08i <  i ,Ct ti @@<@T 08i <  i ,Ct ti @@<@T Ui t`Ai i i $ hi i i Ai i i A.i i i hpxAi i i Ai i i Ai i i Ai i i Ai i i Ai i i mD"pi i i  (08@HPX`hpx$bi i i 8@HPX`hpxN$i i i K$=i i i M$:i i i  (08@HPX`FAi i i Ci i i Ai i i Ai i i !i i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i  ai i i  ai i i  ai i i  ai i i  ai i i ai i i ai i i ai i i  ai i i  ai i i  ai i i  ai i i  ai i i ai i i  ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i !i i i 4!i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i B!i i i B!i i i !i i i "!i i i "!i i i "ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i  ai i i  ai i i  ai i i  ai i i  ai i i ai i i ai i i ai i i  ai i i  ai i i  ai i i  ai i i  ai i i ai i i  ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i  !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i  !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i  !i i i !i i i  !i i i !i i i !i i i !i i i \?!i i i \>!i i i \=!i i i \<!i i i \;!i i i \:!i i i \9!i i i \8!i i i \?!i i i \>!i i i \=!i i i \<!i i i \;!i i i \:!i i i \9!i i i \8!i i i \:!i i i \7!i i i \6!i i i \5!i i i \4!i i i \3!i i i \2!i i i \1!i i i \0!i i i \7!i i i \6!i i i \5!i i i \4!i i i \3!i i i \2!i i i \1!i i i \0!i i i \2!i i i \/!i i i \.!i i i \-!i i i \,!i i i \+!i i i \*!i i i \)!i i i \(!i i i \/!i i i \.!i i i \-!i i i \,!i i i \+!i i i \*!i i i \)!i i i \(!i i i \*!i i i \'!i i i \&!i i i \%!i i i \$!i i i \#!i i i \"!i i i \!!i i i \ !i i i \'!i i i \&!i i i \%!i i i \$!i i i \#!i i i \"!i i i \!!i i i \ !i i i \"!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \ !i i i \ !i i i \ !i i i \ !i i i \ !i i i \!i i i \!i i i \!i i i \ !i i i \ !i i i \ !i i i \ !i i i \ !i i i \!i i i \ !i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i \!i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i  !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i  !i i i !i i i  !i i i !i i i !i i i !$i i i 4!i i i !i i i !i i i  !i i i  !i i i  !i i i  !i i i  !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i !i i i ai i i ai i i !i i i !i i i !i i i ai i i  ai i i ai i i  ai i i ai i i ai i i ai i i \?ai i i \>ai i i \=ai i i \<ai i i \;ai i i \:ai i i \9ai i i \8ai i i \?ai i i \>ai i i \=ai i i \<ai i i \;ai i i \:ai i i \9ai i i \8ai i i \:ai i i \7ai i i \6ai i i \5ai i i \4ai i i \3ai i i \2ai i i \1ai i i \0ai i i \7ai i i \6ai i i \5ai i i \4ai i i \3ai i i \2ai i i \1ai i i \0ai i i \2ai i i \/ai i i \.ai i i \-ai i i \,ai i i \+ai i i \*ai i i \)ai i i \(ai i i \/ai i i \.ai i i \-ai i i \,ai i i \+ai i i \*ai i i \)ai i i \(ai i i \*ai i i \'ai i i \&ai i i \%ai i i \$ai i i \#ai i i \"ai i i \!ai i i \ ai i i \'ai i i \&ai i i \%ai i i \$ai i i \#ai i i \"ai i i \!ai i i \ ai i i \"ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ ai i i \ ai i i \ ai i i \ ai i i \ ai i i \ai i i \ai i i \ai i i \ ai i i \ ai i i \ ai i i \ ai i i \ ai i i \ai i i \ ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \ai i i \! i i i i!i i i !i i i !i i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i  ai i i  ai i i  ai i i  ai i i  ai i i ai i i ai i i ai i i  ai i i  ai i i  ai i i  ai i i  ai i i ai i i  ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i !i i i !i i i ai i i ai i i !i i i !i i i !i i i B!i i i B!i i i !i i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i ai i i !i i i !i i i ai i i  ai i i ai i i  ai i i ai i i ai i i i i i bpf!i i i $i i i $i i i f$>i i i $i i i $si i i $i i i Ai i i m i i i $i i i  $i i i Ai i i Ai i i Ai i i Ai i i Ai i i Ai i i Ai i i Ai i i Ai i i Ai i i ~,v跽B Y=GSZ@Ch˕I_ira(Y:m8~Oo2bQ$O+"lSu;+#]ťk{ZoΝvpC1Z>vYDu gT]'F7ay#CpQoS0t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4"4 (!1f!1f!A %q %q LL!A %q %q NetBSDAPaX NetBSDearmv6hfeb4p@-D0D 0@`Qp(@P`F`F&a03/T@p$$pA-`0`` 0PpU(pGpG@Pq`P03/T@0US $8\@-lPQMK \!\1 P`0 0R0819  0S  /S 0Sk10S8 0p ZpG2 pG0@3'q1*03/T@Y p0pWH2H0@3(1*03/X@ 幦d 0 P0 0$d$nD$nH%=@@-t ttqPl@dphP Lao`POU P X@ &9 n )P@-@oO-`00R@,2t(Mt@0[m pPp@tt@( q R  @Pwp0: S  `0SЍ @P0`0vw9 0wpS0SMP0 S0 [ P   0S;00 0   P 0s s0T TH,T   }P R&8&A<[]/+<H_&APH0`  BR` pRp RBX Xp/&8&90@- u0 &9 000/&ElpC-؀-`P p0M @!0{@ (0@{{z`P$0  jЍp@Y&El%&9@- M @00@   P  ЍA- l1X0Zp 03 s@P t0S@ ((t@0X;0% cP- f U @0`V/PtX`! Rpt0-S N@|-@Ph+P ULP@ U(?p0SX %&EO-6M@T   @P Ѝ  p`  @5Xp0S 5%0 0 |5X 0S_d50S&<0pP(@0SN50S0p rpPJ400<T$尠E00CS0 /Pᐔ Pp  PYU d0 P00CS0 /0 X80: S  +} +'pP p  Qt X0 0( 0X3,$05x000 00 Q00SD 0 0 `7Zp8  t 0Y 1(#00 H  0P F@7P㴂~ t<0S@zK"I R0  [0YY]820#0 p00 R0S 100S 0 7( Pʨ0S;a@T c@P@0 ?oR20S 0  H1 0R0P( @P @0S "P 0S (P XfTy P0Rt00!P &E%/+&Ep&Ex&E|&Et&E]&E&9&8&E&El&U&E&E0@-MM@P  p  ;0U$C dfP TTrۍЍ08 3P ,(0P X!%.9&EQ@-@ TCP DDO,$P $ 0P@%.E&EQ@-@ X$P HH00"P $ 0P@%.P&E@-^r0 Z&90$/'Vp0$/'U@-)@-)@-( @-(#jm@-0! 0 J 0 Ѝ8'Vh@-0! 0 ; 0 ЍH'U@-0! 0 , 0 ЍT'Vp@-0! 0  0 Ѝ`'V@-0  0  0 Ѝl'V@-0  0 00 Ѝ'U'Vp<00/@-0  0 0 Ѝ'V'U<00/@-0  0 0 Ѝ'V'Vp0 @- 00 $0Q@CЍ%< C-`A!圁!ᘑMpW0 |! R0B=00 B  T0L 8 R<B 8!4100!0ЍOPP !(=aP 0p00S  0 P0P      0 3/R ! 7000@080L'D0'U'V'Vp p=#;U'V s0p@-@PP0 00R00 p800 p0  B0Sqs 'V'Vp'U0 0 0 /'Vp'U@- ' q/+@-@- ' q/+@-@-80M@0(@3/P $ 'H08 : S( 0h 3/P   00 0Ѝ00 0 1/pqp0S 00/+@8m@-@UPЍ@ PЍp@-(`Vp80@  03/PPF'8003/(Pp@-@P`P 80 (0(3/@p P pPЍp'UO-2 PM`P(`,PB  0S9P06 I0S +%0 % 0 R,P0(`R0 *0 AV 000+ |tpx i0x ЍOQ0 P % pHp 81/pq4 & |?P p 4 T&p0S4 < p0 )0 )"hi)0 )'0 '0 %)0 VU)(0, SR '0 ''0 ''0 [X'y 00 0S04H0004 4pX TЍ'U Oj'U/+2R/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-hBM 0  P 0  4 $0 0!( Ÿ}/LB/DPN#b`0@ R%H }//@#b`_`SP0!!!! d 4 !P`4h4 O" C\\ T!d4o4h4 <" C  !d4\4h4 )# C  d4I4h4 ? gh8<@p 0 Thd  dp@4+4h4 Ѝ'Vh|bM'V Q/V@-@SG-A  `004P#"6P8P ( 1/pq $ W%㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@/%0  Z  $$ 'Vp/+'V%i@-XAM P!#"18 P (5/pq$  %P< 0080 0( 3/PЍ80 $0(3/P`P4 00V0:0p080 p0l( 3/pPp 4 00V0* 0`/PRP `'U/+m0P@-@ P M4 Ѝ'VQ0O-騇IM0@SpM. 8S+ #=|'|0<0S( 000 P" ! <!x000# #|0 & %{IލЍ&/Y 0 W0 pS 0E0VS06  S  S $0S0 600000Sl60 0\60 00 H6RD;g 0Rr0C0C00Q0 0S. ,B< '$5\%0P` U,  ( , (0S$0$ ,0`040(0000 0S~ $ R# `5`%`` k(0SP%0 H%00   0 (5(,0S 5%0 0[ʑ4$pWH ? W08 3* g08 f 08 Pf g8 0$fp#0T 0040 0@"D@ 0@p ( gU,0吉((0吓) xg$0吳v'P00S0 ,0S#$P0U $   40S \yS S *Og 0$1f 0fBg$03&"  0V$p[XR3  0 0, ( y0$   r#0T 0040@ 0D"48-1,0S 4h d`P, 0R1@a@qU`0``00Pk! 00CS000    0,`0CS0000 (00-/U R _k8 4D$0 00 $0 'W T&9'Y -'XT0 S 0SP/P/S/@- `'W ep@-XAXT0040S+@! PPP P`04 0PV R@40P 0SU40 ^*00"  `0PEP P0P4  S U 4 P0CSR40PP 0 > p'Y 'W %$'X'Xp@- 00CS00- 000 @ R, R xP Ѝ00!S HP y0 Sڰ 0R0CS0000 0 Q  tP   'X&@TT&9-'8?A-O0 R ,Sp WR ! GrYQYYRV{|||||||||||||||||||||||||||{|||||||j|lm|||||||r0r||||lx|||||||||h|i\ijklmdn\nohophqP|qrs(t0wxlxzD|zPP00 nR pR lR 00 S  PP1S )PPPP0 nR pR lR 00 S1S 1PP0PPPP0 nR pR lR 00 S1S P!S00P0PP!R "R  RP 000@8 `PP 0 nR* pR# lR$ 00 S~Ps "PPPು0S!S  G0S 1Sk aP0PPvPcN 010<+08+0[ R000@ ?PO 0!SP ;P00 nR pR lR 00 S+0S BG a[x1PPQUt P#G@ouG`GooPbVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 St)0S hh P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sz1SqP ~P0PP  PP` 0 nR pR lR 00 SV_P0PPBP T0nQ pQ lQ 00 S 7PPB@ 0  !P4p PP/0S `Vn0VkV PPPVPUXp 0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S040S402P0PP0S 0l0Cs0S 030 S1S 2SqW P000@ 0S0 0m`PP| 0 nR- pR& lR' 00 S`1SW!0R!S oE0S1S dc hPUU 0S0Q 1OP0PPP`s0 gRG  R7 0 B RY ``@p?Y0"S; b(pR1 rR1 U0 R 0 S\ 0U0b0 * `P'00CS0 0 P00 S2S 02P00PP2P02 P P 0b200CS00U.4VP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"!2R000#2 0# 0&@T'XJat%8%4'[T&9 e-O'[p'ZX!'Y%( 20 2 2020P0PPKP^p PPY0S) `V0V PpPӔʈ0 nR pR lR 00 S11S(67P0PP0SPӆʈ0 nR pR lR 00 S|P0PP QR000P0P00@j `P 00 00 P0 nR+ pR$ lR% 00 S!0R!S dC0S1So bWW P0S0P0PP1S 2SqXP0S 0l0Cs0S 030 S8 P0010CS 0nQ( pQ! lQ" 00 S3 00SF:X` `S@p.X0"SY`x 0  PP00 nR pR lR 00 SQ0pS ZPP0SPPN0 nR pR lR 00 S2P ft2S7P0PPP&  \-@- 00 ЍЍ/''[-0^S0]S0]S S]S[S .0Ls0S^30   Q  ]Q RoG-鐁`P@0 SS&tPD(!,RF`a`qU`0``00P,yW ( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a =V L0 0@S G 0m'Y'['Y T&9-'Xt'Xp@- !0 P< P@01SE0p0S S u`Pp@0P 00SvP0P00 P l0X 00U0QP0Vz0 ,8('Y'['[|'['T&9-O-|b|B0 %Q + PXrX00 SM Y< U 000<P "$VC 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00P 0A0CS000 0P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pk'Y'\'Y 'XT&9-'Z$'Z(&80A-P0 0p@ W 0 `BP! 0 R00R000 1BQV@ @P{@pU0"S,$@gR000'Y'\O-@SMpcȳ00 0GS TcsT`0``00RPUZ` \X00C0+0&SK   BR  D R: XJ@p R&PU- 00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?"p L\ DR-WppB@ \ p P @UD @<h00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq 0 b'\'Y 'XT&9-O-M!@0P 0k 40S 0 0 00 0(0pPP `Cij0 S pSP,0Y01 Y  $ 7P$T>X TP  B R+830 #   BR 200S 0 4 |S0 0(PP0 ߍ40Y0 Y H $ P$  BR 200S 0  DS P4 00Q' 0 p1pG Y<xxZ  P@1 !T0 ,r(I00C0StX 000 "2 0 0(0P< 00CS000\^W#00 |wP00S 0  R< 0 X db'X'\'Y T&9-'X|O-pᬡA0M0CQ` 01 00C S00`NlЍ|  0P5 =P!` 00000`P00CS000  [  O0S00CS0x00` P  P'X'X'Y 'X'\'XO-RB0M00bsp 0srЍؑ0ЁS 1    000P@ 0.#⩟ɐ Y Fp10S 0p0000000CS0C01; 1 \" \ 0 0#0L\ 0C000@00000000 0C LN 6'X%4'X'\'Y 'Z,'Z$'XA- `P 0 0Cs 0x 0 p0 l   AC^  00@pT @ 0'\'X%4'XG-@p0 PR` 0 PW(S%R0  d P 0 ,('\T&9-@-04@pl0l 0 0  L00S   /+h&9 2u']x']|']T$0\ 0S ~'] 2/+0L0S/0 0 0/@-00 SM 0 0$0+4qppXhVЍ\0\@ X0R@P00C/E 0Ѝ@A']'] ']4Q0']<z']8P `00CS`0p S00 P0S X0X /Xu&8: S@-  S  S/ I* S  S%|@=A-t1`@pTXPM !T@L10S @10S- ,10'p @0 0 0( 0@0S00S 0: S@Ѝ0l 0R00C/zD0 T00S ']'] ']4Q0#R']x']|']t']']<']8']Ts@- P@@P `RU00S @IT EЍpx p Q \0 \@1T ,P@(U']']p@-P@Tp!0C0  $F @G-@0MD$3 30S`V0Ѝ!0C0{ 0XPS !$&0S 20Sm 0$ 2+04&p| t ≺0 ( pH20S 04 $ 20S   0 : SK ,0s# 8#4410S10S91!0 0H 10S|10S : S0: S z`y81p 01Rp(10C/jC0 'Q p| , pP^ ,00S ']']P']'] ']4Q0#R']h']0']p']l']x']|']t']']<']8']T1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ0P 0 `0SpQPQPU% Ѝ  B 10`    0S[  L0  $R,   V ']'] ']4']t']%<%L']010G-S$0@010S 10S,0000 0 0PF0`VGbpP倠UG s!0C0 W kp0S$,  `YpP [`']'] ']4']t']%<0G-@0T$@0@SP 00S,000@p0`0堀S㠐@VG 4!0C0 W ,,p0 00 S #p0S$,  Np` ']'] ']4']t%<@- M @ ᒷp ЍT  P  T09P 00 0S@SQ 0  80&900p@-0PS`` B@P BP PAs@P4 l/Pἶp']|7/+C-CM@A `F FPȐ`T *F 0 pPPCߍw ? P@Fw0S ?@׶P?lP@&=@-G ^X&9 000/']@-G0 LF(&9@- M0P!00A00P!0 0r $*ph Ѝ "$ 0P @000 h0h *pX   DH團"$  (0啘']uzo 1r/+O--Xe@PQM Pn G0Sr  pP 0S P   t00CS01p0pЍ0S P PPpPX l) 84 Rl,pN0 ! 0 X 00CS0p YX 0 P 0S  |PP X0: S P@ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (0P P $X0: S)PX #pPဵ1b0S 㟛 ጲ   P> ߲Pe  R ,VCP O0 ¯S ,!0 0 @!@ ({{ z0 ]p(00@0  P @p lP uF0S  X0;X0XP P ^F0-S  PUpPt0S  HOp @Y']&9&8Q0 1/+#1ERs@-@ `PAP*0P U)[YЍpU \@MK0 P4 @%PA-A~M0pSM P0` 0`PEp! p~,P E@!1P~܍Ѝ0 0`ePE ~,PPʪE ~,P `0 0GPEx W kQ \00 00/P}E0$ >1%Pm:c00CS0 ^0 /O- U`DMp 000D$000 0000S@ȔV"4`0p Q 30Sa4PZ|PZ+E0`$0q000 0K4$SPE0$0V 0030p Q  #6P0 0D0#0V0030d#PD0X#0L3000DЍp(0: S 90 S" qP 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0:pqD0S 0㐐唠0 0p) W W)2`V% 0 /=010 0R  S0R 0!CQ:++R:0'WW~Ta0@  0 =T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`%P']'`%%\( ']%d%m'@8m't'x%|}D00S/@-4@~M0S~, %P~܍']%P0@-p@$0l00S Ѝ00 0*: P0C, /jP%P']XL0@- R81/P 0 0 %/']x( 'xA-p`P@ 0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p@P00T@ _C(0(  /( .%P']'x @-,BPU` V0bP$00 p?W0 pGWhPh3C0 SV.00P ЍP#ڀ;;S 00 0j9 P0Q/PppD1$p0pQ Q(% 00$0SP ( f.B0S00B0ES00B0S B0ES $0SJ.B0S B0S B0SPU B(0( .%P']*( D Tp1 RW@-`QM R P!  BR@.Ѝ R RR.  6 R R  -R R @pT pR0 L8Po 0;p0T 80 L 0P000S$ʳ/']%P%smCG-0 Q@ ,pPP"ڴAQ"8P`0 Q Q 0z8P(BD -ЍQ 0S%P']@-xaPMP d1@0S2 SQPD;00Q0pp 0D8 PA -Ѝ0Q R(0S 0+8PA 0Pڌ T0 /3;0 d4-0 L 0kPA 0, z-%P']3X'xcmyO-rM R4M0`RX0E@FPA F園 0S 0  F0S(0S h  X"T2p0 0:04">00"#Tp" #>܍4ЍT 䁟0S =! !!0`##:# a10 00Sx1pp10 0:00!x>08!000$q0 10`(0尐C  c  ] ,0 ( $0{:$0 t K 00 0 `#@#:#  T%&9']( D'( 'd'`I'%P C-LRLb0HBS0000 Ѝ((0 0 0S  2 r0S T1 2 0S cpP (0: S)05 p10S10S PP "0 0 0S q48n 1 200 0S000p000 S(00(000 P@0S 000S x0s;P 0 0t;9P 0XJ2%P'`']( ( ( ( ( :']%( ,j( Dq''vA-MM, OP/@#+H CP#@"+RB$0`SF 0`CĂ0S2T+p;P} ;Px 0 u S( .p@+l>+h2Lr0`0CSXX5+2+H0+D.+@,+<:+P,:P000 0+ 2 `ލЍ+0S  R  sS SS YSUP*yS*$qx*l*<*P,:P 0S8 4:P( )91P *0S(*PP ߭:P0000**( %P']( |( %d%\%|  Oj?( 6WMl < ]|00@-@FpQp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S {*@DT  Ax%0d#0UPTPd*PV0S pW*@X`ꓢ" @2/PL0 !ᓢ#, 0+%%'^%'^( DO-Q0@`p@F T[ PppWPH* ЍPT10S   *p@ 0 $03/P$ 0 R T @ A$  80 3/PxP\\00Sd \) Q < 02/P " "( D'^%'J'd'^p@-AMP/MYA@P+ p`p P/0P0 Uh0h )AލЍT0_"39/0P0 0@0 `)'d'^00CS0 0 /0O-S$M00`Y P$Ѝ P0,03/P00哬L30S,0@Pz=0 C+z᧹ Jލ Ѝ  ∹ Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40 ,Pz pP#ⅺP0 0 `0 + H`\ QX00O0S0(4 008 00( ( ( ( %%( q$/O-pPM W 0EQ 0S08 0<000S@@0C080pG0S 0`S : 08 0 x! x3  P< ~0@0  0R X2P0P/&P*k0@0 ,0嘰 R P` dЍTT [  ` `PZ<( ( L( ( Rs@-Ѝp@0 @`Pz&P(008  1P00 r( Z0@-@MPPY00800S =J"Ѝ0( G-`QM MJP㠔@ Y #p P 0p 0PP=! RS J(Bݍ ЍwPJ/8 = $LH0RP J(L0 00%PJ/8 PTG- QP 000aq@T+00CS0pT0 0S0T@ 0 S@ 0 P 0S@ 0S0 0 S P ( ( %&8 0 0 S00@-@R00000S0@000S `GP LP40P( ( ( ( ( p@-PP 0S|p `@P` (@P0/S000000f PR @@@p#( h0 RX R  H R/< R/ $R/Q/ ( ( ,( (  S8  S%  S04 0L! 0 J $!1A)P6 S  S0  S04=! 0400S -ЁЂ ;Ѓ"040+04 0P-0P 00   0 P( ( w ( qp@-8M@  D 0`P`}U`$ $ @ 0@P8ЍpA-t1hM0@S ThЍA`Z(ٝ="(<+p@1WpP0 0000p084 40CSL$0r"60"$0( ݼ4 CR+x ԼyhЍB>'P˼S+<  ~( TQ0# [5.@-@XM="p:(x0 XЍ=7@-@Ppp!P Q Ѝ0 0 Z Ѝ0@Z0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Ppp@-PP,@0CQ0#S : P$B0WN%R0CBSB 3b 30+PpA0NQC S*p@-@P0*Q@H? $0S\?:! 0S* Q R T 0 Br\  0B~ \! AB~\ " !. Ta Br\ ! p@-@0CQP0#S : P$B02W"N%R0CBPBb 0+@pA0NQC S*80P @-  //( $FA-@8q8`Q PC-PQPUPQ S A莡AAM:UP0 ddR? 0:S@ 0S000 -O( &2&9/&s@- `#0QP@ Q10*P@Ѝp0S mR! bR kR%$+ 0*S xS SwR!$/QP0P@0$+*$& QPP@0PA- 0SF`PpP ㊗0P# X p R 000R p0000S ,P0=0@Pᷙ( s@-@ `P0C30 0  R R00PI@P0@( 0ЍpPE /*00( @-  Xv&90 Rr @-/%@-4@4X(X XXZ&99 O-px F@ l!\Pp`*0, [/00 ` J O-lM/P-POv`P `0@p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <zP񟗳684x14x604x4x4x4x4x6`4x6p6H6P6X4x4x4x4x6x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x554x4x66 4x66$4x4x4x4x4x4x4x4x4x15(4x4x4x4x5D5L54x4x4x4x654x4x15L4x54x54x54x4x4x4x4x4x4x334x334x4$4x404@4H4P4x4X444444455 4x5`N>4=Q $,PMP>@J >0 -R,Q0 00 0;= =, 4<=(?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$BB?$BC?$CTCp?$?$?$CCCCC?$?$?$CCC?$DD$D8?$?$?$?$?$?$>0>8>l>?$>?$?$>>>>?$>? ?(?$@@ @(@<@P@d@l?$BR@P꼃@2QH |- 3@ > 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eBp Q P???????????? !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0|1Pd H( ( ( ( |%&2%&9( &90't']( 4% ( ( %( ,( ( 8j%%%%%%( <%<( H&8u% Ǜn r^E( @( 0%( ( (, )&9 @( $'$;( af( '^( ( ( ( ( %( -O']r( |G 0 .( D%&2( % T#L#張T'0   0G 5가z0Q , G# 01F  1@ O!P00F HP`1'PE 1E  1D s1 1C1TPC1PB $2B  42A  D2A  T2` `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 0 0S3# C*SS8C0U Pg000Sv|30UӈePE3PlPN0000S 3 Y0P  /( l0P/`0p@-0 PL@LPP@0@v P6 ᳴B( ( D*Y&9( A-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ ( _ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@&@TA-Q@pW :( xT}΢7( // Qp@-(0PS$ l` /@P|6t 0000X0 `%V0  y@p\( xdϴO-P`P Ѝ#:0J84YqW V#C/00p0K0CS`3X IPk0<0043  a  d ( |pq  }? 0$00004JH1P tn@0 B(1<=P l`<0 㓍 H K06S 0S 3 CRR~~~~|gSt K CRW0 40r;; (49 xS!04(4:(404(49(408400C /Q000S($4S::  $ R(4 @0&"**40 p0 2S($0 *4($040)($84  R KS 0 0 40r;; 0KS8  0w( $ ( ( ( xO-j4@SM- S pcW:ڬ60WS0dpGp0PS/SpS 0EoᨂSXA T0CSPP J0xğs# W/0p -P 0p %P04 T 0 !.00 S~ .4 0pp0(p Pw J60000 0 P JS20 SK010d 0l43 00 0P J4 S&L p "p Pp e++ 0S  Q0 ^q @ P0 c0C 03 30P J( S0070 0=Pp0u;; A 0  0S  Q0 ^q @  2.0 0~p0<x P J7p0@ P J,1  = 0qpP J<@\YE   ⾄XM  ⷄ} 0 KpP J} 1P LP$PP P P $p px 0q0cRa1P( xТ  D;% _ MC( GQ0M0@-PMM@ ` =XX  0Pw U;@ 00$0$0<00 0ݍЍ0$ r ( xp@-@ PP ip@#TA-0p-S0S' V@P#y 0O0` S0 DP8PP40TЍ@`j&8}-@-0@P   Ѝ@Ѝ/( p@-@ATp@0 R PeP ` `P`p( -P@- 00|0 x0x 0 0 h@0S Xf00L0L <ʣ ,ֶ$ e Ѝ@ Ѝ/( ( ( ( &9( 6p@-x啜@PlhPP XP pᖜ000S  pў( ( 8ѧ -P7@- 000@ 0 0 0 P0S xe00l0l hs XTᩄD 8g0 e Ѝ0@Ѝ/( ( ( ( &90( 6&9ԍ@- QK&9@-M @P@ލ0/S_Pt_P ip Tdp  0RP 0RP Ԅ Oj 000/( @- &9A-q`@ MT ttlAPD00CS0?,@|p( /+@- ztү&9 0, p@-@PT 0Q00S0P0T`00000ige00CS000S p( ( A-pPd@d`0000SP'U`00CS0$00SA( ( ( p@-@PD`0S@'T`p QP( G-0a000P60@ R'QS \! 000CS000S  0 p㌀匠`DYG60W0DY00CS00 *W 0p( ( ( %0@-S R't  ( A-pP`V@ \ @P*Pp@-XP >@P hDP0P 0@00aT8@p!(A-ppP`000 6@60 06000@0CS000SA( ( p@-P`@T  PV 0@p@@-PG-Q=0@T: 0S V@0 Y =P P0 V VX00CS00 eV 0 0 0{@p`(%%C-3sPc 0 p3@0! 0  0004 B @3 3 00`Dn5蒟 `0@ Ѝ/R@R R@ u&@ B&Q  L8< @0=S0  "?R 9R:BP(t0LD|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]&@T( x( ( ( |Y0@- ( xӉ0s@-0P`0Z0`0@S P 0R@P@  P@y0S00S q0ST P000 R  Ѝp( x(%ө =1 xӺ@-L ^$0`|xlHh` @@~8 \  " Q?0 CàΌ c1Œ? l1 0\PQP̠Q  S  S Q PQ PQ! O-`py딠P @%R=W &R X%1! -[00 @P@ P@ Ѝ( x@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F/P@$ P@⿜ W( xep@-@P0)Sp( xO-@p`@4MTY T\ T( T* #T! @$TX "T 0P#S@    4Ѝ'0DSYJ P@V'0I SP@ 0 0PS@'Y`000`!`0N oW! mz! g0  P@@! Z0  @PQVG'T`@@@P, P@ ( x?$eO-p`M8P谟蠟-!