 PK`p@ D;S: 0 PS 0)0C d|9d 0` 0 lP0SJ  0d 000 OPD 0 DPZD 0S 0 SP  D;0Bp( 0 *PO 0B@( =00H+HK=00H+T'gD;`0D;p0 P7d 0p0 PP 0 \Pxh0 PpD &'D;P0D;0 Pc= H0w0SZ-  B H+0H; 0-PI0 PAD &fD;`0D;P0 P2= H0F0S)-  B H+0H; 0P0 PD &D;P0D;0 yP= H00S-  B H+0H; 0P<0 WPD &D;P0D; 0IP=H 0PP=00-0C0H;0 H; 0/P 0 Ph0 PH0 P` 0 D sP0 P(0 `CD;S0D;PP 0 0,P{D; R0 Pn&D;d 0D;T30p0 P[0 #0C W 0 PK0 PCТ .0 P7 i D;0B" Wtڀ0 Pl"` pPD;WW` 0 P`/U00 F~P0PE0GW k0 qP0`0DkV:<0 aP e0 UPd T D;0BL! 5 D;0B8! /W(0 ;P1d 00  -P  < 8 T ؠ | 4 8 < Ĝ x ԛ x D D @  И L 8  ̖ X T D  T @ $ Ȓ 8 h Ѕ  W(0 PnH0 Pfd M^W|0 PV0 10"30;D0000;D0 20"20;D0 0030 ;D0#100;D00;D000;D0P%DkpW`Dk |0B! @- R  MAL  ,@0@(@@; Ĝ0 ЍMM$000 1 2Ѝ/᰼A-PSp`@@V0 X:@ DDH$H@PU #P( 0 @X:DG-0pW::P0 @4#$4T00 ` 04#4 0@T#0T4#400S0 XT0 $( ,0 P@@ꗼ( 0 A-QMp$0PS@` 0! $, (0v(`V0S}(0S0! , $P, (0V3100O#Pq,0 \, l0U4#4 00,004#40,(0T0PT(0 SF0P$00Q (0, Ѝ 0F0P=, (` , Q7:048 BC, p A-Pp<U P0 @x0W``W 0 .p H\p@^0070.200 0 S037#P00 \00/o/৴///@-` @0 0DM0<000p2 00 RPg<00P@0P< 00 0 <0 30DЍY  O-1P0ਂ0 M )੒ q i C7'r0ApqB$ C@$AQh!dP`3@@C0*T8W@YHX @0  p@0 SP$Z R 000    00 R@ ЍW 0 nPD 0 dPW H 0 ZPY p@ 0 MNPX : %I$DA-`pP³0S.@ ӳT$ 0D0 .R T  S\R C @D.R @0.  0T  S\R  @@@( 0 p@-0M 0P@ 0 80P k`\ P<o4 (0 0 8 30ލpX,0-@- M0@R0  >PP * Ѝ@Ѝ/ J& Ѝ@Ѝ/XPRp@- `@P PP0 ?p@!>Է00pPRp@- `@PPP0 ?p@>겷00pp@-@Q `wPPP0 ?p@=꒷00pp@-P@=P p@ p@ p@-@P 0P   L  S nP   pe 0 pQP@- 0R R  P 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  P * T@T @pP  0 pp@-PP @P   T 80,D0S  0 p T@pp@-@P> T 0 4. kl\ ʠ5 6'l 0p0O-M`0@;~ >p0S @P0 0 0&\`-Q-+*)('&%$ q 000Q 00A S P @1T00PCT Љ0I \ @00A S0P 0 EQD0 0 \0\00+S -S000\000C Q0S\\00S 1CQ$0C\0\ 000C \\00@0C \ AQڼ(Q(a(\eD<01 0[(ZN T @Z h 0&(00 Z0C 04<01$CKk h 0 'kZ 0Sa 0S %0jS 0 JS 000ʙ0 \P\Ѝ00XS1 `\`0Q QH0 9 5^iS IS NS\@?cP \00(S 0* nS h0l $ 0S@ZF$0S `Xm Vm Tm$Rm Pm~"00h0l P\Q  ЍP  ^PA\T0 0C Qࠃ0 Q\ J0\000C Qࠃ 0 JS 0000S 0  S00 00SZ00 ()1 0 j0000 00Vb0P$0 00 (S B ?00 0 0 H0SW 0STX MnPk `nPf p  pn 0S P  gb 8@PaP'7aP`p50S l 70jSk&pBh6 0+jX 0 lPhq0 j`l l l l$@:lP   ! |0t nP`  mP t0VS 0 pB p0R 0C| 00CS`P6 b PEU B0P`@fU`Ff0pX@@00S0SpG@DH0Sd 5mP `l0P(0 `6l(0W`0V`mP` 0SP 0mP TK mPFP&  a 0" 1iiV\( 4liXp4 40##"l@T@4`V 00S0jV0S 4@ $3`P $P3fXp41@D0$",0k60C,0hB@ 03i&i 0@&3 0SR 4PhQf 0ihDF P@#p3`P `k k ~k$|k zkh0l +(Mf 0@PESPH0S `p000\0Q `000S` \00S 1CQ)\`00C00000Q P18<0\ 1401"YMS0S#0! p㨀 h0XpSl剑5Al h1D P0 p)0 X03/P+ @ U: p  @T0 X ( R W  R 0G'WS9Z :U X0  AB pP4 R 0d80Q L0R00SK Ph@` pIZO[P 0 00S !烡 Z(B( /oU" R WS0\` P`600X 40S@0 I@H 0SSQڰ S"@UP0S 0 0X, @C 0@0CSX:0,P J*80@ XC 0 0CSX:@@90 0 RWZ5}0 0 Pe0  TOX0  BRQTᱝX0$0X> R R R D000X>*P00 R*W 4 XpR000pՠ00p  QX#H 8 Q*p 00٠X 000X0408p040,00$0<0|3}0 0B P0 S  TD ,01Q05S*X@@0唠P@X@占 0 CR00X:X0  @0X 0p0%< p+ PZ<`aX0 @ BRQ X0@0X@ 03/P X,@ 0(D0) P 0, 0C0 %X0 +z P00D04!000G8!rDl$Xv)PX0  A pPk0 $  TU40SX@0@0SZ@X@8p @@%< TX0Z+AD ,01Q *0X@@0X P? *E,@ 0(D0(0P  ,0 B  ȿ x $;  h4 A-0S`@M07 S20p 0'PP: ~P5 80 0PP&  0 %0PD)tU Ѝ 00S S Ѝ0p 0,)\&) 0 G-20BM0400 00`S0. S @ጢA~ P p0u #0G(*P @T *X@ <"|42P  0 "2 0 4 30xBލ 0    ! )&@PI PPD 8 0 0@@PBP 0 00 00000 00@(T8 0 p pIP  00S 0  0pW(   0 0ᾣ 0 ( 0 ~(ᮣ 0 ᧣ 00S SᜣD 1 0  0 G-Mp0`v@P0P0 0   0 p`FPwЍ 0 :PP A-M`pPP@P , 0 (   P$ @TЍ0, 0ЍRQp@- MP``8@/0SE 0S 0S0sC S 04>  0 40 0 0P@hP00 ЍpR R / 00 Ѝp0S ڢ 00 Ѝp0S00  0T , | O-LLğ 00 `P  @ P "00 0 Y 00 YP'0 S$: 0C 0`㳐ЍP`T 0S  0C`ÿ 00Y 0 0 AI `\` @0\ " 000  တ`{`ꏝ 0؞ 4O-S,MP   0 0`V$0p 0#0 B0S0 Q6 $ R00S B 0S 0W  s!P ὘0 ` p 0YZ U0 00 @PP $ 0SRRV  RR00S$ R P 0 Dd0Pp \R T| R]  C0$ Q CTs\g [ $ ڏP05 0SV1 ЋP, R0# P0@pP  R TP P% P, P4 Y  R  p0Sp,ЍY 6#00\000(W P PP P [s}! `p@-@0P0FG p 00p`0`@pp0TSl 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< p@0/p0 p@ 0/P   -M0 3/Ѝ/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0 R R R //00/00/ R R R //00/00/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@-@0TP M T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0R /C-`@QpM Q) Q PЍ0 03/PP WP:UR X$ ЍC0  0003/P PW*UX &0P0U URPЍ Pp HHAP0PSP  ;A-P`p@P  R 0 R 0\A/U 0A/0@-M 00@SP`p SW-   P R`V V V Ѝ W` 00 R D0SPV00Ѝ00Ѝ SPp p p (#p@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝpp@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@,p@Ѝ R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C///*0 0 /@ PM0  1 0Ѝ/ H0 4 /0 48 P @Qa P @Q㈀ ؅P @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] ᯅPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRQ P0/ $$  0]R& PR " YXuQ   Z J b" R Z A @Rg .R`P@n0@,Ѝ P` 0D0C  [4:_( 0 ,ЍX 0 ,ЍQ    Z "    R  PXY  P0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy 0G- QpQP>*0S) R5 `0@0S/ @S" 0W*T   000琐    P 0S00NAT0S!@@A@0W( 0 { DRO-P3P#RP3 M0U 0p`\ @H @R9 R R% (00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0P๐ 0A\ R!ɑ" 40S 04 0- M ЍO-S,MP [   0S 0S@0P0w @Pa \rTp000[000 0P0$@0C0@TX @0S @S^  0 XL*PST p@0T00S 0 Sh*`V` ^ N Y[ R0P Z PC Ȕ(00P0S  0R* 0G S 0S 0 $p0ATgP0"1 0\0[ 00圔( 0 ,ЍATX0S"  ! 0SP4?<00 R```V0 Ss000R0 ABQ AAX QS R0SY 0R?0)@ )F 0 ,Ѝ 0H p@- M P0 `00p @ !p < 40 0 1 30ލp@4$t s A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލz4ls s Q:/R/0S/S:00/@-\@3$* 0^ @R R R Ó( 0 0S0QA^ R! Q 0Q" 0 ASB @- SQ A 0SB   0  @脓( 0 / @/A-@P`TP' UVT P @TP 0p V 0 P( 0 0QSp@-`P@ 庖PP@`V  0R p/pA-PAUQU@A`pPWڀ1AP ( 0  0 ? 0 Q" @-ASRB 0@S A 0 ے( 0 /-- M ЍЍ/@-M@ p TЍR/0-S0 \S  R 00O-@` M P hP-Yg +Y` 0Yi T @Q O3p;Z`PpgD3p0Z`P" [)SQ" K0I P0aIQW0IAIQ70IT| V[SQ;+B=0S \0J0 0 Ѝ  00YXP 0@ \@ AL\T@p@-BR"^8 p@,00a@P0T0Pppk p@-BR"^p@O@P0T0PpA-@P rMX`0^ppAtA 0OH0 TAXA\A`0  PP08 @(0 0 1 30rߍD2j 8j 0   i  -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/i QPO-M@b 00S000p!R !03  qPP E`#3?`:0P*Q30A !!!! gP 4 0 ଌ U 0C pSLP0 0@pQ 00S  Ѝ&T 0 @00Ѝ 0 0A-@`Pp0 0@0 0Hg XHp@-0 000St@@@pdPddP @P@P 0000 0 g x p@-P@Ȑ p@A-@`P1ppp0php T  )<0 $  A@f 4 >;@-@P0S  3/000S@誐 A-pP@`  @ ;u000@P p@-@P~Ppp@@-@!1BMM 0`PF040@@@ @@1qPpS p10S d!p0@ U P@A0@ P> 1 0/{!0 0 4 302BލЍ=P ;@P  4/P Q Q 0 0{x0 00P 0 0  @T{0d dd X4(c \ O-qQpMP 7Ap@f a@0` RD0 0]1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W r0@@009JQx00p@@4ЍPЍ<0 0dz b X, 0@-0@P$M P P0L0 0 @P $Ѝ0d G-RPL 81040SA a q@`p #)/0@S-00儑 000S y0 00q0 00 xi0 00 \a0 0 @Y G(00L0 h|pG-쀟0S@P$0S!0p]`PP @0S PU @@P 0U00 ds8@ 0@  P` `ꄜ̛O-dM∐PYSRßQ @ 0 3000S~c`0S00 00x#00t3 0  0 0eP W<3<0043U0 @ 0 Q  Q P0S- 3/0 0'@W$U0 L00L*PK 0SH 0 <00@00<00P; 0 S@W@RP00S,! 