@ )0 N@ 0DS U# 0 U 00S^^ :U 00SY` p PU @ 0DS Ѝ( x rC-Pp 0BS00`S@! @ 00 TP`@@ Ѝ( xG-`dP0@S! p0 00P@@( x@-@MP2`PL~0P  IR NRpp oPpEp@@0PS@ $s2Ѝ( xQPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P22Sp0@1PH0@P4 0S@2Q0%%((/"@P/-0 /RRR00( @-@PMލ0/S \0p +p  0RP 0RP Ojp@-`\1@P 1D0p@11y 0"SP Vpr }( mp@-T` RpH0@Q 8 PP Y1pp@( %ԄO-p/WR 0S)P zB000000000CS020S 3@T  U tU`rW$1{828b0400@/Sp?DpPI0S0/p0CS0oppW002000pA0P00 Qz000 hHU \DU00CS0810S 00CS0 0W00 pR0S/S0@D001@ P  R*0000t/S0S P 0/0CS0 pG0S 00CS0001@1@1@( ( ( ԁԄ%(% OjA-`p0@00啔P 00CS000S q0P0CS0d00S b%@ HW 406 R0S 0Q( ( Ԉ%( TG-2BM 8)r0@T%U@P' 0.S00.S000/SSJX20Pp  `PF { ePZ( `V+VPP "` /` E 0Ezz@0-S0SH1@T@<pUP0VPw 0S W/pP0: S W J/pPXP PW 0S| -/pPsЍ%Բ(gԵ tH( @-$0Q @ S @( Ԅ p@-L@Q;70P000S LTPP 0S}s@@O 101[P00CS00 O 0 O0p1 zT, (8( L%mG-pPp@R` V101 (Pp !Pp `b\TQ @0T! \0DsQS񟗀4444@H44444444 44444$@0 0BP!0 BS@@00CS00 yO 0@0 @T0S 00CS00 bO 0 0SY00CS00 MO 0 /O 1 0d1@ @ @ @ @ @\@@%[xA-@ ` PR 0R 0S SNp0S0 R {O0S  tOU  ^OTiOy xcO  Td@00CS00 N 0 AN%( ( 6% (/+% 0@-P69 06( @-@(0Q P( @-x0@T   @@@@ @@00S 4060S pЍ( (%-$0@- R    ( -@-   0p@-( -@-0@0 H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4N,P / rՄ( 0/( p@-@pPPPP ጐp` 吐`P 【p` 儐`ps@-P40@T t0t`6 N 2h0@T POT0 0@ P@DЍp(Q0% B( (s@-`P0@S'<0`%kG{{'jfk[P[x ,06S 00S T@Ѝpu @0t0S0T.S @N( Թ 0    /( @-@TЍ0Ѝ0CSPPPPPpp  o000 P e0 5@ 00 0@-@M PU PP 0jwp s,P   PPP 0[wp 8 0  Ѝ0 u0 0( %f%@-@P 0S0S 5P 00 0A Ѝ(G-`0S q0P00#@儡T0SXM'@d1$@00CS0D10S )Ѝ00S P U_w4  R s*P00CS00S UC0S>CUP3@ ,0S[#( ( ( C-c@PP^0M& S',똓sQ8`¸Œ,00TxLLÜLLLLLLLLLLS#$0@30S K0S 2$P@@T K^0S 0S@+T ^0S$0 0 @^0S 0S$0S 20S 'H+ @@$@++10S H0S Ho^0S 0S$0S @TM$@P10S G,10S G 10S G00S G  0$ 6 $0?o2$0-0$ R  h00S G 5@"L<KM+  Ѝ%(( ( %G-PMp@)+0 `㠀堐堠aAPP M+Vx0$`W U ^0S W P 0`S +Ѝ(%p%( P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@|*PD0(00$p+ 0$ 0$/%%(( A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S( %G-P䑟 M^`AV $`d*pWT0尡p0p00WZ 0S- |1|aj4 Kl K K00CS00 J 0= K00CS00 J 0 qJ  0N^ $`R 0S S00CS0 p w 0S pS00CS0 0$`0C0 ** Ѝ%( ((%A-@ M p) 0 0PN@T/ 0S0$`V@ 000P 0`@0T$0 R ^ R 0 R 0$0 $0) Ѝ`0(( %G-`倂Fo@p0媢S' 0S$ L2LRH23PJ8NJY8(IJVEJ00CS00 I 0 IQV000  |'P7 V a< 0$000CS0l10SG  D EP` P00CS010S B00CS0 VVp00S #0$0CS0|00S 0S0S0000'3I8IG 0PI%(%($8G( ( ( Kp@-42M000000 20S 00S 1 `12II0Q@TI1I✛PP& |1  1@?0S @T H1匛 ,D@qI8oI$1H0S  1$ ލpA 0 000 0IBP00CS0 0@ a0 00x0 ?00CS0 0S ;Il9IL0HX00S @00S ( %(($%\( c( ( m( 0 @-`o 0 00^0$MSP4P @F(000P pN&P 00S $?0 p000CS0(00S J($Ѝ%( u( C-@?mM000@H0?_00?0 0P@,@'0@ ? `0d00@T 0PPdo0 `0R@T pd0hP 0$o 0lP@T 000P0l $00`0S$v'`0 S 0D0>60S >0S$0S 00D0$ 01C 0d>0S$0S ph@DnT@ xP H047S 7S) >0S*00S5 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sd= 8  ,=, *p@ P 0 ,= M8 = <, R , A,( Y%P000<<0S @A @X$ 0 $ ` 0bh<<<91Gh@T: =p<P`P H00CS00 eG 0PppH@T4`@T @ [00CS00 JG 0 H@`@T0Hk PU#00CS00 .G 0 :G00CS00 G 0  %BP @P07:0P PPP@HPP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0Cs0S0TT)SS B70s0SBP0 Q AqQ8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040 8<000LטP7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' EL0S L8 6 6 @ R] 4 0  X $EW&@00CS0 ps`60S JiP x60S%,0S5T6$5D h0 L5,,0( E0000+,0( >#0hE$0(0S,+ $ \5 d50S $5,0S pMt<%050S 0 @0 AP0ET>0 000$0 0C0 000|D000t4 8\XQ00CS0D40S P) `40So*T0SXQLK8 3 3 3 \ 4 03ǗCU*00<p3 0 0S '|0R#C#0 0 3 Bxh L00S0\P0"0C0000QK8 2C  |2  t2 \ 2 *00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S ,0,!SS{1 08 L0H@*Kq10@0@0S P1 @0S1 41$ @0S  1@0sH1 R#0S01   B  @0S @0S7S@<; 0 00S R;X@,0S0  =,0Sh@P3 \F 0,0 0H 0((( ((% s(( u(( ( (%ń8%((-O&2%%%׆( ( !(( ט@ B \:^G@T(0Sp0 t0Ԇ,0 0s,p)DlHF0/( 0 /( 0 /( 0/( 0  /( P@-@'P@<0 QP cR   ׷( 0 S0/( 0@-0M0/0@0~P ⼇P S0: Sl  S` PЍ0⧇P0 : SV# PP( SҜp@-Px@x`M$P*00S O#0`00``00"`s#$Ѝp( (@-h@P$0Y'0 RP  B R    ( //C-LM*8@8 p@<(P@0` D, ` 0CLЍQ0%A-@P`ۅpWU ucN7" 00J(~p(( O-pWC R``%` P0S:S2E@А @0S,W@  @Z0T/S/00 m0 00S00P R:R0:SPPP@DOB"S"%%( @-@MP/p lP㨐K  0 @ T9堆p0 @~0!0P 08pWZ0S 0 `T0S 0S 0 Sup @(" f`P T T T0@@T >0DS( A- @PM`Rk4l1000  8p!XZU hBB Q PBLBQ8B 00AS 00CS00 FB 0* 00CS00 6B 0 ЍQ PBB000yM g00CS0 TqBoBHD00S Y,y(/+%( &06( :p@-P@@Pp 0S%SpHP @ }p@-P8@Pp 0R7Pp@ }- @0@ R0S P P\ 0%(( G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00IjPPp( ( %(( A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@%Ppp0V:SP0@w@('%(YA-`P倀000|Vp00CS0T00SA0Sp00Mi@T`( ( ( 0A-pPS R+E`a@T"W p000I 0 @0 0 k00CS0H00S F`MP `@( ( ( p@-P$@Pp0P0@ }@-L@000@00 i00CS000S@( ( ( O-PM/`@ 0LP @@@ (ↄP000 0S 0S 000Ѝ#   P@ |FP @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ #P %pP A0000S R  pJt#PO R K R G(΃P0 * R; R 60@@D: P R  ID T@0000S R    BR =D R9 7 a(X%(( %Y( a%f( O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hBi?01 P?PЍbPEUh|hhhhhhhhhhh00p`@[ Q ,$V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0S4YT 0s P kF@T{(( %؅( (%(p@-`P0000S S@@K000 00 00000CS0p00Spp@ ( ( 0@-x@M0 0000\0P>00J 00CS0$00S Ѝ0@Ѝ0( %( @-gP 0SJO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩|P`p00S"" 0RPW>= >0 @ TW 8Lq> P 4j>>0 R @ T ЍY>x>A00CS00 = 0 00  x100/iPXP!  SZZW Y;>8>T}PW.>W~`FhWxWtWq ~W 0` @ p`=`'(T tQ0 ر"7EU%(ؿ[" @bxٍ٪O- MLBLRp 0@0`V' VV:V  VF /V   BR 7` F R! R  |a[  0000SHA@P  ~p[/R 0/S k0\P Ѝk\ @TW 0 BR r R  BR    BR  7 2 %( (%g zA-(A0S 0PS0 0aqP0S00 P000he00CS00S P 0SRh`hp0P RP000De000CS00S ( ( ( ( s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `f@0S00S=STL00 <0 R0AD1U0 S 0S%|((A-dp`0PS@  R Rb00PH @( O-rPԂ0M00B00 00$`0040CS ?4`PP00CS0E0S00CS020S - HW~P+"0S 000Pe~P zd P +10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (QP PAP 0 SR BR r R  B ~  ` B `FAQV  RP P( %( (( ( z1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xqQBP  `V' Q`:00pQ@  @% Y0S" SP P@P P DoQP @@` ( ( ( %XA-XPX@X`P0p00c0p0CS00S ( ( ( p@-P@d 0@ p( @-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x0s0S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x r SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x~^\| ]\Q000``S XSQ0 0 @ 0000xqQuS^ P[Sc:Q! P-Qe]Qb  \QQ PP$"`( }P1 0$0 $`( }P%H0?PP0 QPQ P !$ P80QP*0$0 cP c`0]S0 S 0p@Y(\PP  8QP4\SSPP0 SP0S  @p4ٷ xO- P@M0?S*S3 [S;0^S!S00x|\/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xpPS@0/SR"@ R0A$x r RP R  \$$Ѝ|PX9$P| 0U0/Sd 00EpP $0S/00E0S``0` xqQP 0S JV/00D0x r RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0 qb$( Oj J ( 0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P W$$$`0$000CS0H00S V 0S ~0P( ( ( p@-@ PTp 0@ @@( G-p 0s0 S QA0P 耟`V `R`F@ V PPLX@S`` S =QQ RU  0P   P x0G-p@ Mo oF0P 㹛8a000e U00SW-00E@`PIPE@T Ѝ00CS0@(O- R@@0`-SPM S! C RtlD?So @Sy 00C Sh0 0  a`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666+0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   9 ~ 3   0S q QAQ$AQ!   Q R V  BR + `w~  0 BR儡  BR  ~ ~  `K E~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00(( z(( tL tP%(( %|( %O-$M000 Z0 0H'0=,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0p@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A;9 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 ZY@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R%p#t#X$$#####%l%l%l%l$3  AQ AQ~00AQ v~p K R  BR ~0 0  BR T~0 0N @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00`P 000l0 GR00#S00 B00S0p0 G0 B0[m$Ѝ|0s0S[0000p0SQ x( (%%ٺ(( z(O-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V PR AA KA P񟗇*'\*8*8*\'\'|(((tW 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp  w     BR u   u   BR    ( R 0BQRQ B  W `   BR  v v 0ASq Q AQ~@P   Q @~  @    }@P f i  ~Rf=Q0Sa 00 P   @( %( %((G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S"000`0`0CS0!0 0@p  Y 0  i 0  R 000/ 0p %( %(%(( @-0@%O-XAX`0$M`F;$'%(Uy0S/p@-@PP1PL1DP0a 0(00R 0S"00D05#0s  0C?o2^0SP㢡piP VP p0C Ao PQP0S*00CS0p,00Spp@I(ۡOr5( ( p@-@\P0P00 T@00CS0p00Spp@&( ( O-@`LM R0 LЍO=,ؐY) PPY   0SPs  0 S S S PQ 00SЀ0S@LЍ0S}22 F!0R+  p  !R -  x",]p 0 0H"+ Qp0 sT hU0Ep+ 00CS0Y+0p W +㴱p^ Z 00CS0B+0 00CS06+0 | 00CS0*+0  Ѐ YZ +000u + #40  + +P S#4sU 0 0p@ gd _+pZ*0㓉#ЀC(%4Or5 6 H"'@- 0 S  .^\Q0  p@ S0C  C/o "P R pO-PP10 0%SW P X0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  V0P T"@` P*P \0@00SJ R Q !" R @%4<[(KkG-$a$40S Qq0m0@S| @ ~*Р㼐0Sʰ00CS00 ) 0 C+0 R  0 S !T*(Q0(Or5܉yܫ6%A-p@`QP00Sxt10P 0S X$jPp pP@ gP`WP P11@*@V Q@ T0`p0S0 )@00CS0{)0S 0 0 00SJ 0 S 0 0ܷܳ((Or5V%800S /@-P `(8 P  /Q 0SZ//(`060S/P00S/D0Q<0  40 A!0 S00)%(%(Or5G-Q`0SR@00SiZqP000L:<@ 0@C$ Q 0000CS0H10S 30q000 100S01000000V 00CS000S 0S @pWZ00萠@ 0 ZUQꙂ! P00 R @(( ( %A-`!@SPp% M&WVV |1N0S9 U 0S0PylPkV81 QpJS!1@ ! #&0@$$060S& $$$V&&U 0S PP jXjP HHV WT  0 (%%4y( (( ڮ08 N R S  0S  P %O-pR0`BM0 pP B0S0S ЍP880@000$00 ##P%:T 0S0 10S 160SdTf P c100CS010S 0S 0 2"  \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00?TP 000( ( ((%%( G-pPE@P ?P1N0St `O@0 000E000PS V 00CS0l00SG, E  P0(` 0`00( %(( T 000@0A00CS0/00S/( %( p@-$@P0 0C0C0p%(p@-(P(`@0@D00C0p%(( A00C 00 0C0/%(-A-@P(MHp@`DpPVP u RT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@OI0 P 'pއ T4O-` 0P X W   B R 0äX  P' Bp W   BR 0 ä{Yz W BpR 0y ä 0K 0g P  BR 0@0 P 0MR   0 00 ! PS oWPJJC !P( ޤ((ު*OX%%( tHC-PBM1`Pk܂000apa00CS020S S20@T[UU  r0@0w 00 C@@x 00 C@0@0  0Dr000w  B0x  B0 00 Cr0P 0w 00 CPx 00 CP0P00E 06pA01 X`ЍP8$000C S0 0 Br\  P0#RS& 000sPP 00CS0 ZH 눐s@!F00CS0800S q`00S J( ( (%[!AO-f@ PsMc`P#0S 0S&t30@T#UP3Y PsPP 0STDC01 ,`ЍSVP aV HVP@ Y0S UPiPk  Ÿ 00B SR nX :|ꘁ)"ß꺰 0Q y' : `pI+G W`0 W S  @ txD  Atx;Y  6 p0W\ 0 @*0W P 0 @qpT0 p  S_PgG0SPe0KSp wx?0  0\5Pfm s( s *%}ߐ ߭ߚ߼( /"1 BR00/0S0/@0S/ R /0@-00@00C S  0RR R0\ * Ѝ000C S0S//p@-PP @P  x]P  dWP TL FP 000C SPpppp ZO.nQX0 0@- ^ @P U@R000/%p@-`@`P6N0Spv@Tp^^^f^@^ 0P p@%(x݁G-pP@R^Q6 @a0S 0  pW@A00CS00  0 @aq刁 Q 0S  @TPL$aDqD0 R R @TP@00CS00 K 0 Q P @1@UT@Q@`Q PGD`V0 8% (%rn 00\%P0@-o%0S/p@-@PPEPp@CCA-@1S`p@DPU 0@P00` P(O-@P0q儑0`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \HT PT<0@@T0SOz((0=%P0A-B00`0Q 0S 00S0S006X pWP P6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01P0CSQC0SQ0 0SwP   000S 0 0^0 PA! R   R0 0(%O( P0 b@-\@000D00S 00CS000S ( (( 000C S/ @-pCP 0 (G-0p RP 0S5Q 0S @0?` 0CC10@ !,a``@ `Y@j `` -R \ -Q0S 0`@T0:SF 0R@1T0:Y " @`'@ `0 T 0:S  @`@?:\00|@Y00  T@0 CB!0 4$@ ЍOx]d%Q0P@-HmD0P  Q 000CH Ѝ(( $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ H#PP0@:T  ($(G-tR@ 0S PP -R`@@$0P 0S 0S@0-S ;@T 0T T@/@DSq0`000@@CA!0S:0\:0l0@#1 T030V:0 000CS0 10S 3  0 #@0S`p0C 0 XZ0Oa0C R 0 0CS0H00S U@0S @(( ( p@-H@HP080Sp0u`0CS0` 800C805%p( 0R @-@T @0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @%p 0S/xqQS  0s0 S/00 0/0S/0/ x08 0/=P/P/0/ x0 0@-0%pp@-`R`@P:P t0 0Ppd0 Pp0-S0S0 0pV ($00080@p((|%pO-RM0 p0pᔒb"%Q  X @  [c { R00CS0`S``@520`0@Ѝ X @ ,\[8R /y P0  BR (000lp 0 S B R { [000Yp X R  [R. @@  B@<0  0 Q P Pp P  Q  R P000@00 w 0 C%0%(% th%p0-0@ P RDM`I0 Ph h "  @U0L T<0< 1 0 01 0 %p? thT1@-P@M0 D 0P0Sp`@T*vpPT @T=PLP @0 bPЍ@%%(drl000S p@-XP@T T D0T@p8040@p 0 /%p( Q0(x%0(@-0@?( p@-d@dPm\Ppj P 00008  P8 T Yp@U%0%pA-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A ` 0F SDl V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 %p%0( ( |G-pc0@0 T T+P,0S)㰀" UPP @ @@`P  0RPP `FFa@@T 0 %p tp@-`0$P P g 0R$, (@R   RP3Pf    Q V 00000S@p 0 BRp@ Q080@ p%p@-y0 000%p@-@oPp@-+ @fP P @0 000p` P @`@`%p O-С`P0 $ @CPp/0 CR00SY%3PB%V 0 H100SD (100S @ 0YP@0@Y PX @PW W! V! u000 @(pGWoVP0V      000%p thO-PKM 0 5@00 04 P00400D$0Tf`P  0S < 40  |4 Bft$0000 `SH4 ` ,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  0 0C0Ps0000<0 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S d2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PR@0000 H@!00CS0 0000DP3: 2.3@@*pb0PC2P \00;0-,M00CS0`fR {00^%p( %( %0%(( 0O-鸯帿pM0ϟ  Q"/O/0 0202280 `00P/20S0S 2Y H<pTlDThT4 L/Q00S: P.Q00S1 0P0C0p0000PbP.00CS0)<.0p210SxPpNTP"Pg KPEpE U0@#S?TTTTTTTTTTXTTTTTTTT@TTTTTp6p P00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@Wo00@S"dwWg'PG]p0000Pgw<0 0CS00C0~00P00C0l0P@F00@S0P@9u Y p0P0C0t0E5`0@?o? @2;R0S 6\P(\Pp ?PPpppWppUpW 6;E S8 5:0 S0 U0C *0?0%3?P00q Q~  B  PA0U!*00%60%3?00q Q~  B  ?PA00q QPA~P•3U5*00%90%6?00q Q~  B  A0%3?00q Q~A• ?P B 00 r R P B ~ P  B u300%<0%9?00q Q~  B  A0%6?00q Q~A•  B 0%3?00 r R~   B  U?p00%?0%WUT@>P0 |P0 &PU000@$P 0Ѝ %p%0 {% y( ( ]*By((|%&@T x((% uY( uX | zP#0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0ZP0  0{P BP 10 }0 01{W00E000C00R#PpIN}PP 1 " )00 0: =}P,p @R<2 3 wp BR *p* p|2  BR P=  ŤM= P2 Y%W :W5 #Wg}x 0P 0 ym10G P wp BR pYpT3 0 @ R  B 0p3pIP3?  BR 4p02!R1S $HQ x0H@ 00 X"0`0001BP11=tP|4  wp BR pPP4HW I/o}W" R #p BR p P 0X0 'P02`5Qw0  0y0"0 `! $0  0G-`̠̀0@T@@0PU @ 0S 40 0  B/o"`f0p 0S 0 S U0 0 0j%p {@-P0@-2aM0$ 0 10< 010@01|0000E_PI@1| 1Q @@00X d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 ?0 0 0 S00aߍ0  p0 `0 &H0 D0 H00S^S,0㡽 0( %( %p {%( Q0 G-Vp0 004 P" 000-P6(((((((L(((||4$||||4|||ĸ0$00pK@P 0 R |0f` p    Q0@0S 0 00}Wx P0, R_P}1 000@ 00 00 R, R&P4 00300 0000    BR   00` P 0000 CR Sm 0 tP P`  ``s 0 0008 @0C 0 00`0 SlP XC0 R   L000`0S.0 R Ӻ00 P 0 R000 0  P 0@S P 000 x`@`0P0|0` P/ 00000PU# T 0S U0@P0@00S0P0S0S 000@Ѝ0$00p%p%t%A-Q@`Q` @ p0 P0 0X@p 0HP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P /`P l0 08 00C004`ЍRQ%p%0 A-P0 5P@. 000`+P p@``@@P 0`0 U000 PPe``PP0S %p% p@-@|PP ,0 @P P 00000Sp opp%p P/0S/80 P/0S Q/0(A-@Pp`00p` P@-` 3MP80@ pT@š PP  LL Ѝ e@PAL}z w d Mu%| 0P/(RQA-`Pp%LpWpPpW@ U L`0 R@LP PI4 0׺K0 %| A-`P@xpT@Q00C0U U 1@P0 PK(p@-X@X`0P0000100CS0p00Spp@l( (( p@-PX0@TpU@PU@TpPKP(|0p@- PR @RP K0 _P 4`~K3 Sp%|)p@-@tP0 S000C T  D\KP 0S_K,03O@dA T @0@p@%|fffg(p@-`P0 Sڜ S  8K@P t0 R@U 7Kp0S 0 S  K@0S ((%|p@-P @0Pp @  0p(@0@-@ P  Q 1@K0( 0 P/ R/(C-LsP0 U00000@0CMS񟗮ҴdҔtӄӄhh` J@P@2@  堹J@P2 R@Ux20S Tq J J`<"<J@P2V0S' `Jp@! KpCPJ?P 1 :Ź 0: SzJ,00`l!x`\!l `V'jPP 2 0(7 V U0S000  (P @2 0AJ00CS000S Ѝ@p T 0Pm2 DZJ( ( j%|%  B( fRp@-@P PP Up E2 |ԸIp`U Ip0U +2 ppO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U %nxQ02 u`5x *|p@-P  @zIp R  qIp d0 Rp  fIp _Ip YIp9(%|p@-@PpD0 0RPPp03/GIPp(O-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P M1 8ܷHPzsPP jT H0S_ ZPPZH봡P000P000 S`|1 0R  HpP\Hz B R% s1 ( C HPP d R  HPP UP HR R rP0 00CS0t00S @T0 00`Q RP(%%%((|8( %|;( O-`0Pd#dCM`s`` `00 H8p(V( PEWUCc 0 pW` w@p00S0SሹP20SU0SRp0sS vS V`p0+S -S X @c @Q0 @R: P     /PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' Gp"t0 Q  0Gp0T ]00Z/ | X0 M IU00 DZ-O&2=-O5(|(uB u`g%A-PQU 00CSQHq10SL R@ 0r`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 -  u`Op@-@Ͼ0TP R R R& 1S# 0 庾PpR!Q QT " "D0600S0T0S 00S0(( ( %@-@1P @W.PmXP Jc@-@P XP0  L O($/QA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `/+|G-@Pp000 T` 0000CS0H00SG(0S 00S ,@( (( P P0  /\ Q0 S//(@-b@0pSM910S5 0SPPT,2C 02S ʽp? 0Sl UX U` Php2 W`RUHX0@D>T000 0iý00 E10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ ((%(PO-`@TWP P@QP ,LP0FpS`@ PCPBP7P34 )PP`tDa0S! 000n+U 00CS0 PT40S 00CS0 40S P@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @嶷PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR q*pVP 00CS0\00S 0U00 P 1[RS/%<(( ( )>|I _p4%TA-@P P0` pUTA0S 00S Do0@0@000CS0 00S P((( ( p@-H@P02`S@20CSp-V02p(40T0P?o20S 0S//(C-p@`1010r!Q0@S10C1 ЍqXPU X2ePᅵ)P 0S (( @ 0P/!!R /(p@-8P\2Sp@?<9\Bp(0-MM01`"R !R X"R   1 1d"1!d2S ,=SPl1, ,4SP L!0,00+S@P$1, @T0dD`0P, U @T 0S P00CS0 ! Cg00 0$0(00D>S ̺00 BzDC"!031(( ( (  0@-`"dy(p@-L@/'P0PPp0C/U00p vp@-T@TP0 0P0 (0 0000CS0p00Spp@胱( %( A-@R`P  B0PPEU`pp WDa0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 0 000CS0h00S #sDP`000 0 0C0(( ( p@-@P@0SH00Spp@00CS00  %0%0%@-@0P=(Ѝ-@-   Ѝ Ѝ/-@- 0  ЍЍ/% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`P$ 0S! l0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' # v%0Q%@-@@%@-0rS(H0G-p0 P0R(0帐@0=00=``F@VPpPER000 S=S B`` R`ĥ`PG訧@%(%0@- 4@ 00C00 0 0FЍ(m0P P PR00/0@-HP@^ ^ R0L00 xA-鸀(  R i(p`@pW p0S 0QPU  0S 0S   3/P@P00(0SfA-@ᣮPñU p`pp0S'STP@DAM'^PP(  EBFu/+ 1XA-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T %xO-@00Sp 00P㼀✠Z  0"@PU* Ѝ`V Y   [ Qʁ~aP`0p((0@ R P=R/=R/A-`P0S=SPERPU@'i\0\p!0qV@pT 0S 倔PVpp@((@-1`0@S @  PPV 0 `% Z h@  `R Ѝ@v%Dq   R <0 2/0`a% 0R , R  00 0000@!L@0P U U0 e00CS0`00S Ѝ@ҭY0#L 00P P Ѝ%( (( -p0GM00`000NP  80  00 Gߍ0  0 g( ( A-`p= P 崭@VPp PuP0D @S= O 0V  @*&`ЍA70C-GMP00 0NP00$0 0  Gߍ( p@-@X@P0`$@0U<` 0U`00 0p@(݁!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ((( %(xp@-@`TP000T 00CS0p,00Spp@ެ@( ( s@-P@T@ bPP0 P00Ѝp@n` PP 0 @q_00000 00PЍp v\(A-PpU`A0  #0#@TP@ 0@00`( @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =Ⴅ@@( C-pP@0聟rS``PW! 100S T! 0  ЍC^nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  hG@0 L ?@   W P ث(s@- P`@@P 0 Q   00 00CS000S ЍpQ     R T0000   " 0 "( ( tHA-`pĀ@TP0U0  S ">"0S R   0 02/0 "00 0000(%l%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X %@V R@(PP@-  VC-ܑp000P0`-S㴁@TQ ز@ 0@00`0CS0Uh10SQ ЍCȪ Z@P=P 0 @0 0  0 00 00000  0  RP 00 00=S Vt0T 10=S010C0 0P00 Ѝ( (%l%(  (p@-@PTpu@p@-P@`P \偪NP@ xP@ IP@P(P0 P pVP>(00@/ 0S0@/s@-@/0 0`P&0S "0"S U1r0!l%*0S`0T8000 @0C?o2R0SЍp&@T@-M@ <P ލy<P@ D0RQH0PP0@-M@ `<P ލX<P@0D SPH0PP0@-M@ ?<P ލ7<P 0RP 0RPA-@`L<PI0 0SC P;UA ;PPPsp;PJ! 0RA @- 0-RS# 0S0 00t> Ѝ0SX0 0P0S00 040,\P$ w w w v0@-0P!S@M0SPЍ0P| 0SyPUo U U ᤦPo U ;P? ;PPEURXhpPxPP PPP4D O  P  P  P  P  P  P P t0Sp00@j;T @;0(S0)S0 0pnp@-@`P'P} 0Sz00CStt4L`|,P፬oopᅬPzP.@`*TV#`@VT@`V@ @` Q@`Q@`V@'Da?0S0!SPpp(S0)S0S pp@-@P PPEP.U)p0op=Pp0 \0!S0P p(S0)S0S pk@-50B-%@-$0$0 00 ݧ( %O@- @ڧ R0Q0\ * ЍO-@`@M8 T0pD P-R lRC 5R -R| `SJ@P{2 000E @PppGWP jPW pGP〢倲PE0%S``PXpW ;sR R`6pTP`2尧PU W@1 000 PPP@U _DP@ 1 bJp xJP l]h7;X@P I@P0S0Sp@?Jp0 0 ! 0X` R Q!q *S0Я 0R dS D7pv   T"TTs7oQ0&@T 1 I$%T =1A3 [0@-DMm0   0@@DPU#7@0 =   990P x, pp LdDЍ0=ᷟP ( ( -4O%*Ov݁0xp@-鋧00S 0| 0x 0p0p p@0   PU P@P0P H0H P p Pp( ( ( (%p(%%%%%p@-@10@儳 0 0@0PU@0000A d0 R 00CS0H00S p@[@C0PC( %|(%( (0( P/p@-@PTp000@p@-@PVEK0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+@$0@-0$ 0d8 Ѝ@-@4000@-@4000@-@(0(S00 0v10,0Ѝt` p@-@/PP]qb8`<^@\GPD[`XUT\R`, 8/`/V0,0p@-@4R8}0,0@-@4H8`0,0&"6  @-8@6?( R n8 ", 8 <  < D ,-D  , /(0S \@-@8\@0<<@00,0@-$ 0P ] ЍtR@-0P] tn[@-0P] toep@-0MP`0@-S00(00P0 0  P3P 0( RT  0 0 S40(P03/Ѝp: 6$A 1|@  < S S  SP  L6 CVyP   $W        @u̅0ST  l3 3X@ |3@W h3t @ Lx@l 4`(TL@ 44,@   T4 @KV ` X@H~x<z 4hv `$r Pn Dj<<f0b(^Z3U@V LHD @>|<@l 0@4TY 2Vt,<*8 $"H@V S  W  2VxApr`VЍ00 d2 @V   Q  r20넑0l  @f2 Tl@ pn$,4<GOV^ekrx^f ~#+3;=NW]dlqyFOWNVe @-鑣 3/&9@-,0, P 0 0 2/(B&9s@-@`ᓣ000 #S@jPሣ0S  0#Z00S 0 ZЍp/+%0S/#Sp@-@,P$p0P 00p(Bn@-PRP@ p`2p 0R" ЍG0"S0SO 00SS  00@O&@T@-TPL0 p@!0"SYЍw(@-TΛPL0 p@0"SYЍ(p@-d@P0S 0S 0SS 888 U   S$Pp(#p@-Px@Q diYߝP L0    P    pp@ @ (0@-@PPM 0SLD00Ѝ000 0?P0 0  ("@-卢0S S S8 4 ЍS$ Ѝk/+80/O- pPMPa  R <R$,V P R ߍꃿ Q R 2@sQ Q@ Q@ YT WpZ: R D 03/PUPP(AWUx7@-lP$ R\X@4 H$0S p (X X Ѝ0((  p@-@P 0Sp@U0PS 0P0Z00Sp@@-髡PD@D D`DpD0S.001 CJ&9C-P`PM 0S00(p/p0 @P" @/Q `0p0@0P T0p &PH$0@@ 00Ѝ  ((XG-@0X T0 HRD2D1H#<0( 4 0, (00 08 04 0#4R! 0!4S 0!4S 0!4S h0!4S L~0p!P0S t0w0T!T0S \p0p(HP8W ЍG0S. a`v`  0T0 0 O00US !S|  !3 \B00US:3  U02,  40 0t/0pPu&90 8pQ0BB 1 ! 1/(O-Qx ,@QdP0QL 4QP8PQ$80S,00 80<0S#<0P;~PP;wP1 QB"8m`㠱8X0apS wpR  \ <0RTUP)0< S4LP0S9`(kQ ?(dQ 8@P0S0 BS `a 0p&h R  R* P*da (Z+:K^p(IO-4+M p* bP 0$S ߍS P@T[D@lP 늤 40ਫR ZS$ "$0f0Qf/jǞ,2!S!R !SS0С1,21S ?1P P @ P0 0ꌡ1P#>00 P,2 S,% P 0 @p#>00?s0 R* 0S 0poj5 P 0S 0 pa1Sw j  P@.1S j+ f/jW01P P%DP ( (6]WEV}}-VEWQ0(t&90A-P@p+P` %R 0R000005Sw D $0f0Q $U  (( 9(p@-0@P  P$p@`0$0@-0S ,P(@-P  (O-@:P,kCM M00 8P( 8⺊P008K80p0SP :P  @00 3Y x 幙P 1(p X p@ 嫙P$4 X p: 0 $0,P$0S  q$02P EP pGGqr偙P,圙圩$ pW 0S$00s 'P$00  P$00$0 P$00   3@OP pWa 0SY] 0 0$0P @: 8$ 1\ t$ 2bP( $0S  S;Ƒ8@0;RZ(( P  > % P  P0 0$0P$0S ++RP0 0  | P 0 0$0nP$0T0 <՘ P 0 0$0]P$0`0 Ę P 0 0$0LP$0X0 峘 P 0 0$0;P$0\0 |墘P l坘P 0 0$0$P$0d0 (勘P  50$0P$07 y P  l50$0P$07 {h P  (50$0P$07r jdW P  40$0P$07a Y$F P 0 0$0P$0x0P H5 P 0 0$0P$0|0? 780aJx0S0S  |P0X: `X0 H0I0?0t 0 ST 7 6 2Z/ \g0S 1 #0Գ000S05 0  3000"0$0 0 0 $0dP @$0!S D@0$0|2$ 2 ,@pCލ Ѝ0S 01  QP0 yP0!A"A0S 0崡0S 0Cs RS񟗚j`j``k`j``kd````j H0S0 0S Pz  0$S ʖo 0 S Pe  0$S~ 嵖z 0STsr 0 Sk PI h 0$Sb 噖>] (j@" Xn   (( %():%bJXeit~( &@T5 s@-`0PU V  PKD@P hЍp`PD!ƚ 00E0@6V  dN$00S \%@-髛00%p@-@5S4 0PSP p@<$Pp0S 5S 1S R|Pp5S T \Pp< HPp'(( PpR((``AdeAdrs@- 1 AP(000(`;a5 S4 5S PD0S @0S005S  Pt p0pP("5S ЍpH DlP8 VEW(dfdm%p(Ёdg@-@P f/@( 0 I%( dm0S/!  -3@-PT P 0S S@@ P@Ѝ0@ Ѝ/&8p@-4@4PQ=p@`e) b) @%V]@-t@t0MQh  `P0cS CS SS 4sS00ۍ0(@ͪ%b|0@-MM@` PP 00YSP ,ۍЍ0nP 0 u( t&90@-@M0 vP  ۍ{p@-@$P 0p@ T&90(t( t @-YMM@p p\YލЍ<0< S <fCPژ10YS<0<0(Adr>@-*0gj zgzz'z'&z'z{zgzzz { N(Ѝ5U7@-P0@ 0$S0S> 0S6 TQ+BQQ+PU10S+ 8@ 0O 000 C0ASutttuTtttu0tuHttttttLu`c0As Rxd(tb( Ѝ0zg{{'P{ zg{{{ { { @(@ix@-\@\0MQP  HP 0nS yS0 $00ۍ(@`O.P `00CS`0p S00 P0S X0X /Xc)&8G-P 0p`0A@P O'pGT@Y @ 0@·H^Pp E“p〠 0  a U Ȓ`V `` XЍr&90O-@M MhP`፵X%XTuTT0S0#!pD P P P'p0 p( P " nTt`(p P  \P `k'Z⁻P<08 Tt`( p P  \P G'0(0Ss`, p P  \P 0'0,0xSXs`0 p P  \P 4'000$Sr`8 }p P  ~\P '080Rr`4 fp P  g\P l&040xRDr`< Op~ P  P\P &0<0 Rq`$8pg P  9\P &04Qq`$!pP P  "\P &04xQ`$ p: P   \P 8&04(Qp`P p# P  [P y&0P0P|p`T P  [P c&0T0ۍ Ѝ(t&90  K^ (z5:Y{&Ff O-M@ M0(p PT `V:0S0`SR:P`P8apEbWWnF `F`0E8ġ0 0S0A"S0#1` lop P( APiP@#" 44 NP0S  3/ PA P ,ࠐ异Rx%.A 5p P" 4SA4`S>94`P92a0C" 20< S :A$%"YA%x5|%.A  pY P0 <x5 0AApqA%A0 P<0QADx[0x5< 0RA| sP 0 000S P0`p尀(V R s S 0 0)0`PX/%ލ Ѝ  3%  >  U   q  $  3( t&90(@ K - BR0 R Z&A-P@% R1!% 0%0 %X0 X0 pX0 \ ( H%, <%0 0%8 ${%4 w%< s%$o%$k%$g%$c%P _%T [%0p 1R0S*0X`p\PQ H%VlA c            $ 3 F O _ n   O-pᔀ 2MSR R@`aW 8QT ,[Q 0Ӑ0 ͐  20@" # 8 徐,  Ḑ `@04" # $ 0$ !R21` $ 0S 0Cs RjSgllll  1 0 02 p$8QI ڏT $<0P+8eQ* 8 0A0 @$2<0P+8KQ *ЍO0 0 02  02 po$ dj$8 T ЍOЍ     Q0  W dS  * = OA-@Pp(DI$<`8SA 0` j z0/p/0p@-  R( R((,,004488<<DDPPT@TXPl XRl@PUt @ 0T0p  Q CQCQ}C(@-@t40Pt08Zf/HVEW0H @-P \PY Q@5VEW(80@-0@S K08f/ (l 0PQ0//@-L0 D^#<<8@8P(` RO  0O# &9 %P7@-@ PTP0 08P8 0p0 yJ Ѝ0o(@dv0@?o2P0S@- p`PՎ@P ЎP ˎP ƎP@V@l彎PH@T@T Pp0 4Xr(@dyC-p`@P Q /G᥋P 03/ ЍC@@ R; 8p G%(@/+ 0@-  G(@P7@- UP@TrP DmP804 p Ѝ0O.`(@dwP7@- 34P@, p Ѝ0(@@d@- (0   {u&9O-p0$M@QP`H0 00000X$Ѝ i{ pF  P p 0 S 0T@0SMxtZV X}QW 0  @Dc -[n 1p@-@PP1P' 0P, 8>0P  EF0P 0P 0Pp@`p@ 0x4@d.p@U@@ Ppdictaraynmbrstngg Z/"/+ 213/P/(DA-PT0p`v@r,0T@@DA??@(D?0@-0@ 202 0嫈0Q!Q3(D> 0R//G-`pB 0PᎈE 9@PPW 20CS20CS G0(D@-@p 2SM"n#^  2" E 2"HЍ@]"2dz`PE"2@oX"\4Ѝ@i(D%T 3Zhris@-P`ᶎ  .0SЍp00S@᥎0"S1Ds@-$Mx@000  0 0Q0&9A-`P 0p @TʬE /, q0d / 0ໄpq  RЍAL`0S`@D@,V Ѝ%T4J(DA-0ppP@`ph!14P S H d" R S R 0 I.gU(Dp@-4@PL2S0~( #ˌ0B1p(D0/p@-P@ŽQUp@(Q B?   ^ L043c 0PpQ B?   P Ƞ̌ Č @(DX0P@-<8B 0"@@$18<4@(DO-PLMx0 $0|0#(0p0@00030儠s,4000S9 23S( `0$ 0ކ  0/Ն0   0͆ 000  0 Æ#,bd"LP C 0,0 "¨ 0 RD0 $R0 S p2000#1-R0" 4DD`P@0喃p0P00S (P  "P  P% D`ረ0D00 S> 商0g24 plU$[EL1R?$S%\2 MP@\2CP0p0PXBp0 X20@Pp0 X20T@Pp0 X20T@P`D`(0T$0000Z 00S $0 0(00 0hL @ PLЍ P @!(D%T(G&8?E@&@TXD8-s@-@(00CS0  HP` Pp ppC0 P00CS0G0 Y@oЍp@Ѝ/&8\?EO-a@ pBPp?C$0e@O 0卂pq Ѝ  R ЍODt`_0S 0 tpq `BE, +0S %Tb(D0p@-"@R  lP"n/0!!UU08 T0p@@PB @⧊@Tp(D(N((FG-HbpH@,#Y4PPH |B P UW0剔LI J$ =r0,{U 02U!U !" +I s?@sό0QlX2 G    <1 81 41#(,$#(,sO$@tr ,! (! $!0000 0 8< 4^0 p 0 8< 4P0 @H20H2(D(Fp@-d@0P01ps/Ġ2P@ `^`H"̌ B B$ qH20CH2p(DO-Q04 ЍQ\l hX Kpp !0ಟ0 + 0p`0V!002R x"  px"Qt2 0l4"` 0L`1 RS(2 0S(S"*R1!0  12Sڅ?0 1R 1 t!?q0412S Z 0?0\1QR02S 0 ·0S>0)S  Z0)S  R0  Q !P>00 0nn 0<  EP2S8#(Dq, xzQ0%T,N2dPLTtU A-x RUP@P@aЍPP0RB1P@4a4aTSp ЍA>< 05p p+ 1&1!1<0  11 ?01!1<0d  1P 1@?0ЍA(DmQ0Vfu O-- 2S "$, 00S1 1S. 0W , Q  RW !(,$!(,0$0W0,,0`L$@hd0S, 21S( 02 (, $W P,$ QW  0 W@T0,0`@ pp3"Rk2S |Z;00 0 0 P D00 0 0 PWK (0pD <0 8 0 4 0  < 0 8 0 400 %tb0 @2S` BT$0`pPX " 1 B<0 0@@2 0C00 @@pn2 0?0 @@pGq"??pp1 B<p0 @@2 0C0 0h@@p2 0H@@?0pGq?p?pp$0S 2SHB @TJ0241S$0Sd 0s XPX2<8"0 RS 0 0RT!z!!!@-0AM0@ pp`Ppߍ\ 0  0W`P \ Ɓx02S 0S " `P H0 SR ݺ0PI!"(D" 0A-da0 0XAP d2SD P4t!p" 2SPqH2U 00"$lpㅄ"W Rp\EU$\pI0 00P d2SX R PH9Ѝ0"P 18<4%T(Ddm"G(F"~(N("iA-@T2 @P}P }P }P@ `p@T 00S p`V@r}PD00S @@e}@P6#(n(%pA-Pp`%@%%000 0@@@A-@pT` {{PP%0@ _@%@|G-M d4 P@TPD }P @ 0}P(4 00(0 4QT(0 ,0~%4@ 0#.0@,0S @@((@`@,0s0000CP倃0P>PP0 !01P,30  ,3Q #  [c0VT0<  p@8 PA ,0S , < 00S< 00@ $cP*&0FSʆ`E%P0S -S@= qP00@@P ,0S ,^A0 ;XP l|8800  0 R00S'  410XAXQXa400C0 zCJ740S0S-0S0S C 0S C CC$0#4 ܍p PS P(n(Q0f ' 756&`6) )696?%t 26z @K0/(o0/(o0/(o-@-$@  8# Z &9G-P`pƀ@0S _ 0S X|V U @TKY0S 0S|@ ; (o67ԍ7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-   C-@M Mq` @ PPݍ Ѝp!rp@P=0PPD@rO P00: S0 RP00 0(PP  P81: S  S U r)PP11P%PPPU r!PP @P(o J 7(o,/+78 8&8D@-A0P  0 00"$Ѝ  8a(s,8p0@-4S 3/ (o@-0 @( 0$O@ (o@-@:gB?@@-p PL`@@0 7/P0 S Ѝ g00(sO- MM06@  @  @ 0p$000 (01P(DDg@ ܍Ѝp 03/0P0   !P @$0PS  (0SDUI0`P 0 W xU euX0YpY 0 `  W p[ 0S P%5 we@ u UT \ 0e@W0SU 000 !0 0S# 0S,aQ? o00CS0""9@ T 00CS0!9 P @YT Y@DOoB 0Q    @OoB\ 0 @0  0 0 SNT(s9:&8&90`O.90@-M 03s0c00@S  oyPP* R!qPP<c 00@ x  0PS PW `Ѝ0S v 0S p 0S\0S\  0/@ H\0Sp 0@0 @Kvp 0S0SU @g0SJ  @"  @0St8 @D HP@ @0 @ `!0xP|"%#   T`    P @@``a5 ] x Zp h 0 @`(s(s(s: ]$::":E:[:}:::;(;?;;;qG-0@ < 0P 0S< 0  Q*g  qPP`  k 0`P l pЍ!URQ H l z0H00 p?s0W0p $P D2 0?s0Q(0  1!?/s0r 0 1!?/s0r $0 0 02/1( ?s02/0, X0`P  Pd 0SD00D0Dpp $0"3?X0(0R+* 0H0p$,0#3?803?/s0r 004  pr00 PQ  y   0P XP yXpP1S1S1US1S 3S3S3US3S,  pP0p- p202 12 1300pq00 PQ  '  j 0Pp00S 13?<013?@040  q40  PQ  g 0PA0O A0  nXP 4J С 0R  A eY}{X`V P0Eu 06#++R`DX4 $0S,0,  RT0CpuD0"P#10P 0 # 0QL \0  0P 0PdP@d;L;;<<).>hG-X` p@%PI Ѝ0PZ%V0 0SpVU D8 cX0 (X0 P>q>O-@,M0p@l@$0`P PprP$P ;@,Ѝ x0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q ,  L 2/Q0r 2 q 2/"  @ "  p@*"*  P0@ S  2"!"0  0@p>>>?6?#? 0P s s// /?>?Bo O-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \P0p@P q x0 ` P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P ?I &v?}???@@:@N@@@R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0A>hO- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  ( 0 TX  R 0  0 p p P YP  L BPTR2 Q PEA3AmAAAO-X`0pM@PPdЍ Vv0Yl08L0  S 0    s   00 P䑟P#б 0 STS sH 0/MP fv  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"03 0mm0 PQ P $P>qB G-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0SP  R`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0B4BiBo &vo_B@-?`XP\@#@3P@T@TpW @@T`L(tO-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0vlPQ RP0 Y:0 0 0clPQ PLF 0 P<0T 0B(sBBO-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:BCWC#C(s A-@/pp0%B?[`0S @o0ES PC tp@@0T?  C0(s0 PK %/(sO-pcMW , 0 [P0 S@0Pp(0@@D0 0$04@TD0' R$ X0`1#b3<0#0000 0,<0k<00 PQ cߍ0P@4p(0@pD0 0$0``0 K2#  ,jPV002800aL0`F08 0L0SD00S   800 2800,0<0ek<00 PQ (1 0H 0  RR R0(10D40L0 `0L0C >p h)P.  (10(11  , B 4 0B0 D0P D0[140S  QI@(1  0I0@;+ gr P(10(10@4 40 0S\ 0@ F /o@0(0"s R$ 00, P 0Ss0p(0@0$S@0! 0C@0 0@ 㓢#X0X 0 PP :X R: U$0p 00pP01So | U)0 pPf(@\Q UpW$ P   pPK/\s g0x!P0p00pq P$ b QQ#hQh  0 U P p$pu00000 ,p$@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W u0!L0/r s|!0<80|10W03?1t0U`0 0\|xQ1PP|!R \P PPL0sPP|!=0I|1@|Qx1U0P U* SR   1S \XPP@ 0I 0000@1 hnPP 1|!RH PP 1@_3s00 0Qs (0R~ U$0p 00pPv, u^000U\`0( 0$ (\T P000 0T 0P0 00 , M@W $0[g1Sd Ia1 S0(0ZRh@nP0S 0Sm \llNR P0S02S 0S0SW 0\2SR\M|!.xQP 4PPy 00I@ s 9 |1P /@P PPPPPPL0Is0PP@1@S"U @ZShmP<PU p|1WS P@ |qppL0Ispp@P !RP d,PP 0 1|10|1#40L0s_?00|10PP+ K/\}qPP05P 5P0h00h0Jd 0ES:\P P|!d1HrH"HP :0 @0|12PPp?18 ,M80P$I0 [P0 S0 U$0 P 0o00 0000 0,@ D00S0 0,<0Xh<00 PQ80,R0 PI Pd01S\70!X P %4QIP0%8%\0 P@l(sBBCCC C>h(tCCD$DAD?6 OjEDYDDmCDDE@EmEEEFEG- p@r W pP\aPP Pp $PK/BpD08QP0Q:" 0PS00  Q pUxPh`P 80"8 R 00 05 !$x(sF/FSFwFFFGLGp@-@5%SQ%  5%QPR 5UUQQp  0Q   0Q0  (sA-lP`5p@ @ 0% Ņw@ŕ\(sO-POMp*P* b5S 5唢@TE  kP@ ET XT 5d 50 1 S$52S$5P ROߍdP  RR @` d0C## 0 f0 PQ d d0P Eh0K/0h0 Eo0 8!,qr0d  01(~o  j /o  +o,10,1#40L0sK?00,1001001#40>00010 00 000T0 Cf(5,%PQ Hd ]d0P GP(sGG(yGnGZG~ (G@-@ P 0 5(s0/(y0/(y0/(y-@-$@   j&9G-P`pp@0S  0S X|  U TY0S M0So@ 4(y67ԍ7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @4PPݍ Ѝp!rp@P=0PPD@rOP00: S0 RP00 0GPP P81: S  S U rZPP9!6!P%PPPU rPP @P(y J 7(y /+78 8&8D@-G10P  0 00m$Ѝ  d8a(} 8p0@-4S 3/ (y@-o0 @(" 0$no@ (y@-o@Vnnn@G-`MMP@p`PR0 `: SW/q0P  rR n00A 0C @L#@ V& 0S UP0P`弐0GPPJ0: S,^0"N<@PTP&P+ iP  #PP @v3M`@ S @ S@P)PZ P Po UE f-@0 S R U=EPXt5p1 "(PU00`P00D! }@P2  P=n0S`X PPt0 PP W80% ܍ЍymwPUy eoUu TqU GG FG F@F0/p/p@-P@P $( $(0XRX0X00\00`0ddhhllppttpp@-@ P OOODDO@@OHHOLLPPTTXX\~`\`0p Qp` llP0@ S p@-0@"!Rc0p@-@PsOpOmOjOpA-0@PJ04S->C[O->C?XJO9>:>CEO?n:>CF@O 0? AC>7O}C>G2OmF.OEnF*OE~G&OX J.X R  $$((,S>,O}S>GOmFNHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqxN1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,R2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+j000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  A3e PP1+\#Jj0A0 0 00L B 00 00 00000u0#$ 0 ',"'("&8'$"2&,&42r"bJ 40ЍG@-@0S6(00S/0/(~lp@-@PD @ HP ,00S *70 0pp(` 00S/NM(~l00S/p/(~lO-l2M 0 00<2P0pS@ 020S 0`0 `X#3WQI 0KW0A? R! R   X %|10SI p10SET@Z000@S0@0@ a``0@S.T0  0'W ,(PSQ RЍT /T AAV@Td00S X00S0S@ FP( 0 *(8(`(~l(~ (~(L(}Gp2O-0@4p 0 L0PLQ7, (0R000U00S,  7`P%0SP Ѝ5  prX001P``` 0,00(0S/", (R00Z P000 `0` R0(0, 0 Q 0R000V00S  P0P`"`F0S/"0PS0P X5 P PpX00 0(}(8H (~tG-@PDpc@ppT@@@@   0@S)st h` 紐pX 5pD !PT 8 0 0 00Sp(`(d(~lA-P`( p@5p0S |50S"0 SRpp5p0S j50S 0 SRP@P@A-P`p@ `$P`P00@AO-HMQM &#0@20 C_ `P/b0VP(P,0 \`" :lO"0S1 P L000 0$t  HP' $0000S 僁0 0 Q.P 3 p\tD.Pt3 0"0J 0 3 @p | 0 0S /r  P1 !.P Ѐᰢ L000S0 H \ t 0D0X0x2 0J0  000r00S 2j0 0H 0Hh [ Z0# 030C  4 S 0040FP!t1 0 ] 0 ]000kI000C0 0 S 8   0 0001   p"0000 0 L!0sv  0 00S yGQH}(}(\H(}%dH(HH(~tHHHIDI(~ I@|IhIG-P`J@pXpAZ x10S l10S 00 0T P4ЍG&@PEU<  1 QP0H 0  P `% HZ0S"00S U  0S 0S GprpЍGcX,P H0 ЍU(}(}(~I(}%GQIIIII(~t0/p@-TP@081 00 @ 00 .0@0 bp(}00S/p/(~l 00S/(~l 00S/sE(~lQ000R0SO-@<"P0 `RMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0 0|\\5p!pS 0 00Ϯ0 ?@U '  ϬR8 R  00 \5S0 0/070/  0xЍ  [ X R  00Le0 0<00^/(~((}(}ITJJ1JQJjQ0O-`@:!0 R0* 0p딑唡 Tp3Qx 0 T B:\5 00[P/<# P 1R 0 0/."<0 P 0[`0 C c 10P0S   0 -0 x0[0T 0x0 [4 , R Ѝ(~ J(}(}T((\O- x3MPQ P*0<PX k:$ ` \5 0 0l[@/<#| @2R 0 0/."<0p @x0 N[`0 C c10d0@@b CC c@31B $0 Q,040(p0pPßPp0 8+10S 18P0YC9 P XEʰp 08I,80<01h!0<S0<0<0Ѝ U6 p P\ECEECkC U0 0C 0 S0TP0S<0а(? 0 XTEU p P 0R0SE ?Z0:P00EU S(}J(}T(P(H(\(L(~(dG-1 `pP0Z0  00@ 0S !0 80`S P`P xl$|0S lrl0p00S0P0$ 0,0UA:000S 0S P H1 H0S 0S,0S ]P  f.P   000(kP 0S P  PP P(}MMMMMNN.NQNuNNNNOO5OOOOOOkO(;P& J 'PFO-aH0PSM W0R0: P `4"J,"  S H20SR sЍ@ 0رء 0 000CSY?00 1> R. `@|!\! 0 S P  P  (    . #0 @#`P0 P 0 $0 S` @00 R0 SR Q\ 0Z((HQ8(}QR(<(~4X+Qg(~(~tQQ^(~00S/p/(~l00S/0/(~l 00S/8(~lO-M,MG@g" pW+# p000SPEW ` p3P' 3PUP!00 0؍,Ѝp000 L(3P  8X}3PUPh0S ! L P }0S, &U : : j  W 0%4500! ?0S S :00/0S 0 S :U00#03  R00S <:0S7 0( 2 : 0S R 8P40@S0y4Pş 4 Q)Q90000C/)OPp`#p90S 0p ^!h 0 0P 080S, TmT09 S`p0 SUR680S2 U0;Q0-*h0S* 8(d03 (P xK@80S (00X P! @((;70S0 h0!&77(%RS?U0O:7<U0030#\00SDRQ7 !0? , V0$00(p ^47 V`Q0tX ZuVPk 8' 0 0pP(P6.cPK"^h0S`p&ao'qQ `panq V0 Fp`Q `pt A?7#bp 10S0A[p0 `} Z$0S 1000S 50S $0S 04  p`^t0/ N$0S 1000S 50S $0S  ,@ 10S0ꊡ  0a000 04 0 S0 0  P00 0!$0000 #600S<40S `4 PP @ p t3000 00S0 LPX00H00SS7 0S 30S0 \P$ !D7@lP  2 pLtPd\2 0\00Q&&0: @000S82<`040T/806#e PR8P<`@hX0@\ SP 10H0K00AVNPa`ppPU 0 \;<5 D5@0LT 0 b32 R p'@ `글0d$\5S b5 " XD0/0 Q,40S$40V SV 4t`V0`@0x@S vd0,'M0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0D30qA101XS>  0A00Ϡ% 0 S  s0S\00 0T@T` VT0?  `@@T` 1 0D20qA000P?0P0E{!P00pQ :*p VT0S0@  QX`` @W0`3Vŀ T 1,0`7: @T @0 O 00   ^ RT 1VSd Y0P   W *  A 0uP 00((}T(<~(~(~(D((H(~l(\(0S_&9(}(~ U(~xSSS(HSO-` @ 0MpԐ԰ 0 0  BRЍ :PP U  QP p@` {{p @Q RP Q @p(`(~4X+0/O-@dMX P0pP0P1P 0L1L H1 0,0SdЍ0S Pd0,`K0 `00 Pట 0E RpU0 :u`P 0RA0 S0T TX0S P@Spt0|(}(~(0(`T&9(\(~l 0440@/00S/p/(~l00S/0/(~l 00S/2(~lO-TM`PV`@@M4:0S P *0 Q0*`00#010S y0 KP0 X P )K P9 `0S 0S \)8L P00 49 < 80R0p00S0100,0;0S80S1?10000#0%n 0P @pdy _ 0#a70 @0C0P N100S 0y FKP 0sF0 S$ 0S '00qP7}`{ /00S0100,<0j;0S870S1?1$'p 0pp00ppP*0S  ;P^ 0 1U6`V/PR @p` xpB6 ;6#0 #0@0C0Ɵ 0 00 0Q,*0S  P 0 "pWQލЍ0S #0 #|50S pl0 00$001 5b,P 0S #0 # 50S k`0 $00 `S!  Br p 5x ᴑ5Q@6#0 #=00C008S< .PRS8$ 0.S ($PPP3P` < 8<#0 R0 *3 00hP2 0 0v<X P0Sp0AS񟗳TS$3 00V20S400005P 2 B< 80R0؀"0  < 80R0xQ' |20Sp20Sd"؀0  (P  : S000! *!0 < 80R0 Q   0FQF?h!h  D10 S' Pj< 80R0 š!ɡ0S  0R ؠ{P!0   0p0P``0P00C0X9P2]  (\(d(~ (` OjTV(~tT(~lTTT0TT>U TOUT^(}U=ULU\UmU|UV (}(~TxTpUUUUUO-WM M0AS}`|`$ YP 7 >Ql hLP P7 00A , 7 7P 70S 60V6 Y<X L0`06`00Ħ100V0:6 R`0S:`@aVxPV~Wލ ЍT P@P   ]d 0S X @ F  Lq0 00@(0S S㜕u%pH`pG(pP) 5 /  B+ !D ]g850ST 0$0(0 ]/g 0S i(0pAp[H0pGS(pE p(P@S,pK40xpS@09Y(0G7 @,0 S1 # (R' S000000Y!"!"9 dxhp:  (  0]/   ,0 S1 #( R S),)-*-{ {d ` p0S(0S , rK2(p2W ,@R@ )' 0x AT!W"!"dh 0R@ )' 0 AT dx@0 (0S 0$P Q 0  s00 \"0p10S t10!h10!/00C0H10!P0 800000C0!" |p(0S{@0z !0C0v 00@qUI(~tV0IVQ^(`(|(4(0(}(@VGVV`V|&9(\(8V(~jIVI(~lI(}VV00S/0/(~lO-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@Ds0 ddp,00@00C0 00 R2PU 2PU0p 0S0S)@P@R1PPUPRPU Q0:0000S 00"P D1y00C,(P X P.J0P0!!0` 000pSL" gTdXHw!Pe 0 07 ;000pDTt(|((0W &9(}(}(4(~(}W/Hd(\WVe`O-䳟P3张pM/`@ 0D\1P 0/ |0/ G0  JT30SL30U SU <0 S 3 S  @ 00000CSGTYr! P 80R000303L32   0/!  R1W 10SF0T!  0 S01`00/ C  030!ܰ 0S H0S 0 04040c/ $ 80QT $00$0 40 4L3 2   ^[0{ {<0 垸PpC(}(T((H(~l UW~(~@(~h(<(~(~00S/0/(~lO-plMX H2吒吢00,0SlЍ0S @d0,PD0 <<PU000P㸀 @1 0 0D RpT0<:9`1 PQ@ \`X00X00@SQTp\t`d`V %P 10S  0P@P%P 00S  0 0S  Q\ {{00 xK0Q! 0 P  H 08GD(}(0W&9(~x(\(}WW(~0IXX'X/O-oMM@PL00  H0|2?0SX0S $5Sڔ0SXPYX0S $XmX S RLfH?`0Vd2 P\20+! `" d" BG00!X d"B1h21$\Pl2ڼΟ\0C00p21`t2QB1l2 ?V 2l20CL0=SLq Q\20B <80S 0 ㌎$5> *Q/t>h>0S 00 0S0 $5B111`R B- 100 S ` $|00S% @ 0帀- 00$%BR0Ө`S<B11D%L0PP  Y PN 0S  <P| *堀.<<0S !0 00\0 bA?L0<5A?X0 =<0T0.H0 G; 0VHRQX0h0@ @0F8 <48ϠQ b{ S W,0 Sa?^ @k%PC ;0S @ A>+@B@  C(P4;"  @0\ 0 000D:J*f.::0S E0 0؍ߍ0<00<`/  `!.0i0S pd, DB 0  000y;!"\Q 0 i0/H F0ЈSh90m Sm X90S 0`)S 3S 0S ( X0 0h80S 8 0S8`0`80`M 880;."\^ `0 0/dh pN.' `n3&>8+?ᛓ)T<D  0PRT%ͱ|7DpP0W`C ?Q `,00C[qS  Y0;!"\Q 0 h0/D0刖S  70S P#@6z0堦h `-60S 0p&\Q`\uT6PD60S6<650;."\^ `0 0/dh pN.' `n3&>N `$5S8)Ax( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2?E 2@%S\2/< 5E 2%Sd2/?L *EW=SL5s45p`Ḡ? ?`00SE[ 2$Sd2?/0?  (2h$0C(2 2Sd2?/0?  (20C(2`D0P ST003^0 `0 D0d]"{ "{ `,00C[ @@p ?! |"l 0AS  20 2(2@#0C(2 2Sd2`0/0!!!p`Z0: 0`P   Phdqzq08PPN$20$2<0S4 dF@ 2,"S\2/0?! ! 2"S?ԀP5/`20PZd@p@0 0 @@000$5S `0t63 03080D ` ßD =R ,20,2! 2`Sh2/0^>0^00/\N(}((~(}XSHv(\(~XXjXMXXXX(d(<Z(0Y&9T(HY*(~(~(L(YJYt( 8(XY(}YY(~@(}(~h(~l(hZ(~t(~Zk(Z, UZL$5St2 ` 0h pp WS $%S0! !,r  $ t p (t | px  | l L3xh  bhl  "D0:"P3 00p`Y7 0$S0\000S7呫!"pW`嵏X7 0 %S 0\000S7呫!PpWO-P`@DDT(tp o W @(ZZA-Q0 % C@*r`!00" q0SU 1P0aO0  a**1t10S N0 0T 0@# 03A0S4 _@ 5*< 5)000S &0 0u@rTP/UA*t0Tp Pd0 0S L P<0 0S (}(}%[ (~@(~h(~l["ZZ(~t[@0/(d0/(d0/(d-@-$@   㭔r&9G-P`pC@0S  0S X| U ᓳTY0S U0SB@ <(d67ԍ7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-   C-@M Mq` @<PPݍ Ѝp!rp@P=0PPD@rO"P00: S0 RP00 0OPP P81: S  S U rbPPA>P%PPPU rPP @P(d J 7(t/+78 8&8D@-O0P  0 00u$Ѝ  l8a(t8p0@-4S 3/ (d@-B0 @(* 0$AB@ (d@- B@)AAA@P/00@-0@S @(}6[g0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT 8(~(~l(@(D(HT8 t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/(X(~T 8T8 (~p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0'H3H3L3u/L3P3P3T3T3' 'h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0'H3H3L3u/L3P3P3T3T3' 'EEP  z'4K44K44h 4n' 5- 5d0Bd00000P5P5H5H5=CS>S>h p@!0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(\O-t4M X `D``t`Apv@L:8D80_ 0 P\lP TЍ0/90 Pp P\QP0S 30S30S tl3l#0Sd `#SXq P L0S @=0bS  s*&0S @"\5S 2 2\5\5" 0C?o"20Rh [řT"40Q%㓈Pd0y$"0/E9:010S?,0A1(Ÿ "\ P 0 B0/ 0Sf0S k0āh !&0S _|!\5St1\5P l10S(` XA L!0 0@! 0 *% 0S 30 0 00P[@hPİPPHT* 0R A (~ 8(p(~@(P\[|(H(}[(~[(~[[(~l\(} 8(XT(\\2(((}\L(~h(~(~(T[\\ 8O- 0x*MM08PpP#?嶯 80S M:P?壯 h0: S P SPލЍ,8H0$hSO 0)00S 00 70 7 9   ` 8 8 ݯ[V``Z`P`D7V< 97P Q P @@8P0 0:86 R>0 0p 0<&0|&0P7p0p 60pw>0 P0p 2S # *u9P *p9P *.rVXZ hY 4[ 0S[?관X V. 08=  8 <0\9P$$V Q2C/7iPPe 2S|3%8 S20#"20$#20PC 2SB4$040404`02P&V20A2\02@2 0Z80C`8 `FbN8 0| /7H 0/`0PpT#0`P\`Q=S/0P 5` ( 2RV0 S,S,c 5*< 5#3 30S 70 0`20S 0|#0 0R V 10S \2RXX0S@}2؂= C ,0x" t`06 Bq'/ 0 >#a0 `0S10S!0 R=S0S lG $000/ p 0L%000P%X30,;q *w# 10S W0 0(T(~|\(~\Ι(~(p]](~8(}(]8ڮ]1(l(p]] ']]]]^ ^4^[T^_^_9^_V_^_oT__(}_\ _```;`L`a!aa(~|a(}bb+bTbyV(~c((~((<ch(~xc(~ (((|(((c(~t```aEauaal(`b(d(\(~bb(h(}(~@(~h(c(P(H(L(~lcPQ^=SZ0SR  0\p<<00P%X30*"0 |00S #0 00S5 0 >0S wPq 5*N> 0:#: 5"(1_ 10S 0 000S(SP0q0*"1? 10S 0 00<cQ3,hP 0r<0*"(2 20S `0 0倂0 RL%r0L%r0H00q" T 000cH00SP4Pr*O"220S .0$# 0 00L40q"  400cL00S Ps*'"330S `0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*!d4\40S +0$ 0 04t R,5S0%45 RS! t004e0SP*!$5`50S 0X% 0 00刅(0S xQ$ Y0S< x 0(%0S8zPȅ*!5350S t0 & 0 08%<5HRS$ + H00<508S_LP*g!660S F0& 0 0܆@%D5LRS$  L00D50@S6P<*8!L7D70S q0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ᲫPLX p F9@ Tʰ8  @@/  @!. A@O@@ᏫP 4  #9,@ᘧ()P4 ' <) QHI ϠR 5l)p) x)z)ptPW)pp _ 9 r3 P. ~P)Qڨ0Q, G 0 0S kPz* :$ :0S e0H* 0 00S vV0S0QQ 0 0S 9Pz*T ::0S 30+ 0 0P GV0Sh AV0S ;V0S^Q  "Q  )V0S&! #V0SQL<Qk V0Svq V0S0 V0SH00<5L080D5h<@ ,5S0SP ,000<0,5<0(5H04e0/<5L0l08%/@%D5*0<s<0S 0 - 0 08=0S 4=L=0SHm*T=TL=0S 0Mh =c |P'L5s0SB E-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!DtN00 00L 00*d>>0S C0. 