00C0T@dЍ@A,@@@510\U 0,0S/  R|1|0$   @$(0f@$0@S(  ( @0 Zp+ p1S `cPJ 0@0C000$   @$(0P7 @@$0S(  ( @0@$  $(0D] x, xX(ؘ$@-0N \0N@ T \cT 0 \Y 0 0@- MP@0 P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000F̌0@-l>0F. "l@V,h @P^QhLl -R 0 P0R 0R R0HĕC-$Ÿ$20#Lc\*0Sm S} 0C l l;Sàʌ͌fc\*0S[ S@a 0cϠa^l@Ҍ 1C0o 1fcf Qq P@\ pp0T0C␓H` G41@?L1c1c0P0B0P0BP`N4PQ` @PS( 0S l lVàڤ0@00002c2cPÌ l làL l là@)\P ף*Qgfff$Ip 0P /0S/ 0 S/0S/0S0@//O-M0 @  S 0P$0@8 <@D0T T0W,Wn౔ŠPnnAD0@4j\ F查^౜NΠ @n nL4jR౸柵ƟL,౜BΠϠNl !B8 < jQx柵xƟL౜AΠϠl 0 A@jPƟ 0@c@sTP0SjQ v f V F 0Sj ` `U1:`X1! R< PEe@Ϡll  pC CP Q BW^oPU< H%@0 c sD0 8j0 ;R~ `@Qq\0&Py 0$ UTY WV] V0 0P@`$0Pp?0/ 0 /?0S BͱV bͱ 0$0  a`G12Bd@3&bCd`@GGd 0ԃ0.0̓0;2T;r70Ctw00p?YZ0c 0 ᴃ0+Q _P  .0㫃PVZ}c 0 ᡃ0+a o`  .0㘃[? `C#E@CP 2T1 0 cQ R@ 0@ V@! Bqgqg[pCc 0 o0)   .0fr?D0CpX1 # ?B1c1c0Z@ 0B0 ,15@02c2c2B !@" "b1C S/  0@ 0Id 050y.0.0|4:`vc 0!0&.0 }:E.€Qk9_u"nScm$Ių 0T,yc 0 0*Q _P  .0PPE`0@ 00T @ @D0 S0@@ @$ 0Ѝv c 0ς0)  .0Ƃ ]<00P<000084P<00Pz\ꌇT 0 0@-pP M0P0@=P T0S V ZPLPQ%  .   ! 0 0,. R0 ^ 0  ! Q0sԆ 0 Ѝ0 S, 01P0% V 0? VPՁ0R ,PPQP!V00%. R0R!:∫ RF\h 0PPC F>02YVF"F,l Rl0l0U"RP*;<Ѝ"R 0S*0Zg2 0*P;M@PP00C R_U_`,⸠  `PPP 00R 0R0S 0V0vW2 z6 @S%VCT00S R ;S,S SP0\- 0 (\ 02FSPPE5PspP>1PmpP, P00cP049@Pi@V|hlp崠hpx|…崠 ራ }ЍHPt  0q [   10 0!0pS0S >S0C#1 0\X0(0P 0,Sl040P 0S   PTl6$ihƎp60$|ax倆0*;$L, P<@P@ğ嘄嘔00p8p[pT @D bY1:LtbW 1!/ 0Pppc  p0@P8<@ P0 @@ @0 Q0 3#唓#cR01:#cR010! 0 cR c s S R  l3@0 @j, ($ p4 1  @R -S +STP *EX1TP T00cT0W W Y8p0KpP@8<@ P00 8p pPPUS lQ8 X1X!@0d0 T000(aM@@`F T0P0\  R@ d?@D  @D0P0T0S 00 PP@0 0 l0 00WPࣥTD,a^^^Ġ h][ t]0]@-\Fa`\`at!p0  ~ wP2L! `p,`0 H v1 0UP@@ w 0 0 t0 30%xЍ0娀 S``  {T 0 }{0l 0<0 0\ t0 30 xЍAv d`Q 4 (z@P-D0D 00 @P000^ N DD0@-00@S $000S 3/ POp@-~TP@Tpy  03/P {k@Tp A-h0`0pP@P UP {S $0p `@ \O G-@Rp @T `ᗆ% 9/@DP@PA-@p`pPT yP t`L2P @0L€ 00#S €^"RxNHNM0O-pA M@`tP2p0l P2 ?LB0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S?T030# T03S0 p0p@T@@P20CP2P2SW pGW ЍS @  L3/L2 S @MM|MpMMLLL [A- M@Q0Pp``0 80xQ|QZ8O0T800@D 001TQXQ\Q@@% 0 L @0 0 1 30ލyT 0  \ - 0 M0 0 Ѝ  --0M(0  0ЍЍ/ 0--M0 ЍЍ/p@-0 0@PXl`00CS`0p S  P `X0 X PXlpX5`L \0\ 0 `00CS`0pS P X0X /X --00 M (0 X] ЍЍ/8 --4M0, 0 XaЍ Ѝ/ RQ3G-@0#03Q00S`pP %l0. X X* t0J0P04P8'S *yT 0@0 0 t 0 B  k PP4P0XP C000 k Iupk Iu--M  Ѝ Ѝ/ -- M0 0 ЍЍ/ @-MP 3p`Pp ~@P  0P( S!ʴ 0`@ 0$  0, 0 (0 0Ѝ@Ѝ 0UnЍx0000@Ѝ 0Dp@-Pjk@$C@nkpp@-P`@s R T0U:T:0T:p@s00p@-!@R ! 0P0 0S 0BPQ`0AP R 0 U00SpSiP0hP `hP0  .x 0`0A- R` P$@ R0 0,°0aRH 0  a0R00S 00@0A PAp2\ #`<p@ 110L00^ 0A pW \00W00S PA0 S<A@80p@#1!L0A 0AtC-p@T@1WP` M w qw0S D!cw00@ Ѝ00w qw0S  rw0 @w0@O-=<;:9p7l3j10/.,+q)('%k#"i PmLKJxh RwtLIzS WWT 0W   0Q񏐩00@0C \$SjPg u0Sq 0Wp1!PK  u0S 0Wp1!P;  u0S} 0Wp1!P+@@@3 1u0Sp 0Wp1!P"  u0S p  0Wp1!P  Z u0ST 0Wp1!Pg up0S> 0Wp1!P `0*S0 0C P@00C P00@ S0`a`0`F0@ \$P/ u@0SWp10P 5 u10S 0Wp1!Pu$0S 0Wp1!P * u0S 0Wp1!Pu0S 0Wp1!Pv  s u0S? 0Wp1!Pe > u0S 0Wp1!PV p <Ѝ 7 u0S p 0Wp1!P8u0SJ 0Wp1!P+pn  u0SB 0Wp1!P  u0S p  0Wp1!P u0S 0Wp1!P p] p p0W M*0P~ <<Ѝ ep7d ^p{] WpV PpO IpH BpA ;p:vP0p/ @0Wp10P# ! p u0Sj 0Wp1!P^ B u0S p 0Wp1!PIu0SA 0Wp1!P<$P~0`YP   pu0SO 0Wp1!P)@J u0S p  0Wp1!P p p pur0S p  0Wp1!P p zpy  uM0S lpl  0Wp1!Pu:0S YpY  0Wp1!P00@ S0@01000C0@ \$P u0S8p7 Wp1@s P  0'p0 $ Wp1@z$P@0O-ttϟ oM MƍH0@00X !PR !0 P{0 0 \` 0S]   Rc 0(00D0>䰍00h0>X00@唰l0@`TPU @%U PU 0T  `J 0 R 00S0U`m0S @0S @r 00@0S0000PP e-= 0 6 30O oލ Ѝ PsdP    R 00s Pb?`1RR`O`.TQXQ\Qrˠ NHQ`G0L,X \DPt/0@8DE@P@cP@@0@ 0@00 0T|0P`p⠀z0%1$0 0GZS񏐧w<N_acqHGFEDCBA@cdOV~}|{zyxzvutrpofmlkjihgfCd0h6}+[Y.lT*PO)M*@0 G 0pA@0 G R$WV $@ a0P00U`| `h:( 08   S 0S@q-0z0Z;(  00 @TZ@@RPPUi@z{LP,P8P4PW Pq`bz@L,84%1$ S0PR00S<000000`BVuQ 0Qz0S0%Q 0$0QI0S00 Rs @DT L 0 Rp0 &S8 NaP@@z0U $ PBU0S<0000F040Z0( S@1 !40 S 0|  0   0 X7 PR10P @0P0CD0 0P@0 |0(@S-0z00s80 p@@`pj@`-pj*`p ``$00(0@0S 0SH0( pqH0W ZZ @x/^ |l@0(pnpPP P @0 00@s(pPP@P />  pXlP0 ph 0@ (p0 3(0 | Z& Xn (  @Zz@S00Q000 RPPUR  0Tbo {d @pd`FdX 0TPPzL0,08040+0pz0p` 0p*W0 0 G Rp 0 G Rxp`tpkq00(0p@/^ kWH0(0boH0 P0p (@_pzp`O1(0  Z X (  z( @0(0x0P(UH %11H 0Z :z@dS~0sp `(0p@PWH (0010`H 1(@bo( 0  S 1(  / bz0pS 0z0 Ԛ  'kih$gf4c b < ̆ X <  l \ Ѐ X} (0`0`S( H0qp(H0W Z( `P  H X PznpkP@000{0{0 SRT N 0SK plp 00 G R@@A@0 A R$Q  R(H 0!(00$ (0$0H $0S0c$0p`{*Ё1(0  Z Q !   R%q( <0p{PT0R4 RV R@ D8 `HV`V ژ 0 Rp`0 S08@V@DT8 pT R   V  \ 0Rbo` 0S0 H R@ @Tژ 0 Rp@0 JSJ0Z+ZVڼC @p@`JZ   0R@0 SgJZ0$ 0  Q0   $ PBUUڀD p@`PEU   0R@0 SAPEU$0 QP0 S ]0P00!<00$ `BVV`%  0@dPppp P@`FV   0R0 S`FV0@dPpp%0 \ ` 0QSw0L]0P000Ttf `` 0Pdp@p P` K[0\p0SK[ @0Pdp'0 Q @ 0 S0e]0P000 Y]0P00 Z @boA\@@P`AD00PAp0 S D JZ`Q0J0S ]0P00 H0Vڠ( d@pPtpp P@`FV   0R0 S`FV d@pPtp80^`0zS\0P000\0P000}\0P000 \0P7 \0PBD Q 00 oS:0` 0J? 00  K c  0 R *0  SK0    \ 0   0 R S0@Tb@ D@ P0p0%S` J? 00 \ B\0P00mD0 0Cp0D JZZ p@h`  JZ{0\0SD @00NSQ `Wzsʤ|p@P00L@,@8@)Sz0p{@\0,@Lp @ R Rbodp R C00! , 0g 0 @ [ 0P t[0P00 0@A: X (0( 0 @= { QH ( H yG@:C X (0( 0 }L,PQӪڄ08{4L d p`lpP, XRӍX,  B, 4 HI0Q 0 S0 f[0P0  PBUPU ژ0QP0;U@@ATTs P @DT0Q0S@DT 8 0^@0[0 P00H0S0  [0P7S0yH000H0fbodp!000  0g0SP00 @0GpBTo `` 0P4p@p P` K[0\p0S Z0P000 Z0P00 0q8 (10R+ S0bB- C S)!rھ @ΟcS,/L!b0C000A0 A00@0A^B0J/ ^@0`0`0Zz]@@p_L@,@8@hZ0PX ((  9SH(01HS-0`z0͵Z(  0 0+X ((  QH ( H @r  P k $Z0POz @0P4p,0 Q @ 0S0|005@@pL0,040_$ g X ((  Ϡ d  S (Ϡ 0 9 X  ((  Ϡ # f QH ( H Ϡ    3  S+ (ft{(p`WZ`{pzT0S 8  B0S0S S0L8 T,@@p_4@zp Y 0P J2{0 \,0p0 `( P\@0bo40{T008`4`4 0>eZ0 pH H 0S T  S  RW0 'e0@P40 @8`T{<p, 0,boTp dpA 7Y 0P b -Y40P00X4 00 ER0 J/*!J/00A`0p(x0  4HR !$ p* Y40P002ot @dhh唀`` ,PP`  @DT0\0S SD 8 J B¯Z X 0P bSH0(@@H00mSH(01H( QH ( H X ((  X{ ((   wX] ((  mS? (AϠ 0XS ((   YQH ( H  ; iX 0P vp \X0P00 SXP@@ ~ KX 0P v AXpX 0刀bp 0R$H $H !8%0  P@0 @X0 P00I0&080@@pL0,0_2H000H0Gtp,00H0S 0`c@PpH,P pT0LpPdWp!`040 0Y001 0|Ybo@PcX` H( @ H@H0000HH   H H( @ H@H@(  H@H@(  H@|H0H9SH0(H000( />  pcP 0 p@* 0@00Q (SQ@0X ((  <S (X ((   -H0ϠH0 0pg 0 0 jg 0 0 iH@(  H@(  H@H@ ( H@ H@(  H@ W 0P >@s@B SH0(H00( 0 0`0}( 0 H@H@( 0 H@,z gfffw NNDNDLr \Ito GFH(  HϠH(  HϠ@qR0L0,0$ , SH0(H00( 0jg 0 0 0@00p0 G R;@A@0 A R$Q R! p= R p(@7RH (((H +X 0刀p= 0(@pX ∀p2 RH0H0 @( @ `A-@`Pd.d>`.`>`p6L.L> 0`pX 0P  0 <P0H 0@E P0DU04= 10 }P(0DSD8D<.=010|=4 00  ` 8|ЍO5t@@C>0 SA@0c 0c60@DT0A0D00DS0<0  0S 0 (0 0 P00 SS00PC_o0C00P0CRS000P0 t@( 0R?0S @000 ,0h0T0Sp@CN0@6@d00<0@t`P < RQR00 B@D0A< 0PQ 00S7 `P bPP RPP Q+00 0R0 R00S   0`Sy<0`0<00@0TT0S`D0Sc,0S00Sr <0S( 0St0 0,@ B 0, 00  1CP0;  0pRpS 0  ^QppW 00SQ 0YD  @ ,0S@ P X#  `P  P00|Ѝ0S000E 00D0000@0( 0h00S,00P0 0 RS00000,0SPPU (QAژ8  01!r@ \8`0p" W 88 u@P`p 0D0S  7P 0Z7 =,0`S uA ,0H0(0l00 e@|7H00P1`Cfo 0 .