0 0.P0 @DT@8LH$d0/ C#Lc c,1 0@ `3P Z( \?0S  Q8L4H$0/d@ A! a,3 1=?0S  60p00PX6@ ᠩ<6P0E V0$& 500060S 1S 3P 5 5 @CQ U0@ `P @@0 8< 4 0h%S L50S PZLP 0  0  `` 400 0 0 8< 4Q Д A0SXhPY 04 S 20S^YP_ 04 Xh$0Sd<KPe0 $V:PP/PQ  0Sd2Pe000 400Ry c0ScPd0 0 0ip8T0S 00 0 0 00 40 #T0S 0 0 00 400 0T0S 0  0 000 g 400 0lS0S 0`v``&$` 00Q 400 0`qS0S 0@00> 400 0 1 1Q1Q,+ 0S A 5< 0!00|!0x!0(pCSq #0p R0 !80Bs00WP P0SG0@APT0  Qt \  (E/ !0!XD H!](~t(c(~(~](~(p((PLABLdV(}d YdUdsdddS9d|al(}(8e (v(x(~(te*eVQ0a|00S q: S *C   S D00S @-4^ * R  S//(~l(}e}|1A-0`S hd1@ TL! 0S<10S,5$11 00 )00Sp@w(00CS0pP U 00CS0 P PYU 0 P0  0 0 SNU (}eQ^(~(Le(}(~e:&8&90p@-PD0@0`S  0LPp~(}eQ^O-01 (1$100 6P 1 (P 0P  PPPpp(  @ PT`00 XT RV Np WP @@ 00p(((}e((( O-@10$MϠ,"4H`  00廢P p0 <v j4(TP U  0~pP$Ѝ? 000/  哢0P0 0$00? 00QS / Ϡ/.0  8p0P  (pee(lf%OO-`M0P8 0Đp@/2#@ KZ 0 Ѝ 0|xPZ ЍO 0/  0P 0/ 0Pp(p(~8f3OC-P`U@ (1 U -P0 PP0 0T2`p܀*0 L@D0T@S   8L4H$0/d@ A! a,3 l1 ~0S   x0P00`0@T Ѝ(pf_Q0fj(~@(}(~l(L 0S/A-@p da Al a3`Q0 000SR P00@00 0` PЍ(}((L(P@-0P@T@T^d pA `anj3ƌ` VW @ 0 0 0P0@0@00 Ѝ( (}fp@-`P@XMX  3 `P @%XЍp @-Q  D  DH0@S X00S LP004^,P00(}f/+ffp@-<`# $  $0 \# 4$$ 0<$( 8D$ @HL$C0 5L5s0P500ߍTf(}g!(H(~l0 \P/Q/ Lœ4|    ,PŒPŃ ,6TPH40S/<$0G-4DP,4$ 40S2 40S. T0SD #3 `3R0B-R? +S*3`30S 80P 0U`dSTSנPsѠPUU00Q A2P 0S ?/@+岠ᰠP`"hR0"00S8 pr003Pb0S* xZ0S* 0R0E>0*X4 2p510S v0 00SN[P10S {N 1TQ d1*kX1`H10S I0 0H10S <YN (1P 0*I0`00S '0t 000S d0P`N 0U{ 0G(d(~t(L(P(~@(T(~(}g[(\(}(p(~h(~l((( ggy((;qg;((~g(X(~g(}(hO-@PMp8 R3B\? 02 ? Q00PaV`` 0[ΑYP l"0\P  0@" 40/ ~0 A0 2 r0S0a Sa 0!S 3S H0? 0!0! !0!S`0 0 0` Td!Ϡ 0 8 L3R 24  B # R#  B ` 0Q" @*c0`0S `A ` `Ѝ0jS  $  B$ $ R $  B (}(~((<T(((H(~l UW~(~(~@(~hA-Pph0``ATR 㵜@P<u0S @ Q/1p0A(th$80 0 1S/ 0S/(td0 5 /L0P 3 SP 3:.  SR///(}F^QO-0(,P0p4@8`@ P P0P` 0S 0 S   0  0000 S 0 S H0 w0    (~((xQ/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐp 0` RP/! 0p P  C1p  1p @- `h@0` RpP@o/ 10#/C!000P/@- lh@0` R  /  /C! C!/! !/@- |h@0` Rxl  /  /C! C!/! !/@- h@G-@$ uQql#`h RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP deP`T `qP P8  ,ip .0S  Kߍ<08 0(0`0,0 000040!04 04$0D0(0P W[  @pU p:p* d'`冋` 8 4- <q 0q $q q  q 0,0q0 q - p 4`?`a8StPb 0  00*0P0  0 *0 h\@dAdehs@dzhGhhhhhhhA-PMPp`;@ p@P  P03PXU 02 " ݍG-`MMP@p`匷PR0 `: SW/00P  rR -00A 0C @L#@ V& 0S UP0P`弐0QPPJ0: S,^0"X@PTP&P5 (P  -PP @v3M`@ S @ Sŵ@P3PZ εP Po UE f-嬵@0 S R UGPXt5p1 "PU00`P00D!┻ ⇵@P2  PG-0SᏵ`X PP~0 ۶PP W80% ܍Ѝ胛mꁛPUy eyUu 嘶TqU 呶GG FG F@F00S/p/(~l00S/0/(~lO-pT1PL1@00ʟ 0B& X 3#ˠ121` S`0 4&Q䐟a00!R00S 9I% 0 %#s(0! RXh000R T00 pp8P,0(v(}(i:(}al(tiPV(~t 00S/(~lO-,Mp0`@Pᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S 000/%$ P0 0 0 410S t F$0 S0   /000P+ 0(P0$00 00{0$ 0 { 0  0S     `@`00S B(}[a[\(vj0(}LjSKjsjjHj(~lF^^Fj(~tH(\((Dkalk0VO-1APQ P1a`3$MS0_ 1P11r00`g00 0p000P0@T <UPXpXT 000/ 0cP'0Ġ[@  0S NE  OP PD0$ЍB(}[a[\(v(~(xj+kK(}kk(~tp@-P0 % .  @Q 0S pP# #30l0# #:>00@0SpP p(}F^(}kQ^kkR/ G-P $` 0p!V@`0 !@`` V`@&!D( `G-@P4S p`&X30剑zuP| | 0 0! ##P 0p`/Ѝ_ uP : F^ :^Fp@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@40P/ Q\/O-P5>UM 1!O%0@`Spp$`J0 U  0 0n7Π ^ÌVQ 0V>   P" G Pa b72 R0 V1Q0V"   P 0$P ` U `P`PЍk  Jl0A-1àQ`P x0x xx$0@Sp$P࠱ ` p@QL ࠁ PQ k  }lp@-@PaSl0l ll$0C800S   0冕0080P4 PR*Sp0 l9 ' ,llO 2,0S/`0@-0@  L{C,d0,0080S 0  $0@T(lflO ; l,0@-S ,0, ,,$@TP @@=l N lO--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00PN U0#03?W[[US㯒 @0P$0,5Q $4O0$0 9D 0XR @"!H08pp(0

qqmqO-P-@p`,M,$P Ῐp($0S0$020S'$p; P V 001 0P0Nd0 ; /fP AP PP \pP$p,Ѝ`P0 `P , ?o  0S0 00 ` p 0Ppq 0p U,p`r&2rr r1UrCG-@pP` &p`:D10S:  p o09 6X $$ }p+ P%W00S $$ smp YPPU `fV rV GTP$$ W Qp$lY&2rkrrr $rݰp/0/ @- o A-@P`pPZ hhή XU  AD<î4G  廮 Ap6&9@- 0R0Ѝp` P@%p0Q  R SR  R $$00BR R zP0 -O (P/00#s01"$# 8O-`p  @W@ @T  WP00 Ѝpꄀn>6 \  dp7 P Q*" ?    PQ* @ P*Q*? #? O-@`P0LLp@P T \0᳠ 0S@P 0S@P 0S@ 0PP 0T# ?@TSU:[*%@@6 p0 7 0Pu R0Q @@ 0B R ! 3O'G-(`$p@tPP 0㘤I$0 0P Q ἌPЍ 倦PC-(p$$ 啒S%p@ 0 `P Q Ѝ FP404-@-0  Ѝ Ѝ/-@-00@孎 0 Ѝ@ Ѝ/-@-P 4(婬  aЍ Ѝ/6O-MP`p@P(Ѝ *0PW0 SP 4S  07P@T=$Q 0MP 0S 4S 0 40XS$ R 0  RG20 0 !|0`!u0 0 0  @ 0P 0  Pw < t0T됩'P*w`s`4`VS ڴ 0e ` -\0  p`P@ 00PY: r"s s.sRsysus/+sO-,MX`\@P$_ 3R 4S 0^,Ѝ0 P P0   RSRQ" "S 0 d000 00 @0 QP,4S0 S: 00 000 @0 10P 0 oO0@$00SS P %XPp'xp   0(X$0@S4S 0g$R  pP[0 RS  0   pPN P0P 00000 0 P(p6rUssssttt1G-`pHMP_@P(Š@TC^t# E@0$4$ 0840 ;p+kp Rf⩥p H4$$: S R B.\ ❥pL $4S@ ($,40-B.( ⍥p E0"dR04<($$4,4$t0K>Ѐ 0 ,0E  00`d$t؀E0 PQ0`0 Dw4S  0  Pp 0p 0 p pmp| p0 ppt P AP 0 0 SPp5:Ѝ0Z hpW"tatvu\t@dtt@dtttuu3@-@P 4B BRP p 84  'Ѝ@耣Ѝ@duiu@-@Pp P P4PS 4 uuv A- @PPvTr 0pl`X` gcp0 pv:vP$$ @-@@T@RT ńCs9 #600<0$0@000< 0 0 @-T$0    O-`P@p M6~`6P̀PP `00000ߩ따 V:Ѝ 1 00 0P0Ω`P1 0 0ĩP UP < vhQ0vr&9v=C$4 A@-Q@- `S@l)ЍpP P < 0R00  -OvvvO-P_o 0R0`@tMR(0S00S $ 0R0oU tЍP PU 0SIpWF (0WSB 0RSR8$ 0R SR.pG-0[ KP# 9/p  9/p 40 P m0 $8  P P  P vA-@pP`sP 5/p 4 5/p 4 zvC-(00PS4pR Ѝ$d@ 0 0 0d`> 00  0 `WP vww@O-0 0Php@᐀删T Ѝ` KP `V Hp  0 D@-O5 8wtA-P@$`$p0 @ⵧT 8wO-Pp$M `@Ȁb뼰0     Q $  x0 p `p X0 X p`"00P0   $ЍQ0 8 wO-PQ@04 p 00` ЍP P(U0 E `P0  t  0 4   04 p #00 #p  kwwww0s@-SX`@ PKh0 ?o2R0S  <Ѝp-Ov@- iR sR aR p`  xp@-P@P (`Pp p-Ox8p@-@T 40`PPpp-OxSiR@-- 0 aR bR LR( sR% tR@sP 0P0S`00p`(j0 xw-Oxep@-@ M\P`းP0 0͵0,e0S _ ЍpQ0xԍG-Q@PM Q  |ЍA~␀ p$τ`P pxhB~0 00 ` 0PP axIxxO-$M@p;P tB p $Ѝ-PP0  0 7 0` H0$0V!<#P0*fQ P`0 0?V `S 0S PV0P `E0t PU0 op $PP< 000 00 `P s 4! `00004 40W0000S0 8pu $$5 3 M0KH R*F0P01 T0P=Z-:L0SX 0 pO L004 0 00P0!9P= 4$$   4 P44- p〰% xyy8yVypy"y10S 0@-@C^M E$E$4 0 24P2Ѝ0 @1q !}0 pw0 \zX 80 DP<1&2 zzz{ {{6{T{hO{{{0$ 8fO-`DMPp4 2<0 [p 0S8 ! R4!DЍLRd a0BS)S&``4`H``D10S  0P U@P   7C@ Pట 5 T  0 厤0@  T @0  @P@p{{&2,-O<: &8xS{A-p`(P@P0 p!`P @00 0$0@-@P$0S @ރO-pP 0 `0Q 0`0P0@SP 8@4(P<Ѝ|^| |E|||OO-4Md@`P 0\0T$00X,% 0  0 0 0 04 0  0$ 0 $0 0 4 $0,0tWH 0Sg   R  _ = R  X 00S(00 0( `S$0 0 $0V0EV0B$00$` T0  0 0dP  ( 0,0     ` p4ЍT0 0 (0 0 (00 0 `0 0w `V00V(00ppO-M8pP <EJ`@QU`@0S @ `00 0 0 0 0000SpQ `@Ѝ 0 4 X 0ZX X0 0 @X` 0  @S` @@`000Sp `  0 @ ` 0 @T` T#U` @ Q 0S P ZUpP 0S 0 SU Q 0T P fP00  T 00S0p` @k}}}?}`|}z}}P/0S//P/0P/A-AP  `pSP  0@W S Q@-@,MP@p`ZP8,Ѝ $ p`&P |x@-X@ P HHH0H)@@|@@8P8`@ T < ~~~~&9~ IR R R @-@R R/////Xp/0/ Rp@-0@P! R!0DDDDDD RD(DDDDDDDD pp B R"Sh 1@\ \媠T0 L8 pppppppp tw(|O-0M `@P "PЍ"0PP ᖀ8PP( p0Y:4S 0t $4z 8PLgY:kP `PP04S ڠ0"S1@ -0   <03/p! 8 H0 ;0(8$W 0P  0S  0(0 QPEpVEW tw(O-0P`p4M8,0  މp@30S,`;^P 0! b pT AT fT @4ЍsT0 0,p00 00@!pq 4 `0}p0 00$04S 0Q41!0 6 R? 2R502F. YpWp Vp 0oo`@ !Lp@ R@ R0R R 0S 0S0  00` 0` 8 H00  $F C0 Q`F&2  t58Xjw(\NA-@ĔQP MP  An``llph`p>P LЍ^p ( 0 IG-@Pp* U$4 d& A~ĐĀ p$$  0 P`` 1L0#p  H= 0`$0B~ 0 KI Q O-M@`Ph  4PS 4S ЍtW P tWnP 0 Z 05PQ  WFU 4S 0dp pP30   0 yPP , ?o  0p0 00 PWpU 0V p 4S 4S 0 P ,Cvrr1UrC@- &t " IhA-HM@Pp4 x `41 0S1D0 p T  P 00S0 liR TR a0BLR lR s0BST mpLlHЍT4p &2d 4I0 Q /0@-$M` 0 0@P!!`q ፁp#0S00 P 0SB0S? P\^; 0T 00S! 0 `*a@ P TtppT T   $Ѝ&2 HIp/-0,M$00 0 00 00 00 00 0 00000000 ,Ѝ+/0 1@-  RC-@MP1`  000sS 0lSp` P$0㓆( p lp P 0㓗) p ЍpW`Vp \C-`P؀C$TP W ЍPP WPl|:Pyc0Ph0 `aPT00 $4VP,8la`P aP 8 VP$l8 #HP $8 ; pQ< pIP <X8 P < hwPs0 Q00000[00$0000S 000(0aP a0P,0 jPP ؈ؘبm`P m$qPP0L< mIP <hP hP H GPn DP GPh L0 SH00T0 RP0( 0`0 pq 0S$$03"ypq 0`~3$4P p`$$($4P` V<a`P! , aP d' aP j0P$0+800 $l`P$l&? `0 6pqx AGP 4xo h KGP  P DGP 8 =GP    6GP   /GP   (GP q !GP   GP q/  GP q?Kr?t 40 GP r?1S 0Rr/0s/0{0r?0,s?xr?  FP s/ FP sa$$g$4Pk,aiPc k`P k$4` 0pq\8 x8D 4HPR DxP D p D $HPB DPH FP7 2 (FP. ) dFP% D DGP $ D(@ TFP @ Y* 0C$ Bx $ P$$03`"pq$ ؊X$ t0P"]  $p ( 8X0$08$Y1T0P mR\XhM` $4pq|_$$唊$4Pp`\K0$$;`"pq@$$u$4P `<&2 -O,5O oX; &u^r"yEU  'iFe2"Po0@-@M P  N 0 0S[p< <奸 4寋p$坸0Ѝ0 8i'@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`px tD Sߍ@iii!@-@  b Ѝ10S/p@-!MPM@P% PA. (01P A!A(P7 0`0?oS c`1 06P- 0H,0 0A. 00P0P A A 0  ԨލЍp`0 0A. 00PH0fP A4 4A@Џv`(/(pQ0 9s@-6PP 巷P 尷 -`@T9!ЍpP  00SRV   Q@ FC0 R !O-M@ Pxp.p"x`P"  *  &]P- ta]P:]pP hapx]P aa \CP 0"h 0R00  p!  CPr 0SohQl @ 4pal 2a! R R RZ  0PW l Z XX (s<W 0j0S, @ hP@ `pd HQ L 40R !?;01Sp0S 3/p\ U 8 Xىp \ [ 5@ `̉p Ѝ PC QYc/+rA-p\@P@\PP\2^(] PSghP]P vh`Pvh@- DP Ѝ `A-MP paC@P00 p`ЍpP w 0 gp 1  0Dji@-@p @A-P`\pP00>`P@?0A`  F=A-P`\pP}00 `P@:t?0#` n F@-( BP^00 Ѝyp@-8M@ PBP 1 ! K\P _  Q0s0S00_PP  \@fDp d  i_< Pu\`ofV8Ѝp 'k `i0@-@BM M  <p 0S 7  /  (ⅤP(@0S700$0/ (d wdP(@0S Bލ Ѝ0ui@ma@iUj0@-MP[@P a_P Vl0l lYc_ 0 0S ,p>Ѝ0z mԀi@-@M  D pЍi@-M @APC0 x p 1Q0r R0s04 1p`Ѝ 'k (iis@-`Pp@ @@AP0 I@Ph۴^ P@ LҴ@[P 4 lЍp 'k 3 2QL7@- P@:pT T岴L[ P@00 <<0400b[@ Ѝ0 BcdnQ 7@- P@p\ \勴0H~@Z P40 009[@ Ѝ0 QcxYnp@-M`ZP0P0Ѝpe^P@Uxi@PdT0 D(p<C8 P@ PP lxi@-$MpZP00$Ѝ0^`i@Pp 0 XpLP@ P`@ p$ k߀i@-C Ѝ"Q00@-M00 0  Pp `Oi@Pݳ ` @pp P0 `pR00bS ㇋kuU ᾋP ix*P/+s@-@`+PP  .p 妳m0Pip@-` MP@YP ] Ѝp P)    .]  P:Z@4dD iv0@-,M@ P@P0 i p,Ѝ0 R0 s0S 0  "\PP  (Z@cDy 'k `fp@-P,p@`@@YPH0H HH,7]Q P jpn j @-T @?Pi00Ѝ  p  j t/+@-@-M T@?PD0D DD08 0 p$jЍ [c 'k Ҁi@-M T@{?PD0D DD08 0` p$jЍ ^! 'k Ҁi0-M $00J P  売Ѝ䀐i@-@0X P$0$ $$RY@dn Q00@ P/a CRWC/A CR=C/@-00@- M@ 0( 0 pc Ѝi@-PM `@@ft{G 8 8 IЍ$$= ?Q0"¿@-t@WPP /mpPL``P00 00ъt0@`Vm`` PT0d0X @ @@@@彊b㵇03/` %Q0&9////0 L0L0/%0 T0T0/%0 \0\0/%0 D0D0/%0 d00d0/%p@-@pbP 00p00D S 0A0CS 0$P>P 0@p%@-p0( 0`P/ R/%0 O-4M@@!2T0-  DPCpğou(p"WD@P`T `P 1sexT6| P`P`@ p00KTp R  P Q R07 0TS $P\(P  1/P @0S  p 0$ SR(0S` \ 2/P X0 [  ᲆ(0;>O-MMPp  X p`$ pP$ 1  $幡-ӈ d ׃ph Wt ʃp Q X巈 s8 p$0Q 姈$_ X@T 0X00@0 0埃P厈@U 0 0 ,0@4@刃p 0e0Pl0q 0X 40,@ypDg 4<g(h0H0S 'P31XH0S=I0S:Z`@T 0 3/@: " 3렒M0S:00 % p"&pM0S  '@ @03/@r J⥜I0J/pNI 1Ra`"%J` 1 0 d1 T|p 1 d\!1 Hڇ`@#%Js!1 @ t1 x!|1  wP@Tf 03/@ 03/ݍЍ Tbii~ %ii ( (!iH bL*3=H`kO-@PpP  p tT U@UPT!`DU`P \]PPU D1O0S ` `W P.Z  P' =P! K0S 0 L0S 0M0S 0 N0SO0`S PPV ̆ &i u( `&90@-,MP@vpP YUP`(  pH0S h HI;P00< <خ0 $ʮ,ЍG(t(i8 @-P@ė0 P嶮G-@UPP0 `@ Y㔀XpXᕡPP  8pp H H@@@Rf@ ]w 32(ts@-@{T@P00ЍpXPuXa@P <` 8P%fu ;(ts@-@QT@P|0| |OZXPLX8@P T` Peu( iЍpQ ]w @(tA-@"TPP0 `@)XXPPp ėp< >FJN@٭ ]w L(tF@-@ \:PP0P PPL 0 S@@00 >00ЍN 'k U(t$&9X0@-M@(TP#TP TPpTP d0P P P P 4PGp 堭Ѝ0٭Q;(ti7s@-@寖h呅 ՖP L剅HPH` P! ,~Ѝpy@/+ *5G-M`@PK _ppP"^(  o   _p% (a( px" <@T t8P?l2P\8 UR TЍ0 PtGc@P $@$p t 0R k) 㾄` `ptQp R%P\ 㬄mLP;ЍGdQ\ 0Q    1 0PфP0 RSĕ ῄ # x0` R P U 0pD` P\\\G 8(i8i d  14 HQ0 * $Pp@-P`@6RP V  BS`P ;]`8] 00p#RTp*]A-@T 00`PpW0 p `@@-MPP00Ѝ`0 00p0@ 0 P U0P 0 p 0 `P0G-@(P|00!`( p Q1r0P*0X 0U0$ 0R0 ]"0Z0"SЍD0PN 0 , Yp 0 @0@-@P \@ O-`@pP,(0V0S 82aP$P$P 40S 04S 0S(0p(`8P0S$0(PbcO-M00 X$000Ѝ 0Q`?  0Q> 00 -8PP; XᖞpP ,,pC,4@[T /@P00 Ds0800 0STz 2PP]0"8!10#R0 0l8[ubP Z@  0YPH@T 0CS 0 0r xC0X0^ :T 0CS wR0xL  @0aD\W@DAD\ 7@Dt@S 2s0@0t@0@Dt@ T130T@'bTp t] QP[@ H[0 0 0`0y5 =1 2LA-X Pp@`,P00U?0P 0 p 0 `P0O-P`$M@ Hp#X8 P W0  pPp` 0p0  0 O0 A-`p$P@_P0`0P 0@ A-`p@P_P0` P@ A-@p`PPPU0S0P`^0PPP ! P000S0P`A-`(pP_@P @0 00  0pP`@ C-P,`pj_P X0 (0$ (0,0 0(000@p` Ѝ O-pP`@M8U[ DB! R:  p DB!U R:@DDA< @Ѝ  0 000Gߍ@QPQ 0@R |ƧF/  R ## R # 0[p _ ہiJ&9 A-@0%M0F/S p p<8 6p- 9`@08p`N/8S^`` Ppx0 pdP,00L0P,00T0(`$0N/e%ݍ(piK =1X @-p S耐iIrp@-d`dP0S s@ Ppx zp@@pP@@%@(O-+PZ` 00S<1 000xSP p1 @T Y  P0 P `GR B`Z     BAP W:h W`%*0@D@PW@DB0LWLt@| @t@@P&@P&@TQA-@P00S 00QQ0s0S Att~p0 000xSX~`PpV~`   @0&@TT&@P1np@-P M@ U U( 00P Ѝp 0TPTT@ !!0P!!`[PP  @ 0A-p`Pp@ @P(L ߒ AQyGp@-@P`M  N `ЍpG-SMMPPx!x'ppX!\ Ep@!H F/+ $@TSލЍw`P 0S0 S 0Y9(00 1 ,0xp]@(0#70St0 00#00`X0`M/dP41S 80X4M/,} Ci(pVp@-`M@jp 0+SЍp宥P    ; R # <xp 01S 0/S ]דi  00S/@-@}(/A-P@`TpP @ 0SP l&9'A-P@p l`PW\G TPH0 000  (p`Ku&@Ti:@- M @pd d' X1P~00 Ѝ0, 1p nzi9@-(M @p  \3PU00(Ѝ 00S H 1P 02 , pؤ zi9@- np 0QSЍS   |/0` 3?S $S DDD S/8 S 00,/(/$/PPPP0t 3?S $S $S LLL S/@ S 884/0/,/(/O-X`@p1!0R  P A^QT X PPD@YZX80PE00O5 D ]JP1n@- M @pl)d }0PT0T TT#0H 0p@@, \ Ѝi 'k XiC@-@(M!  0P p< <4 p(Ѝ Ou gSie@- M t@0Pq`0` `\ spL 0@ 0jp,ã Ѝt 'k qiiCA-M< Pp!夣0@P "` # 0(0xp0@`@$`<0\PT100 0(000804 /p'凣  !P@0 @   :R@p00CȀ0 0p0 6P00ݍ@ T0S lP@ 0@P0  S  0 8i&@T50@-0Mx @ pd d's0PP  041p 0Ѝ} i&9A-@BM`(  dpP 0 P P PP  8 ! ll pz l RբzlmU#0P 6qp 6S30S z0lP 6_p 6S\L30S Hz 0$P 6Mp  3Q?zI0P 6?p 2Q8z8  /p 0S0 Ez8 $pu p | p 0@ `PpP2Q HhzBߍ20S ,`z10S Yz Vz0  `0000pBzPU0``0` Rڬ1000 0:S R TPD z`p0PQ zV pWP ,y; zH0S Lz y~y! !ry`0Q y y(i8ii(( )$8iiii \-4g&@T<@Lrfp0@-@Py/+nO-PMM@ 4\0L00h4 T4PL24'S$0P0@ 0 0 @PE( 0RtP 0S0'U 09 0909 09帰090909y(@!!0 P q0 /C BRZ      -BX9$ B2"! 0P PE ^r PE0y900IppcppCppPpp Spp@BppA`8 0PP0` x!0tX@"0(0(0S@ ox0$ 0B'S$0؍Ѝ 0 0 (S   BS>C0C''S Q:ǟ"!! CR   ##9C0C<"!% 'S>C'>C2"" N=C0C Q 0*S ;S. RU 0C'S񟗸;h;;;|;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;S66x4644472S# St 0S R S8Z 4&S0U 0R  t t0x0( 0 B( @U0S 0S `pw븅帕帥pW>w 0R 0w`|0Sl w0S `p0H00 <w45H3,,娀XP0  @ wp` w0S Z0$3?S Z^0S  -Pw0S xqw`w`ov`pDW1qv `pov`J, zX4,003c1s0Sa|qqww ,, iw3pGx#0P# P# ß P# hTw`HH#S0S TGw0S0  8@w+S :w0S#  4ws匢 `0VV /r  !"   0wV" w0S Hqww0 w` pov`X1pwp 0J,0Y 20, `&#Squ ,Q, v1H!0P! P|! x Pt! TvLI  plhd`\XTPLHD@P4iP Bk((( $<A/+`KQ05 P$)P0 *2P<AZ h #,3Gp@-P M@` eQP0 aPp@@:V Ѝpi@-< @*P$0$ $6 Ѝ 'k @-< @z*P$0$ $  Ѝ 'k 0@-MP "Mp@PۍЍ0@U P+ oP@UۍЍ0@o0S0S1iS0@-M TPp@@UЍ01 ȝz@i@-T @e*P@0@ @@I \p 屝Ѝ/ 'k A@-T @G*PM<0< <  >p哝Ѝ X 'k 3 0 /%\/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  lWhW ЍЍ/@-@UW7jp 0S/@-(-@-  LWHW! ЍЍ/-@-  >W:W ЍЍ/@-\00S 0  0000 0 ]VpЍ(@-@nHnnp0pp p@-pMPP2 P0S 0@P 0 0 00 0XVp DlP@@ ((@,P0P4P8P

S}00!031 0@-Mt 0PU@P \ sQLPP @ (@@ 0=UP 020Ѝ0%`(  @-*@0P ,t  tq&9DIP@-d0 !T| T@0!6q0\ (0000/ P@-`0` X| TD0!6q0\ ,00 00/ P-4s00#p^0<\ 0000/ P 4ps00#\,s0P00/00 PH- 0:# ^4 0P$0000/ PH- 09# ^4 0P$0000/ P 4 <# \,4P00/00 P- 0:# ^ 0P0P@d|0:0# PDD#^<s0\ ,00$00  @- 0 00pP ЍG(%hA-PJp`@WЍ )P #3MP@ p7@-P@U0  (dR Ѝ0bzA-0@nS0oSp@ pTP``TPGR0nS0oSSPPSPP'5@-0 sp&9O-MM`<(0p2pP^`0 e! 01P01 0S} Zqqp@0 pqT rq0Sm ꨐ  P 0000Z  0P0 P44 0S܍Ѝ40 0 q3}pi P0##4q0ISʉ ᇆ`P0 0!-PB0p p=0 P0 0 00@v0S,kp >Q0SZHpp P X PPZM$0Sh poQQX PP0S 1lZ ,jj0kp<Q8B8b8r4000 pnX0S  P0SL0S40 P <8@80@D0j  ,fjP(0T0(00 ZLꃎ0 0D@00 l0(hp60S SH /O 00,00 引rk ^p@-@PᇫP (岕0/Sp/p@/`u@- TnNk&9O-p0000@P`ᜐ (,唰00 Wp0@DTq oP0 P P<s9 O4&2-O-Ou @-M@A>0 0D@00 l0gp0S SH :O 00,00 4j 'p@-@PP (*0/Spt/p@p/`u@-  $ j&99O-`0@P(,p娐娠娰0 Vp00@DT oP0 PP{  jA+Ou-O &2@-MM0An H 0P0 $@gp Ɣujmp@-@P፪P (帔0/Sp/p@.`u@- ZmTjz&9O-P@M P0`r"$Vp)20 R. +x   &  x `!p 0 *00)0`VpPgpz `uPfPMP9 9P$ GP g@Pee<e<e<e<eee<f$e<e<e<efTeUP|0 0|00|0|00|00|00pt`x0 ~P~~*Pyfp Z,0p0Y00t0V0;;0x0UKXg$00|00|000ЍY00t0-O&2^ ¼-MMJNP0 @P300 x0fp0 \Ǔ0 0N/ 8 ោ000 0@(kbi 7@-@P L0Lo SϜ 0 咓 Ѝ08@-@y@0P@B@-@A0P@@-@ TL0S 00S0?  fЍJp@-@P5P (`0/Sp-p@-`u@-H.@-40 0,0,0(0(0$00 0kh&9J7@-P @ LP00S\ 0  Ѝ0/p@-@ PX0 *0(p1PP( Php@J(nO-@H p H 8Q444f Tp60pGWQq 2@FPl\l8kkkkkkkkkkkkklkllkkkkm(kkjkkkokpkpPpkkpkkkkkkkkllllkkmkmDkkmPkkm\pl8p(pDp\pkpxp40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P04P 0I 0(80@008 0|PPC0       +  @   ' B ,# R#  # R" , @ ( "  )            <|20  x4|0$000 T*|0 000 0 |0$800  |0<:00  |08:00 |0@900 {0,000 |{0000001|0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+0)40 E Ѝ%%@-O&2(,($(0 d1(( @&QW`jt%DA-RMMI>0PC@P@(0L AH`q儁( `L0cp0KSh0  R < (Lh0r+&f0 ( h0N/@  PP ` p,P.`0TP P T0h0\ $00X 00@00\0|00x00t0 0p00l00d0hRݍЍ }($ p@-@PᡦP (̐0/Sp+p@+`u R R @-寐/0@-@MP`p 0Sb000 cPPЍ0P0 0 0Qc0 3b0P ؃s@-0`08/00@P  bP0 VЍps@-`P@00!  PT0 0R0S PU @@ 0JhЍp( (002P0/0S" -CM001010 000000 0 0P J, (hzH00Cߍo/ O-MpP8@@`p+ p D0 $00 00<0040D0(P080,0|0PF0<0lP<0< Dp P;H00Ѝ0S R@ g(ts  O-$MP 0Gp@` PPW V0<00$Ѝ 03/ Y0p P$ 0P-: Pp ` @P LH03/pPG0 0Q pW@ P  ӂyGQ Q Pp `0  ig A-PMM`p/oO P@1L# N4AD0@@ 0@00 0p@/pߍPHڀ@T ,(G-P[ 0M@@0P` :0P`P_)U  00X 0 P  8J)0, 0pp00S0 W0S00S0 p p`  oP 00P0S`0vD0D00W 0 0000P0P0Ѝ 000<0(8 }e(--0M 00H0 @P (嘎l zg Ѝ@- Cɷ->C?Xḷ9>:>C᳷?n:>CF᮷ 0? AC>᥷}C>GᠷmF᜷EnFᘷE~GX J.X R  $$((,S>,t}S>GomFkHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqx1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R, 2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+g000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  B PP1+\#0A0 0 00L B 00 00 00000u0#$ 0 &C',"'("&8'$"2&,&42r"bJ 40ЍG0S/!  O-,Mp0`PTXP $ $$ 0P. @T 0 AbP BPG@U   P @ @ @ @g@p \0TU @ T0 0D dS1R q"P  T8 DR0UQUDTP 0  @@@0X R    0;$Z0 p00 S   T-$,Ѝ0 00 $ʉ0 (8F@-@ PU xxrbpp0h`SPP\@Lp0S__D0D,_b  Xb@(8y&9S 000S/@-C_(80/s@-P0@0S 00S Ѝp@0001!Ѝp@Il0`1#ā0P0?V XC 0$aa"_Ѝp(<(H(P(()R/Ҵs@-@00S#000S 0 Ѝp@?.ă\0P`?V "C 0$+a$^Ѝp(H(P(<((OA-Po10MSP8MU`aO0@OS@ 0 402#0, p!?P0< ??. U00S1UN@c@Dܗ 0ݍ8ЍAї0*Gx0 R `\ : V 001帗0*jݍ8Ѝ(H((P( hO-C ` d 0A axS0 <0S  0Ds0S 8n0  B  R\ ?0!.0S   d 0A a 0< 0$ R$  B ,0X0: 0P[` p 0ἠ/<#\P2[ 0  ?>#‚ 0Px0 `0報 C c à01d0 P CS cQ0@D@ @00C030S300C00  0#0030 #300020SNd 0A0 a/5 0 ST0T00  B 0Pu SX00԰W,ڨ0d0? 0 0A0 a5 /0 zϠ Ϡ,,3 0iϠ ,0/a00C000 \qS T10S   d 0A a 0<'0! 20Z%_V40A_8 0 B0 080 $0C  $@$  $ 40040 08 R R` /  1> ( ((D Uv&9%HBp@-P   @ @00Sp0?0 00Sp0?0p(D%Hd0p@-0@SklP 00000B0F0p(O-MMℵp,@ `51n_R0PPCSyq451XX@ ?F 0SB ?2?F4$Q/NFp؍ߍ @D@Œ@2L 0@?DKd04 0BT0 0 SC0ISyq$41XIX@/0p22220B'oF0k?0 0 40 @DŒ@ @0L0 @?DdK40 0L l104 @0#p R0Cs000 2s00`Xp`20S7w 2࢟ 0 000p0u   `  Z XZ0 ``a ,! 2\0Q0@/,040<010(08? 0$UQ `@0 0D@ő L00 /4;0WW 0@d0 0o 0  1r 0aW Wp`| 0"/\0X0`0d01{0?{{{{(0, ` D@őL0 0/4;$!WTW 0 dhl 0A a 0<%H(<(A%%(|(DTO--)MM,0=0?0(8$0PWD0D`0S> 80pW:,0 0  0 Z(<(P(H((P@P`P @4  P@  4p.W 3E p@ d3T@  >SPp *= >P tC(30S0,5 Sx0<0(5002 0,%S0022Q04\e 0Q[]xx" 0 04 0A X[O 040A 8[F 0 4Q[= 00 Q*[4 00Q([+ 004 Q["1 p00W00G-\3Sr1\s垒XX\1X0SH[ X0SS0$50 40bH00aL00BϠ<50A8ŀϠ@ŀD50\P00\T0R380^S`R001q[ p4_P 0d0 a 31 Q$ ((%L%P`(\(h=h“(`(@(ETy(pä(%H'T(l%T(X(d(x0RC00#!3x000<44$0<0t D0p@p0|00pXsL5P5 P4H 0/8@`D0/ p?`)vt00F,o! L ϧ !>  <4 04%8$SZ+22 p<4800x 0 08`S¯PN @P@0? 0 0P@bQQ* 0 /a@QP(5#R0:pP@0$- 00Z00 1`%"0 ?001>0Z`0 c2# S,[!Q [300 !1 00^00CC Q`0?#"4 0/V`1V`#T0`10F 0I  0/ B@TP 0ἐ둈! 00B1  BZ1 ` Y"B !!0 R0C1I C0/ 0`둈!0  B!Zӡ!` S1B0 S Y@u @P`x1 F0<48ĔCP`0S8Ą<4-0$5BPS,`QɑRBDL0 0 0000|60S|0` ?H4L04P@0 @6Zp;' qTKp00R  QDiP7\5?>C00!#4t x0Yt7 8!"T a31< A202!0 0P@ 04 ` [ 0L$4  E$ ( B, D%LV.  R*h 0(b < <( X D( \ L( ?.@Xd@+@B@A.@B -< He `x @40K `0 ,p B A YZQ !0 XZ R  ŵ{A/ 8pW $?. t{ 0Ąß Rï<0\@D$44 0L4( 0ĀpH2 R 5#< 5,23lr0S*됺 z'z'zz {' 000d0 CSQ c6Rc(;R`X @ z犸 z'(Ȋ0 (08倏;R,tX 0  R0:1P000\tP2#00@Q@0 08p00 R008&$0 n0Sc@ SPX QQ0 뀠@t9 j0JF 0ssK0`0S>(|F^7(R ʰ(j&8@th&90Ė(T(@ UQ0 1T(H(< (%H$(D(L 8(P `00S^ 0 #$A $0+V. N00S  0=S,0S$0S0$0! , 0 B2\,,^   00/d A! a,3 1 !RW$1H ppRPP04SP0 0R0 S00C0 S 0,0u0P0B 0,0ST p开<ȿ 0ᘥ+" 8 Q \%p#R!0@ (0 0 @DU`@4AX20 @R40 `0```0T00*(s 0 ^` pL3$,X0`0 I9pQ㸐 P#(x0t0 Sx0x0 B\0X1`01Q0C00h0`0lR#00B1 d0R*,%u U0   (0 0C0D(0( 0 R R` ` + 0$5S  l01` p0000S3d0%ST0T00! !04%SP5X0`0`P5S00d0 01 .   (0000080` q@Q ㏍+H0H (qP+H ~H000-ᴰR㰱 ,  BU 00q0000T0 10X0岑0; R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS ~T00C@ 0`w`d4  80Q~T:  $5SʨG $`$`(0wV0S ,4  d,04  0,4 $ 00`  Vj\0S   0帀0 X#` x0x 0X\%Ϡ  R     d 0L  l!1v L9\%R Xi0SP.pi\`/ `ƌ$  $ m0`S` 0$5S  l01` 0000S1do04*ST0T00! !0X*SP5X  ``S 0d먐     0E00080@&0C 400400T%*$ Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Rxl倐H)rP00@8p`0x1@pY70IX!@@Xl00@0T: 0 @%A$\Q  @08( 0 0( Od@ 0LLC l 01sp0SH=0S0 000S.tT08C|M = R0/5,\%R    0 d0/ @ `.3,0 $ T0000S0S 0,00C0S0 X>0S lyT0S 2T>0S 0^ %T00|:x*,8gP>0ScN C>`>?.0S003040 4004 pCVW*D4|V.P\oV.GVG0S  ?0 PS?\5=S,3??^0E/0 0S 04  dHLĒ 0A a04 <,$0S0S 04 d ,04 0N 04N)ݍЍSmfG-`RM@Xr |PP d{P`T `P P8  ,Np 0S  3ߍ<08 0(0`0,0 000040!04 04$0D0(0P W,W[  NpU pNp* d{`!` 8  <+ 0] $Y U  Q 0,0K0 G q CNp 4`?`a8SmPb 0  00*0P0 i 0 *0 h\@dAdehs@dzhGhhhhhhhA-PMPp`;@ lp@P  P03PLU 02 " ݍp@-@P̐P (z0/SpAp@=`uR/fG-P $` 0pᚽV@`0 㓽@`` V`@&!D( `G-@P4S p`X30剑zuP| | 0 0! ##P 0p`/Ѝ_ uP : F^ :^Fp@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@O-4MX0p0\00``P0 0,d, 0Q% P 0 zmQ;aQMQAQBA0|bA QD<<<<<<<<<4SQU @  DT dR$0 9QQ"P T U8$0UQUDT P 0 sQ @ @ @U  @@@ X 00 ` y0S000 00  0$04ЍF@-,@ (]RQO&9< 0/p/p@-P@    pO-@0p Pp`G0 00000ZI00SB_: W `B?F ᴐ((LP0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p(0P  C @- y co`/ |s@-@PH` 008c/V  P@yЍp(( ͂s@-@X00SPH0`ă5#40<B/V  P@xЍp((( ͇ h10 PS/C-TQ@@MPM`6`@f$q ᢼ!`0 P08 0 T:@6S/O@ $ DD6ۍЍC 0+0 R  Q\ Q 0`;Pdg 0+ۍЍ((((( ͌O-BM p`-PPp"pbx F (0<  06# R 0 "Lx0 40C 0 !8x00060 &806 0@p00C0(0&V :D!Pp``Vp պ03 r(o$6/ƺ 6   C c1 0 &$6/ᱺ `V&L0S% 0: S$0$ ` AB0d  &ЍO/6X( ,PyƗ%A-a00S FT:p)-PP  0 0A1S0Sj/ P @D A01 S  w0S @21060&=/06@p  p 00C 00( ƻO-@PGM@X2J``?P>U㰐Y  0@00D @/60d& 6F H  T4> S`$v h3 XRQ 0@H0ƺ̭0D 0 R (cR 5-0 (0尺0Dp9 ૺ0U C 0 fP0  0 00CR0 00,0   (卺pF0L0 06 0 6x< 01200UD  ,000$P`%($0\ $(p,,|<d0c0@LPI$I 0T0;0Lh5,L0Sf h,;PU OPZ   L f[ $ ' \p$  0A! \ 11 C V0E0%QPffC0CP!Pp\p : +PP0  ( 0 0d00,0\0000<402802@p$0 0Cs0<000C(00SE0S00 0  C02#' L7P pp[HPPXP 0R SHP SN`Ppb SpW0 0[ 0:[0:06\{  0(01 00 JU 06 0_6&(6Z:0USL0S d0 P V50SdpW}P0S ,L0S d0 lP$ 0D5#?o2UND&0# 0H&哕)6 B4  剸 0  h屼6\0CU 00C0CSY: B5Z! !!\0!!!0 Sr# ᓒ"!Џ 0d0$&S:06 0Ɣ t4&ah0.LxG{ 0W5# 3 ILpXm0SLf`F`VH l30S@ 8LW KD3PUL0S \0:`0!p  PP1 P# z. 37+G6|0\0000F096 30;P㠀p`Ks` Kp` z\27F\0000Ff &! 02/!"6 QP *d" P 0 |0ٻPPP!s v#)`Pw!i )P  6t!h`!PU:< &U ":0 U:Z+0 Q+0 xpL0S[] UB: A((((&S}ǧ%%( (%QNSL(h(d(x|(Ȟ7( )&8@th&90 1Q0Aʫ Xɱ< z%%A% (L((0000Z: [ I!  @0 ' 6Psyd P [ %%* 0: q0 p1Pi 1 !3P,D `U&`P1x6hq0U0 0 xi xL0S `0  1#'$/%17EE\0|000|E090& 2|0P88 ź 0 ``Ɣ2& 0x 0D?o2e#D&0#6P S2Hvb pG0 ~HDcEGߍW;0/p/p@-@P+ź  $$((,,00@@DDHHLLTT\\``dd W_ WOpp@-@P`U}zur o lif c $`$d]dhZhlWlVSPMJVpE0AVp0Sp7Sp2Sp-Sp(Sp#SpSppG-`RM@Xr qPP drqP`T `P P8  ,vDp ĺ0S  X)ߍ<08 0(0`0,0 000040!04 04$0D0(0P "W[  MDpU pGDp* d4q`` 8 A < 0  $    0,00   Cp 4`?`a8SځcPb 0  00*0P0 ^ ⥥0 *0 h\@dAdehs@dzhGhhhhhhhA-PMPp`;@ -bp@P  P03PeBU 02 " ݍ@-`p   @P00S0?0\$ 0S 0 pS\F\GL \ 8888888gL|0 SDKT ЍE%KUJ%FZO%A_0 %0@-陹P L IDD`P<@i/0R@p @X0L 0S @] @P &s0 @Oa #gPP#\#,@p AP (&WH0aS 1XL : SRQp9   ٲ@P@0j V@r@DOoB@b } |IJP pY00S  ŲP@  pẲP 3m`PUb$0 p00D0$PQ @ B80S}0t S 10S10S00S11021x0 0180SK0 RS00 R0 R0S= /jP; 0@S 00 T^Z0Si 1Sf 1Sc 0 㩰1C0S [  [ *0SR3#:\00<0S @!0S bP@ T <0 0P U8 PDJp8P@@0111e000Y0`S`St0S4X0L 0H =0 0Mp+ p`PlC0S)7p3 p1S?V?`#)+p' a 1Sp)!p Q1SAf1S YO@p( r 2"OKK@0DP?`|KL0OKX0K@L0 0Z0T0Q0S<P[# [ [ F [h0S h480S h0S`0d 000@0D0 *d0S %`0S  T*,800S0 [0S0S"  0C 0T 0#Sx{婰0S0\0S S <k(0S ( 0C(00\00h0S0x0  |0S|010S1d0S 1`0S$140S /840P$0&9(D9_0P$0 $>pl$? P1: SRb06V000S(dR0$0S00[X1` 00PV`5U0,00A',0Y ,`'H넵U p 0 pSf:Yf,0p`uU ? 0`SM: !DR&0S $1 S+40$00l000 [ 0R5 R4*P !RP5P"S4U  R$1SPP$Q$1t SR U HSRQ SP" 00S<0 㚯P3P%P5 0CP0厯쐝Y [  0D0P,00pP1+!`G00b#02b#b& 0X 0S쀍 [( Y&: [],0"P!,"00 S :0㈀ 0[I,0P!("B,0"P!0 Y` ,00 0!030q W5o:0+a&0G 00+10000 [\Q [PQRU10A+!0 Y0 0@c&0p0 +1׭G0A 00S1!YV*<-@d x/+ΐ6ζ&@TϢvϳ(N+WЬЃ/?*Bц\ѱ-]Q0"Ґ +4E (LS1 [&9)LfffgH ѨUӘRRaArrAa [0 [00S 0( S00R 0( p  [0 [00 bU*3!A$$1QR0X@BQ5?01SU001 [0XS 03 !p515mB000 ,0fBP0S `B0S0 YB1L0TBY NB1X0 1X\0\ 0EB1?Q0 8>BY!L8BP6B,r \b\RQ.Bl,B$Q'B AH0S yލЍS03150p5 [1 1Sx0 ] #>H02=`lPP iH<#>CX=Y18800 8,02#|H0ղ [00H <0(0$4s0`0,0#4s0d0P0#4s0h00#4s0p0)4s0x0X0#4s0|0\0#4s00@0$0Q $$   T  00D4Q0T0(0 S \40S d( (0 0 0PB0$040S& ["$q4 0W0W03 W00S pZ$lp.0S  l;p T  $< p Z [$1l C/oS" R `0 @ 0 0 0,0 [0d00000P00h0000p00L00x00X00|00\0000000 013?$00(013?,0 100#410$120#430)001t 02@100 0$2?@1c4 04v 08#$0 #(#< 0 0'9@ 9>Q T0Q40S0000o0 00 R  ST T9'?  D:p@ TU z !R R S 0 S7071011H0, RZ*8J(QL0 [0 0+ S  R   0S* 0H0< 0J?oR20S ?(0 00 25 0?10 0P B24 0?180Sn0   k B*{@-S-l@ 8 / Ae@00@- 44@4P\P 0B"" )P@-'B=)x@-z @=&9G-`@ P p?00gP U0 0  i P@ GϜx 0P`0- 0Pg R 4g U   )P-Ozԓs@-pP@ 0  2;X 0TT?LЍp . P `";0 r?)P/+)`ԭ@-0S 0  ? ЍԵ/*@-@p$M0 0S ` P1 00P 0! 0?))?1 l?:\?:L?@DpQUVPE:$Ѝ}?Խ"4n0@-4M@ 0P0S Q 0  R0  2  0$4Ѝ0@H?R  #  0$R 0S 0S  0!( 4Ѝ0@?4Ѝ0)P;\}Ւ @-8p g)xգD@-0 L@ R0* 4s# p)pP `00CS`0p S00 P0S X0X /X6@&8p@-`;@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hd`0Pp <10C <1$0 810S81)P%&90&9)0@--@4MT >A`>d>hQ >`"R d2RK> >>d2SA = hk0:{PPS['ΞkHk?[E{7<1 = >< * + (;R  PPPU> 0 @@@ ! zj{ k{[;R[;>4Ѝ00B:k{{'*k{h;R-> ?@@?6C-@Y)ս)P %P))ֈ=o@-i0d2Sõ;)P@0@-0S0@d2S`2"R2%)PP@-@ 081< t;< 0l  {{(;RL/< 0@$@G G(@@)PKiow&940@- ,0R(@@N0 <9*4TQ0!&9@-@@TP P< D< 8< ,< <9&9!y%p@-0@ R R 0 RS000p\RP 0SP0PP'R"R `0S So<P0&9@-@ P l00S\ 0A !0R3 @00SQ P990*T**hp@-P@ 0` ?0@@ Q-00B 0$10S !0 0C!0R3^0 P 0 0 0*00 R))|)))))))))))|)) R  C=00pPP; 0#0%0!P/0@0&@T*h*T*&9凛A-@P`pm P0 SR 0S0B0Q3 00@0   ֒*h*T**P 00CS0 S00 P0S 0 /=<&8A-P@pRP  p@Pd˥`ȥ`V :<<z80/S&0 R0S /Q C0p R@ `/RR FR .R@` FRP @D T0t/S`0 /R/\ OjQ0&90O-cMM00@00<+0< 0<0<00} CP 0S~0,3,00,30S3S0PXl\O P|P :H 堝 00 3 S .@@ 0T S S00 0K#=PCAP0S+K K_40S3/S9+K &K @0 T@PH[K>D 0:t,  t  t  0S (8xS`S)?S DS . x000Tz*P0C r9K+ C (K0C+ ⃖00CS00Ta0CS0 /011//1///2///780/8//8|98d ╤  PK @0P* 0A0 9 90Sx9 00K  K F o 8 إPK 0 V PK. :K v R  ⻥PpK P 0K. 80  8 p ⡥@PV P80S 7    ≥P>8(<08808407007,07(07$07 0707070707 070707079   YPK  PP ,70St'0 0C!0R3z T70S0Ss K 2 @P PQKh ?ãPK ⿣t0@Pp] K> 0 p峣t`@@hP0V#T00  HT\HX0Qt0pW p`R000QSL00D0QuDD0@o0 `X\0X0S 0PV)PP PP~ K 0P@0 K. 9K>x%x 0 7 `@씟D@pP @ VG| : 0S$0 0C!0R3 0S0S 0`0夤P `0ឤP c=0,C 0  R+ .t 8 ⤔0  d0d0`@ 4L Rp 1 1 S 01 \Q \HHB/p@!bK L0 S1P00P0P D0S( X3 R  h8  X   `H0 S   \0T0 S `,@0SJ @DUYF  ➢  P0S|& x 1 ⌢ ` PcݍЍ 4  y  PPA0S, ~P  e  ΣP X  Pv L x ⵣPPj@d0SXTQ000+ O\) J \D'***,*&92O j`; 2 A*%<`po=*Twn4Pp%IiQ**hfffg ,e Oj)11N7T:L]fkq@-<00iS03S !@KP4*X*l0@-h@   L4 @0/ 0* %**@-@`| |0 P0D!0PUR3P T0p0S @0R<< 0,$pK7 Ѝ*%*hw&90C-P`@!@1 0E!YR!tM@p  10S '7 tЍ000iS00S 00S d `P 5W @ 0  P + ỢP000 p 0pi W@000*%*T&90*X*h%'` @-@X 0C @T!0R3@ 0P   0S %*O-xQ0S llT @P 0S @D @a@qP0 0@0C!R! 1S1 < T`PpԀܐ 0U0(' @P 0E!0R3x0S   {60Se @TP`3# 00 @$ *h&90-J****T\*O-M 0% 0Cq0WsP88 P p Pp0  @P ``G FRB BBDAA`C` [ R  R  R* T Y   ```_ @$ R 3  6 V 00030S3Ѝ  R  R  `& "  V P \Y F 0 F X@00020S 3`%0 5X0000  000S 0``5 0  0@0020S `0 Ya  k 00 0 X@V0000Sp X     Rd @ 0 0 8T R$q0S 1 @T 0 @g 0 @$ 0 @Wh00S 0 tL} 0 `D50 D$ 5*h*T&90&9*(Bep1G-0S ``I`@TqT 0T0 :@18a P8qU @T+$PtP@`0S 0D !0R3 PȐ尠U 0S 0S   4'P0S0S \0S  4@*h&90**T**Ք0A-0S P `p @T V @\PT$@ 0S$p$00a`@*h&90*O-!1 RR0娑S @Pq倡 0 P0: ЍS DP`P 0 #^ 14000] @QP:RS  04n Q yq`P0p[0 o000%`000*X*h*&90'**J_o&9(2O-0S 70b0- 7f 1QpԡP@p0Q00]: 0Q0 *@@ > 0X0: 0R0*0 S( -0 R S  T0:X00#03RQ00S !Pq 0000 S  Ph] \ Xk3000P@ Ѝ*h&90***ho&9C-MM@P Q 0S 0 iJ000@T0S p@ 0T0:ۍЍ`PP@p0 C yY ;  000PU/ *h&90*0A-0S L`P p 0U0(@TP`0  RF000S ,@*h&90*!A-p`P@P 2Xp0S 0X0 0C?oR20S ,DoS 07&9eQp@-? @Pᤜ$ Pp0 SRp*<@-820S$0$ 0 0~2x/z*@&9A-@0`0/0000 SPڤ/0>+b T0 P<yP0? 4 o00?*<*4%&0@-@0 0:0AЍs@-@P`P @TZ TT/2 ?0 0/+"+R  + *Ѝp&9$0L<S/ @--P*4%&@-<*p @,P*0@0%& O-2@`pVCMy Qp@0DWCߍ`TV B/ @ 0R ?s0 0 U@\1P0 S8Q 0S>(h X:0000[3*0S 0 0S 0 000R*Q 10S x`WQ0/3?0 S 00000S  `*L*&903Ga*ߨ*hO-X3p0]MS DD@c@C 800#0@000RS #050op"& $\RPP "XO1W 0"000RS[ 0"0xloph"lL[PP"L  PpvDDB@@r0PSY : SVH`P؀? !aL<S $ 8 <8  @ ( D `  P  `\  T  ؂X  HP ,@ 08!88hN/0>+b  P<֑P P f0?0H @P \PPD N 0L P \P1Q|]ߍ*h&90**@*X%&*4%& J *+*<KqxQQ*j&9%&{@- @ 00: S*G-@q `0S+6)P 00S P0 S00P R HRڀ00S |p:0 Y \P Y00:$00S $"0**T&9 J O-AMM`P@opP8 0 840 AލЍO/0 009/P6 0p!p . 6`Q D D @P <⣛PD {@P@ / / /⋛PD c@D }`ḰTAލЍA> B   R ; 0 0t/D G@D a`4 ​ 0  D ` ,e*4 Oj!&9JA-MM00 /R @`㨀p6PP 0S P@ۍЍ0 D /ᬙ`D @P 0V P` J *4p@-0@ @P BP @ p@-@:(@PO-3tM0 S ppl00RS\3 P3P#0L.HC4#S<88tЍOt, 1/$PL  R  /+ /p0@`00c(آزL<` n.L\0@ 9IWI < h`VV#W   @Pp PL<0@'pm0PxSiSbP 0'0@$ 000 1.L<0@     ` `T|L ZtЍ0 0C0\10S 0`S$0` S\'X'h0SS   7870S d00X00%90P!Td0 <b.d'*h&90g*X**@%&%&&9*4*\*` .@Qn* A-MpM`@PP 0ppd!d '@P TT&.Lː̞_< 0.ۍЍ aD D< Q'pPU'& U`k &p0P -랞1 x-*0S &p T0TP 8 -녞8 [E6&9*4*\*%O@-&P@-L@4#S 0  [  '0#S0 R @'%&0A-@P` 0 Q0: 0xtp0/᠗ @$aL00S$`@pV0 SR$`*/**TI 0S 0 0/ R  /0SX0 h p@-0 @Q0P*H`0/b Pp0 TUp$/p**0p@-P@ 0 Q0: 0|$x`0/<!1S 0p@D $P\P@@p$ 0*y*A-PM@T 0``p/VVP   幘P @T@ۍVP @p@-/Pᠠ@P@p00/00@P 0S A-P/p\0@oC 0T@@DXU pDP@D*G-pP`04PSp_ @P`0PP0C0 T`4 $ D@**pG-頁P6pS` 6 @Ptf0&(0C0T%Q&F( $06ʛ00vPPEPP Eᖖ @$  (@/僖 00 @ pP`0` P0@0 P $ **p%>Y@-@X00$D *0@-S@ \0S 0S S 0S M0 PDA T` R 2bD0&F$ ЀP 0S00j}*p@-@`PP0S = 0P0 @/fPL`0P 0 0s00pO-2lM0pS 2YIp+PP 0 X T+Lj0`000@0 Q 0*`  0R 0?*A0 Sg @018 $1 %1 00`0800J(0 "S $`;q (CA#͡ 5/0(0#S00 #0Q0У0d[ (0S $<(0C5/0(0,0S3,0P0?0!#0,0@ *P Aۍ<ЍP(0S  ;q( AC#͡5/0(0;q ;#͡$ 0$0  BRʠ0@SP (0S 1 P@0S& 0$00S  B 0S 8#S 0SR 00S \0l 9P tl x3  P8P0S*Td**K%(O**T&90 0 *qx@-@0SS*0O-wM< 00 0 80 4 @؂ P 0 @00L0@0HP0D`PP:P S  S  S;  S 0 PPg p SK  S"  S,60S  W 60S 6v0S-)P 050S  6 Ѝ50S P 0 p<50S  ,,  000 %p\0S40S   40S , P 0 8))&)   V0 00T40S 0 < 30S  30S30S 0/MPX 0? V 0 8((H30S_ H [D 0 .(#p0 0020S  s20S8x20S P  0 V 0 8((20S 0 o"p0 00r |10S 403/ ZZ!LhV00 0NT10S00S 0 83000S 0 4\  03/`V 4   00` *&9*h/&90*d*\*%qsDs@**`Vi QYqx*P* tu A-1, 0  S !@ 1 1R 4S8 !4|q04K@0t\a00S/ P0S  R+* RS-RP- !0 010  QP 0PU 0$N 8'P ЍPC/0P;C0P|90S050 00q0 0 @ 00 0**Td**/O@-|cM0S llzhChS0S Y^PR0#0,,  R0 2r  0500K Pr5"0C590C990C9000Ph|n x10S \2d"`2Q090 9P 0S 0@TP0@-@  >0  xh80 dP20 P8,0 < &0@ (  *߸'09>D*߹p@-P@P @0 4 0D !0R3 Qp*M&9A-Pp` C~00CS0rHp@ T 00CS0hH P yTnTyDo0 @00  0 0 S&9*:-@- T /L00S @P@0PμЍ@Ѝ/&9*l? dR7@-P@00S#P #0  Ѝ0R00SP{0 l`X00SD 0@P<$00S $ *\|&9*hn&90w@-@   P   P  P  h$P l Hx\0QX X (p Hl@0R&9 1);Pd`[}0@-@MPPPP8  P$0$ $-Ѝ0P*@-0@ M \0 00U  kdH ۍp@-0@S g9t0P0SdDP 0@00ᬋ? p@044000Sp p@*\&9*h&90A-/`{@Pp/@DЍ/SpPP B 0  EP0000S@-0@S  0S 0 000h0@0S ?PS @044000S @5*\&9*hU&90@-0@S 0 000d0@0S P$ @000s,00S @je*\&9*h|&90@-0@S 0 000d0@0S XP @000E,00S @<*\&9*h&90C-0M.S`p4P4A0/SS y0  0U ! i  c        p  xX  d 00@ <*AЍ*`Q0 5$-4;@-ADA-@P`App` P L@0 S000ЍU00*Ddp@-BM @P`0E CR V  h7P0FS \0 BލpAS P0P S00@ M@׬*DA-P@`ᦃ<0 pឃW @A*D@-3 BP@ 倉 0SP  $Pw@03PP `@zPP 001F0S8 0 00T1T00 `V!010a0,Q5 S:; S0,PP!00P  0 0 P 0 Ѝp r _S-S xt`0 00P0;C*n(ۡ&@T**H0@-CM@P0,  0  ?Cߍ0*@- @ R300*&@-$M0h ` z P!@PPDp$ЍPU DY0P ?)*Dp@- M0P@H  V ᬂ4` "  Ѝp.* @-\M0 P;  \Ѝ3NQ -CM0( ) Cߍ/;Cp@-`Pᙫ0 R  @  0!S TPd? |80 T0 D00o d10p*p@-P@U U  0<J $Cp@zf ?#&901P 7P P "/ //ZgM-M M? 0/$ۍ Ѝ&904`00CS`0 XaX0 X /&8O-pQDMDЍOXz@x`lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U L   ن  0. X   Ɇ  .0X ;  p8I p W&90~ <* )/+*ؤ3<0S/@-@QPM PЍ@ p31Q``X|00CSPHHH"[0PЍ@L O!0S SL   ?d0AS& 8(H0 0S0PЍ@$    0l1hS fS501 0400030020j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q !, xVPЍ* <6Q0 P q Ҟ C!/n4< Ps 3  rO-@`pR X1L0 S p   ЍO>K/00 P*Kp`-P `V6P5 00 pk ۟PJpP ПP X L0S`Py :P ЍJp` X- d;*% (p@-P(@P Pp@%L0S $  R R o 0@-  *(@- (0 0 0 0 02Ѝ 3   P P P R ? H 9@-(M0@ #\S@3@#:@ (Ѝ  Լ h7@-P|  D@P .tPP @ZPQ+,o Ѝ0*(*(0@-QPM @T 0d@Oo@' T%<%(Tr + ]U  @ @%<P P Q ,boЍ0U P Q%Tq @ 0,u  @" v*( y s p Q@-.@h0 \!@@QR  0*( Լ*(0s@- @R`  -P.sP ,n0S ,n|Ѝp l0!PU U 0< 4Ѝp@!Ѝp@%*(*( @-@T T 0( ( ЍЍ@,Ѝ@ *("!Q p@-@P T p@<  p@0 p@/+O-@"PTMA@ p` @@0@$(@ P P嘟TЍ)PP9 @@0Pt@႟lT:TЍOe0 EW y R@x   ;y0P ayL  ,\100 0 S00C00  Q,4P `0 m0 0`g M` `bX`00CS`0 X0@X0 X &  %< &8@-00C Ѝ@-0  ; ЍO-@p P7 aTAD -QP  P PPP@D`FRPP00SP Ѝ @-@0 0 0 Ѝ@?@-1  &9@-9@-QAM`p0V@ M0dN,aXQX!0TqL4!0P 00 ,Aލ ЍP0001!! n?t0$D e!R  0Gxr5@P㑁; !;㈁<T0 <G<@D@ \0D0X >@ DD*!/5Q0N~*4"@-*40@-6S L *@-E KHExBm/l` @P" X TC   < 44{,  @ *(*4@-j  &90@-h@  0@ 0\0CS @C&@T00S/p@-P0 0 lhP 0S 0S0 0S  SP/+ $*@-M @ 'PDۍ00 R   3P/+*H-p`3M|M!PPWZ@PhkP <ckP@ P04QkPV 7 P00S , P  ? ߻PPi P t-kP ,^`[ , P U(&P0S bV! J1!@ 3J P RB PQ o 0 UxtJ|!|1h@  R$BP< o @f4S J P pR>Ph 0R :CoP᫲ j > jP00 S5VPqo0 xxpio0 `Xp* I e/+ L Vm^L ` q _d  [  !?  &9!O-pMM`;p.jp P@@ p p p0Wp㼱0Z:0S ލЍ0 0W@P\ @PLqLL?H=jP  1pZcV㟉 1Z SP nZ.pZP nZ.20Sa00 0Z=0V9 Z-P n\Z.@)0T:Z^P nZ. d| *Ade6!}*1!Q @-0`0 0^PP 0@PT ^P Ѝp@ 0(PP DЍp  1O--tM< 8@40dPPtЍB0P(0  (QP)% U  sT T T;P0t4tT$0 hT6P0X4XT$01P0H4HT$00SZPT5(4TP$004 0S0R0S00 0 0 (0 @` 0 0@TF*3#03  0303P0T0P؋@(0P`,PY6*40S 0TS0[tDd  p 0`pt 0+Xpl X `(pm0P02R$0g 0BnS01 0<0S 08 S@ p?@0?D000S+ 竸z0相S 0P0/Hg T08 { GP/0 L 8g?L 0H 0g {{'0{H 0a,00@ ,0 0D0 @ PBn| 001 00X[p`?$ 0\`0 +4Jp  0G$/$+4h;p X0 0T0 {{'0{0h `Pȟ 0 f` 0f $0pT @Y" """""#"# _"I#nz#)#4#M#W#Q0##İ0SQ0兤d4 00kS& Lp p4X p p+4` p}  0[ $+p4h pp h0` XPp ǟ 0rf 0lf$0`00[ 0 `f$000$ T,0S0gd0kS㋤8 q 0pX p2 $``p+4 p'  0[ $h+ p4u p '@ '@{ {'{X0@0 T0 M'@ '@{ {'0[PpǏ 0 {e 0 e 0 eT0 @YQ0#$$@-Wl $9&9A-@`4Sp  PT0DPEE$UX dgP00\gP 0-80 P $"3MDPE@D* /+p@-P@Q0 | 0 p2gP @0S \9$Pp HoW0@ 0< 0p R$'$%+)H$+՘$+T+P+L$@-3400S (0 0 pp +)h+)H|*O-\M0 MS1 HpW-Q`@`((Q(0 #]+ 0c=P 0 0 ۍ Ѝ0 000nS ?S aS ppS qS x0  0 d00L0>0 8+)+)p$+)H&8$+D$&@PL$%%A-X`0S L00S 08P8@p0Pp00+D+)h+)+)p@-@L0@3@00S-',0, 0S00%'s+)x+)L+)l+հ*C-RP`tM  ,,E P RQ ğE R`S d0t`FQ ğR   TDR 7 4* CR ` 0S $ Li ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+U`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ000,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ&@T&@P+t+Յ+t+t+)H%PA-@@P@T -@ P`p0Sl} d0 !@ P ,0< 8(0@A% 1+)H *ݳ+՘+T%A-@P@pP0`S00|0 R d7  R 0L 0S @!P@`T !+L+)+.%&+$$P@-- 0 D+՘&:P@-w- 0 8+՘ [P@-k- 0 ,+՘&AP@- _- 0 0 +՘+)H+&GP@- M- 0 0 +՘+)H+&hP@- ;- 0 0 +՘+)H+,&P0p@-AM 00@0 0@S- P1 PS" 0S00!C:P 0S0o>PP 0T00aS0` 00S0``0 C:PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0>''Aލp+՘&&+լ&&&+ՠ+՜G-1MMP, 84 1ݍЍP0$C:P @4@`0 PZ30S Scs 5@PQ J0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, f 0DPQ0S0TӸ,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2.&Q|00S  d0 0P000<0P+՘&+D , *+)L+)l+ՠ+)+՜+լ&&+)+)h+դ&PC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! M9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(! 9PY#P0͡ ,g0S @$00 R   R 0 'l00Q5pq T0SP00@c+՘&+դ+՜+ՠ+̜+)H&&+7'/0 0 0 0\+'4!0 0 0 0R+'4C-KM MP* x2 Kލ ЍP0\"C8P @<2@82000(aP 2 0S@2Zp. P0 "aQq0S 0S 00 3@P R.`1@0S p5PH1 \0P 818!00,1 0&0S P+ 00 000T   /o" 'l0 Q00S 0@YP0 00`0@\+՘'7+D+'D+̜+)H& , *+)L+)l+Ȑ'K+՜+դ+ՠ'4+)'/+)h7@-PAMM * 0 @{PP0 ^` pF _Q|0p 0pppp0+7P3!AލЍ0S 0 `X+՘+)H'p'G+'4 0P/rnP@-)0$ 00 0+՘+)H'''Pp@-@P U?o20#pP `zP tuP )p0U0P0 <0 @U,0 00Rnr+)H'0@- 0'+)t+՘P@-) $0 00S/0+՘+)+)H'0@- 0'+.+՘Pp@-1 R   1( @0PS 0 0S P B)0 0p`PPl@ \0 t LP 5P80 @p0+մ+)Hr(%+)(;/i+)+՘n(0@- E 0(Q+)+՘0@- ; 0(^+.$+՘@-(@(0 0 00S 0 +)(t+՘+մ0@- 0(+)+՘P00P0SA- (0 !0ЍPAaq0S000+0S 0S1d000PPzP00rP ,O08`0H L0<\04 +՘+)+-+)H(nr*+)((0@- 0(+)+՘0@- 0(+)+՘P00P0Sp@- f(0!0pP@/`P P0 0  00S00 P|0x0 0l 40P T400?o2$ S0 +՘+)Hn+.+-)2r)P00P0@-S ( 0 ЍP  5P 0Pd00}S`00S T0T喑0HP 40 0, 0( 0+՘)L)+)+)H)])+̸+Đ+Č0p@-PP000049@Ppp dWp@ P p@'2@ 0S80 000T+՘+.,)+Ȑ+)H))P00P0@-S ' L0 ЍP 4 m5P 0 P 0+՘&)+̸@-M P{' D1 ЍP0! L5P @1@'+P0P`p Y0@P+0@0 S0 0S WP ZP l0 Q 0S H0@AP000$0@+՘'7+D , *)+)h+̸+)@-P' 0 ЍP 0S t 4P 0S0TP0@P ,0 $ 4P+՘))*+̸)G-@`pFoᨂ@]P 10S 1ЍGvY(& 1 ЍYPq YP4Y! YUQR 8@P dPPPA @1 ЍG0],1PP(qPp+6U@0 000Q#T6U@ pV(PPP 0RP \`5|0@0 M000 L0'# 80 #1+̜+)H*+՘**K*?* k+<*E.A- MPI& 2 ЍPO0S!4P 0 1C9]P 00|S 7P 3P 0t%]@h1d@) P.P!@4QhS&`T@P X d@ D0@ I0 @ 0@3/H0T 00S00A,&+՘++)H,9,N,a* .+)l,z+@+հ0@- 0,+դ+՘0@- 0,+. +՘PA-PPPPU㈀ A"00P@lph0hPڋ00`0 @00IT,0P AwI+՘+ՠ+)H,+Յ+t7@-PA 0P00岋00 Ѝ0P"0P%0S0P 008N0@0S 0 S  @,N@00+T;I0 S +<4I 0 /P+՘+՜,+)H+)\+)L+t+t,P@- !0S000 005 0P !0 0@vP  0 0 00l00hcPL0H0D0HWP0 0 00 +)+)+)Hr+՘n, p000 0@-S$00 00 +)+)-+՘+)000 0@-S$00 00 +)+)-+՘+)p@-@Pp@0@- 0-$+լ+՘0@- z 0-1+ը+՘PG-R@Pp P1!ЍP`P? P< P`TP5 ,PT. ,@PP$$`. U(1$1@W 10SV U00@ $ $``PK0 0  S  !V Up0l0@W T00S H0H 0 @@ S8  4 !c'G1t+)+)+)+)+)n+)Hr-@-| @-j0+՘P@- x0 pP \00}ST00S H0H0@P 00 0( 0$ 0+՘-+)+)H--+̸+Đ+ČP00P0Ss@- l 0 Ѝp0` 0S P@P *P00S  L 0Ѝp@$Ѝp@+՘+̜+)H&+-. .&p@-4@PP2 0 p00EPp+)+՘.VA-P 0$"0Ѝr0S 2 巉P80S10S 1婉@a0 ` SG0崁S Cb"c! !    c#A P0U0CtQ00CS0<h P?00CS0@_ P7 (!-PS0Qp00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S+՘+/8+)H.[+).+CD+CD+3D&8...P00P00@-SM  z0| 0Ѝ0Ph  K-P 0")@tqP @0( $0U@00+՘&/+)HP00P00@-SM H0 0Ѝ0P | -P 0B)pq L0@0P-) 0,v 0S0000+՘&+)H/(P@- 0 P+(+՘/./3@- (0@pP0 @K+)H/;P00P0A-S쀟 00ЍP  ,P 0E0`P PPP 0RPbT@_T@@>.p F DE E00+՘&*E. 1P00P0O-SM   0 ЍP  u,P @P@ 0R@T`-|0P 0E0hph`h@Р0000 0<0 8/+՘&*E.+մ++)'4'/Pp@- [0 0p`@PP P  P@**p0 ` S P@@ @000 (z0+՘/l V/s+)H/{+.+./A-p`P; @Pd0 A\bP m00-4 0 RU AM+)H/+)/ A-PP   R ЍAP  R  0@0S00Ѝ@`p+՘%+)HQ0/0A-p`P0 AP@PLp @A P 00 00+՘+)H//p@-X@PP D0 p<00Sp@,0,=0 0Pp+)+՘+̜+)H0 06p@-0@p@SP \0 pT00Sp@D0D0P0,Pp+)+՘+̜+)H0;0h0mp@- @x@RP^ d0 p\ Rp@L0L P0 ,dPp _+)+՘+̜+)H0u00O-MMPQ 2 3 ٍЍP0 #C+P S@p3`X 3 |d TPP@)L_D0`t' P00S 0P @B0S0l00mp@I2剆2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )bD0 FR@0SPiR0PS 0 D)bC02R@P1= d1 0S x10SL1h`10S ,0&00CS0. h C0 03/00S 0S 000CS0 S0  )tC00000i0 3X 0`S8 +՘.