&0`^p $%" 0P0PX`!H0U  6 6lp= 0 0pp 0`pP 0< 0 PP l0XPT(0 0DR Ps9U@ PP 000@0Sh0,06000*000 0 5` uA l5  0@PaPd 1XPWt@( 0R?0S00S6<@0`B 0< (0 B0cP00< 00d<00000 000QQ p`pV Y V  R R R S p cP P9W  01p 408 |ЍO 00 @008040Q @|ЍY 3 (0@c010 BDB\ 0`0#p  30`@pS؄ 8^<0@0<0000 PPW~PPT 00 0R0 R00S 001 `,0@ S00Ӣ?D2 (01Ӏ ,0S 2  0P,P`(0@0(0100PV L J0Tw (0 x P h,@!"`$APP P(0 0C (0tP 00Sh0S,0,p@ cP  700S0S0DSp0S S tP P T0D, ?aCoc?`(?yPD?;'t;?@0?$@@Qw  s9R@  00C09,0S  P |Pd@0V0@(0f>0 P0EHXz PX 0H@)p`S 0 0`ph0PP@ PXHP p1 0P& 0PB 0X@0SH l0(0`ЂH0`P)2 (01Ӏ0,0b@ ,0[  L2`p 0W& 0 0 0`pZP  0`pJ00P 0PP  fP `@P   ! \P{UDZXv,0S h0SH0(0 0C l03x 0q 3T` uAY0S0 pS 9[p9  `P`q(  ( 0 PTg0 S 0Sm ST  0% 0`p PH 0PX ?UY@0S9QPl0@PX(01X`fl0X(0A0S46S T50S0 000@R 0 0SH46S0 0 v0@ s0R c00 00S(0 0(0100V`؄uOnL `P h0S ,000C0h0#h0,0q00C0 h0 p`19[ p\ YM)0<`=H 0!460/Q460//P@-@00 R@P@Rp@-@`0P0RP*0PpP R 0 R VpP 0@!O-0@MS]@DPqp1 0\[1`q0&:0 @@F0 R0 W 0 *0 @0S 00CX:X@D* R @  NP `00 0P W 0*!1R 0CX:X@D* R @Ѝ-0UM 0,@P.0L10Z0 0 00qT 0 8      lP[P봡 x$@-#@-#@-Qp@-P `0@ R @P  Z00pQ ``0`p@-`ZP@P  Zp-M Ѝp@-@ P` !LNN\ !@Ap- M ЍP/D -2")2b3c1@2`M1 ЍC0 00/0 (0@-P @M  0P@ YHp`Ѝ0 -- M0 0_ ЍЍ/ p@-0@Q r P p0 S P1 p3PP   ! Zu@0O-`M p0D A QP -5Y" @0Su SDP @T [p 0S!0S'0 000p^"00 <0SK`5Ѝ<0S QI@ 0SC Y 0P00 8 0` 0QK<0SX 嫰 `V0KS  T RB<  "!`0c - 0V0=TP  @|TQa\PPl701P jU P T@   "! 03d0 0@<`| d `P  0Q/ R  B / 0Rp@-@P*`0B @!R@ @B@DR@@@3 e]0  `f2f`pS@ * A BP   P]pbhPPO-PM$@ 80`X 0P0|  -R-+*)('&%$ { 0 00R 00B S0p0D0 @ 1T00CTqЇ 0pB @00B S0P `@ EQF0 0 P000+S -S0000C Q_0S00S 1CQ(0C0(000C ^ 00@0C ^(AQڤHXHaH 0|S 0P|Ѝ0[HZ^ 0|00H 0@0 BS< z St ?o2T0T @ Z h 0 Z"$ ;01$C `pX 005SZӍ<0Sz <0S< %0jS"<0pJp0P000XSP ℐ 0R RAQ00 0S|00|0R % F [ViS| ISy NSp@ P 0 |0080000(SK 0 00nS 0 P|0P ` X P BT0/ 0C Q`@ Q` 0000C Q`T0 00000|0 080vPv 0<P0pJpWe0 $, "`pP 05PK `PBpUp  p`pp0 A0S`Z0QP0PGU  R [r0000D0P S  `00SP0`00(000 0 0<0@ HS B @ ?$ X0dd@/P   ! W0$P    !V@p$0P D0 P U@0X0 P@`PC0D@0 @`XPQ0C@D@P@T00V0S@DPE`F@0S$0DQ<0SU V P  P 0S0S @ `  @T0pSpPpW 0 #S$  V`0P S0|0 @T0T` @DR (p00SppW'0 Ph0t5#$(0 0#R00@S0\0x0t E`P\ tQU@  !RPK (0S  B\`0P S (P B $0Se0 \@0@COoWB@T ($(40@P @(4 P 1`pP  0P(0Sv    PD PH pg0 $#1 0 p W'bP$ $30X`" `\@ @"#z56 _EPEHpXP 0"X`\@`2!:?C0Cp4656,0Vb 0\"$P 0`PSTR0 000 Rh 0 0W'bP$ 10X"\"#z56 _EPEHpXP 0"X\`h1!:?C0Cp4656,0V 00!$P j0`P0S` 00S 1CQ `0C0@0 1 ヰ@P 00C0~P08 0000000 |0P P" 000ꈙ x V瞯<d A??N\s0$ H @0 0C10 T 0"|0 0 80P0P0PcB   1@PPP V 0 h00P#$$pfP  B\.(0SK 0 0R0 (0 1P pP 3X$P UPP `0 0C B`0 0$(0 2V 0 $L"L2PPh(pP   p 0#q 0T$\A \N 2-PA0$0aZ`P\0PF  0O$P= P|0h 0|0(0S 00CS(0 (6P8 ( 00C 0( 8 0 d 0 0RW0 00S S SA 000 8|0000 @BAR *0    bX00  0 b3"  (0S D0S 0P0|X"0 0|00Q00|0 @0|0X"0 00(00 |00 ~X"0008 000 `A@P 0@0C0W$0 Cn0 @5!0|0 0 h05pP#$6? 00T0 00cT0 Q PUR08 0 000P|0 SP0P`00(p`0,  4$$p#0(0V@TH @DPP`00C0009P S !l Nl l HlQ`@TPH0$`0P00|80P 7U 0P h0p00ch0X U"7R < 0a0P0Y,060P` $"< 5\ 0T"|0 0 80P @0R0@00 ( B0 RူSqЇpS(^Zq pOP :P0C$0Pj`" <00C1 p@ c\5P`S0!0P|0b0A`nVP0pe (0S 0 |vP0mP 0!0 0C  | 0AVP0pB!0W|06(0` PR0/ pPs P)0 |000C 0GPa 0S D@ 08 00| y 0Sw40P(000P00P0|0p}0|0W!0|0 (0 0#R00S0 V W 0|0 3S 0|0P`0P |pS!0|00 R0SD00D0P  @1@d@P000!0|000C0 @-00 0O-RPP@ M@`PV 00 0DpP@  "8$8!80Z#8J @Z3pK q WG N@ "8!8P0LL#8S 0[ 0  0 Ѝ @P   ! Q``O-3ß0 M00@Sp 21 `000`C0  00 0Sl  0Sg SB0S00XS 0QZ P@  Q R^T#3\QcTPQ0 ^ \ <0QR- U00\0S{Wc*0 GV*0F@S3 F\   gU0 RVOWM 06S ЍЍT@DPD@ Q09 Q0Q l  l>P:00XS Q0RL)AoR^& 0 0S  0c1# 00Ѝ QN0O0l1 c, 0# Q:v00Q )Q  0{ O-Mp<0` >H8@P00S 0@0P 0 B@0P 0SQ^  H0PP   Q0DR0^^ 0S 0S S SK pPr@00@0 0c 0W@ !TpT0 Pe 0SUP0 @0 0R R 0\Pb S 0CPPa R@ 0D0CSڣ0S" pP[ 0[0 0 RYd*0  TDQ @J \  T @   T 0CC10B PDP|0S0SCU 0S S S ( VTP@"00ЍSu 0CPP @+P~ -P% 000LP 0ࠃ:L0@^ > L@YPl #@Ѝ000 PL 0\@0Q  R  r KS S80S 0p00 0p b@0S"00@@P  D21 2 Qn\ 0\0C 0 ^  00@Y 0Sg Sh S @0p 0ЍI  PePg0S`q S@"00Ѝ@ @QA@E pPJ 0H0Y@HT G 21@4PEz@80SjU U E-P 0 00b80S80S800c8080S xTp0+  RP!@L80S L80SH00@X \y0l 00f@`  BR"@^ 1P5"@!@V+P(&w W ' A-P@p`! P  0 P  0 PA-P@p`7 P  0 P  0 P0 00/n 8A-@> RϠP`pl3 ^9 P 0 W@0 p0U@@PEPU 0 B P @` pT  0 B Pp0U@98C- M` p @P} 0  C 0C2S P 0S Ѝ6cz@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ Q0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/(̭A-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0@- !P@M: R @ 0S R0 @ЍQ0@-@@ T3#H1THPD1$LPA2 L+@L+l0n0(@- 00 M0000@  0 0 0 30"Ѝ| Q000000 000000 Di i X1A-0@`T@ T P4 T8#8Sp'Q0- Q"q1 q.0R0pQP T@W00@   COPW@ TPZsX@03a2!00ꈫĪA-@0 Qp`U$; x S V$%R JV@TXU45S 0A-ˠ Pa LRCs\ LU/ rR?0b03 P7  pp„ R ATT% U# \E20  r/>4̠ @@\ \/,Q P AW/pWp„A !  B E@T@E0A-ˠ a LRCS0\8 \TN:x10@o\0 ^# QR<0b035PPA@DT30!#11S!41 #<12 A"LA^U /B \ s၃p AT\ A Nr14L@QPUP@E 0  ]@T@?tDO-`9:#:p \S)*P@ M"* 0\R$ 0 S6C 0:  Ѝ> *0\ S 0*p`W03"X  Ѝ4>70 G- PXl X` PD Xa`  P)3QB< Q7qW ?qD0 @)pY Q X Y00    $5;0'% /@pY X``@p@pW0VVA?@ D da2  2 N33. ϠФO-鄢 M! # @dtk{[@0R- P% X@R ?[e0k?0 C c4 4+3 0k# 0K>#@>@0@2 0S 0 ЍO?9 Ѝ X7 PHP0  ?{M`? + 0K# k6,+60 `2 @5205P0 P P0/Ġˌ ЍQ`b ЍO0@@0R P@P 0 ЍO 0RH0H000P0O-Ă M!j# FUu,["{Z@0MVW V0 `T $:S0{:H20Ao ЍVL Y< ?Ze0j?0 C c44*3 0j# 0J>#@>@0@S^ Q 3 #1Q11!01 2  L2!L F>!l"4< ЍOqYA ЍV P Q1 ЍO   V! `I?z'? * 0J# jb0/tP P03 !0##1RD$1",!020 C cA.c00 //p@-K@T0TUoJP( V @DOoUB@T p~T03@d0 L  000V`p@ (  000ppp@-@;0SM S^ #  0$", !0 C0c. =Ѝ^ h <$;S 4#>Ѝ(R03:045S <?S/ e ?S/  \;p@-!0@S. ? T5 S\J J P03H:04Q P00Cà0cTR7 ;P39:@ @AA!@aà$!RU00 p@ AABAR(R 0 p\0D?oR20S p@o0pp 0 ;!0A-ˠ_S  _%F \@ \RH RQ3P:TA!@L,lS^+ CQ03A:0 !00C0c$qaV 0C}@~@0p <?0 \Q AR^\R A0 a[0x,;0S ;0S P 0/45S 0 ;S l0l !;S /45SP/P @- P/;0S ;0S ?S/P 3# /R /45S @-45S 0/;0S ;0S /R?P 3#P/S 0//45S @-45S p@-88A!:S$&O#S,C>c0&0 PcT @C22 Q-pQ1^ Qp  000p0C?o R20S p RS00 L  000ppawTp0@-0!*P M!: %+ % C!A Ѝ0@ 0O Ѝ09P :#:S % Ѝ04>70 >-Ϡ M\Ϡ L Ѝ Ѝ-Ϡ M\Ϡ Ѝ< ЍG-T!MV#zO\` PpO$ W \$0 Ѝ0` GoP \M Ѝ 0pW 0 0 p P`U&[㉕eQ`ve` #>   0p`0#0 0 0S@@ 0A PЍ 0 ЍO-s!j_,M#J_%V `$@P T T$00ό 0 st0 0,Ѝ Tx ,Ѝ 0 9`V  0  0 -` Š5(ˌ$ @刅Q㤊 E000R0 FP @$N*0/S  #0!:*S0p#!`!H:  1!)0r0Z Sl\ QY0^ 3# 0 Y`FP0 #0#* 0h: 0Q0! ,Ѝ0H,Ѝp?/0P00P 0 0G:`ch!` #  \Zp#|`Z Q Q Yp R0`^3# p  ! #% QP)   0/ ɠ@- ʠ,ʠ\ l!P Q4>70i QP/>@-!  #  ^Q\ \0030# P 000 2 @-!  #  ^ Q\ \0030#SP 000  A-q1pP0S2 U`e@T`* 0S00 000AT !0S 0`te@!0 0D1S  000S 0~,E xdP 0p@-@P0p R pPQ`00App@D `_80 0QApp@SC x$d0  0#10/!Q30Q#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P@pP   ! C`~ ((R00421S/ /@-@P0@0O-0M[ pp @ S0P0= PaU*0 F B  "G 0 X0 *0I0Cp0Y003 0[P^   p0>0 Y0 0[ PT@T 06S 0@ЍG-q0p@9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,1J1EPU 0C  P 00Sj`P! 00000000i0S x0d0iV0S 80 ,0R0i $@ \xdqG-`0b@TP塢ڃ0T'P# Zp  !pMF0  n.  