+CD+/8+)H2+&@T+)`,9,N+)l,z+)+)d+)t@-@P 00P ~00Px00 -d0lM T00S WD 0d? P,00pp +)x+)h2+)H+-lMP00S W@ 0d  P(00pp +)h27+)H+A-@cQP` p0 0Cs0SQ3  NPP 0 B RQP  00 0Cs0SP3 p@-`P@:GP &- 0S1PS !x-p@l-+`)P %GP00 0-S!0R2Q6k2Zp@-@P 00PU P  VPp00p@-`Pp@0P<0 .0Sp 0h R00 Ѝ0 0S0C Br RQ"  +.2eP/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&@TG-`P(P @ MP  MPU0 00b P0 10S / GPe P*P@FP 0pS 02P pA*:PFP p9*P :FPQ p000 SPk0S 00S1 @RđU0 pl `MP0 0 U **) 0 011 M2Ѝ @p) PA 0S000)0S 0PS S St0 0S 0`S@)H0pW ),p2~22+-222+) J +)|Q0 - BR0 R  P R O-0@!M M P<@8@4@@0D@@@MPm4` 0p 0S 0S 40S 0S HǦ@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /XTpKX`V  A5PUp@ @l0S ;X@P dgP TbP D]P8} (x000@0)@P4EP 4@P@)4:4EP 00(<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU APPP @ @ PpW ApPp3 Q  `3 T +k@ =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0(P0 Z , d0%T00S9 llX% 0S1  + $@=0 00 (00$@0S0S20}S[+ @/DP00Y@VN 0SK U +H?+ H?+H?H` +@?=0 00P$` Q(0 A `00+S?=0  0`0@@DcT@@0P/bWP0,00(S  Ya@p262 J +)233 33?+-3_+)l+)3f+̸+՘&93'G+)+)'D1a+)O-iM Mh8dLlOpt͍40,xHD@|0 $0PL0.600K/p% ,A'@0'4QD'8aO?ⰐV=HLa少'TU01d 0S TPD d0sh0sl0sp0s0St0s tU 0S V|V?0S ;'?0S0 /VP,')'T?0S 00SV( 0 _ 0 .<0S ~P' Vh<, )0S ~Ol) P$.d>`N 0 ])00 IPL /=0S-`= <`R*$` (`,`-0 RDNP;0 00|S h,(0S;0s JTM hL= ,= 唤X\P[,^>@;P0S00(  V :+ 0S 00S 0Px 0Su w&ptL PPP 0S :UPQcLX :HIPPW #xPx0SV x0SY ; 0 PH$P %BP  0`!U/1\1X1T100p `10T1S 0S \AT! 0S xMP h oUV0 0T0S 00S P P%\K 0;R0 sr ZOe.!0Q3/Pp;@x ,+0 R0;Q;F ; 0 S d|h xltpp"0S,d< 0R.Kw u420S 000S 000S 000S 00|iލ Ѝ0S 03/0S к00s@- P@tCP  nCP0P (Ѝp `P  [CP 0 FUphP Ѝp@6 0S S0S  =C0PP2~222:00@-Mh 00=P P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :-<P 0 S000Bp@ T dFP 0|S 000 0S00 0000+.4+)l  ++-+)<@-`$MpP  70000000=@;E0P/S:S y@P@tQVP $ЍU"EP@ 6  6 60/0}NPP":xNpPY@P/000 09@P00-`0@@DcT@@00@0CcS1S@1s+՘ J 1t2PP00/@-+K (0@  000 K@+)x+@-K p0@ `00S T0 0Lpp<0000S (J@+)x+)h+)H|+@-J@\00S P0 0Hpp8 10 10S J@+)h+)H|+ d0@- T00S H0 0@pp00 101000+)x+)h+)H|++D -X0lM@ ad @680 00ssX +)x;+)H+@-0lM@D0 0 00 0rS sS ld d5d X5P0 00ss,d $+)x+D++ո;J;;;l+)H+;D@-PP`@ @0@ss00V 0ss0000@? UP UV 0A0T0Ѝp00CS0 Sp0 S 0 /O-pTM|0x0?X0 "?0p 0 J0P`0V0X B@x4 D000S@ H 8PZ0S= S DV0  @P+I0S I0#S I|0pS d!0 R LaR 0# ;Itp uTЍ  ?$0 0   PPI0S I0#S@DT|0S ld@"\;$0 V `~#O" 00 "B@+)+)HO-@BM MU@$@ A1-?0a>0 @@@0`p5(`5夵P< $c PP)|50S5W h% 0\U  :;0X,U S00H00S 0S  0S 0 S  R 0 00U!$1PP$*p 0㤴 d ;@P$p 0\u`8 4 ap0TS 00   00Bލ Ѝ@3@30S VW@@c3!%:3 0  U@ L30S.;50G?oV20S4 30S0#3 RJuTN20 CRk2000/ U)U00e@ 0B>W0pXP44220S V: V `2KV"h2000; "00ET1#0 CR5@V-U 0S 1  00 0V &T V00T0ST dT(U@ 1 p1L10 CRVT$10S@d@0 @SP405+( 310S (3/1W 0    0QR\@\0 RZ P :/ 10 YS P 9/0G + 0+՘+.+/@+)+. +)H+/<+. $;+հ&@T+̘8+/D+)-A-` @T Ř 0 ЍAЍ/0p0$ P &xiu9 h0h Bo:0@S uP 5/k+/<;+՘+ k+.,+O-@sFM M`  @FF BF 0>F0$0`30(0$ 0,@W0P SwG 0 b 3 Fލ ЍV0 @,Q(22@@Ȳ@aGT  D 2 V 0 PD0P|2d oLP `"`d2 L20S 00S , 0(d  PP d⺵@0S00?o2 7P]  F0@6V6 D01@jp  d咵 01 @D0(66S0d00 0d0GA0`PS ƗP P 00S t0 |0HP@ 0 @00,`@0?+ +);+՘+̘+)6+)H6<6N+ (;+/@+/<<*<>0O-VJMMsn0p̖FXv600S00p  9Pt X \6  T60 9P,JލЍ60 0 0097S 50Sa5s005ĥ0S# 0S5 Q S 5R "P 0S d500CS05Ps00@;0S P97S, 44 % ^0S 400CSX0$000(00000 PF h450000S\40܀C XSX 4T00$ 0C h00d00`0( C P 3x4\ 0k0$<` ((0d $r 0+ <7$ &S \3]0 R0S R|3(0008'P 2X0097S0000 00S  x 0p8'P420 00 0 0 D pL 087RP,ݳ 97R_ S㴁 0S [10S. 0S* ,0< 1, MJP8!81 R  t 0 4 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00`X0 <0S [X  U++)+)+.$+ ( >,><@- 2 Bp`WLM LЍ@ pPl  pf 00011 0S<0 ?|q0 (,00 Q 00SZ=9Q ='/?@#b!"/p8pD0S lD0#S 0(60 8pp \D0S XD0#S  pp 90S0 00 0 0qLЍP4&00+)+)+.bM>+>v>S0A-H`D0 82Vp  R`RBR RB`2b  Q  ,`/00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 Oj+#+)H>+00@-PQM0MS <811S (1 ۍЍ0@ @ Pp0 P 囱 T40 PP  勱01S |0 T  +pp PdP000S\ZۍЍ0+/<>++՘??(+/@00@-$M00D 0=P@`4`$\4Q00P4@T D40S@ 440S@@$40SPr40S3>ph 3 30p$Ѝ030SCP NPDh/ `3 0 HP@-)10003 & pP@#R000 00 0SP  tKP dJ@P  H 2@(=,2P0 S R0S S @T% 1Ao0S3 1o10S 1 P5kiX10S  P01S 0 0S PU P 0S 0S h01Sd|> 40 '/+ը&&+P+̔+̐+L<+)l+)H?g+՘?1+? + [??+ @+)L+.+/@?A-M h  LL0 8 4 4((($( $ ( RS  8Q  Ѝ 00-S0S 7 7 770SK0<00@0D07 0]@PPpGAld\@ ;<PXH7,07P1CPP7`@0 %<P  <P6Qu AQ ,0 p,0000I7Pn 可 Ay0S t6 @0soD0spXFP,00<0Sj40Sn5$  0  q 00|S  0DP,,0SSX5@5<0 ,,0S  5P<0,0p,0MPX0: S 4 D4 n0 0,04 P4 00S,  P 4 440S!@@2L4@@0S`4@y XTP@40S 4040 4 n4q,4 R 4 $  =4R P 3C D0s D30SP 30S 30S2P 30S Br,0)p`\ VvUR J0CS,0,#p,040q40 3P001!P 匮<0S <0,3/0,0@4'4@k!0 R0+P?0 SX1#10 ? 0!$$P 48 pU(,00@ ?00 0C400@ ?800400@ 0 48 p 400@ 0 q$\0 J#G@;D 7,0S <0,3/4+)+ոL+)++)+)+)L+)H??+P+L++. p <&8+&&5`+՘+)*e[:??'4 [+̸/++.? 06?+#+մ+)@@@-GM , 0 0PO$(000EP@+,0+40@P@L0;@; 00;00%:oDD0S?;0SW 080< @ l+ RD00S0P H0PP@KN<041<S$9P $00|S $\P/$A@>0SR >0 SN $ g): 01RS 41S $00-S0S p: lX:$ XD0S $ Gߍ.0S : <0sZ@0s[IP0080SU00SY|9 t9 X9T$ 9R Pt90S q>0 S $P$00$0T $/00[>0 S$P$80SD8Q0SPlg`P=D0S!0S' X+l80S {\(S  7@(80sS|h8  6Pq00S  +PfO000S`$P t7 ('0 R0RAO41SC$ 8P!`74!(06 6 (0p(0p 0: S 0&0&07 R,6&l;$00|S @$((0S$K64! 6 680$ ((0Sp6$hd6R P 6@F e(60S` t50S \50S<5`50S 0CS0D0S 5  (p(3P$00t%p00(0q(0X5`001!-PMM=0 SFh480S 80(3/0(00|0L0S$0 SDQ  40S 8 |4R2 pq{ `%'0$`x0po3X@$P  0[c囫P$啫D0S s 0 P0 (PeP@ 0T0(0 00WPvr],pp P @P@#.0 ? 0!% S0 04  P@ H0S @(, p% (, pV7000@ <400<0 S<1(00@H <,00(00@T\! 0 t 04p@ TL0Q0L0 T V @%\1 *#'l@L `Ti <00S 0E<@ (0S 80(3/0r+)+ոL'+)+'/+)+)+)L+. ++. p <>+)+)H??+՘+) J Oj+ը@1+L/++P+? [&90+.9 <??*e[:+#+մ5`+)@@B:p@W@ @/0i+)H@oQP@-X@ L0 j P s@ 0 +/@+՘@@-@;0 ЍAy0 Qp@-P,@P@pႫP @%@-T@0SHP0<0 0R @ +!@~C=C7+!D@-T@4SHP04 0R # +!@0C]Q0+%H0P @- Pp@T Wp`W VL\ P  R/%`O-@p`M[6T oTP ЍOCT <<@DT#Ѝa 1 !Q@ ~QPu ЍOD 8S 0S P pP 0 \P 0 X  V& 03/0 00$A2+!@CCC%`C/8($\!\R% R 8( -0 \ \ \; (R ( R 8( "\  \  0 ( ( !R0/\\\0^ (80\ "\0 0(88S08 S 0808+!@%p@-H0H@8D0 (8080$8P  Up$80++!@+D@-AaM(8S h0 S L,0) P p p $8S 80pP\ UP 0S ,8S0g (8S 00CS0 0 0p 08j% 8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝ+!@+&8C,9,N,z  P/@-@P$iP  bFCFj@-<@0sB(00pp0Co%+)Hp4p$0 00/O--KM@t Q 0 0SZQ=9 =:k{@8`V0 @P y@{P@P0F 03 3# ( `#0{p`Z T :<#[030(0 0f$#`  &[ (f 0"`< (00< 0f0" n0` U  S  RS0( `"1f 0;#;Z0S;#;0d ƒ>#/+"+ 0"%+?;#;0@#5;DE @!0;X@\ P`U0WTڬ1PP1 Q IQ@@k{H{7{Zk(0`0!d YP (e 0 P<T(0@<e0   00S @ P0S S (0dt @(0h dX A.+)+)++)Q0"+ոFQFFF HF++FFF|+)H 00pp(Kߍ@P%U[0DE:@-d8X @0 R0 @00S 40 0,ppeN8@+)+)h+)H|-$M ?0 0 $Ѝ0-4M 00 0008P4ЍO--pMM$E$ "  4P p !PUp0( RPUp4$ 0R 0d*pğ^P $0S 0sX0S P 40▧,40S` $1` $[ 07 [{@0 (@{{:?dSd0 0#f3` 3R - BP  B1 BRڛ \3\図"B P#0 f<#2` 0 $ß S#3RPR  !00f " $` Q(0 0SZQ=9 =:k{fH2@Q09@ {P !5 Q; %#3\PO  d! !00f!1@Q0G10 S`dQ 1*!3^4?^0370l!P0\`1 000ss&(40S #5; !jUp; 2@0S00d )@0 00ppMߍ@YA.+++)+.+)+  ;+ռ/++G0+QQ0 dG7 HGAGNGcF+)H+.4Gp|~@FG} 1 Q!0 @@ k{I{7{z`0Wy80P  Pu@<*00`<pke0 @  @-}6@Ry6@p@-Bd00` pd00CS01p ,P P00 @R0S"P8d`Qd00CS0+p "P \Pd00CS0p000S 8A0QPA p0 0 `Vp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 1Pp@+% G+A-pp@`᳥P@ .(&PP ᩥ@P PE ,P@OoB@+O-$U0mMS p+DPd 50S Mmߍ0P.0͵1%4PPd'0P0S SUpF P`4P PP P0CS  |  p, P P  P0 PsdJy0P P q0P d0ppP 0? dA`?dp P 0Sd0ppP0? "p P 0S0S d_h0 P P d00CS0p\2\b P Q4280 0 dAQ 0~p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0Gp0 dL\07p 0 p P`, ^0#S^0C0 dvPXX +)+GQ0+CD+̘EGGH'+)HHX.[Hw&@T+3D+CDHH+)L+/8@-0 @0S,P  k+P  0 00@ x0 lP T0 L P 00 ,P 0 &@TH0h+̜H~H00CS0 Sp0 S0 p/1A-0aS0P0/P3U {*P 00.S Ppd1lN `L+X1P@  H,*P10T0!0!00 (1( <U 0 ! -0Aq000 00000P0 0 0pS000P0T h0h0 @U t0.P$0`Ra+.+).VH+/H+/D+)HII!+)LP+̐+̔&:+P+T%+̜+) h06I&I1p@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ ԡ80@0S, 0p+/<+)l+̔+̐+Ĉ+-+)+)+)+)L+/8 H0@- 800S ,0 0$pp^q+)x+)h+)H|+.4A-@?3Qp0S `0S ppo00`P㊻p00000S p`0S ppvQ000080xT  2p+)l+/<+)+հIO-P"2 AM MR0xB p" R S4 P #04 S` 4S4P  $Aލ Ѝ4Sg1+%;004P/S ++VPJpUp儑0倁 00g000000000S L1oo81X$1 R100CcSppW100S 0oR 0000004SU00V$@\PPTy "P00+D+)+h+)l+- J II+)+մ+)+)L!* +՘+/DIA-Q0qS0`00@S Q`Ѝ0_EP f"P 0 R 0000@ Pl00}S0s00T 0S$@,_ +.+)+̜+)HIJ+/D&@T+՘O-쁟a0AS000qSP4M Q 1_4ЍPF "P0.0l "P00XV+P" H@,P$,!020$A$000 0@, Y09+P 0 @ P 0$0噼pq00P0}S0s00U 0S(@<_ F+.+)+̜+՘+)HJJF+/HJNJR+/DJJJ@-,@02 ɫP+pJJA-`P`p L@P  8@P $@KK(KB@-@dP+Ȑ 0A- 0@0PS0p`06P㬀" V!P 0S 0"S0x R S  p`"R"^ 0 00+Č+.+)+՘Ԅ+Đ+/D0@-M M P 9 @+Pۍ Ѝ0<Ph`4/SX* @ +P;0@TP/P OjKXO-@P`pW 1@@Pp3:+pF+`ܰ0X1 0!*T@1`0 10S 0 SY J0^ Q0*0S*00 050 Ѝ++)H@-V0L0@0 <pppP0 0SP0 0D0@Ѝ+)H@th+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C+)+)K~+)+)@-0 000$  0S" R 0S0000S b0Cs R S             Ѝ &@T&@P@-(A`0S0 0 0 0!0.p 0S:S50P0S0 0 000 pM0S:S5000h `0PpT100, 0 p(%Ѝp+.K+.KKLC-@\ᄐpA`\P ^T1:00"\ \ L|9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10Ns[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&+)l<+̘+ĈQ0+Č+Đ/A-p`P @UP0  T  `00T  '0@ R   `FVp`00CS0 X PpTD000`000 T00L"L0&8LBC-pP`'@0尐T[ ] 00@)ax0@P`0 \LxL00D P 0 Ѝ+?+)HLYLu&8L{L+)d+)`G-M@ ` 04P0 03`PT 2P #T# 20S+ ` Q `V` p-0@00E.002 2P Eh"h-E@T-ލ еp`0$T  õp T0q10@S $0 0/" ᮵pOa-0$S*F>C0S  ϶\4$`$Q(00SZ=9Q =(/?@#b!"/0 0sp4;-0S 7-0#S Z0-0AS  T0 0000 0⃶p 0S -0- 0 Rpx0LT P-<00+.(LLL+.bM6p@-@Pp@F p@-@`00CS0ppP0 @ ,0S0`00,0#S V ,00p0 PA-p@`pP0 @ ,0S0`00,0#S V ,00p@-@PP`'P 8'Pp0Sp#pv =1M @-@ᏘP M/@-JzPMV@-@dzp  MP@-#PMM0@-PlMQ@00 00 T  40S P 00 P 0 0] 0 _PACcpW' 30S %@%@@` r L? ;P m`&PJ P |0 S8 L0P 00P02 > 2 PP E00 @T q% * P 60 0@T b% |*P 'lЍP 0S @P@E C% ]*  P@8% R*T T0S @P@&$% >*0S @P@% 0*Tw 11@T  0P S0p`Vu&PP)000'0 0 0PhQ XjP@+-E0+.0+)H+)*N M&8L+՘M****+Ĉ+)L+)l+CD+/86|++)`+)d+Đ+Č7@-P& 1 Ѝ0Q0S 1 1fP !0 CRhA R S0T!L1P 0S0,!S NP 0S 10S 0 02@ @40 @0@,0 @&0 @ 0 @ 0 00S 0U+՘+)l+̘N+)H+)+)+-NC+)|+)N` [+T+P+LN++N++ +,+(c++̼+)00S#@-@0M, ;) 0P0S8i{&@0Ѝ0@+)&-A-%8+%LN++ Xz6NO@W+d0&+d@-& 0  ?<+\@- 0j+`+۬P `00CS`0p S00 P0S X0X /X&8C-Pp@  l1s0S `l $0S t 0勵`V   Ѝ+d%8+\O2+ܬ@-RCf&c& z p( P@ QP >CR&O&ЍJ&G&X0/LA)P 00TT,FNTOIOO%8&9kOTO`0s@-@ 奮1`s0S P0S   單 H咮@0 ⫮0nS Ѝp+@%8J+H|+POk@-PMP T` P H00S@0\A PЍ @sPBO}+%8OOQ@-@80傮T B1 ㋲+XOOD0@-|AT 0S  0 : %8+d@07@-LAP/%)0P00 + Ѝ0%8 @-@0S S S 0\ \ \R@ R0 RG-P0@/K00圀/F0p0/@x` 0@s QT@D0 DЍG>Bs0 b@T*Qs00!%lO/+OOG-AMMP`PDxB  d2d `2 岭T2 P˭ 0 04R 0 0 徭 0R  0 S!寽 %`pP@D✡0S1  圭1 0S00SR&@@T  iT @A<1<1s0S 0Q \!] 1 Q$六AލЍP0S S  S00<1s0S p 0圠0CZ (Z <A 0 @+d+`+@+P++++۬ ?dO%8O++HO0@-EM,P P @PdAEߍ0 ,PP + ) $ f$x0 <  ^$STPܭj 6A OOOP ?d%8P,O-`h3MP@ pPP庬L`4$<#03 ,ʬUPE 8`S00CS0%p00 R0ScP1s0S7 `$jP22l1s0S  ♬ 0 0 Pp`1 Ps0S 0 ` 0D PVS,1s0S 8 ` 0 S 1s0S <1s0S Ӳl1s0S 0|0d1 T RGL1P)  V 11s0S WpG'㰒`PI#<1s0S0  ЍS R   RWP00Uq QLLDP@+@+d ?$++P+%8+dO+\++H+P:OPQp@-BM,\PP3L1 DɫD#A#$!1 ثP@P@`0<1s0S >0Q 0 夫 ##Bߍp &P`TPp0厬#"J< ṯO+@++P+O%8Pw+H++dPep@-BM5,hNPP3X1 P_""0!\(1 $n@P?`1<1s0S ԑ0Q A0 : =""Bߍp ἑP`✻TP|P$!""<➱LO+@++P+O%8Pw+H++dPe0@-@pP4M\0PP <<0000<<0  4Ѝ0+dn+0@-@DP4Mj0 0P88 04Ѝ0+dn@-M, ,PF A f 0 001 屪1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍P%8+@nr+\@-(@ $  @+d t{ tz@-@>T@1p@-@PPpP p0@-AM MPAލ Ѝ0CP庐0![>PPl1LAd1T@][太WU0!P0㼫u喐GEA+"@: tU0S S 000 OTt   T l't  10D0 S B/o" R  0CPsYP%8+ܭ&9PPP+۬@-MP Pppp p٩l@PL\܍@;, HP ܍,0 < +P+hPP %80@-MP MuP%@e0@SۍЍ0@=P551d d嚩PPTۍЍ0@@ 5喯 , ۍЍ0+Q+۬Q PQ#Q/p@-"P dd;@PpPP妰Pp@4<֯8P L|l1s0Sp0p@׏+ PQ1%8+dp@-P MP(P @R0ۍp@=Sp`r@P\ۍp@衯P l! r R< < 55 ,=ۍp+QC+۬QJQ1%8QbQjQ@-  N1&9RO-P4M$`5~`=@Pu`0 `4$$Dp0Z$ dQ Y  Q$0 P0$4042 / t, h)  0X$XӮP0PH} p@z <U, U$$t @DOo0B$10<13 B0lS010S 0P   R N ᮬtS)`S FSI (9S /S 00C6&`a0CS \0 [L \D [L ] ]P [L \ [L [L [L \` [L [< ] \0 [L [L \ ],hES 0ScTPS2P7Py 2Pc -PPO 2PBd2 @d PV  LPR  @P/ ,2!00(1 1 0 0!0S1/ *P @C<,00 1 0 x,0P pB 01 U PUP0 0  0@@@P 0 T0@0?o2VP0SVP%4Ѝ++++%\VE&2+Vf +++h gV+VV&90a m6%8+\V&9S-OUUwUU 8UV&V@-䨷+@-@M h \0P0 0D0@10S  10S0S@ЍnP  ,00Sj0@ P 0 00So0S e00P0P@0 S090# ,峨 ^t+++h+d/+ t A-U0S7P@@P0Px% /Q4 ~ \`PPeDpMHu0S+ 85  05@,5 $5 5 R- + 5 400000@T ,P004@Ѝ0400/S@ P v v vldoXo 0SuQd0S %p=0c p;0cs0S000S : }0P0 0R P T3Q |30S p : h}PX30S 2Q P No2: @}P 2 : }P 2l!: }P 2 : }P 2 : }P t2!: ~}P T2h,!: v}P 42L}P T1 "1 R|! x1 Rp! l1Q `!\1Q PL1Q @<1Q 0,A, Dp00A <p00@ 4p 00+VVV%Ɍ%ɘ+++++++WWAWW ~{WuWr+W .*+\%8sb 'zn U +h+p%+|%'+V+x+lW+t 'k+hW+dO]+`'H@-.@$P ᠬ 圬㖩&9WW @-0S +tT@-00CS0p0 00S00&8+P@-@P9 W+; $+ +00@-M0Q00@ 0 含 P 0 @P00CS0mp 0 g dh00S0@oЍ00 p0 P 0S*000+ g/+&80Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?+\XPP 80 dÅe"Å^ P?d" @pef"/++\A-|x@xPx`xp 0TS 0T `0h2So T 0T * 0 @X%ǐ%8XX+0@-P@4Ml 0<, p"lR < 0 2  s0-  ,S 0"!8 0r 0R><r> 0"4Ѝ0+%8@-`0S@ P0S 0000q20\ @肊+X( @7@-0Pl000p@h R R  l R  R4i03/ Ѝ0Q P%8%DŽ+/+p@-$A`1QS 0SP kAP00p000P P0 P0 tP  ddԪ\y 0H@H  "  \ p%8+a m6X6&9% +i,0@-1s0S 0P 㧧%8+p@-(0(@ _0@ w+P++Hp@-`BM Pl@0 S0`01s0ST01y0 唪0Pn00x0 0BߍpB/ BR 0C00P My0001+H%8!+p+P 0?o2 0/%8@-AMR |0b0000@000  Pڶ0 q P 0SS WS BSs0 +P  {Vt0S an1@0S0 pW Ⲣ1s0S ؀0S R      |P W 0@^S00CS00  S00 P0S`+@ n+d++%8+pp@-PH@P@piP P bP @%8 0/@-o/A-@PP" p00CS" sp s s s s s s t `V 3PPဈP0 P00TA6 0S P0000 !0S0R 00 YYA-AP00C!SaXp `0000CSP u\ t u u u u u u`00CS`0p S X0 X 0 "S  㾩0S`00CS`0p SX0 X ! SX!㣩K0 0P0 P8000 `70"S0L0A60,0 0P0 p +t&8/+Y;@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 Y'G-@OP2 pqp =`P`y PP2 00PF 0P ; V @P @0S@0S500@PP?A P PPP P 0!SPၧ !cY2F+t;%8A-@MPP\1  5@P `p崀  iPu00u0ۍ0 oP 0@ 0000S F  P00 Z%8YI+YSp@-`@.PP 0 H;Hp$PI@pFs@-@P` 僠  R   @T|Ѝp(R( d儠0PP O<P K(P +d@fZ8 tx tyZ<+x0@-@M@0(@,0 0 [@P Ѝ00,x0 L PPPP0S p00@SP |+x%8+d@-垦 (,>Z_+x@-@ 坡s 嗡nlP gf 0P3P xutsUh y XڟKJ lЍ+d tx tyZ|ZZZ@fZ0@-4MP4PW 1<1s0S FA E  0 9 0 L壟DS<Q8 囟,0E R 吟 匟<P! 81PP 0(0S$4Ѝ0=R00ES ~ ~ ~ ~ ~ ~th`\XT HM%8Z+d&90Z;ZZ+xZ\ JZ[[[!@-0 ?@4+d;-@-r-@-0 R   ЍЍ/+-@-zh0 R   ЍЍ/+A-ARp`P@1T pPG`@DO-dM@P0P00P0 0 8`800,@400(P@pP@ `0`,0SW ,0S5TppW $ @@[ W  ( 0 0 ( (cʞpt T+o,00,00r0o0T񟗾 L 4 `  < H X | ( Q 0S0TȄƄ 0S ` dЍE 3  ( 0C,0-N@ @( QQ h, 0C@( ,0t( Q< 0C@( ,0i( 0CP@( ,0aU@^ ( PE  ( 0CP@( ,0Q( 0C@T( ,0IU@E @B ( Q @0C( ,0: @7 ( Q @ @P /U @+80 "(2P5 (j30S!   $ 8 8 8 R/ W (b0R040880(9Z|xp8 8 (b0R  "M $0 P 8 Ï0000S(9@SW ( 1P0C S,0( W@S( 1Pl0C,00 S( L[@[c[N[~[+[[[[\\\*\@\X\y\\\\O-lM($ \PYPU``8@ p00Ÿ   0<02@02 @0` 00J@P dᇃᅃ@  L`@0S( P @lj` $0PlЍh@?@d o00 S @. @ C< y0ЍC0%`]D]w]]]&90 _pA-MpṝP`ЍAj0@: SPPT@ `P00S 0 00gQTP1 p P PU0DsLS<(    $7 +]]]O-0]M-SP MP @p<>P3 00S0W0S( 0S#< ` pPq40S ]ލ ЍO~v/8]ލ Ѝ  @pl]0* RT < RP ᦛPP$Iu ᲛP ᫛;0v: S+  뤳 0P@`YP  oP pd ` 0 0L0 00v  0S0S`- TP``bv `0S 0 JP |V BP `{z R r8MRK pP \ ⅜P x!1[Z  0 P.M[p`l< 0S'HQ0|!0v0 P: v?b  0S-vךpP vyW ]ލ ЍOP-6֚ 0Sњp`P P : R S00 R0S ᦚPPdVT}+%` ]]^^3[c^ ^A^V^l^^^ *_&8_"_+0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ [!P U8IP00S D00S  40 #/+I#NN[P+,%+<%d@-J 7@- Pp@-P @ᝁp 000/+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@   P@ЍpPU P:  唁0P0%̐+`: 4@-@P @J400S@+p@-@PPp00Spp@+A- `pP@P000 PP0 0 7Q0@-@P P0P00S@+@-`dMqPU< 0S9 \P0 @@?T-  + `00@ C 9@ I  0*R /D/ZP10.HH>LP dЍ`J (0@-n O]W+.` ' m 7pYDz ` U;a %,0  +0  }+@-@(=St00S h00S\00S L00S  c400S  \0(=+,%+,%<,%p,%t0P/0( P/++0 D+0 $ ?+0 :+0 5+p@-D0@0S 00S 00S  "<0S <0S 8S0,=t00S  \00S PH0(]0Sp@ DP 0Sp,%++,%t,%p,%<,%/@-0  -@+$00S/0 R/ ,%+00S[D,%0  +0+@-0P4 P1 +P00p@0-0Cs0LS ``PP"0-0Cs0LS rvp` 0  0.S00 U`T  Ѝ0 l@-@P P  P P ЍQQl0l0ѳQQH0H0 Ѝ@Q$QO` l```/p@-P4@Pp@B0S +S:0+Sp@p@@-@@@    0 0+O 00@`/%p@-@lP     <00S   4u @p  +,%$D0@-0S 00 @T@JF@,%P+@-@0 0 0@+@- Bo 00S C0 %̐a+A-PRp@ FpqADFpq PP JPp P`UX@DTUtl@8/pXVt @W@T*U A  )a a a7aN \ah$0 0) 0 00S/+@pp@-@ P 0s  hD@p%̜a|O-`0S P p0崠9 00 ?990 FI†U00S[   RP wP  .D%x+@aP 0S  R 9  (0///+@ O-M`V 0IS(,   RQ0 R005s: 4) "P  2"RgpV  rq$ L$Q  4Q Q 0/x$P 0 {   {`  @`   0 PP 0 @@0(p,`vyf`pzVX!RSB 0?  0 pq2CЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pi09p`2 q4   10SP  09ϬRXW a0SGnC002gAT10SK d10SGPD  H1 09 0( 00*b=@p 098p<`yp  RB 0P  , l00St0PR8p<`0SH00SY K+@,&,%%̜ a+/+,%T, a%x,3|800S 900 //+@@-`@0Sp <)00S000,0(0,0(0+@p@-@0Sp Q 00h@x00p098@00ps000B(Pp 0 %x+@+a,3|G- q`V= P@7U000Q00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00S II(, 0@+@,3|@-P \00S @T  S 9(,0 +@p0@-@TI0 pq0@ @}00p+@,3|l0@-^ 9 @!@&)60 Q@ ^@U+@0 R$ 0@-00S0C0@ S 0S!‚"\0PQU 0000@/+@P00010 0/%̜7@-P R I00 #0 Ѝ00R50 @!"0@@pq Ѝ0@[A+@a0@- 00 Ѝ80098<@ q|/ 00\ /+@A-p`!PP"@i9  @0@  P09   !09 r`A++@@@A-p`VY@  @ @ 0 vP0 0o0 bT 0 0sv0@AN!+@+0P /+@\ -P0S0@  P2:1S0BS /O-@8QM44@`@|0S!U  BЍObS6 .S5 00C S 0/QP @cS@U:y@0@0CS000 00 B/1QP @@+Laa+Lp@-@P 0S`PpPQ P@dPQVL>@HyP0S  p P%̤%bA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SeP@u0C?o2+L@-dMvX*@PPLPHPDPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @u?0:S m?w0cS .S bS S@ @0,S@pS wS ,YP ( QP 37vP@P@P@P0 0  Sx RPRP RPQP hP ^Q0bK+P+\+h+tb2bZ+Lb&bzbb%+bb+bbb&@Tbbbb 0p/+L@-p  01SP R t0 T!WP R HHu@08 ,5@"P0 +Lb+ *b 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @P $ L ƀ Ƽ0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@+L0p@-P@P QT4@pTT@DQ0`VC@S@ T0CQ @6@+L@-l@PXPHP <00S,P++%,%%@-l@PXPHP <00S,P++% ,%% Q p0/+LP@-$tЍP@EP @ $@P r0 噒0tT! _P P0X!P80T@ 00 0 b+b+L@-,@2P-P+%00PbA@0CQP//DA-RPp `@X@@Ѝ`>P@\@P, PP@@+A-P` @P lpP ` L@P  A< $@+rT ggYgigqg~ghp@-Pl@P TPpDPpp@U p@Ppg< O-MM`p 0@P P0: SXqX  wTP  {@P> ᲾލЍ R R R00 tP P@ mP @P fPP 0"SU T 0S0C0 6/ 9TP 0mS Pg%gg%gP P / +s@-P@` "0 00 BЍpA-@Pp4` R 0S Np@g@-P`( @p0` G Ѝ+@-`@ (8R808Ѝ 8 0 CS  8 0C 8++p@-`Q@PRpP0S   $0Sp p@0S S D0V@ ` 0V, U  p@%Tggg $0 (((( 80( /+% 0( (( 0( /+%C-@㼀`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0+L+7@-D@P@@00S Ѝ0 7P+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08~9 80 8 00S08p9++x0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڨ 0`++x@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00++xs@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00S808++xp@-p@XU N8PE`V` D0(  p8Soppp+%(080S @-/+p@-D@0S PX* 8P 0( pp+%p@-|P`@l0 R(0p0CR0R: $0( ip00+%7@-@p@P@P  AP Ѝ00P$ /+0S/0G-0PS`p@U @0 pP0@@@ X P00nn @ P00,%@P R/-@-4@$P(0,0P  $8 +%7O-0PSGp` 8(hS?Pp $8SDG(R008(h8! 0S0S ^ Ѝ0S08R00(hkP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S X h h ܀ ܐ L  , ݌ P P X D xeP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VL"3P( 圓R( B( ( W(PV  [PPl?@oH80S 48PS8P m08880X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0P0J``` P Q`*ZXP@$ 0P+L+,%+g J 0 pC-@P M!00 0 B R   0.S 3 `! P`;HP P 7 Ѝp0 P`000C/ !GP00+g0(8R/+0$P00 /+00S/ + O-鬡MX[$ 00! 0S S`PO Pm@0HQSQ0Z00h@P7 ppP0: Spp{ P)dp0 R'0 Y& .@Y  K0H3  x*/%l#lЍy pP00+%,$ggT g800S ,00S 00Co//+<+8+@p@-|PPF@T p@``kT0S S VS 7Sg@ @,0p@-@0S00S 00SP8P p@0pq  00S Rpll0P@ eP0PL0@p88 SP@3d%̘,%++,,%+D@-?