P2)0@R0C`0P003 `MpG P `C-0P!1^$23\ *G-0@P@DT`G !1PG*32\ =:Pp @@  Q0 0S 0SQ 0 A B`Q3 3pU  0 0S3#U0 E B S 02LS @0@P`P 0 0A-`@apPFF 0` P0T 0@*S UV@S  \ SL T 0`7S # 52#10C c2s#0FUTV 053 1?A-@Mp`@PBP @p!JW0T0  CND@D@5`@Ѝ P0 `00 !30 0ST0C@@1`Ѝ0S0/0 R /@-H1HQPP@M?r`P3 ypP-0S  Q4 p 0: SkKP  8#800@ 0$  0,  0( 0 0Ѝ6EO00Ѝ<0,E 0 Ѝ%E 0 9 0Dwp@-@700CS00 P7pP  BR  /p@-0rSL wS aSOP D 0 pLP0S e C+S. ^R# L0S@@p0KS0DS0ES0PS@P0p@-S4 @y7 P00P! !& 0S 3/PP೼000P @ P v00 `p00aa^7@0`` 0pb4PgD 0P000@-!@R !P 0C 0 0 S /4p@-Q1P0@0S2 0 EL 3000S7 0!$0 3/0P:0-p00P @ P 00< R 800pI0PGU4P005p  0@000 pC  0@00pp4 4-Ѝ/p@-@P@TS S S C 0 pH0p@,0p@b0p@6@000 0 0000/ ?`4 ;`@:AB98C D`? >`E=GH JFI`<''(Op'tKLM Np匀GF`DE`E DpŠ`KF GpJ Ġ`IpHHǐ`I JpKO ƐMLNp`L NOMpp R `p QpESPFpDGp` ^p0P``pA/`2p^ APpM_Ām[PQ 0pfPMQ 0pfPBQ 0pfP8 Q 0pfP.Q 0pfP$Q 0pfPQ 0pfPPQ 0pfP UލލAOA ,!a`Qp@-P P4ATp  @P 41S P0p@A@A-4!@| pP31S L^ @P!W4Q w0P0W0S!R PMoPP B!Rp d9W?Ap@ABE 8pDPF|H`'&&&pHIJK`L0, p  A AA` P  L0 H HH岰 S+I !!!EEEE,TGPGp'''NpNNNR.FF`&&Ƞ&TCCPC`CpR'BpB z 0AS[ RWI^Sx  a6/@ PK(P QP p 0D A2n0 a!N^ Q'`$Va```04a$PP   ဃsc@|C 0 0 QߍO 8 =y= Rp=[ P ʠ0 "ؒ4 8P0 p qD=@ =`V PuP0 \4S 1R!3Y 80rYYf@4P:`P3w ZŠD H 0 $'cP&80KB<,0(PXpQbPQ =@̠ 0P(4,04 8Pp ` aD#=@ =P(P &]= P Z Q=PPK=WG=@PB=@==@! aLt,l\O-@(`10p0X 000; Iq00& Z#Z! 0J/S   0 0P00: S 00 p0 R I R0?004 <0 0 U! - 噵p"00SY `0 S00R0J Z aPu0000S ٶp pնP _0ppGorr  p|oR Q0P:Q0Q:+@-p @-@@ᆱ $ @ \ p@-@^P[#,`UP$ p@艶 00@-$M @@P U 0P000 00 0 |p 0S$Ѝ0$Ѝ00TP 0p 0S00000 0~ 0008m( O-@0dM\`P `T09+ \0 02+\p qW0G 弁,p 1 JPB 1ᴀX0C08(#8XX0H1崀ሀ!0  1 'P pp 0C 0( 각 0H⨀H(0!1 p崀  Pp@-@`PP 0 00(0`00Q(0pO-@M,0 01 pPD ap`F`h&hV2 P`X%XV! @H$H  @W 0F8P h 00!01@0 @3 0U @EH$H 0f0@0p 0Ѝ " US ! B ("(R p 0 PЍpQ tP `  ἀ @P}  㼁0S0 (c 뼁0@S 0H 1KpP 1 X0C00CR  ("( Q  " ;QP (PP !@ B  B  `P'  Q0S0 V@UT@ Q 0R `0E 1pP p_ pPl xP^  pq` A1@D@@DH$H vP@! @1 0PY P`F@D!H$HV@ `F! Ap 9 p `1 0p1p`01( P  @T *p/٪000/0^ @-@P , @ ($ 0">O- p$M2P (@0`$ \0 0p0p pP@ `  %0Ÿf#""`( "$ `$"     Q!  %&d!"d+"!  px10`00h1p0 PP `@  0  0`.01. @Z98#(5#l  00# 0$ b!00#b! 00 0 @ 0@P0 P0 0`0` 00$Ѝ>x=iC-@Pp M' $Q`?PU($8 A#0(0 `P4`㼀` b8"#4b4#  0V@h ## Ѝ 08R(@R )P@ b# 8  #)P8 b# 0A-1?`@Pp @f(XI P 0刁$0@pG0( $0p ?W?@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ qp0 p$0?W@`G?`@`(`@ m 0$ <@P U 0$ _ 0$ q0 0$ `R @-/ C@-@P 0 C@ (" 0"8R @-}/z &@-@P 4@ & Po" 0$$8O-B \M T6  0  ^,  ~?  @00 ( P0 , D0 0 H0$ 4 p( 8 H4 < 8 0P`L@$@(P P`p,0 D00$7)$970#%'ɂ%)' "ˠČ 0#ˠČ<0 "$0  (&Ϡ' .( 0  *  )'& 0 )0冼᧳ . 0<0  4 8 ,  ",0+#)0 0# 00 @ 0Y$04(8300#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,`@ 0$P0#0p`+p ?(P)1 ` =<;:9876543210/.6P ڌ6P 0P#0Ġp 00P0?CP 0P 0# 0 0p dЍ0 0  +0#0 0p P4 0 # 0# ,0#0Ġ 003P 0# 0#0Ġ0Ġ0Ġ~0Ġ h+ F0# E0# D0# C0# B0# 0#f3Pl @0 00@43p0Y <0#d G0#_ P@0 0P0@4p[  ?M9 *0#D )0#? (0#: &0#0Ġc 0#+ %0#&0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#0gP0 0# 0#0VP  0#00040 0# 0# 0#0Ġz0Ġud 0#`0ĠjP0Ġed/ i--,,,P<+)()(0G-` Mp@  000 0帟ɞVJ QP0S !PPL W`A 0S7 P= Tp8 T 0S:  P8 @V (! 0S01P0PW 10 T @0@0  m Ѝ WPTU U @ U U X00YY  @B 4(B B A A A p@-M0@T 03/@TdPP 00@T 03/@T\1pH00@T 03/@T$p@ @ @ P@ T@ @ 0@-\@M@P Ѝ0P  0P /pЍ0xO-pPR M ഁУ@  `880 S" 0SJ: b 0 Z  0080 S 0Q>0 L 0 0 Ѝ 2  0 0 2 08 @@ @ Ѝ  P00 0 00 0 tP00 ЍgP   `P  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? 9P10@-@0T1!\ 0C B  S P @Np@-P`V@1@!T 0N B@n\pSVpC- MP `@(@ <``0V"pؑI@ T`1 `! @D q T@ p PP Ѝ ЍpP p`O-Mq0P0 pG 0E PU  @P 0U`1`!000  0 BX0 PU0 " ЍЍ@- M` @  P 0 q@pG t P@D @PPT Ѝ Ѝ ЍP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-Ÿ2 0|M@R0t00P`\ 00S80S `h"`2 0 t0 30|Ѝ4P  pP8 p0\ 14p0pn`0$  8 0 0# `[9 P%8pW= ` 11!040 4PU 08  R88P@PX`0 A@8s 12480Q8p :s0 S m08P^hP8 P 8 ` 0`P 8pR00N08P?IP8pmE0`0hԹ`e  42 O- ʟ M 8p<$\  0| `Vv 0@"4SlSj90Vn ,000`000P.  ]00\ S|  S `PI \0P0  0CX 0 !>01H0(0 p0S(00S0!Q0:X Z c/ \G c/C 0p0S 0 Z0 00p 0SZ0S00@2S708 R,00* 4P0P\ R,0(PK4`,0(倀8@ 0  p  (`VL` 8D7(0_V$704`8X00 S  0 \ V Y P% P PX V0"2 R8\((\ :P00S$8Q 4Y3 @ [`@, X`D 0SX 0 BPZ【PX 0SQc/ 0 00SP ZD 0 SR@T R000S $0S  !_0 0S 0@T `6  P0 SR@T *000S?00Z【 c/ \H0 SRr@T  00 R 00"00$$4 0 2 30 ߍ p 8Qd0 SR@T 000S00Z【 c/\p0{@ wx0 S ,c`]eP((\X` `0XR48 0\R408  \P0` @ R=0 SRI@Td `00_X P2 `0 R(S VPR V`Pa `8@400 SR1@T ^000S00PN0 SRc @ c@ ``㙙 0PP ` N8@P@-@ Xs r@ =@ 0 SR @T 000S@ E H1 |/ .  * `) A-`PpX@M@`@000,0 0(000X0@֗Ѝ`' O-``ßp MWA5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @R0@"2 0 0 30ЍhTŸ <AЍO躜T 04S:`X ~> P Pp` $ j   `X  yTpK`PYH  T  QX ( Q  ` T 04S`XA @p~ _X` `H`pI`@ T W`@Z~~ @-@0V@p Y ! 12@pU VYp:q?oT20S@` Pc0 0 ^Ad} hp S@P  !02300  :P0Ѝ;00ꄭ0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ00@-@ᛕ@蛕H-M  0Ѝ- 0 0 0 M吕 Ѝ\_ R0   Q/S/@-0 00@0S 0  R 0  00c0      0R0J0 P @P 0 0 $0 ^ 4@-@`p`pPM   2P0:*C/o" R; 0  S  L 80(0P  Ѝ ; 0Ѝ] C-"2 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0`0S p0Pt D"D p PR00 p JPP0000S!$p@ GPc 1 0FB0/Q/M-,+*)C'&%$#"! C- ##p00  00o 0SP ` 0g ppp  00 p4cPM$] ] \ Lp@-@0MP00TaV( 0T1S OD0T1S0` 00UTX!\!R Ѝp@Ύ\!ڏ00Ѝp@Ŏ00UX\! X\!0 000S/Y xp@-0 00PUp@0⣎00TQ奏U0` TQUP ◎pX1P0X1ꔏ0T0`X1X xh0h 000S/@-@0|0X10CSX1 @sT1OЎ0@l@X x0 000S/gW x0 000S/p@-P@0SU0 \AQ\ X10CSX1 p@C`Q0T1O✎0p@8W x-X X0 04M 0,008 00 0 ,0 304ЍgV V  ft,@O-MHP@Q@0@U P0`8 `pVP0STA 0ST@!0 0 $0 305,Ѝ  @`:( #<@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@Eꇧx@ @ P? O-p`M@ P-TP +T@`00T W Xp p 0 0  ?0X 0j 0   P @p P 6 Q P  S  R- ! R 00B ^a0BSW0BA0BS(70BU%| X[  Q P  S  R !e"00^"00 0S \0F0 0 Ѝ@`p00XS00 C R@0 p`0 A BRWvp pup@-BR"^< p@0007@P"0T0Pp; p@-BR"^p@$@P0T0Pp@- M@P`0 pdUT 0S* P  T@p Ѝ$S T@pҊ @@?p Ѝ@0 0000/: 0<0/0 0000/@: 0<0/0 0000 /9 0<0 /0 0000/9 0<0/0 0000/t9 0<0/0 0000/09 0<0/0 0000/8 0<0/0 0000 /8 0<0 /0 0000 /d8 0<0 /0 0000@/ 8 0<0@/0 0000/7 0<0/0 0000 /7 0<0 /0 0000/T7 0<0/0 0000/7 D0<0/ @/ /H-M 0ЍA-`pP@ 0 8#@T00@0@-@M/" R Ϡ?#0! P O, P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*AG-Q`pP S Xb `RSW Pi 0Cr ?o/o0CS`00c<@#ÁX  qS& ?o/o0CS@@` 0f0 <#Á0Ϡ00 Q`V@ 0XP@0B X0 0Ueo`P96?oo0Cs !` V 0f0<#ÁX X go0`06@f>0!.@<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /x 0@-@ P  000d8 / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R R  // U /Q R 0 0S00/0 0/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP Q  00S@ 00Q0 /0 U0/Q0@- S Q0CP S  @P 0@ U00Q 0000@-Q @ TS Q@DP  ST P 0 U00Q 00S @Q U //q 0/  // R S 0Q00S0 0/0 0/0 /R  Q 0/0 U0/0 0/0/R  -/@-\00 @@0S0s R S   0 /U/0 0/0 0/R S Q0 S 00 /0 /U/S0 0/R S 0Q00S0 0/0 0/0 //q 0/-Q S Q R  0S 00R 0@-Q S B @Q R0C  SR  @ 0U00@-0 M0| @000!0000 4 ,0 0 0 30Ѝ,% $ 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/$ $0 00S0/D# x@-@p@-0@ ,ppP_g0Pp(pp//////\ //O-qPp@`T4M U10 0 $(, ( 05/4ЍĘ0S,    q!Sp0S S9 3S0SQ00 X00Z00q[0 0 \ 00!" R 0S@L RT\00  L00 S00q\q|phpXpDp0poo/O-˟ MQ 0 ; 00$0t;0 0 0%SS``S; P0p  0GZSZXWUTSRQPMnJ~}|{zyxw?>=<;:9876@43210/.-,+)('&%#") UP.% .|x`\rIRW P 0,p,@``P@^` V Z`4 ^ \ [0ʄS0CP Z0404 R*d 0PCUPE_ [ 00ʄPU*Y00Gp00G S`   0 00Sp0-`p Hp `@T u  ]0P 0CUP0 `e Ep xp `700 `uG 0SU00@P @UP0Lz 0V O   0pp@ p*W 00G SPpQP00G S+`p 0 pP 0`ppV `pP ` 0,@, `7 0``0` 0u 0SU00P @UPV0LP0/, ` `u1 QU*P @3 000 0 3plWp 5p倐2 0 0u`` 0 @.10d0Q00 S000D0@@CE @B 00<y ` `( 0& 0`uS 0@ 000 !0d00CE @}d< `u ``f P00%0!P%: 0@P&0 0 i dT0* 0P0C@C0CE @P Z  04t Zr* 0``[pʅ ^kAQAf [0ࠃʄQ*`AQAU0 [ 00ʄQ*0M` M t 0``0 0|0 Z0J0L"42 0 0 30Ѝ  e 000?0 * `0 `l ` `` `P0` @$00> , 0 @ ` ` `3 0  @0(0"(  0 0@ 0@@@# 000 0 0 @ 0C@A  07 0pPUP 0ZT0 0 qT  (A-`T0T 0pP@PU J0PES 8/`uX@pWl | 0SS S 0R / 0R0@o/ @-oO-,,@ CM Mp4čP`0@  0 @0 44 30,Cލ Ѝ 00 00p0 `0pOP [t 0h pL+  ~  0~/V H 0  fG-0S0 S,QU) X&p`@V 0`S  0P0 S@0S 0S0S0S  P PU@0@\  R!R  R0 R RO-p0#TTX BM%XMUčHd  0 а @PEPU):0 ,bP@ V:bb 0 @YPBPH <0 0 4 30BލЍ걛  O-dd AM @ MTč 09 0R4:0px0(S`;  !4"T4T8X#8%XU"UPE/ @V: ~b{b 0 0 0 vP PU:t 0  aPP D0 0 4 30Aލ Ѝ0x0(SQ  O-M MΟt p . 0  @TM 1SJ 6 Sh`1  0 ?@X@0 0p t@& @0D0 >00S/ SA`vPⰐ0pS >P3 p 0 M 0P(0S1Ss(P @`TP00ST`0v_Ⲡ0Sqs`V0@  ^  0S< ` @, dX Tf0 <0080v?@0p0L08 0\ S<0#P 1S0 00S S00T01< 021t0H0ATX0D0St00p040800)SAT| P0@P{ @0PpPPwy 0;4@ 徚P @0P@Pn 8 <0 @8 @ 0 T<0@ 0X  SX Y D0S+,0SV < 0 p0 S00D0#*pLH`|P6 0  0P4/PX|x*d: 0 6 30ݍ Ѝ0`0 040\0 g pW5 A8@P@0Ppw !@0Pp/0 = 4`0 0E~P Q0 t P8 x<0PSX0S  P@0U  00P`F $0?mE0(0 蘰 Pf10ူE0( &儰 ~PI [0Z  QP `1  0 80 (X0,0 &  R ,0$0,0$0 0 C0 SQ@0b0!0p?A9c!}P 0S @0P <0'0@0'0  (,0P,03 Q#  #64 0 P0`1  0 70X0 ,00 0 0  .101 0,0`1  0 60X0 ,0p0 M 00 T5P]0,&0<  X`R8000S<0T0=FEPC0@[>@  0 @000D00,0\Q @U`D  100 V p@چ Q v?WU1u0 1 # 3^U10#03 @$A 2UY1#30C Q# E @EU O V@$000 00S0 @0U  6 ˆ0v`1 00@0P 7~0#0@4#4 ~K (0`00,00 X3 X0@0p0(3 @X~ ~0"0@" ~0 AQR `1S 0  Z |, ^`!!! QZ   X20 @| X0Q  #0D R[ YAT *`v|P 0p tPp4/P@0 1D@\X0 I0,0b/0+S .0CS(@&0PP!PQ 7|P0q@ p20@D0,@0 0@X0 0`!`V A   | pCHh H<T̪t44ԦdDأ(x( ( S0X01SP 0\0\00S S00 00ᨰf $0P16J\0 }P00 \{P1014@PD  8^hP 0 (0(0p [{0P`p P 㸐D TP B("(R DD h{Pb0`0_P]0@6X@`06S$0S 0$0 ]VPK0g("(Dp D  T B("(R D0D 3{P-0`0*@(0PR |0"0@# (}EW 0 0R` 0`1  0 3X 0V 0  ! UPy  E("( 0R00  T B("(R D  R,# zP0 3d X0M|0$0@H$H |0,00 84 X@0&0 R h!4U 0|P=0$@ E U@ 0 ˆ20V0$/D0S<0`0- 0` ` 0/0M(0`00@ 0|P\8P1011S1Z= 0 T 0 0 60@X@0" \&0 R  0 D6 X0K!3 0 0 0r06 @X3|{0&0& &|0`0@0P9 {0'0@<'< |,0+S .0CS!@0P l{0'0@' {_{0'0' {iP0@ I{0(0( {/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@zP$Ѝ0 zP 0"c110$Ѝ000$Ѝ00@-$MP@zzP$Ѝ0 zP 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  ?@Ac@0Ѝ/MbO-1 p0AMM0 40pP H d{PPC @ +0IP7 0S4 `  0S+ 00@ ;P00@S 0S0S 00@ @K @nv @D ,0 0 4 30AލЍ*H  @dD4  Y <@D LO-ß BM M`$č@pPPA@Y[; 0.[@[VS5.K2o11T. d1 0T 1 #R T4 00iP 00S 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 Q\xPN p"PH T4 00[0 D DR000& 000SG .SB T400Pa0=S 1SA S5 S6 T000SC 0sL0SQ0S 5Y00d1  @@T?00& D DR0 0 " 00000S0000   R00S0000< 0 0T40 0P\X00V@:XP t   p@-@P`wP p@Fp/O-p0Ÿ\M P@`&T V  0 8#à  #4 : 4U@ T 0 \Ѝ10  0 wVX0 0 0 FWP0x 'xXX0SUPP   B RX00 0 BWP xXuXvXoX ⺠H\Ѝ0 `F 0S0   _X [X \X0 SX0S   0<H0H LG-@0`P p(@D T@-)/XW (X0`  X X @"440(",40D(JF G-@`P p崒Ḃ E0S@P0WU! W@WP ,EG WE(0`( "4`43Z1S//O-0P䱐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^ 0  SR 0  SRS Ѝ Pd1 00d1 HGvP0 :v  P  P060 P0 v P  P090\ v000<ui0:0  nP  gP090090| XP010r  NP020h  D0P0[^ d@ ?R? # q 0 2M$ )0P0[C @ ?R? # q 0 (32 P+ @ P010  P010갎Ď܎PO<\OX\NNd4x4l@-@(Mux{u% |Ô0`p 8   0  xa 0|ux(ЍЀXp@-AMT  u 0P0 ``00 0Du 0 0Ѝp@@,@- 0 Q0|MU0t00& t 0p`0# @0q } @ 80 0 t0 30|ЍPP  ,A-@Pvs 1!01n0SPpvOPp esp0Sp@-Q@U x3s|p )s01P #s01000pEsctVx>sP // YP //ᨇA-`p@0.V0PVSQ@ PQP  U Q0 0O-P(+(; 0M M060 ;@0,0]U0[T 0 tp01)0`,4q 05@ d!A  d!. 0`11110gqP  4J0@ʏ$z0 p d10 d1~ /P( `@ Fp`0D@SH _V S\  S S00 Q@0S S R: 0CQS0 C0SQ000009wtP 0/ H  0+ 0fBP 2#S;S 0(S# 8 R 0(S> 0(S 0x(S 0 h8R 00sS 2 S S 0<(  $8R 2 S S0S 00 S S SS@@ `0 o_AP @@ 0Q"0A'A+S? 7R2 S S000R00S 0`0 S S00 (@}@0S S 50@ @@@@@00P00H06yO 04 0HPdD@ R`P 0D@ 0R`xZ `L 0d!S 0 0 2d1  Aq0 |3ާ1|spA τ0`0S [ `0`SH@DH .S0S[ P`.AV00K[0S 0 0P % $0$004 0 6 30܍ Ѝ0, S B T T Yʔ4800404(P0$0 0 P,

T800 R> D( 0S  !R $8p0p( $ p aGa@(`P 0!P4 R B  B QP|70 pHl'  ( X'  X 0 DG @4007 p30  0H0C(01`,0FS0,0(0$@$ 00$S`SY(@CQr @T  B Q$ , R  @ p,p p$ P  gP p  B RS RA 4Ѝ50|PP @ `%0 0 0  x% 00@T:T5 B0P@500050 P ATf4000C?00 P$ ,p R*#Zp $P@d`(Op 0 P 1 T  @ P$8$ `R " @T7 c ` 0Z$@ Z (0pp00G0#0 $0Tf # 0$ a:,lC@ 01$00P0k ,0$ "g,0$ PY  B , b, $`,P (djP 0SGP( 01 (0iPP$ 0 a$,P1 0$1,P$ z0yi@ P$kb`(0$ a1h(@ P$ jP0 1T(0B1!0<0 ^ςS0}00 @P +.000@P ! /1:\0   \00 Ppp<fL nntDn@n|ma ,pD hDx`L8\XdhdO 0 1Sp@-@M P]aP8 \,0UP8Ѝp`Ѝp/G-@B@M@Mȍ qŸY w@`P_ 1 R2X<0*%@R[ZZP ? B2< b5<R P0\pF YPhX!8 0 2 K؍ЍU9P`J8 k8000S "! !.<L0L.8.0LL\ Z0J  CQ"$ C|ppY@0S@0O 0 {딏  tIO- P `]@P H1嫲p0q1  J  0000N`ⴜAO-40@S M0S0040000 P`D 0$p`B17v0C1f0V0N ^ V LW 0 \W!B! 0 SQp  R 0S  p`s"`fR  0!1!$0 Q0A$0U @ U\  QRT2Qx'xgWc 0 P 00000 pBA0 ЍVD $ U D N @ppB W PUjp1 PD D00CD0 0 10CR? 0 B Qs"00`Rx3'x1px'xP!@ A 0$ 10C0S  0"cPPT1 b^| 0 Ѝ RpP0Sʅ `P1pD  W xD 'xPU PH D p BD 01 $1 1  EHD8D(DO-P@`Q M%0᳀Xp0\[@0T2 P> @Q 0SQ 0P @P0S 0P%@P 0S0 0000SW 0 [P 00080080ЍO貛Ѝ 00008(8⌠40PЍ0000PA !C 0 0@! t 0 ᳀0 00pG0 0p0@ 0ZPP p@- @`501@0JJ@0D @$ AR3@D$0@N0!PR T00t 2@@lRDAp@裡, 0O- `ş\MV@ `Pf0P$0a 0 ^ P( Y $h0&h 000 00p000S,`I80@ 0괰Q ` * F   00J00Რ`000  R@ڴ R4 F  "0KP ! 0@0<80  0(`0B8,#8, 0 A0 0$ p000( 000\Ѝ$0,p(0@AH$HQ4$0(0 00p0000CSx@@ᴰ[ `Vh4c&hQc@0@0QD QFPPv   0b000@H$HQ@00 `V80SBAD @囚0S0QD Q0P0@ 0 0 0+ 000  0! 0Q00S 00 0H00 0 00 PL0S0 H0X0 P0S 0 p00l$ 0D40A0A8,#8@TL000p 0&0P 0 `pV 00hS&h 0,`v 000040? 04,`00?00S$` 04000`,04O- @`T @0`S0P p@D%P [ ZP( [  8#8R40  0(10S0 1$10$10 0S0žP 0 P0S 0ᲞP  00S 1$10$100O-@`  B MXp0 [ pp ` X !P PEX%X6 0("(8#80EP 0 P CpPK`{ [f0`00pQm Q 1 !(c Pರ K + pG0㲰E0E000 Bೀ0@ര0@000  B W3 PP1! 8 #8 P0C8#8 H(к0 pW0!8#80Hೀ0@0ഀ0 00000 Ѝ @   ಀH(dQ 0 Cp ЍP x`P 0@000@ A-p`P@0R"  0S00 0ᾝU@ T: P0X BPR RQ 0R0Ӳ00 00R00A|8 #800 B 0!000UU800C80O- @ T @P@D(0H$HS(-W Μ0PPI$ TP! @T @(0@DH$HT `pV T`  0 ੜP``p@-P@ 0^\ ^ P0Q Pp\ p pG-@` 0PS 0S  0Q@PS#  00S ᲀ\= 0 BS5 PA 0 \؜P   00(!S%$! $! 1Q0 ÜP @p0弐ᲀ 0p 0 S d10 B\x ἐ᠜'xP  $10$1 !