=@Q4G-@" e`T00P  00pတ倀 00ST  0W0 000S T28  ,0+D,3|A-pPC @`0000  :P0;0 A9 D A0PP     P  5X A< ,0gp@-}@Pp$R0%S!S0C Sp S}  ` ` ` , ` ` ` ` 0C Sn ` ` ` ` ` ` ` | 47S ESM /Sp0  00 0pp@!p@?0P S+S@ AP j0S0pwp 0p@` 000Sp p@B0!S $P j$t00Sp$dP`p@&L00Sp7D00`Vp(m'p@4p,0+ +hQ0h hp@-`@P 0p@N,0A-`P0@@@p0P/00,0S W HT T A,0, ,0 \:<h,2 p@-AM0 70000^0  d0  _0  Z0 U0  P0  KP`0S1 0 =PU0 D<<2 40 Ѝp,0hh(h4h@hJhUh[hc J ,@-@0%$0PiP/,0< S /@-0 0J4 Ѝ%9hf@-@{0@ ,0p@-x0@M@T 0S P0`P V@Ѝp`F0PS +@-@M0$ 00@S 0,0@-@@P@-@0G--e`㊋,B,r0(2(0@M0?000S0S  A10S z0S 0S4&5\0P P 1Pd0S P 1rP$0SX80S! vH2U80SeV}Z0PS0S\ /S US S S U U#38>P h#2Z 0S H:1' "1 ,0++0,3|+,%,hvݨ,lhh,%(%%̘+h>s,%,%8,%h/+,% ,8_,%,$% hh++<hi%, +i<iIiXhnQ0iii|,%ii7S< iS0S P0 P P P 00[`P iV 0FcS񟗧 h |    @ x    4  D  P   T    <    p     t   8 ` p    D   8                                 00E.U S``dP ePdP= R0S`Fc 0SP0@_U0q ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  z@0#0P MP 0 a0CS00 0`/P  _ 00P 0Sa0@S @P000S BV!P '2,00 @0S 0|$ -P 0S.P ,Ta0ES000,P ,0 /UPmUU0ESe @ @ @ @  @ @ | @ @ @ t  @ @ @ `*U( @U6 !U[ Pq 0S US'T60S# PP pf0SL`960S 60S0 97R0<  J60S07S ;07S 00#0'D/J10@S0 @007S9 :<#0CSdP J=P 0 i0S e`p!S '0 0R0*?0G$80S  !S d(0 0R0*?0-  0R00 !ı 80S 0R0T  0R0 0!ı  (9 @9 0R00 !ıl90S  0R0) 0R0 0!ı  0R0*?090S  :0S `!S 0P:0S s!S 0 ~ "r L8G 0`jR00 !0060S0 !0<0!eSd0C0<0S d0 !0<0w<1rQ0kQ0 ~ b0S0 !ıd; T5 *N;0S0SSl @ 8< D @< H H< P ?<00 00R00 !ı<00<0 0 00R00 !ıJ 0< `0 0000R00 !ı4 ` `<02C!O?P`~ 0R00 !ıP? ,,P P  0R0>>0_?PZ 0R00 !ı P  0R0(?(?(0E 0R00 !ı?`P`8 \P?pq ?  0R00 !ı?`P 0R00 !ıP ^D3`P?P 0`0,`9P?)P 00,00  20S8V"  *0 P~P U U ?V"H0> <PkP U U -"80 P[Px U Uu M"q10S %PGPd U U.P!0P]l!% X(P0d  0R0L1 0S<10գ?0/!(!0 S00C0 0 4 0R00 0S00գ?0/! 00 0 00iS 0 dv,T00S0802+2+ ݁%,iiiii,%d+x,8, 1,%00S/+Lp@-@P/!$pO-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0T80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 10P R* 06P0   80 cP d [0J0C+L0   /G-pȀWY+p S@0!PPP @ gZPPE0S`0S P B0r 0R R@0`ip@-`R P@ a0P @@@ 0ppM-@Pp M@(p00`Cv RT0Ѝ0 p/e>P0/D p/>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#:  0 ,%<+0,A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 i,%<+0,@- @ @,| @-P@,,|i @-P@u,,iG-,2pW pЍ{PP* Q0`{p`@P 0 ppqa {{? SZ a0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Uk 5 P @U(X0jP ++,j#p@-p@`PP<I,<0RV@` `<D IP +p,|j# 0 ,| 0 ,|7@-dP@ PP 0S  P Ѝ0,|Po/@- + Ѝ/+A-`QpP P P@P%U0P 0 P l @`T @P 6/P`j`gjp@-~|0p p0h hhP 0X X@0L L8P0@4 4 %D%<jx jj jjjjjjC-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@+<+8+@G-@`M0PSS003 @ R S0\R% :R R DZ `Pp P0H3/0S@@ R0Ѝ P/@-频p U( q*`Ѝ00S @  d`*\0PT T Q( 8(pq j/+,$jkk7G-@P`pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S ,P 0F@@%(%)p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`; PPp@p>p@. 0@-M +0 x@sr  * PP  000Ѝ0+,400S/@-$@P P@,$+@-@P  +P/ @-p@''0@-M@'xPx00S@)PaP DP OP AP )dP oPi᮫|0t00SЍ0 x0LP 00pqx00@#)+k`k%xkO-(M0S 0S 60@S Q v P 4X ЍM 5@k Pp 00o pPPP`T#P DP  PPpP0S P``30STPQ|PN ((@(!P3`00P0`0 pP0`0 3P T ( -^0 bwPl& 20SP `JP   @( YP wY |2 pd T2 D2p@20WF0b,2P 0S P (xP11P +&0S )/ 1X cP D^P Pd1 ]L10S P] 010 (0 yq 000Sp 0 :P  0 R  [ R 0 0P: l X ++_k<,%l;,/+l++,&,$+++ ,8% ,% ,3|%l`P@- 0@+00@-dP '@,le ЍO} *O-@P4M(0X0 ,0utP @4Ѝ40SX4  0/Q)(P@PpLd00$0<p P:C   `V0/ ;3p` P PP00@ἳ弃0v V ` VP@,0S4 x3X4 P @6L)X30pW0 0 `P20S Y Y` P P `V@Y*.P `@T_P @0S x20S 0Q (0 S 9 8&PI 20S 0   P @1 0R00S7 P Pc p 4ЍO V0000Q h 0P@ R ~LA0 Pp``rP@,1` !X$0e$0@Q_ V V]P@k P P Pe PQP@ut$0H$0@Q_{( 0S V V0$0$0S 5P@ B`0 ,$,+D,3|,%x,8,%`,%h,%,%7@-P@{P ,0 R  000 Ѝ0,8O-p`4MV0 ?  4Ѝ p`30S3V0V0 00B(4(t30V8PT30S @ T T,CF $C0 PG0000PO00 0 P @,0p 200(00P P@0% 0P,0\" ,00H" RF0 0Rï[0 P P p| p}z0Q Z 0PO,0P!,0 R 1 P 0$00(0 ( $P\L10ST 0  $P @H X XX P P@P PO P@P@P P T0'I r0Bz{0 00S X X0,0,0S0S0b0 P$0 P$@,$,,%`,%,3|,8,%x,%pqp@-P@ SPpp P PL0L`P@0SV3 @TP@P0P@p%̀%̈O-PM@`<P!@@T 0000 00V `F@P0 @Y20S1 ЍO~#pP ЍOd 0s00 T 0Sq G W0!pF0x!0h!0 0@0Ѝ00[ 00S 1 0000@0@ 0UPuq@ p6Puq@ %P Q0@` 000CSed00S`H0`0 0`0@,%hm+0,,,%@-p` Puq @uP 00S h0 Ѝ@2V0 @P80 (, Ѝ@ p` Ѝ,%h,%mm@- Ppq   Ѝp@-P p@`@P@PQp@0pq  Bp@@PQpp@n+0p@-P@` P P pP@000S  p@,%h@-|P @,SQ00Q  B@n+0A-pPpq\u>`vq@A410 `Q0T0A n:nU,%0 R R /p@-h@M0M0P`0H |p P*`0 tp000nۍЍp,no0+p@-P@@Ppp@-@P \R ^R3 R    0tR'jRbR< 0BP @R00 SH# 0 Q' !kB P UL T T U T T T U, T UV =R+` =R-`8 { Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` P `` e0Sv} p0Ps {Lj%,%9<&8nnnnn}nQ0nono?oN$0 RP  /, 0 14/, 0 Q/P/%`@-04 ,    00++++G-P㌐剀zL@vLPT`ppP MT M 5 ! 0 M M @`匀, A-8p@0PS` 0P0aP , @-@$ 0 @z, P 0 R   /,%$p00S/p@-`@m-PPPpP 0S8@pPp  ,%, `r9@-@P00Pl0 0  ;D01(</(8-(4+(0)(00rA, PrRrc,,,,,P/0/, 0p@-@00P0 0R0 .PPPPPPPPPQQPQ(H(D(@(<'Pp P0 Q00, ,,,,,C-頁@0PSpM`Mp`tt!0 0!0S0@ 0  @P$a00CS9 `P U9 0 Ѝ P -0!0S @P 0R 0 0rq U l Q H S  yPuP,%,%`,%,%0, ,%,%̈%̀,0P$0 00S000/,%`,%,,%,%0p@-L@P`0S0000p01S 0v'P, Pp@-`0 p@QX10S |P@@p(1@0PSP5pP/i`P0@@S  1CP0 1C#@)P 0S"000|  0p  0d  0@@PC 1CPP +L, ++++O-M@pD`C00wvP1S{0\P1 0S M 0 S1C10p&QH   0   PP20SK 1SH P"1 sr R0x2q`01UPX20SGXR 1R 0 sr0`pS`K e`0F[K 1RLЍ1S ຆ 0A# R Y1S1S  p` 0gP  00KO1 0[0 `0S3& UzH& 0R 0çQ0pP 0C001萄 S lI  0, ,%,0,%+x,,%DA-pP`p00S HP `P 80@0@D@ 0@0TЍ,%, +xp@-P@) 02PpA-`p@@PGE$1S 0P $@@,<7@-PPP0 0 B01S0R4AB/@D`  pP@DT0CR0S*A8A@D00SV0S P  0 7D00S p9,%, ,,,,,8,$,%+L,$%` 1,TrHA-(BP`Pp P U = ClP  U@10S ! RS0QS 0`E0 0S$ l10S 0SB0$1 01 08P@0$1Q 0S&0S# 0`00S R 0S$1R0$QʜPP E E 00WT$@0O0$10P0 00S $, ,$,%,`+L,<@-(@0S =500, G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000X0 0C0S )10S0 0S  G 8Y 0 0R  x00S U d00SX00S D00SX   , +x,%H,%D,%++,%<-0 R!  ^ !0, 04/, 0 R 00S P@0~0/0P 0/\!4 0 / B  0/, ,%l 0 /, pq/G-p` @PpP 儐u U 0 0W 00V@00CS1P Q 0P@P, ,3|QG-P0Q`PpЀ@ 0@Dt P kV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB, ,3|G-p`P@0@@0W  S #R0C00C0Ѝ #,P  j oF 0 ?pGA-0PP@q1e`EP q0 P 10, G-1@`p`P0LL0 rS00TD`0PT@+x+0, p@-@PPpU P0S0jGp P%`@-0P %`0 P/0S/  0S !/,h00 0S/$0$ R T,h,%r|,A-X@ 0S0dS 0p,0(`P` pU` r0,hrX0QH0H 0.4 00/ 0 0,,h,A-@PU ^"04P4p 04 R0PU R4`40 0  P^P Pp0࠱`  0,hO-2P0sUPPP@Q0Сp`@` V 0R00 SRP@ 0 V 0 0 W0QR 0+4PP@` Y0  0t W`@TP0 00 0` vq &@P PP@p `W 0 0I0  0`yq @TP,%,h,3|Q0G-dpPU  0R0!RS@ U W0S P*P @P P`@V0 0 0 @0 00r  0P`Pl`@W 00 @0 00r  0P`V@,h,3|G-`8@Ppl0Vs 0S@P`%@Ptu TUQ+0G-N@P0pP`xx80p @ 00 0P` 080uqn:,h,3|800S/,00/QQ//,%,%00CS0 Sp0 Se0 p/O-0P-SP Y   9 e^p]P ^@P0S,}@ 0R S%t@T lFC]]]:X   m  0 ЍO`P @@ <@ 0A $ hcC |7r, _dG-@P $}`P( tpP ` } { ?" H @yz  0Z P p@ ;p Tt p@t h [ 40 z prZ |,C-`Ixq p@tq@PP.Y U0 0 Ѝpq0  p 0a0@S@-TA0@S<0'@ Ѝ'P( #P  P ,,$H,$(r.Pp@-: $P# 'P> P 0 srp7 p^P 0 &- &P B06 p"Ptd0`TP@\0 L0Af&P,@m006pr+,n+0,$HG-@p`dP4T#0 5T Ta0'0s000Pp0 uB@6T` P'0,@-o0@-MPg@P   rsЍ08!P MB0 00&+,@-GP0 sr@0 ! 0&,@- w rs @@@60P&6 B0606Ѝ,+G-4@PP`j>T6k.sq 00P6 A06PU p)`AP0PPЁ G-P ,+,%@-P ,0 0R 9 +sl0@-0`  ^ @^TSa04S '0s05S #+,0@- P@0 QA6R 00,G-[pP@P P7`PA`Ap6W @,00S/G- M`pbb@吠吐pqp6W @ Ѝ 0 ~ PU!P P P 0 ?b,%4T,<s@-000mS Ѝ 0 Q0 <@P 0 S#  PPP0`0 S  P0 R pV`PPp Ap00+017@-PU0P( P@ P0 Ѝ000S/@PP @]P@ Ѝ0@H00S< Ѝ0@6 0 0$00 +s(+sJ%xs^sys 0 +<00S/7@-@( (P/@ 0 Ѝ0%+0B@,%@-P M# @0.S [00S Ѝ .0S 00 00S000 l C`P0@  0R 000@0,0s%ss,%sss<00S/7@-@( (P/@0 Ѝ0%+xB@,%d@-P M# @0.S 00S Ѝ 0S 00 00S000q l _0P0@  0R 000@0,0݁%tt&,%dt<stX@-@PP  @D Ѝt|@-@PXP  @5 Ѝt0Sp@- Sp00S p@t# al0p`vP p@Puq@ 0p@ j+t,$,%P07@- S S8l0 Ѝ0ҾXP@T0PP ?@y Ѝ0@v?0 00 %0%4tP/L0@-0@S 00 $0$ @,$+ ,$ J P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P-?׾ Ѝ04@P,0  0 10 % %,3%$,%/+0/0,%P/MP @P/"@-@| pl '@0TxSPLHD@<8@X%9t4tuu0ujuuvv4vi@-V0dSK@S!1 CRJT" R&0CO  R t t t t t t L t @P3 @.A C#R T t t t t t t t  t  t l 4 t t t T t t t t t t t t t t t t k Cr \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~,%$vvvO--@N<M`00PP*0 S 000C S0/   00 Bp/=pU:Y U :TЍ D0!R1@0P S 0,ST00( @0D@D1!0C 0 ,T%%C-PMP M 0-@ݍ ЍC` @?0Sڐp吀吐 G?0PU`>P0P 7? @@ ݍ Ѝ :?%v,TO5w%w /+P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000%)%(ww@@-PM 0  0 x0  @ld P 0S>000D ;0Ѝ,0P <,%H,%DwJP @P/ 0 /wb+P/00S,%<0/@-@0S,%80/@-,@0S0 0j00Ѝ,%0ws0/@-,@0S0 0X00Ѝ,%,w0/400S/(00S/@-pq@,% +P@- 00@ ^S00S00 Ѝ0@ (%wp@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ ^\ @,%,%wx>MxP@-P A7 ЍRS+DSSS 0e C R E C CS -S 1 CR 0CrS dSWS ^S0SM0wS     0  E000 0 FK N R WR Q S-00 0  x8,%xS800S ,00S 0P//,%|,%,%$0P/0 0 0C/,%+0,%@-PU  @; Ѝp`@kPppQ 00S0\Q0S 0S@V ᒽP 00$Q00xf,%L@-0 S 0*( (s[ Ѝ * k[x,$x@- @ =,$xP/0S/P 0  //oP@-/sJ 0LP/,$ 0@-L   Ѝ,$xf@-`MP@ᗺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`xxO-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@s093@!+P0P0U0 P @0+S3P :{:9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  0 p0 @ =RP   R R tq000SPP000p00CS  P ( ( ( ( 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S ,$,$+ xy)x@-@PM @PU@`p0@ mPzPU   c(A R  u 000CSc , h x h h h T RyV)00SS# P|U  U Uc0?o20RP 2/ 0RP0 VW 0 {Ѝ 0?o2RP0U U U6W0 0S00S00W 0 0S00S000ESX RU U U , 0 S0R  c R U2/U~00SS 00S000 S000;S U000 0 yXygyyyy,s@-P`@y000C S0 ` 0 Br ^ ST00T00VЍp $`wS 00x 000S/P/,%,$@-XP H0H@ 0S0S  0  03/$@z ,$% 80S/S/ 0CS/$%O-@pM8Q 0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 0@@Oop B0 R ` 0 0S Wp0p%@- PP0:%/-4M D20S8cP 2     Q2 0S 104Ѝ001 0R= 08"$01S 10S 10S1 `11S(  Q2 T!2 R (10P!000 0 Q R  RQ0 000S P 10S 1[\ 1P u0S} q0#Sy ,0 0S P  0!,%,%,3,3|,,%T%+D%,%@-ُ,%@- 7 Ѝ@-PI9`@@@Ip0 `wW Ѝ@-@9P  #9J,&G- p$@P`0 ~ )  0s@@ό@ p\p3#@- d0  Ѝ(7@-P@2#@/ Ѝ0B@@-803?B3c/  0 QЍbMB@40@-0@@T PP  0 %,&,@-@0@%0$R/ $儼,&p@-04S S S ὦ0S  0 [Q0嫦0S 0  C 0Q/ 0   ^R000 Q\ S$R 0C 0 N0P0000\\   0C R 0 C%(,3O-pQpPpMW My@xcPJTpd3dC  \\Ls  PZ PUA (3T Xۍ ЍpPS@DT2P@  @@~ 0 e(X &| kW@ &T@"0S000P ;04P ST@ T4 Pp 0Q 1T 7XP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P0/ T0p0000,,3%(&8,3|&@T!0@-@ҲP˲P |ƲP lP \弲P ?P?%(")/<@-@P @P P P(@S5B[O-|1M0S" @`0 ЍO^pP400 0 Ppyx@`00S 000S  0P Ѝ 60 000 { % % 0S @`,3,3|l,%,%0@- LLPR^0S @T 0 B,3%(0@- LLPR^0S @T 0L B,3%(0/,30/,300S /,3@-8PP >P>Pў@-0,3//@-L@ p0 P~S0PЍ,3\ QS *0/QR QQ*/0000/@-@P $000000/0S0C 0//@-0 #3P Ѝ@- R@PS/ P >B`Q  1$` PЍpA-`pP@T@  A-P`"F$@p iPQ ,0 0(000ePЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0P00`a0C@S                         PЍp  000@@0 0 0 0 0 0\/\\A-1!0 l \[Pa@1!0 k[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CqQV 0p@]^S @p^404 0 4kp\00,E,Ezop@-0Pt @R RP D D <@D@ p@E @&@T,E,EC-1`pMQp@P0᠁ `0Y 0 .PR l1@d1`0 L>k\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . Cr R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ,E,E,E!,N 00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 j0IS@P R00ۍ Ѝ00@00 S00@,E,E`7O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `ijb`0V ׮P0 0#"P,3,NX,E,EO-`M@@_.0 0\0.> 0j S \|.t>0 xj Q \  x  $ L      0S 00@0!000 0S 00@`0`S 0S @p#S ;S 0 p00@\ uP  P 0S| @,Sv p0S 00@P 0S  00@[VXp T H1H!0 10S"000 S 0Q 0Sh @;S }S 0 0 Xg$ 0 0$ (0 0崮 Ⱞ@p000@ TH 0S  p0 Utf,5&@T,5,E,E%@J`,E /+"  %,3/Db,=,c[&= $ p@YP  0$ 0     呻!1 !  0哮0 $@$(⋮ 0 0 0$00$0 :00܍<ЍG-@`@lp圀P䘐U@T00S Gl0h0@X0 0S0 0 > P,3,E,E',NX,N ,N ,Np@-P @"000P @p%@-@ 0  @0%0p@-P`PUp>@P 00CS0jp Kjp0 Bj,EA-p`hB R4 RR R P$0SV0(  R R K>P$0, xeP000 P0! =PQ$00P0PT0, PP (00S(0 #R nR0V ,0020#00$0,0$0i( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0S $v (0V0(0 00  T0(0V0(0,E/+o^,E$@-@X0  0S 0S00CS0ip X0 o,EO-DMX0`SpM00S 0S d3#X0X0\030 `00d0尓XSXP 00CS0ip XߍX (pP0 `d0 X PލЍP2 -ip0S o70]6P 0L6P tp4S ^7&:0p0p4S \PP iP _00\0-6Plp0`0d 0R00d000S 00Sd @7P00 2 016d00S ++ P0 %d+0+0Jxf37J(g 0h!; P*6\PP h8<P\e ( p$p5\0pp!5 0`PS(00<PX70000t0\`0P l000S S P@ /o"0 l 9(00(08,E*&8[],J,F/+,FNW`v7@-@$P cP@-@@P cp@-@P+Pp0 c@-T`@PP Q 0)p0 y) Ѝ,N@-`MQqM0S000@03 0@ɬ0S ĬW 0Xc 0 0S S ` 0l<@P *0 j; Pg 0 00ڍЍ,N ,E,E@-@P  0Sxc p`\0 `  60P S w cЍЀ,N *G-pA嘁!0`PU , R:(,>0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P     pr  Ppu PE ,  R:(,0(0   o 0 ,N &@TA-@P p0R`*W00 O 0P P 0O-ؿMO00PЍ080?PU 0PH0 \ R0S40P 0!Q0Q0 0\1SP R 0SO00C SQ0 0Q0=0C>S = - - - - - - 1H - - 1 1 - - - - - 5 - 6( - - - - - - - - - - - - - - - - 0T ; 0 1| - - 1 1 2 - - 2 - 5H - 5 6 7 7P ; - - ; ; < - ;S4 0 PS0@oP1  Q Q* S  H ~S 0Ri 1cQl0Si0H0Rl0S 4 0 q1S Ps ^S0@oPfQL0 R: L `0pq0080S8<w;8 00 \04 01<0S EH0S[P80S4PU 0`  EɜP0800A E4 0T P 0  004 0 0  0;)00z040 0:倚R <00sd '0P 0S #0S 0,( 4P2S 0 H` 0S0`V: $ 00@ 9@80S 3 0` H0$P x0 0H$0Ө$0 S9`0V: $ `000 00C 00P0 m8 0R:`8 0\ `S p L(,8 P0   R: ` 8B 8` !9'1 01S:l` 007  90 S0``78 00 g04 0<0S + gP50800 WP80Sg04 0<0S  80S0p4  Hⓛ`P <000F400<0嘆04 ҙ<0S V 0400<058 00 8V04 0庙<0S fL0 R: L ' `0pQ00pY R  Q \5 0L_4000  P 04`Z Z 0Z000 G 00 0 0 VrX4Z 0 Q\ 0t 0 |0  0RQ7 p0V`XCcH0p0<Hp<(0000S s04 0 <0S 4p PA #000Q 0 D00 p0V`0  `0P   P\  p0VX`0 0 P[80S0s T"T0p0 8^04 0`040P0 X0P 0S 00Pw80S0s!h0p 4 0;040P 040P P R0T 0`pL<0p<e80Sb4X_  0`Rl0#0VT*0000pW(p0 1(W$0 p09,E,N ,N<,5,E|,N\&90%`]@th 1 ,E!,E,N$ /+Q0&=,Nt,N ,EDH  !  R 0P 0 pW* 0$ t(1 0X`pH0`0h<Hh`<x0h00 6<0 0R0((Q 0{Q  ,5Q0,N\p@-@P`Tp0wS {S sS 0p /P 0 D]0`@p /P `/+G-`PPGPU00]p01@ R  pPVCGXpp0!S < CrQR2 ? @0 @ @ @0 0  ]0 0 00 00 00:S 0S0S W00 000 0V 0S`: P 000BS  ,N$p@-P0@T P ͡P1 0S- At A AT A A A A0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@,N-G* 0@-MMP.@P  P] .p4]+ . P.ۍЍ0/+AH0  BR Rp RH6 p/&8&9@00CS0 S0 / .6&8@-,Aٚ0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@h,O1@-01\ @T P#OoB\@T P P P QQ Rr P\ p\ P P Q qR  -L@,O0@-  `Ğ\ @ T\    %R    ,O-L@A-pA0 5S$\! R  (P 8!}0  ,P !t0  4PP6 MAӌ<0S 00 <ZP`p夀0U00S 000\P P D @000 :PS-L@,O B&9,O Fp@-@0` [1T  Y4td lP`PT p ;P000ST @&8&9Q,Nfs@-@P 嗝PJ>@P @0?SP@P` kp Ѝp/ȧP@&QP 0S S @ꤤ0S00=[ Cv@-t 30&9@-0@<TQ T00 30001S R0Slp@TX` T@0$ @H43T(8  @,3,O.&9-L@.8@-* 30&97@-@P?  N0S 0@T 100 Ѝ0+0"S p`@-@P  p ZЍ.<0p@-XPP%0ATp0 "R   DS " @DhAp% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,0P01p,,01//00/00/00/00/00/ 0  /,( 0  /,( '00/00/00/00/400/00/@-@K,T00/@-@=,| 0  /,T 0  /,T 0  /,T/00/00/00/00/00/00/00/00/00/00/00/00/00/00/'00/a00/00/~z00/ < 00/ '00/1s O /gb@-0  0Ѝ@-@ +@-  ,r 5@-0S04c  +@-  ,k @- 0,y,| @-,|( 5@-0S04c,| @-: @- 0,Q,T M@-,S @-  ,R ( 5@-0S04cy,T < @-  p,4< @-  g,1 < C@-^,T< @-  V,3 @-  M,3  q@-D,\ e@-<, e@-4, e@-,, @-  $,4 @-  ,z @-  ,2 @- 0,, @-  ,4 @-  ,1 C@-,T @-  , $0Qa @-, @-@DwP d 0   aQ0 0@-0 |1ӈ, p@-`P & 㔏xN;l|PttD@ P < 0@ S< 00ppp,O-F%O-,M@0P0 T; R0AT 011!0 S01  R01;aP g,0S  R3/00S 3/[1P  SP \0P 0 0S^`: p` 0 011S`@S0` $0uP$0pῒ$0P``Pp1U00$0PeUP0!S$0๟000CAP PCڰDPA_A$ Q!@ Qʒ` 1  pP$HH >(0 `p0C0CS0V`0Z `1Z츟0Zm` 0 000 0(%0 "P P SV`x 0CÀ  S CUPPEPE_P0 xP ;` 0 0@0 PCČP M}k1 0 x t~ Q 7x!눷PgiZP Pl7000F<ᚆ! "1 "0S SP 1S b !ġ1S 0C" !s0R11$PULHfrpr0 \xP $v ~xc!`P 0PSY *E 5k0 k 坐+뀥Y P|500xPF qPC >P' dP% <P f SuP5P 0CP  @@PV 400C`F V$P P P0S p400C`N_}m1ST !0C B/!?1AE_xP00 S11X@zP`PxP@a@1S50200D(PZ) @@P { 4 ~0@S 4 zX  zX }D zX z zX { zX zX zX zX zX ~ zX zX zX zX tL3P#0CP?P* <P >P P10!1 NSPNQ0^ B жr0s0Ɣ P P?@ "0C S񟗊 z { }D ~ }P {TYvPr P1aD P w#|1S'ʰ1 D P uw|P c00P1 RE40S 3/Pg PP g P,ЍPR0j {^ 0Sp0W 0] 3/pW P `fD P 3w g `{g00x00A>0 b02P 00P0002b{kg,OG&9T-FRS&@T-F&@P 001/,OP0 R0//,OO-p`*@PP [ ! 0P @ Ѝ000 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,OP/D0 R/0@-A1 P f@< ɔ,OO-Bp0 9$W i0p 0005 Ѝ`((0S 0S >pP Y000 @  S! S0 30S #pP tY qY 0 0 0 R @ S 0 pP VY0S PY0 00` S P0PS PH0SPPo0 00o0S ot0#?C S 'YPU  Jl0X!0Cs0S;3PP0 PEY,P &@T@ UUUVO-$MHZS  R0P 0L`gDp@ =0Y0 0S 0g ᠀hՎPooo@`0l@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0ikoX 2 h0  B࣍1V P0{ P>  PN P P!VUA`E DU{@DP`0th qhnh@`"PD P AP;  JR !   ` D0-{0@0!P`1 V0p00@  \-`<\z`F`FV0p00@  DPE{@DU`E¨` Y @ @T`— R    BX0S 000 0 0$ЍO0Y S ,P (2k&@T&9A-lP`Pp `n@n@0T G`P@ P P,P @-P@p 00T0) Qp@Ѝp0 00]0 h` 0@ uzN@t 0P ⳶ & l,P h0p@-P@XP0Ps H` R :P 0S@@Q@pu& l,P @-@kA,P 0l,P 0&l,P -@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@/+@-@/+@-pP@`M,0 0( 0 00`Ѝ@- ЍQ0O-M P`@pm@mUjT0 0aPe 0y!D0PSY 0SV L00SRDՌPPL00PTP]y@DO@W ;p pPQWpV`KЦo`0 S`K0 r@PC@0 <PT0 0P00L00$T @Z  hs cxccЍ00D R00S 0S uL0X#3pxrP 0 9s똰G;Gee c@0 EGErdP`pG"G`ee,P -F@-,, ($ +ЍQ0@-P@`$0 0  0 00`Ѝp@- ЍQ0@-pP@`M,0 0z(~ 0 00`Ѝ@- ЍQ0-@-00c g :Ѝ Ѝ/Q0p@-Pl@lp,P @-7@- @MBc$HYPU _% {! bM00h@PU O%T k!RM00000S$$崿 Ѝ0,,g {, ,P0&9 O-DAM@e!PP4q@ &@ A!N9 h@(Pࠟ   PMAߍ`V e  o`PX Y  @ =R@8@0% ` }@T&9j! 1@-s0O-MM 0p@X`P2 yPP* P nP 0S0 07    KPP偌P 0 Q0 0PۍЍ0P 0 ;0  0 ;  J ,00S/ 0P rL@-,,@-TP MP <IAE(@"Pq@g J A-@M @ˏ0S0|3%P,  ⾏X0S#X|P  b0Sl Y0] y)Pe-B@PaD'D*&B^&'ЍP@Rb>JP'P'20S %AP'.eAp 0$!P8>  X $P 0)AT 2PP ~AP p`PP 0q+Q Sp 06&V`T(p`AT-~@p0T-:W?Q  R@4Q p0Q  R@AP`003/P 00  h0S  R l 10!@@P,,,t/+@-MM+@(w{+(D{B+(n{B+:{(4@PލЍB+@P 0 T @@@@@ @@@@0'B(?  3 -MM+ :{+L {+ 2{+0z ?P  >ۍЍ  3 0@-@M s1@@$#P @  qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$}*@P3&P/[P+W@P'@P# 0P} =}  0S 0_ Z'P @P4o0m &(Y*00,,b  -F-F@-@M 0@@ ?X#P* ?@d  q}P 00*!R00$Q *@P  |0S 0` 'P%(*Ѝ,,O-`M!  0X#*0S ` 0 SS 0~p0 S00C `@o0 S:։PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ S T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 {y&@T7@-@ PU H! KI00 Ѝ0llnP Xp 0!L j ( 0$[+,  ) 9 D ] *Qp@-P @<00S   0 p@K7 0@,,,7@-@ gPU  H00 Ѝ0PP | d00S .L 0H[꒍%0 ,,, {! i z,|s| * &9s@-8Q`@;k Y{ 2ae|`ex 'ae6e`{7{g 0 Al@Pxx6wP BA)`,` ݅k{Ѝp-F/+&9 O--{MpP`ȁ 06p F 0S  P R  0S  됵P ~뀥P ~qp@T Pe(& D oT0B? 0NF,P "G@P "G00廇P嶇P_; P  lZ; ;0S ;-P ; 4%E00z4"0{ߍ4a3 ,&0z"!`׋؋ 031,0l0,0L,0   L 0wP600Pz?"!!0 # m PV  YP*U l @2 0S h2P rB0S hPU L ^P0  T 0  SR CA1P } 1 *V 0I2_z?0YC0P0SP @ 0V0 R0SQ e}0S/ iP ?_yk  PS 2  ,&Dtptb @f,,,  T ,2    %, J / 6k0@-0,MP0 00 0\PPP@P DD@0Q ,,Ѝ0@# &H&9 n,, -O-piMs?!0kWP 00iߍOЍ/l|@PX1P L!L0v0"*@P jZ`  PPW0FSV030#Z0S c00W"9F!` zP Pp0W0#FU80P , 00.*P*,,!  -O-p0MT@X   p$p  `V X @M'U` zPPDP-@P AAH E0SPU 0'SP0U*S/ ᓍP G{ [ 0@ 0 0H0 bP11Z x0p`PUQT ( 2S022SP0220C2   S`` x$00 00( 0p|W  @0   (PU wdxd(c0U 2 ]W 0X0C?o20S ]3b$]Obdx@0Uk]]tx00CS0000E4T0U Z$0S  r7{UhWxi 0%S @SJ B* B⎈D0 0z/00L 0.RP 0 0˄PH00ZpA@P 0A0 0X3 4QH7g7Ux00X (Sc@0U Adxz  0UX ~a ]awqS PPW  WK0ЍO Ѝ/  T  1@th-F&8| 0@-CMlj3PP 0S .Qy@P 4tCߍ0 Pt ,P4,Q3G-p@ 堀堐PB`AT:00Z W ,/Z 000 _yP EQ 0 K@ &@TA-`Pp p@ ᮇ ,pQt P8@,R2A-P|@yopl 9t0S DQ0Q.SP @$ $s s,P4 Oj,Q3@-M 00PDP   t 0PDP  s p@ ( K s ;PUx@A(  s```p @z(PPЍ s s`i!,T2i%,TP,R2(i8,Td$5O-8MXd0 @VsT400剁0 ,P40,   -8 4d0 w=C$ C><TrP, 0.̟ Q(<P 00 ( 0 0uPPPPP:@<,`0tD0D,Dq,x `<I /  0p>0a Xvr  匂PP\  冂PP;U 1sS 1lS;"000 H^P p@ v ! HhH Qp0TKT[T{1D+0~, \P WP RP MP HP CP >P0:4: @p A*`0p 0HA8wp H0St:t*10ll N'P 0H0 H0A wp 0 APPH , X$U x ]PPP@;P@- ,7r)0xW)0wR݁P\8 0\8UXLy0 y@T. 0)0z9 ;ā@PEPSPN X0 #\6SE p0 7@P: 5 |t h[7S'  PH@A07@ P 0(AAP\XP@Ps:4S 0 zP 0'APxQP 6P'`0b@Pal\80<'8\8P,W 8zq8 _vP0&08P 8hq8m MvP0060&S\880\8P 8 Pq8U0S d&8P 8Aq8F &vP000S\80\8/P0S\80\8P@sT %0}D\8%0|<5T$A Q0:$R$ Q9ğP \8şWt^ H4   4H4SP  0@?S @P p4{ 0Q0:$R##\ğR#$R#W%HR($ 3 ( Ts0S1 `P 2@T QMHHj#00S "0S <#|w[@3S3 TE 8"DC?00N?C0C ,>$P0  0@F0@P^iP$A?p@Px080Ca@,0,P pY0S ,v~ "X >0S@0 < X+4AS< ". 0 0S DT~D"W5S !#o0 0S $4~"XvXz,P4  ,, )&9 L9 d v&@T&h $u,R0,$   J i,Tn   a 1 !,R2 *-  x },Q3,T2,Um ,V!        # > L O T i ? .  " L X,U , S ,U,TP W b m,TD      ,X  7 O _    P 01/!Q0C-鿏P@,Mp8P3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ ߍ a   @-p`CM|@~PlP#d0RXPP @ W<0080 `0(PCߍ aQ0  ,0,4  ,|@-@ @,@-0  0 P @0@ 28 0/P $  Ѝ,0 X,2, 20@-0@XMP0  0@ P x x0 t0Ep@1P0/Q   LL 1 0/R@, ,@Ѝ0,P4 h,0,,2,0 2,t-MMZPO~P  n n0 00SލЍ\0\ \TP L0 (0< V0, Q,T },0,1,t,4,z (,X [@-RCMX6S P \8lP XoT20S H2\6S 81020"!(62`Pr\8. T^Y10 A>:4S !74\@C10 +:4!SO *00 0 B ptt1@P) *1d TL < 0S ,!,$!$0S   =DP\6S V =btCߍ 0 B,P4 OF d,  ,R2 q,R0  ( c,Tn  O,TD !    ,Q3 ,T2 T ,U  ? S @-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0PQ0//!01000/ 00#0//O-`$MPA@T +{ p|P00 [0S 0S0S$ЍP P00 S |S, R ,0S R : 8 80R:P#3///@-@MP M p" :  *`Ap  Wd5\\ SS=S 8 d3R 0 ,b0 ]ڍ ЍTT  #@-`QM p@ ”P  PP tPЍ|PTP0 p0P@$U@@ZT @ @0 @a P 1 ' ?OO-Pp0@0Mw'PP `ĐĠ0 R * PЍ 0L03/P  0z놁 0 z  @$0S P @k @k`, Kp@-P`o0@0S 0p@*@-0MQ!p0`L0 3/P< 0t@T 4/@0 p0y 0y 0@$0S @k$0 @kT `@zk @vk@y0S0C@ ,$@ )Ѝ, ` 1 (/+0S/p@-P@J 0000p@O-p@P|M YE0P,0+`u,sP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00PpP ,0<<0@D(@0S =P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0  H@-Z P 0P 0Pp PQ` QTyPQH "P <080P/,/(//!$_Op@-8@Q0@P@DPp 93Pp&p@-P@P  j [j00pp!@-  p&@- { p&G-@PMP N/} ej0 0 s0S1 0S XP a,P ލ~0S ~0S1S P ,yP @l0 1h0$1d0(1`0,1>1S nP >$0`> @ppԠ( `p$p ` X D$0zY 4 P 3S4 c 3} /}0000? `䀍0Px Ru'R 076`>0`N C(Q0Bn Q? C0PP LP GP  ,4101PŸ "`w2P  @000@A0"` }0N?P0(S  0C Q 0 >0 C,4101P吀 "0!`9J` |KR |000`811!$10 100-!(, X<@ax1|P,a( {1S%4 ␐0! 0A 0{ ,001 "P `]0  ,001P "`I0\ n ' q%1D}P,YQ] |Q0&@T  '`Q ԭ@-PM`p PP 0Op u@P  xPP 0Bp Pu@PQ 7/PЍe! 1@-0 0P Ѝ @-0 0PЍ ߰O-aM,MQ 0`aݍ,Ѝ@PP $xPK pxP0 QpL4PpUu80$P 00S 3/p0$Qrbb>0Eo`YG_FPEwP 0000!(9PP 00S 3/pO003/No,P4wP (S("p+"g bh+bg`@vP@``VBsaV>+"g+bg3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   g g0 0`PxqxxU" b +`P  P|_P"+"_gb+ "`P 2wP# -wP (wP #wP wP wP VxT .g  *g` (4P n J !, , 5;6 56#/+ I e- 00A-p$0p@` PAP0 @ p> C 0 1/@P00pЍpP@00003/003/$Am O-PUMM.dh,@4PUz.zQzQ_$x($Gj+U`V`(0$S^ 0(0(UݍЍT  n? 0.07 00P00@P#Ppύ`40z(Y^ 4S =$7h400C27\4=1 V =V?h400C26\4=1 0 000000000 00pp`\ , Y0440|40s -1yv0 00 00000 0zp` 0440Z40s -1ଔV3 `v00. ndE "9fT5@0Y^ =2XL=1pP0Nόeph \  v00$? 000*0(0S00Ӧ?"N?@/&#` C6$1^(1)041 $,!0 (q,! 48qHL1$Q pz \w^u 2Ÿ@p"0Ÿ$1H0!$+ 4p2P p>ؠCT g $100$10 0: z0G80 ,! ,6$H,@JS  GPq<PK ;ISG 0.$10B04!8C0(1}1S0}1$1S `4@@,-F&8 $Z/+&,, ,P,Q0,, _PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0   /P s Pp ,{*'0$0 ||$(pP d4\,G ܍Ѝp 84g0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕 < Sn "Se S P0~  R{ <pWv  &P d0S P"8H8  8Rd0S $"8\0S  "8`0S !8X0S! S! 80L0@ \Q\0S ` R !8x8 ͔lQlhǔ`Q`\TQTP⻔HQHX @1R<0Q0}P00P0)0YP0 U @& 'pPv 0Q  c,  'f  J 8 k , [   e   )v(  t    " (  :  F N  Z R :  ^,O-UM0M*a8V"e&A'@n& pepV pW e&0 T0.T @Q ,{ލЍ9 )qWd ^P FPn' kP # @{P @p`H吴 XBT0SXd \ T 0S 0$< 0P00,0P FgP14s10#5:# (&&&$&0S && 2_i orP0Z@DPa@  pg `V  H `p80  P 00 ,0ST0 S00 P0p800SS 04  0x; 8:/P00400ST0(ll S S d T 0 0 0 0 0 L  Sc  SV 0 <0rP<0PL!@  PP ,0$  40x( P2 } ,1PP qP 0005S0+4^b 14  u 0R0s  jF%а 0İ 0, 8v,,    Q0 F1,  + E ^ ݁       O ] _ J h m u |      " ' d {    FO-@AMT MXp P`L D@P`T $9P```fPP@Aލ Ѝԃ̓C̳ @3 (4@$80DP@<@T@X P \430$3 00 2 $02(408@Y P 딢娂  t208@d2@DDAT P2P"PPds#P <2 8%PI,2 $ *20)ATp !0 yP&!,%0 Z@0S k#P 0St H0@4 000@0x;8 8/P6  %P !^%@P 0  p @$$0 K@pW:p@!  F6  ' C   * > 쀶m R! x, ,/+ 8Q0b8v0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB,Y,[ $0@-@"!Q(@,Y@-$@2S 02,YO- @P@B`P@   PP@ Xn@p0Ec#రPU* ЍI QP  QP @BI    R0S Up&@T6@-@00 TP Q P 0bЍ C-`PJMM⼂```p 8s@4PT_H)PeP8_ Yo`GFWI `oP 0 000!00P < 8<1P#<@XNo<0S0 0< 8 `PV 40,0G1@ 01A010000 l@@@@,x@s0S7 0S(8kJݍЍAT+P0 8`$!QQ@0RT<0P 0 003/@#S0 S(0S 0S83(0S003/@#S@,  ٬ H&@ 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-Pp@`4M0S4Ѝ0 0L03/P 0 0@P`180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o 0@o/b0 !!/,_10/Enp@-@4P0 `^1111p,_O-P@p`ԐԠ԰0/ C !  !0  Pq00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ,_ #   0@-P@M/.q1, 00 0d0@00 0T0@@@@1 0 000@BP, ߍ0 ,_O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  ]0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAPE0 \A0Q     TTAU @@,_ O-`BpX1MSL2=X\1S,2\X1S \QUЍ0C`1^`1Sb`k1PS \1 XX1! 0`1V$ 1x C H0C 0gP 0 S 0.S  ']Qp `Z!XDP `0X`0 05`X"`p\.P \!Vp000: SX1x 2 \1` 0R 0 X1 ` SX10 2 $ e\,_&p ,` 4 + @ J p@-MMP,jPoۍЍp&P@`+\ P*+p\ P*+}\ P*PKPs J p@-&M@(NpK`P7 i<0 0j P (O7(O i9_ <4@P  Bލpa b,|! $ @-X@01SP@0S01S0  ,_  O-p@MrP! c0   0`崢Y p` 0 0RP0SߍP X%]P0kP0 a0CS0S  0PU`08Sڠ0S) R& S^0  0 a00a p 0h1劅00 0s0Z+ @Kp P` M0P!h!R( 00@(O v 00O0 0S* ?0!C s 0 00t00 00S 0vUa0 4 ! 8 @dAde,a !(,_ /ԭC-L1 @1 R0   A h9'Q   R 0<1LPDTPapH_iLP [iU `1DP1 UiU `1TP1 OiUP1 `1JiUp!00, p@ ЍC !!,_! Q0 @-M@ %P @oЍ@-| 0S lP \0 T0T 0PP0L004 80<( Ѝ Ѝ, !.,X,T 2,0 #a,1,t@-p@Mp)t90 0 0T00.00 01t9$ p0#:! Ѝ,_!4p@-Lu<@0P cHp@ !S-?@-P @ m R ,%0$@FuЍ0@ Ѝ/ !g !@-0  0l P L0L L@ 0< <@6|0 $@/Ѝ,0 -,2 2,0,t-3M M TEP0  4iP io3ݍ Ѝ J `-3M M EP3ݍ Ѝ J 00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,,,\ !,X,3,T ! #a,0,1,t@-0  0 P <08 0440000 0 Ѝ,T !,0,3,1,t0$ 0!S/ /,`0$ 0 S/ /,` 0( 0S0 10 1/,`,_11<0@ Q !@-0 " !/,_0 10 1/,_@-M/.l, 0l0d 060 P000@ 0@,bߍ&t ,_0D D /Q/QQ Q/,_&t@-@0@ 0 0]PЍ !@- @0S00,X !0@-pAMihPN @Y  P<04Px9d/]0Aߍ0 !,_ ! " ,@-P@ 0P  Ѝ,-@-   Ѝ Ѝ/-@-\0X0@P D  (Ѝ@Ѝ/! " "" O-@-\0X0@P D  (Ѝ@Ѝ/! "> "O O "o "@-4P P P " " "@-@fP@ bJo@-4@)hP 0 P ,T,1,|@-4@hP 0 P ,0,t,QA-@@1@#PP1P#Ttpt` aP t ubW!T!??e8c8[A[-F,|7@-@.P @lT0  Ѝ0 "&9 "0@-EMTP@ X \P0000U ($$0x:@9Eߍ0,,_@-pM6hA WfH1^= P0x ,! r/k<[&0P H ` p 0000`0 0PP`PC&kߍpb023&kx:X JyP (W((J ",_, * ,` # &p #/ !@-@P !0`Rxz)gP PP txZP`h 1 F T /01I@0Pt@T 7*Z Ѝ,_ &p@-@<%0@- 0E Ѝ0@- 0; Ѝ@-0@M00  0%Ѝp@-P<@0/SpQ fPp@&t@- 0P,4,0O-$M@Np`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ #FQ0,( *, #I,X,2 #gݚO--,M`d$[@op[FpPd ${[P@bcT00S@ dPPEUM P1P!PPh$00  @$0VSS00Y00S d 0 C H C$E[0 0$0  0 $ VRR   Q # 2R @D i0@Qpd `P$ [@,Ѝ #!<  #A-`pP@P!i gPP 6/ApO-@ M$Z`P Ѝp0P 0`jVPPTP$Z-@- 00Ѝ Ѝ/ -@- 00Ѝ Ѝ/ A-p`PMMP\' pqp@u@ FRV ,(($$cp&  0Su 0CS2PJS0)  0 0S8 0S r0S 0S QN@|P$ 0 \0 L@nD2P 00b0C?o270 姏0\(G`0SލЍ!7SdP1Q! F?p@Foh!H1Pg0  0M(%' ) 0S q0Sv 0Sr 0So QN@fP  00 @PYF? Q. QxFEHn #q # $ #,o $ $:,,\ $^ 2 $,V&pm a  Q0 $E,z,4 $r *a *-MM P  P  ۍЍ $-MM P  P  ~ۍЍ $s@-fP' PbP l%P0S 7 7H 7P 7XP @D`HP P@TTNЍp Oj $x0|+R/ @-d|+\0XT0PL0HD0@<0840,_ $, $, $,, < ,,P@-@ MF @0W,|p@-@M L(@H@g0 #,0H ,0@@08hLPp0: S HcP T  T܍p,\g 8XgQ @P@Pڨa <PT81!0f|8<DQi T1 08808PP oQ #P00S ny < R t00 00000 00l0p@ m(t(0S!,TpY,0,1,t,k %!J' # ,,X,k( $O- 0CMSP3q ` @j0!`JD50`SPW!000 @ US@3/@P CߍW! 000Z 0S X 0 @/T W  00 0  0S l00S \  P0W0 ! !  000,0,2  , % %;/+ %d, %,_7@-PQ@0 SS 8=0 000] Ѝ02S   % % J O-(UMp !4Q  f#ß0/SCP3c0ЃC0P/UE=# 0SPNW|C1 dq` PLP$ 0RP GP U?^ 0 10S 0S6 0 1S20S lP`F $l2l)E2)UP"!0 a4'0 0J 0R RP 10 1000`zRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 Q1 PKP 1 =T1 3P  #a, %,&t,_ % J & & & & '-F-F,0 % % % & &N &z $p@-Ph`@TUapUP`FP  xp&,/+O-`MMp\` `P ⎂PP0P  Y/@ڍЍ sP kP 3PHePP 3P2!Tt" @PI)!2@ <" a0q_ `P0=S`  > ¶P!!V (P#P  Phx@ 1/  D$P@ "/+3 ' '/'42@0p@-4 P@:d0 Pp@@-G-`P4 'd@T$ `V! p0F&04 p0RSP pPp Pp40Su p OdPp@T/0 R/@-p`0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PcP  p@J@-@ ]([@XA-P@p`p0S 0pp RHAE05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8pЍP@` lp ^p   0g`V{@ t@ lt_P\kP LgP @T %1D}PQ0 'U] 'Gp@-PMM`; M p  @p 0 A H0L0 : H0L0 3 H0L0 , H0L0 % H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC !SH000050PpG0  d 9/ 000(0}0,rX ^ c |,x,Q0 ( ( ( L L L oP ( ol a ( ( ( ( ( ( ( ( ( ( ``C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``u0 0pp07/@-M0@ 03/P 0 004000 V003/ލ@-`,MHP @J@0 0 0PP@900 RS THP pW YP00P00P0,Ѝ @T@0/W/0  0JH P00P0&@T<0@-$M@D0X  0P 00 00,0PH0Dd$Ѝ0 (G-%p(M@PV Xa `P`DP08 ,`SS0 Q "S `P  P !X$U0X$U ` 0 [0 00 00 0% 0MPP(Ѝ N!` )! ) MPC-40PS,M80S,ЍS S S !S S )@P `p䐟`u`X 0 e000 00t 000 0 00 0 0MM`P*#! O b O8O-P@0p(AMP U  0唂0 `!"O00(p1 "DUP 4P H00 P P H00P0[@!} 0` 0 @ABqA0  0|!Cg @0  T!-] P0  ,!DS`PpVP@!@3Q@VT -`[T@D@`0@@< 0 0K-[0 0@`0P Wت.$l 00@p `IHAߍ #"0P0RPPQ0,xԭ,rX )E )O--t5AM0DpP$sPN G@`PD X- @D0 ,`4 S00,0ñXT, 0 $0p0pC0@ :x  Q * Bq Bq BQ B` B  0Z 0@ X@@p0 0,(0 @@@@@ p@@0`PUߍ 06'0y pD`∀ Lh00*8b0A-0<0@SH0`4 pUV09U?V090VP:0A!s0S/A-@P0\03/0 0    `0V R!  B B" OA10C)Rp0!YP! 0 `OPPp !@` B".A00080000$0 01P0100Au wqO-P@OM H(SYa1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@P LşT0@0C0p0NC2 VH0 0$ 0 RĴ V 80L0TX 3/P10 00H03/ 0T 0000 3/P#%#& 00t80x 3/0lPp X̍X 0 0t30l3700F00, d@B= 01 SH0 V p .4tM` PP00P00X00 3/088q0X 0L03/l 0 , t T x X h H !0T`X 006/P d0 !Q`0 00 !s"D  V p0 B?D!2 B"?1ᴡ0C100C0 gX `V`s`V T00 03/P0 0D 2#4`0Z3 P0a d!0` !p D00C?D!2 B"?10C10 0?o2100C0> !V ,$!!h ^! W QA-Pp`@f!0P  p0Q pi?p Ws`P !@ B"S? WT0 01`0(`10q0000ᙾ" qp 0S/ LP0 05/0P0 8

0=C0D00 N$xU 0S  T0Pq0 000D0P0 F0PT0S x@PP 0S00Q00`Q0S 0L0 aA3/P 0̀`0`0 &003/dP`p E 0 g&` @o/cNX` X 0 Z0R0 ` <0@ 000R<  0S8X) a`v0"$0$0,0.0,0$0'$0倒 D0 +N0 px 00 N0 80 NȐ0  x0h00l010h Ht0pM+D?+ ?L L0` S*pV 0 TpU 00 0`Tp0 8TpT0P0'$0, Q030#Q0S $0( A(0b2Fwp0 ` &?00`P3/ ``0``P.VLPZ0G X 0@4`8T(Oލ Ѝ, * * *,x * ** 1 *' *@-@! "  0 Q0 "ġ0S "O-Mp P$ @ `|1/0PU0@5@[0Z@0 0BM pP 0PPЍ p> C 0 1/P  0R$LH R>0$0 R 0S P P 0$003/0$a,$0pQ@-s㴻㭵 #"T R0//s@-(@T@ЍpH>0P:0 w003/@P刻ふ/@-tM`P @P0 p@@#P  30@Tp@tЍT0 @T|0t dl0l p u`P L @=6,0 + J + +%, +; + +G, +T +b/@-x 8@5 + ///@-0@Q s@o?0 \ 0P000@-P4M0 @MT0@T I 0 ! @4Ѝ0H@0,//G-pP@`㈐VT0S0S oIP$1L0PUH0 0X H0 `p@ +,\R0  /p@-P@G<0Q"4` 6D0# A@$!9p,,xA-<`P@1IPp( v9 A,@-a@-p@-@M @L0 h卺0S Y`L0LP0VV 44 0 ܍pc,T + + +1G-1`PM@1P1!!  xxaxatt0@Pl7TmPMOP0 [ߍ B1iB?AG HpP0=SB5G?q@ B?`@P b B⁞Pt@t P 0 Tp?D j?:9 "| @ * +,,/+ + + ,1A-1P@,dp1P1X X T`T`  P  @B? 00c,,:9 , ,& ,> ,Q ,i@-0M02000`00Pp0@P @T 1\ 1TO/11 +PO/11 Ѝ ,|R; 0@- P ,VC-`CM P@ `KP pܐ܀0 `0`F0SO/11 Cߍ5S  xl lPX \\T0S  <41, 1,T ,,S, , , , - -$M;Jp@-P@1 1  p,1p@-P`垸@P嚸0 p@ -Ep@-P@P PN/1 1 p -QVp@-P@1Ͳ1(1 P1 1 p -`V@-㿸@ -QC-@aM.pJT[BP`᠂rU U.z20P$0 _PZ `"0(@80UPW @",PU , E 0m,P@EPKt1PL0P P110PU)!,`pApP0S7 S1  @J 0` 0P@P`1\3PP aߍ@[0!TPR0 ,}(N?P0@9 ]DR9 0 0 0F& 000 p %@p&,,,, -| - .=9:,S,T,,5 -r --F-F K |A-P$p+@P a-@T   P( 0  P  0R= P VF@ᲹoЍW\\x P< 0  .>,, .N / / .l . . .h//O-0p4`@T Ѝ@T@T' ^% L U[Z [ԡБ YZ PUPE P$P P@B0"/,O-4Mp(t$ \ ZX0,@P @ PR00d``p ͱV0 0!D0 0VP @ 0DPU@U0@P!00000 00$ U0 000Q0#02S 4Ѝ; 00 0S  R% S    0@   00@VP00VP @ 0CPU@U0@P RG RD RA ,( ZQRZ3UU  Z 0S0 0P@V00VP @ 0CPU@U0P@0U00P@U Q Q0   .0@-4MP!!0  P P!P@4Ѝ0@/@-@ #@Q /p@-P@/LP `@ HD0P P `Ra BQQ pQQ 0@S:p @-H0RH #@-50@-P@04MSz1$! PP Q*   P +U 0@S Q 0S4Ѝ0,0p@-@ ^T00PUPU' \$ST sp 2@Q.^U@P@$ @  $  0 00C 0p0 //~p@-,@PG0P ;pA-@p```P匀0ST 0@P"Rp@P!`, 00S@- /,,PC-麋X@(p,P3`$ 0АYĐY T  T: X0WaU|U VP P 0U Ѝ 04V0   /{ / ! !"@-@P 0  dF!@ M!  /p@-P@0S|T0p 0 Tsp0"S @0<00Rp( T4p0 ,,,G-lP0`SRp@;S S 2@1+1:X 側p  QBp\T.@T&RQ00 00(Q $Bp Q 0S T v3 0@1 00 0TRT0T"1,{p@-P@q@op1O-0@Sp`P 0 PQQQS SK0UȰБ r0 $0 ^ 0 "90(Q $iBp0, 1QX#  E vQ 0530  R [ R pR H0H HfE R# Ѝ 0W1Q:P , /! /p@-P@P0St!U 0E p(0"PE0U055403 0(2#p,,,40@-0@SZDP0@0ӕ,!`A-AP0`SH!U 0E p0耟@SV Ѝ 4 U(@0`P `4p00 0@0FPp0P H pV `00 P0'p(0,0`,,, (s 0 1A-0PSp@` 0 PQQM SE0 E 2  0 !Rv?0r00  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` ,D@- @⡖00S T ]ʲЍ1O-X0MSM2"MD\0@S2"`0Sb2|"d0S2d"|h0Sl2H"hH 10S@780S 8( SRM80S 尵, 70pHPASTPPDP @W@`P- @ \00`0d .0xh X hd;S XxH!H@0dP@_oRݍЍ 0:S 000a 1 0 0 0 0C0 x;0CS||qPp 0!6 / 0) 0B 0Z 0u 0&@T0y 0 0 0 0 0 1!` O 17 1G 1 1( 1 |p@-\P@0S 0R;)r00 S0@0 N Dp,O--BM MpX\@P 0 `^ ;`( p Bލ Ѝ80 JP  Q 0 0d!K`ppq0 $0!`4X00 (00Cv$0;S P p垺PT +RQ 0P \P SA0Rpʩ0S S 00S 00 0`S0S 0 ű0000 0P 0S  0 0 R$ ?!"S0S "mAde 1]O-DMh`lPPDЍ+@P >4&"R p 0R>`P0+"R G>p0 d00\ `0h0x00X `$P`Pt0 (04H000 00 00p;!P 0@-`X0Sg0 OB\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S0 06Z Ѝ 0!8 / 0) 0B 0Z 0uO-Ѐ0TM00 0$ 400 ,00P(0 0`800!0 @ @|P$0SSDp@p Q 0U U L0!<01PSPp=PU<0pDPH PU@p p0S $Pp40S0000p$4P S 0  S PS p0S ;S S 21+1:$0S D$0,  QB\X:X2RQ2ȠP,$0.$0(Q $]>p(0 S  0S H (v+/80ƀ1 00 0"S 00S " TЍXRX0H"1,{O-P0M@GTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P ,!PA-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-?@P`p1S 3/P @`VTd0@@(T0P0S@000S4000S(0000Aj!P,,!P!#h!*p@-@4`4P0Sp@Z10S 3/@,,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 |00//00/00/00/10/Q@-@@L 0A0003/P@(f @ /+C-B`0SPEM;0N;0pSF;0 St> ;0S 7;0S@0;0S();0Sk";0S00$ R!000V F 3 ? &>0!C> f`l,0 010@0`Q0,p, 1m/+O-PM 0@0` P(" `b0  `000 H:p!0 00<:@! 0g0p@׬ x@x%ttulS:@dȬ 0 L!H忬 @p0 $!$嵬!p 0`쀟P0 R + P+BЍ 0p!唬0i ` `+OT 0-00@p NR S3#:@`0Q0,x, ( 1, 1 1, 1A-@0`\03/ pPW@@P@uP< 0쀟DW  \-W0 U  0  !   0 00$ 1     t   Ch  0SJCT T0T TT=0B@@ r,q $ Hu  1!hy 1s@-P,`@U01Ѝp,pp@-0(M0P,03/` 0@ S:0 00 0 0 0 Kp` '0A0ᒩ(Ѝp0 tO--PM4,@ 1PЍ #pP 0p @r @< C> PZ0H03/0S`@G`@@00壬`P p" 0Q!d2A 2I0C 00000008"  0$0ߨ彥*ᶭ0S ("0 L0P 3/P \0T@P`@X0`0 S8bPZ 80 S ,1 0, S001{40P ≡0L0 3/00 P0uF 00% $ d 00qp`@囧0,嗧0唧p呧` ㄤ8 x44@`(1  `!40 000 f0,0p ӧ0$10h0\$10b`\0@ pd0900S< p0 PÁp ,h3 000000 000 0 040p⤤p` 3d,0|l0S= S@: SM`p$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS`p 0SV 0GP2Q }hЍ:P00SZ 3/@@OoBS o@0 0610@!Rx!@!x@|@pPpt@ t0S|0X*@MP PQ 0! @x 0T:x0S@ Nڨt@OoB@|0xT:Ψ@, 22! 1,,p R Q080 4 D, Tu r (,, 2J>O-S[?UM< 00<48@`D jP epPᗨ UߍZ0P40 P,Pረ3, 080S 0R? <0S5(1SK!L ,LH S!C <H@$+4 0@PP @T "2B 40P 0S 3/P,00,02, 0SU@`PD`D@t w T2RΥ Y0N ǥ ĥ ,!L12HPH@"Z`P`T@尥P Q` 23@ /3,,3,00 0000囥 @B 3   , 7 3, .٧ 300P1:1!7x @0 000000 0000 00ޢp` D⺟D0U4 Q[T Y ᧧ᥧᣧ4塧v `䘧,,Q0 2} dno 2! 1O-/<@JM M`0RPP+s$P) 0S% 0l"`E!`\r\/ <0P T  0CT *0C/Q 00P8@/m+@$ P:8?0  pP+0: S `V8>00ꨰ  PJ>0@0/SE 0+ $ S P+ $ P*P 0/S`0oo`bS -2p*20&000 SV+t# P*+# P*Px8@t8@]Jލ Ѝ Oj 2 * J @-M @P(0  @P  P ЍP0p@o O-M` )PPp X`p㴠崰.P&Ѝ0S @ +3P0  TpL峦P Xp0  @@o 3J 2L 2@-Q*G-|M `P`P PP<+C#y@P@ 0  @ GaW@PX+J!#QJ.0I+J#BJ.0TT:X ٬PP~D14 ЬPPu$F+J""0J.PPe6+J" J8`  ᩬPPN+J"tpll40 0J>P 0 .⊬P UT gލP@Y+J"JPPp0J.e@+" ZP h lJ>SPR 2 2 2 2 2 2 2 3 30 3 3"  3/ 3@ 3?&! 2+ 2 2 2 *? 2/00/00/00/00/0@-@0!$Q4M0 L0P\ P0T0670 P @P +"04Ѝ0,,x,O-AAd2M(0!0PB(0 0000= 80s#0(0p`\05 0 0%500%`0$0 0$0S000a5`` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ `0d P[ T0 SW`vp 0 ` L$`y0$00  0 0 0#94P00 0`0000 0峢$0Sr DZ 3D0Sa @Z%S[eQ*%0C?o2 00;0, 0H03/$0pS`, LH0I #"0V 0  G/Y 00;000P0 pX00 00 (00 P0 0 0S { (0 7DP0v1$ 0;$1 ,1 0@T0 S>X2@t&L"@(-@@,0S:((0"P!@P  00+0@080s=0 0( HT -W|Ѝ#Р!@&(00T1 0.X!00 , 0 F  f.40 0]Ѝ0!0P8q0 S+P ,P c C|,xԭ! 40,A-@  "(0M2( 0PdQ1\2 5  D! .h0l0 0L03/, 00Y:pPp勝p0Q0P80\5ЍO80H03/,0$, ($08RPp0P(p$P<00XN:< R0*p,0$ `$0 0S`0S<  `S p $ PR( P`( $0H(PU`P!S_S Y0S 0`p8P0VR:40S00000040,0(Xq닟8`0[:pp8`Up0< p 00<<( 8`q ,0,( 0L03/0 000 0V`V0$0( 0S ` ( $0'`V`P p0r   008,0,p(p<0yS 0| 1/0 0Q  RS 0 ሰ 08;/`0P0H03/ps0D08P 0@00Z}*p0 0 `<080s`00] <0 0RW04 pD R@ 000 H3/PB $ <0 %Q 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/008 000` `0W `0 ='0V400000Pm 4E!"] 4u,$ 0 4 0Q0 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc 雟00040$0(00$0 00 0S(  0H3/P, X$ 0 03/p7  0L03/ 0pP$0( 0S pP( $0&0W40000 00040(0(00$0 00c<#$‚0  0 00 H3/P0`r 0R04($ R ( 000 H3/P* $ %Q 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S~ P0 P  R0P0v 00040(0(00$0 00c<#$‚0  0 00 H3/PP80sc 00` Q [ 0 SX 0 SL0  3/P @0D RP0 RP0{0 80X T,3/00T00X0 0\0 $0`0(0d0,00S` 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ@Pp`,0 0U?:8尚p" 0S p ! Q\pj`P p0Pi"0R[p Z[ Yl:PpW00 U0#S~ p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\  WX08P@DH0P00 00 80sp8Hp0!8p 40X 00 0S 0P*p ` *80s0 L0 3/P 08400H0, 00,0+$0T00X0pPq 00 80sh p *Php@-@P(M((0S⯘(`,`~0 00P0F0 P P`0(PP,(ș(P(Ѝp000Ñ,0(弙0,`(P-F R,O-|X`M)1$qS W W (!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1S<1@1> x.؀BCPp C( ,H3"0@ 78 7 0 W &%, 080000, 0 J0ܖ0ؖ80000  0'DP10Ȗ0HĖLH0P (P0`)W0 000p8500 %  % %P,  (P 0 %<  |5| 000000 000 000pp 45P,0А=XpW* 0GSC0.(>P C$ 00S H @3/Wv@DpH L0] ZYX03/ 0' 05@ 0L0 3/P 00S 0SpW+ WP0pH03/0 ! P7/P%$%$)@0 Q1TYK@1003/Q  01/ 0S 2"|'$Є  0 <P 0 7 Hp0  @D@0 ᄀX80X> Pmn,0S $pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,p\ 0,QQTQ D@ pP Q Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 0000,,Q04p80,,< u r J 4!" 4u0 @-@P`#}4Mp@0S $ 0dL03/P #` 0 #8PUV`4Ѝ 0R00S0 //O-Yp@P` 0< # 80s#   002|'  0 S R( 0S%   吁( R Q0 2^'T 0 < {+800 s"000S   uX 1 SR0r01/,!0 /,$1p@-S@ x1SP $003/p@Ֆx1ҖP$1 0SO-@0`PKMM0((0DpH0S >I @'0 0<0o- %#{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,ⲑppK܍Ѝ(⊎(0S*< o #8 ;c&@@ $u-O-`0@PMM,0d1d0p 0S (0 S> 9 H& 00 0 <0.%#@~40kP`0V,p0U 0000000 0 0000000 00Yp`ލЍ,1ទ,0S*< #, 00A"X R00C0C0000S0 0,0A$P, $u@-@-[&0 !<$10(10,1P001.@-@G&0 0! 0O-,MTTpPP`0 R㑾,Ѝ "P9 @@5/ᗔP`K &` V`G2  & 0" ( 00 0Ȑ`ᦍ៕0,ЍO/@[;p@-@Q-?t?????P3 0 P,40 Pl& <0`p@PP80 P<,0 P00 p' 4) 4*+p@-PBMH`@ J V@@@AA0AdAAAAB$BLBtP 0PP FBߍp`ՒP00Sϒ0`ʒ40Pl`Ē80PS<80  0X0S,!@ 尒 0P娒\0 `0S ʹ @`嗒d0Ph0S ⽴@l0S ⳴@|p0SD ⩴@P`st0P^9 4: 4;=z>? 4 4AOBCE@-PAMH`@X  V(CCCCD0D`qK0 @0S  ^  Z8`V@5 0 #P- 0Aߍ(0S l O@d,0S D E@@00S ( ;@ ^ 1/ 4O12 430@-AMP@0Q*DE(EEEEFF(F@  5 q0`N 0S (0S    ,`V D7Aߍ4Ǒ   q0`N 0S (0S    ,`VP姑 $0P垑 0 P㘑0 Pp咑0 P\匑0 PH冑0 P】 0 ( 1/+ 4   60S O-@MV M>Po 00x R# S `^嬵嬅adDp80  @Q D0 Pd  _PD  HS  M`V8p00(0S%Q$B<00,0S$D$B/0000S$7$B"0+ 0 p0B/Ppὠ C"U0S1 `F` 됣0p⇞ 0S . *`,pYV o$ <4` ❷0`0"  "Cߍ@ 0  0S  Ò `pV Ԏ 0  1 PS0N  TŽ0   0S @0S@峎 ߍG<0040!00԰@0Fo$ 0DL03/00 Gppqr0S !0⺰PD` 0S    p8` V0(a xQ0W < 8 RFO 勰 0@ /.@Q 0  f 0R0Wx 0q   5< 54 6 1 ( 6&/+ 6 6w 6 . 1X@-x @  ; @0p0;d @ 6*@-D @ 000(0,0000&d @ 63p@-XQ`0@sJM@!   0[1S:TUU0UUU.Jߍp0 00@ @@0P(@0 (0 0(0000 0(aDP(]D4P,@,P0@