( 0 O- @ T @0`0CS0P@D p M!P YY !XP' 0 0  ^P 8#8R0  Ѝ0 0S0QP 0 0P3000@- M@ P p10 Ѝ0O-M 0`p  0@DHPpG " P3 X  0@ 帠 ⌰Ự ภ *^Რ  ര N0  `p0`000S XЍ 0 ڛP  C("(0C 0@00[P @G-|xŸw?`0 (MR$@b2 SA:0JS> P Pp2 Sn1C PX: A  W1: 0C8#p#ȅ3 20  2X!P1 0 $0 30K (Ѝ P@ ZPp Z 00C @ 1px'x ⎷p# 000   ` 00 pP202 p sq p A-@pPQ`M 00 2   Q `:1Q峷0" B!2 0 0 VI WFEYBAG?0PU: Q * 2 13/pV P* 2<00@0 PEP: 2 I0 EP VP V$P "0* " Ѝ 0 Ѝ0PU Q:(0 $P0PUP`UP   Ѝ|VP 21 oPW@--M0 @ 0 0:Wh hP 0PSP000S 3/% "WXxpl 8 80 $0Q/ $0S/ k h((<<0 0R/$ 0S/ k p'A-@T 0Sp`/tXP0P@Q0@ @@XP 0A/P433%A-`MP{"XqA \p1A,4QSX 0 0 0VpLєBP b0@S<S9x ?(00000 00 00,40000000J^00tr {XЍ 00 0 0 0 0 0嶌PhY7,4%%?(%f7%O-@PMp`Q{W3#Yp#x3H RPGPP/ H@ PTXhPXP f@QQ`@0!C!-\\ R0C0X20pW WT Z( Y ,PPPXPqPT! {`P   PPa 0+0T!YqPPpWp`@ l% B Rt8  00Z V  X 2{ 7/ P  R =$ V %$ V t%YuPZ0S @sUY\>%8,% 8.U88-o878O-`4IwMpP$NzV`` `` =[p8pGW( 0R[ S 00 0 0vPePRP&GP1f0@S\tthtttttt|ttttH0@ S ttt0t@tHtTaP ` ` `` ` ` `$(,S4 0S000 0S000-CU0MU$pG4HU` ' P C```V/V  0001=0SU0S0000 C C0S S/R TUpy0Sf 0&vUo0: S (00/V%z00pJ`V  hPpT iPPN0S7 g0P0@ /Q50CS$88888$ `U W$ S$`0SG 00   B R\ L Q,Q p / 0  pPpG 0ph 0  P 0p K/R  S/R/    C  R:  (<#   30SS/Q$ 0S% AU0sX. @D!R\0PT!R\ d#X00: S  CCU0: S H1: S t : S  Sy  Sq ᾋP9 `6 Sf S0 L0S !*(0尵0 [ @#  ['8Ÿ0 S802"p Q TP,0!SQ  TH1: S B00[0S 80h!0CS80h1h!hPQ X0S 0R#0S !0S ! RW(0S0S 00 gTp!0: S0 W d%8Y%88|>%'9 >%998O9l9999 :%):86<:Q:8?\:7G-@Pw`TL&XpD@6@f@4F壍P$60`V[0S0  `RP 9⌎4P0805H`40=P0%.(0@eP8㢐P0d `5`%H`RP8P H0@ 08,%43/00P08004 僐O0 P 0!2P (1+P 0000/0 $$0 kP0; S @,0(D 2#!H8 01/NKHxfq@P5 ThdT0S\cT2S  DP0$CP@T `@ p/RZ/ eP ``1  R:  p00  ᚫ װPpYL'% LA-`P@Mp D 4 0k 2MP  TL (MP  JL MP  @L MP  6LPl4h3P0`3P P$PD3( 0vP+( pP3( jP7( dP;( ^P?P ( PVP( PP oP8$@Ѝ(P (BPFT"(0S (3P(0S ()P(0S (P(0S (Pq0S KP!0S0S zp X姹`PPa D1R`GPU 0E /R HP(PU  H00,0/003{00CSP0$0u00S p낼0s00 ꃺ꠱'%lP'pYl G%mE@mx''kmA-@PoK`p Pp 00S VᡜP㥈LP PP ``P a$ 0@-JYt4%(%%?O-`pFMP᠖uoK` ` fPp t6 HX.0S ЍfP WP! PP p `RP dP vP iP0p0 `rPxPpp0p0 p$p qõX 1S  'VDhehhPU {KP$0 S@500S6(2G@X*/Q /kP.QQ .QQ[   Q00@  0P0SP$0`S0S@ ɷpP ȸPP0S ć50C SX \H0$S P P K 00$ @K 04㗇0S $ ?RR00R0SV4 $J 0SX  *P ͹0 0C0 JP 0S N0S u10S 5S 0S 0SJP 00~ 0 0yX  PrTIUP j0S 0Sc 0?S_ 0SٷHS J 4000: S R'  S/o" R 0: SIP 0S  P SI 0S2JP 0S 0?S 0S꘲'xY%7Axx81xA-P@mIp` Np 00S PA@PLHpPp HIP0PW` /P 0S 0S0P-IP00YZ%7p@-PM  7 $ 0CHHPH@IUxITD0 00XHP00iCIܶP30 0嘔P 30S S! S  3I d3! l3 00T30S  R 4#6 R #!SR3"63 3 DA20S (M 2 20S 0S'002@T$;P0"@.B00CS00 \6 0 D >60S60016 R0S 10S<:0PT<0 01 10SQ 10SM(x1d1POT10S P10S l1 `1 0S | 160S 8l6 5@$1 I0 1p@( : 90S0F0S 00q0S90S 00,@`|P@\2To`'YIH%'Գ'''''cG$zfI%I%p'G%'YtyG-@MP ;luH2br@@0 S * cX "MpD 0 L1 04P8| HPh'/dx HPP/L8 HP8/T< 0DS 00S8 @0xL~H0QaD0@0 0Q)@0SZ L ⥏PUa0@S񟗶@ꀁFP `΄@@LE \GP DEP GP 0@0 00 @L3DL4D0@0 00 0 yPLE|JD0S hx HPT.#FY%%msyBt @ht@t@P%,7gt@-dk-F FO-Mp[kGHb@0o0C?o`S20#3ԓ @@@Ip#33 X XT 0S9 Z`7 [``3 \-RPGPP ?JH@ Pxxxxxxx`hP vP  fP@``k0T 0080 S1 : P @;J A0S #S4J  ճ`PM 0p#?. 70P0 p0p J Gp 廃0S40 080050C SA||||H||H|l0S ᒴ@Pw0S- 㐃$ pFp 0 3/P00S -$ pF tp[h0X0 0S /EYt'XO'mG,u T ɺ\I%%T'fkE79W'%saz9M(%md?'PC-ʄV 0P !@㐐`p@XPC PY`00CS`0 D@T ЍX0 X @Y'%oJO-P`@dMu$P(P,P0P4P P  =Hp4pK[lTT1Z03rTdT00 0Bp0-t$t,SPPP@S %%%$%%%%%%%$%$%$%$%%a0@SY3P0 0dT5 RT ST# QT040  pT[ S0lT[ 0 0Y  $ɴH$ WCp8 dЍ $⻴$ ICp 8⮴8 `PpG PB 42"S 200002^S R2SW10 dbV% ``L0p L,>pP  ``L0ppd2S PAPX0: S0d2232` 3`Sd2St}0 l=wPpM0SH D x/3PE/PF1@PC,,,9P<$/,,,,<-,,x-,,,,,,,,,H-P1,,,,,,,,,,,,T-./,,`-l-,1,,-,,,,, 1-41--$1,,`1A@9PY007000`仟 ,b,000S0?# }0d204202020202 @\[\k @CATaߍ0220202;/`ᚩP000S PYp= 00[ / ሩ`P000S >Yp+ 0 0V /vP000S ,Yp 0$000*2j000 0B BˉP 000S }3 S;3ť)00i 0 ⳉP 000SX"\2RRX2Ti/ /P P@PX0: S00z `P )?/P 0  PC}Z'?`PF'V3?>@p X:{\109 [tp*?[\ D%'!14<(S4?̲03&703!7$}pm703|7 P ʰ0 S 0R' 2S$ 2Sp 0s ` >p@&P/ |P 4 f/ H7 w0L7TP'\?S@<"820,"(2 WPPN0 0P UY+<P`T |d2S+  @pX&>00SX!\1 \1X! 0 \hW02T7,2P7p` Y&H>`%;XP ZU ybGPh tbrWx 3023,2 3(24T\2S(",2Q\2X" !14!8!t%' 4JJ%2b'@'`SC<[|1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0x(,A%edARvc7!% ( (bCCJ%>Y(х}Xy((zd@(O-`@pБЁQ ?p%W㰑 0S 0S  p1`VA gP db0S L\D`V.Z ЍyPmPPP fP ecn0@ SXFFFDEFFFFFFFpF00000000000000ppW 0rP !cPcP 9X},(%O-4$$MpP :P!!9`-90D嬄嬤00```$O?p6Y00S 0S 0S Xd `L4pWQ* 0S00ɤP Ĥ0S 徤庤0쳟0W30S$ЍzPOPBP4 FPo P@*PJHHHHKHHXKHHHHHHHHtIIIdJHJHHHHHHJJHJKHHHHHH(K0KHK00 P2 P20x00b 0 2:l0 0ʰP00b `ðP00[ 0 c@LJPS,N000J00G00D0 m將1 >0S v00000,000(00%000!00000000000``!0Sŝ TP` 唝0Y0S 0 垲0P e +8PpG! 0姝o0XG8fX,(($(,P((%,( #/,2CV,K%h{O-MP8]TT$ PUPEǴvPlP+HP7 TP3@ ` L9p@,  ~bqp@!ղ0S Ѳ < <0@[{ um@ PNXOLLhO`OpOLLO` 4"=p(2 R Z R 1!, Q (0嵯P(0,  R  $ @(0`P(0@$0\$0 -RE 80@0 0  p0Z@P>Ѝ 00v1 4X ? 040P ?000R0Sp b```8pV0SG0S {000@`p@ @ @P Pl 03/p T u,T#T%;/TCTM%@-,@,@@/(4M%O-@P8M -`,@岱F8 0⭱v`^ p p u6 R|,0 P8 /P0T 4P0\80pHP  F U95VpEh C0IPHPU 0 <p(5pO005SO -5*( 0(0,00(00 0FMPq#PP,%,tPzZ `Z NZJ (AZ; CZP pia J0R USRSRRRSRRRSRRRRRRSRTT$TRR|TWZ$00!0 0 ( ֤$0DS +mK0L0J0O0ܓ~05{N00Yw 3M0sH0q5$00!0 0 t 婤$0@S. X&tI03YU0zZ0QkZ CZ BZKLZ aZGElJZ ASTQQQQQTQQQ(UQQTꨒ.ꤒ,[jmPfH0ScI0S`O005S) LP% U( p0 (0S  0C!P @P!&@kp``p! P|! Pd! 0S1H!3/ 0<\@ & PH9#`P45(0#P1!H) HR #Ы0 p.) PP 0 /) 0⹫0 p^`M%/(N%hN%0(M%N%%d{,PN%M% N%8N%*7vbwSg*x9~Cydidiui m@-P 7s@8oP5(p@-D@DP@( p@X5(S%p@-D@DP@(~ }p@t5(T%| A-|@|p `(Pf,ci0`f8P@^@@4X,Yk`Ao5(T% G-`MW5PkP6P0 p) P5\5@P L5H2HP8"0 8288@宍 6 H<p HQ 5P  @ p1a 00 @ pw0 @q xm080<0@0D00 0000P0 0 080$@P  8'4 HL@P@T@X@\@HP( H$G4E4C4 0400,0@@,0( 00P吘pPPUPh0PP 0/`Ѝގ@fǎю *4(`/$V%----5(O-`Pd6M``F(`0  9p86X0K $V0S`v`@@0V|P 0SЍuPfPFP RPh lg@PP^]]]]t_^]]]]^]]^00n0P0 Dq0#S #P00 $}$00S  $q$00S Y`P q0#S (ՃP $V$0(0Sx P $J$0(0Sl 0gP hP4q 4q 4 v4` @fpKWwQ3@33@0 RH0cS pS: bSAJJK[00\Z9W W, 88 0,3/8 RfV X@3Xi <3P0 0C?oR20S` htZ|WJ% `pۭ000 000 0$,0 $00S WZ 0 %­0S0010SA1 0S 0ɪP0 0  Q00s  `1000L,0 0Q383PX& S R 0@0@0 #  R S 2P(00s  2p3X 2 033А,%5(7ܐU8 VP%CiO-P@p'M Mfট$PP =8p6 @DT T/ TX 唶k`PK'ݍ ЍAP? a@PP񟗡leffdfdffffffffdffef e8e@eTe5P50S $PW oe`pP%000P00` P LP <PP  P  ϩP P( o- qmaPq/o00 000#0 00$00 0P@i(&hPPLdDo(VP(X@SW  ⬃2 P ;P( !4P( (mk@P` Tk0P` 0(Ȑ⨀ qaP 00 00$0 00pu@P j@P  j@Pj@Pj@P `;P 6P 1P !g`L)P X  P( (`m` pP( !q`@PP WD 睖Pa>0pp+0S > +ݣ /PPm`` 0V@ r0 00pp` `  I2P00S` 00 000$000 e( 12p00ߦ0Pa0SJ+S'- 29S!S 1aV`%jV5(,ߕх}7 R3\~'yzd@edAp@-P@vUp@-P@nUnp@-P@fU@-vp@-P@\Uep@-P@TUp@p@-P@KUp@0O-nM M@00ܞp4`-LxPI 00 >R㰎0$0 0>^000㘮(000 6p@:p>P10x?0S8>D$RH$r R  $t ⦪|00<4A @0<4x00<$ 00p0 mP Pp`FB@D4TFdnnnntnnXnnnnnnnnnn8oononnn tnnnnnnoon0pdppp\qqnnnqq,r srn4snhss00@ᮧP \< $w|奧Pr Ell  (< j <$$r $b@4ᏧP ;$0 00  0 <L0(00 0,s|;0@= dm T;$50 00 0 \ ;(0!00 P 0 O: 0(00 0*B:$0!00 0 5:(0!00 0 (P:,0(00 0 :0:@0S P0$0H: 000 0 $!00  0 :0!00 0 :0!00 0 $940c 00 | 0 $: 0!00 L 0 88갸@0S 0 ]Pl]~嬦P0@4w 奦P@q 8(l ᙦHPD40 呦PD40D4Z | X0P00P X@00 1 @1 t08C@@ P0 097 000  w , G: P"P/ P Gl0S 0T4000(0<4 T!P\/-PFU ZU V¨  ᾨ0HVp0`R 4S<4Z0 H$L40V]/p`p@?HL4@0S |$H?H5HLX  $?|5XHL0$4SH$L4R0 %-p`  VN/p  4S@  y]P  =k  fP`; Ae`Pd%dV)/p `1: SD < $R-@P  <d0P,0   pP .,00S,0Z3$R  $$H0Fp!|$ L{ =p40NP40 r04iP dP$,03}pL{ 40S0X44SP0S4ڀ2S, "20# *APr 0T40S6Pp'0ST4S h38#d\%P P3 `s$2S 2H$L4P*pk0 L4H/0#! 0bp<2 C  j(0) ;[p̞h  .P L q$L4H1# 4S 0*._X0 ,P0$$4RT SQ  X0  x,p XS  S!0$Qh +S0$:$40 Q$ Qq*4m8(ï,<<(% %*&ڳ[hǶ%P%3̷ W%"0Shװ P<(-]ȱ۱8(;NRȭ]q3%`οɲ ';UW%1NvFKHL$ Q,} Q+Q +*0$0$Q0$SV 4S$nP 44崀S04144 0S @4S 0 0@4,4S $4R#1ѣ1,4$0 0 0000Vv +t +0S 0+뿉p@ P! 0d!|,N]G;+ DP6X+-Q.041$4+T4S), >-d0"|,;,+++<~,\4$P1H4PT1x0<$+0@ 0F,pec|♣P;=0Z +nP;=0⊣PN  Dp  TD > ,0+- (!O-0p IMM⌙i4, N1pP^d9`4pGs04WY `  Xa$ 4S<44S $$4R0( +p  `,p  4S P,0S x0$ $tY0 0p 0$ P0$ D1Sf  $$4P_*` hZU CUDPEU4LLLLLLLLLL܂LL LLL00vbPEUUPLLLLLLLLLLLLDLLx ('8#80( R&0C RJ ("(h044s04>0 00 0  t610(00 d0, 0@# @0 00 ( 0 0*00 +0 0*00 +0 0!00  0 0c 00 x0  <50!00 H 0 ,00 1 1  40(40Sh;d$aPP$h`+p 4S )PP$t$`0P0#X  L(@֜P@4(0(p00S0 Z 00p$#;$` =0廜P0 r04աP ϡP #0g3m`$`4S80S4d 1S !10"D 0S4j⭡P $3" b}000  $Ĕ!<#\_pX2   g0 $ rpԑ (P p` 4 $$s(4S 0@*?W  ;) $tR $4&S 4%ӠX0; 4 44 W  0)p0BgpW㷠X0:S Q4S  0 ) 8 ")0Z00S )( $!㌠X0⫱ㅠX0+<(,%۱@(ɲ\%~ڳ[h%̷;NR<(z]qZU ';UO-GM MPh gD嘤$.p40PEPEUa@@5P(4@((T((d(((((((,((((((((((((܋(0(<X(t(Ќ(((V04000XK(83 p0,0p00000802" 2@ 2D~ 2Hw2"p0L0mx2`"wf`2D"p_H2("iX42 bp0V0  2YWH1 Rp0X01!I8 1B`1p00 xp0B)pp`%֢  sRqpp`ʢ0 S Ƣ  0p[`  e0S0Shpl` 0 A/጑P"0 0 @x(xUC@Pe Gލ Ѝ,%Qka5TR(O-`PMH8 d`cP(`OPT~e (P'p ''p `Pp80ZLD` 8HO-pR؎ 0A P  Y .>> Y 'P >"OP 'Px<;Sڥ'P`Ѐ mi $i 0 [W >eWV PZ(  >0 -2S1<+02H0WC=0S UC@4PLH dTdԔp<HT, 09 0iȌ hh0P 00R0S dU 0;8;08;N 00L<ppGG@h;h00S 0{NP  +;NP,  0d hZh000S0? <  0< 0: 0 |jd@0 0L;0@; 0@0 00 008;0 h+h0P00S0? :P 00v 00s 09pꔊ h7h0`0PS t\ hh00S0@S Xec 0; 0004*0 l 0 0 000* ĉh0 ɟ Lh00S 0MP :0D0W<809 , ?d P 0: 0 T>!.u8PP9P H92D0SUȌ0 U00̌ ňp0p{P#Pt  c 0@ @ 8 0PUP 0C S0400000,00(00$00 0000000000 000000<0 0o0p Rp PP&봈Wp &r8; 00 d0&px 8; 00 d0x&pj 8; 00 Xd0j&pD\ 8; 00 d0\&pN pW  |0 x;0z+y; E |0;0; ; '0cy;0z;(0x;P+@dP d0-&Pd;"0#10@00 0pc`QHLe  p   p 0&Plc0S PP c0%P_ 0  00 5%PxRd t90 `,&UXpp 0 %Pp,5,%% =!2P(10[[[[,Q0Q4QD 0@PPPP{$D<;SʤD%>؀C 0 ?Pzf@PQ 3MU 0T 0T 0$(cN% 0>PZf@XPQ 3-U 0T 0T`"2Rz 00LPt ' bt#t3@P%LP30S 0 8t' P@P 0LP@P 0 LPD2 p0崗#p00 cx@+V@0W0 00 Df%P0" 200S} # P 1 %PmAQf%PD 1$ 0%bq S~@P 1 T 0KPZA@ P 0S 0@PKPD 0KP YG)@R){Gz??=eAY%,`RMb@A3QmTR)4fJ)pR)pH)YI)P%+ 7VR)S)cXR)b% I)-C6?R)- 8~AI)$@I)@@HM%`H)VI)I){b%8S)(%R)+eQ"a})B\r"3Af4Pt~G)  1 ZSR  p"@|T8 0S4 \0Pl0l00P0p+t"pP ݝ0S  S $t;D000[ W1 0 7 9$81d"R&RZ 0 W D G1 @S8 2R`2 C8#<48#8S|2!TR?LT!LL0do0 d22X%X  :  xx0|0?$,c 0R#R 0JRJh YJP# !UJP#!b)*3PU 03  ⪘Ph2d0h220W`! 60#$# D0(0"(002 0BS1 (S9; 3 0;#`U10#tt4x!'x008C8S!! 0 0G 8(#8 "(t# 0 (5q;    0L;X_# 4 0V6c0`#$$D0(000"(U` 5 X  p0 IX08dPD0p\5> 0X0[RV P<X0 0RpYV[60#$# D0(00"(0e&0 G0D #v̖0Z`"0  "0CSDtd DhԪ0 P Q>갧ܧ$,4<DLT\d"n 0`P#0#!" $(,048<0 _PN \0 VPE QԨu"h"0 7P& 0#$$0(#"(!T"0 #P(  J"0 PL  0 P Q Q  p n0 P  z0 P  0 P  0 P  0 P,  0 PL  0 P p 0 P  !: PP O 0`#0SH S' S~ V 50#$# D0(00"(0`@ !SpIW0KV pYpBpCp0K pv ! 0\0pG\0W0 I)p0K9+q \0\0 YpIW0KV\0, <+W  zbPV\0 \ o!\0h< X{PV a!` 0\0pG\0W0 \0~\0 P!V K! 0#oO-M`P;@0L-S@֗P0 @,4 $t%p$+4QP a`F0pP[NBPQLpGK.!PL ! ]堗P@ T3XC d@P @````````H`T8````l`t`|L@0S @HGG 0喕 0p Y {\U]Z'V`P P`0b 2 R    0 S    U+ 0  !!0!00!X᠊㝊㚊㗊㔊 㑊p4 ,pܙ0S㻉X㶉` pʙ0SP| p@@4  0\ VpᏉ`lR*o%j7f_xY<OvcO-PAM Mh@`,눧P |&Pt7tW00-S% P ῔P\ @ p H PZ O`F0S0 ` @DDA@Dv Z$p ,0Stb@Q 61 Qlh 偔P -00 u`@Z-00  D0B5S񟗌ꌵ, ,ĵеT 00S [P[0 0y긄*4P [00k00ht400d t4 `0S \[ X D4 T00Q0P J  300S P80$030(000,0-t0C?o#2p R0S0$0Pl PP3%x0@"z*@DT,3a00@`FrS= RS iS1 tS xS4y!'㠢Ȳ+ :~60p 0@00@00S 7 0" Tp#0S 4M!'~4#R0 B(0/S 5'9!(0S * 0@"(AR#0S (0S x1 0p0l"X&S <T' !(0S 0 0@T"'1! #a:4 r'Pp+5 0 p4"PTW'wfES* 83,Um@}*b%'%$%C 0C0 0B 0 B "00P00 C0 2#10C0 00C0P00C1# 0 00C0P00C1#0 00 C000C2#0qp4 0P 0PQT++U_JZ2V v`'os`F 9P$ 0SU030#:U 5%PXҳP Hd1 0rP&T6K/r0X; 3PvTS0 0R3# G@ⰁRPE:X!EK/r0A;P⡁"E0<6S"46S|" 02Q|" 42t01W㉁\劳6S L关;P W0`W 0 㮌P0 :m,6S m/PP `_$VW<6S46S;uP1|Q0@6D&Sl1 0 00R\!  H&PRL! $&R@! 8&R4! 0&@R$!  !Q   @ Q8 @2@[t0P0ؔ*,%qZ(***P%%0_lf2?eY) s#T#V !fG-P`pIHM p10PEU& :HP h0@ S S(((((((HHII00pa 4岈P ` 1!aPP S L`$@@Ȁ`(` `C< n^P 'P0S PxW VP XS0 0000 Zfl%,%Rvc0*7yt pCt y0G-`HMp0l: C S _p 2B1 `FS 1S 0$  !RS@$ P+PTPQ|MSxP`PAP MP2 :a0@S( 00 04044041! 00101@30@3101101101101ДY 000 0AHЍP PPp  R0S  E0 ,`PKPV q V D`FV R $Sa (08 ]V Zs!P*,%!l%اT*7(%C-Mp`0ឌ@PV p-6TpF`F5 VE@T T册P D偌P2J0F,V fp6PU 5 `V V 50S aP tP0S HI500@V 0S qpG IP`V \\4 TL0tP9@PA@3PD\p 8L`zP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0׶ B0SZ<0SU00SP嬋P0$0-:FU 0SA 0S 0S;`V UU5咋P t卋P |刋P& UH U U6PEU2Ld    0U( Q P! gQ U4 @U U0000  J  U QaLPJ0000 0 JP  H H$0S J qH p 6qp*-m@{T  0"600"$0k$P @P P`W(n$*%4'(,(%(lV7aV\'u)())$);)G-@PMaqM p10S `A⼑P R ލЍRP fP74fL`BP\ PX@0JdP1 JP/0: S2  S)J MLP0 JN@~p 04S00pzk_0S p |J #LPJ L@PJ(n`m+L*%7+ +p+C-PGMM dy0XM87P=P <8L=8X@8DX€P8=0D80l8"=`{C0X `XdXhXpXtXXXXXXXPXHhLhPhThXh\hxxx8囀PP   P:?h 0tOILL ` 冀PX< T <@P D=P 0P XP.0P[ SWW0 XiPP9Tx 8P 9h(pP 9T(X(f fbNP t9h(d40GDS#,8lD $H<T`X0<,D08WT0X8T8P0MM,MMMcGLNVN99#9.9:9bN42hNK|rNC9}NK9p `  >N6N* L NG-P`3 8Eh}*唆P03叓p2S l} PLUq|PH t处9PB/PE0@ *  Xpl40pEWQU P4 000`ᆄP (L,6PE0S#4 4# 3CPyyyyᷔP (LvP303 :`px pl|Pd34X?4S HS巗P  0L됋 P 4SqS套Pl l PnR|,p`bG1/΅<01 1> 110101$1外<My0"02Q$kp`h Pe Q18C8S wx`q܁ܑXl0V0C?o20S P  \ǖ=`S 0 0000 lg18C8S 3S P P=?o20 P P lK18C8S 0 P *`?oP20S 0P?x`+4Sa```%P%ap++aO ^_(%1aw%gw%8aIal++' ``7H%cYWC-@`)`P)P L1 H@qD  p,1QA= 1P5 ٞ00 P P 0 cP 9P0P00@0VP   dP0 lP000 0T TTz pݞ0S4 +gz%%44cg%gG-PC0`@00p0޸P 0S00(L崄P00z @뙹3"7xpՂ0W* s/R囄P0r0"2PP 3V밂V 0+0C0S PP y sP`F 90S -P $2  儸P 0S |P 0S10rP  0S1 0$pW pV 0SP{P ¼PPp P`F꛻P 㐻 10S 10*PK~70S0P[Pたv*Pqp 0000)rCP*P Z +Y4+Tj+dsjkt++h+%ė+O-`pBPᨒ0뤂堢 ` p2 0 qQ pPpGz{uP`P GP( IP) EP ' 0  2 a@PD@P0000GPU 3b TwPL@@H 0F ꮾ,%7>Ǿ0O-@44%005M@(5`@ 5b 5p@ 5b/嚃TP P @T0$5$T5$500owP]~{mPN DP> fP@ CPA \`pPB rP p EQ$( P00: S0S00^{`P pP 00SpWTyW  Q`P  3 t3t CR@00PPPLsqq0@ Hv$P PR Պ'' sssqbф @P(@UP,PP.@40(Vn,Y@P k  8Q00L$2"H21QY |OQ 1 Ѝ4(p#,0TP (40S(40S(4PU@P( 0P 0U0 0 0 00 kpP P,8,0`,D,J48J,xK,H6,@J,p:,D,L,t<,HJ,E,/%EFSGiGK}NB,LJ,EHG,D,,C,|G |  (6,vDJ,B,X+G  O-`MM, 0PUP Lu` `` y p@$50 CP1YR epP  00I0P80: S* `wpTaTb@DT 08lzT !0 < 0w 000 0 0 01  0d 00` p 0V0R0Sg Y (գ(0`Pp  01P 0{  {0P8\(0P Ud`PQ> 004 0!002QX C000sH$H( WpP02 0cP- P(d@Pt$ $  Q$ _ !<DVN 4}040!&DP D &r㥞 ~PRx0S 㙞0 0/X0  $ HP`0S ぞ @$tPp,h)0  Q   S  R#4p@0S0_ q )UT@PPp` tȭ,y,%7!uyyyyyy%ht@zQzz+zyx p0\0J00 JR1810 J1!1q匡0 y@Pb}0, = J0R0 =+00-181BVPMP 6P^ ?PU 4P000p=` 0N@P񟗭< ,40=` 0f@PP񟗚`<0x10< |0$0yu|<` 0q131k0$000AC0` 0<` 0W 0 p'P 0yP 0%$P~ 0 JR[0 @P 0 p0\ ʡ8d&`@00$01@□p  ޯP m100 01Sq@((P ;,4@cq ۬/Ꮲ >8:$0P 1@ P 刯1@ tp  $sp 喯1$@ 0S  Q0 0  P819:0  0  @㺯0|) t OpPd j땭P ,4L '11X zP`0S9 (Q90(0 0+(X1 @U`1`:' o 8 P ! pL V &XhVV`` 0S 8!X0S @dV$0 RS 1S !10180X7"/0 Π<!0 <2s7"/0 <<2s "/ ⶠp<Y 10屮@`  P:咮!1 01 6 `)p-| 哮 PVV`` 冮0 $``#6800 &p $00cS$0 H圮~<Q04&< 嗫p !P$Ao~0S v1 e~0S\xZ^~0SV Z~0 SR 1011'zpK~0S h%dQ``p>~0S @%0D@&P q@ :' B$k1S $ P1 t #(0p m1S #00p `pW P x(0,A>0 (0t10T$t m1Su 004p1 0($p k,0(t10#t m1S 4p ߭04opl1S 4pl1S |#TT} Ph`p P 101<F0z0@@00 x%`P  <i^0 10 ,pY !1! !" 12'GpD %+pdv`"0 倪!R1411 P,% 0$0!$0R0S"RA1ݬT1t!JP$0!  R !A$00$0 Q[ 0꥖F|p\% >?d}%YњAY,/Ij|ݝ@FIMy̶p|9 }Lg$͛͝ޛ!6\%9WLrܸ(%ל7dD,oԴĮ1Y8 1 ϡ1pW41!( < V ?= :0;Ს1`@T 0S 0  @@ 0S   e 0S  NP`p P ( RV  R   1 ٩@X0 S   0Ȭ`VDa  Q/0p@-|@0Ptt@ P T0gvDp@ 0 0$010t pUPp@-hPMP@T Ѝp@ `0 @ .s 0 @'sldjXj0ƒ S'* 0@- P@ R P@ 0\ R^H00"@ 800 0^$00"@0/xd p@-`0M TAT!@ `` @!  4!0  (! 0 %e QpP 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp @\ h\$ ` L0 @-M @Ѝ\Ph  0S/ -PM00 0 p 0 S 0 0 ЍR0*/4T*/ */6 */*///*/@-@Vy@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress4L 4K] ldn4Z44L4i9$TL#4 *4 )4 kUh-434!94"#?4`)`?E4(E`,GuLP4PYY4\Hc_4kl48k`Xky4xk4k'k4k4k4kTUl*Vȉ._l4t4t4 44O=cBZ4yl4l4l!4B44X^43 %6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory >>=hJR @@> l>@@>`>>c| ??$@@4q$@@?`unblock and -DNO_CONV?,0- -33-L,L,oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... $ 0BLXeI/XeI/Ex{EZȇ݇ # _)^)F)<)>>?QdPATH= Sh1tD^Nf_CdJCs^NcWCmPCl^er pm nuCv }]b    EOF reading here (<<) documentafU]aejosw{|ÖʖΖҖٖ :?DʎIOQ4I6N9}-+?=hjU@kUآјؘ@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''0H'14'1'8''054'0d'0k'0rt'0{#i O(S u`KX" ?u^Z ݜ  a9Ww9 s!ƥL|ا                  +[xxhMbxkHgl f1<N#4Huдj"(2+2_\׷\3T_ JTPi;9qBJlʫ.HQ(vW\UYК_Ly?T T  , fx1Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20241117161804Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed ѳ¤%=` ǤͤѤ ֤w_ DL]  Sh(.:cZ,|.,,L,+,-¥P-_-q/,k/l .ɥC#B3K#J3R2Q3X3W#x @_G@#"%-<D5 @b+ C$CC$Cg"u{ m@@  g_@ƦΦ ֦֥եޥݥLSZai p@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.#+3@ @9@A@H@P@Y@^@c@j@y @o@u@~@@ǾѾپ@@ %,28>FKRYciov~IN!4VcVۼosx^ 6 _^QLοտۿv6 ^#+/5@O[k N")09@INSZcksy}½ͽֽosx^ 6 _^QLοտۿv6 ^#+/5@O[kosx^ 6 _^QLοտۿv6 ^#+/5@O[kchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] UUsage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'9'Nu    5 Wg~$8Mc{ !_#_$&_1_23_4_56_899:;2<P=h@wABCDE0FEGEHEJ[LxMNOPQRSTUVW4\>aYccdefghipq_s_t_uv_w x:Ku4Tl6Sc 0CRep____z 0Kmmm&D_{U__w`_)_Jm/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]VV`J4[ZU`Lοտۿv6 ^#+/5@O[kreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockd d d d         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-GNOOO&OTO]OOO(OLSS"S5SJS\SpS~SaYccdefghipq_s_t_uv_w x:Ku4Tl6Sc 0CRep____z 0Kmmm&D_{U__w`_)_JmSFH0eC^pSFU0eC ^Hah!IdontNeedEFI^^(s*K>;d%^|nQn- q+0^<^|nQn- q+K^U^|nQn- q+b^k^|nQn- q+|^^|nQn- q+^k=rGy=iG}^^;Mt?^^mWC 3KOO^^yD<#*=(^^3Dh&^^\ M}- __-чH ,_-чHA_ZIчH`[_IчH[n_IчH^y_2IчH_S'@ )Ѹ__*1@ )Ѹ_O1x )Ѹ__backupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsxxxsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcapsziN%CHyiYYYN%xwQ%9YYN%=R%ŮhR%pwQ%CR%5y8R%N%#P%N%ÁQ%ʁQ%N%ɁN%  ".:@FR^f o0x@%  @init_current_mediasetmediamodesetmediaoptsetmediasetmediainstyGyaЧЧ yЧ`@Чamedia_statusmedia_constructor]fmHS%rfmHS%ffR%pfp]S%ofZ,S%VfVxS%paddr_matchD,,settunnel@N%S%print_link_addressessetvlansetvlanifXT%ˆ,* N%HU%U%Č+ƋƋ8*!!*t%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %sf=Gх}lVHhMVR  @̖ɖusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o Ҵ8p0c۶$Elٷ @gѸ%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @.B?CNFZIsL}NO8SabcefhOi[kgmunorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp c` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()x[t[p[l[h[d[`[\[X[usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY   (@iGyAUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print!"h""h("."h=~C"h("P"h^"p"h}"""" "h""h"" "#'#h7#?#h7#S#h7#c#h7#u#h##P#h##h##h##h$ $h%$0$hC$J$hc$y$h$$h$$h$$h$$h%%xx<%hN%S%ha%h%y%%h%h%h%hbitmask_scan"!!!!%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlyIIIsendrequestrecvrequestYOOOOOP***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230505NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:inN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gz%%t%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataYݜJBLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-iHGEQKQ,GGR8,GYPJ,GYA,GGE,IHF,HHG,=HHHt:,cHrHQ9,HcBH,HY3H,HY2I,HYK,HHT6,HD,HHD,HYD,H`|K,HHS7,HH(6, IqTK,IqP:,)IGt<,2IHs=,@IHIr>,cInIs;,IcBq?,IY?,IY@,IGL,IHM,IYN,IIB,IcBO,IYO,IYP,collectKSKScBtBSLοտۿv6 ^#+/5@O[kNAME=ZU[J4VVmount_disks>      !"      !"#$%&'() str_arg_substget_available_cdsLοտۿv6 ^#+/5@O[k edit_fs_type_ext H   L t  ( 1L _ o edit_and_check_label Lοտۿv6 ^#+/5@O[kdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdt1 > (? ,B < 8B 9 5 @ 6 89 @5 <5

;d%^|nQn- q+0^<^|nQn- q+K^U^|nQn- q+b^k^|nQn- q+|^^|nQn- q+^k=rGy=iG}^^;Mt?^^mWC 3KOO^^yD<#*=(^^3Dh&^^\ M}- __-чH ,_-чHA_ZIчH`[_IчH[n_IчH^y_2IчH_S'@ )Ѹ__*1@ )Ѹ_O1x )Ѹ__ dwwww^wAwwww wwmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new[ f_Z$afULa@M0MTVpUUU$hPR: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************YOOOOOPusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2a5s5dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionb2bc%defghijHkl=mnoȥpq@rӥsڥubt_u%vwbxz_yAB CDEF"G,H IxwJ6K=LMFNLOUPbQS?TjUtV~WXZ146LN|HH~Ħ}Ϧ֦ͦ  %+1HV@IkQYcpznMΧ^קdefault_configread_configrt_compare_protod%d%""rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt##rt_buildrt_delete""sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initv*1;DwhOscript_buftoenv?T"make_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os#JNSW^if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCget_leaseread_leasedhcp_openbpflog_dhcpηٷGdhcp_bindP  !dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B- 4-T-t- ---V-.04.T.t.BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~X% (  V 0@ x D VT0 d/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist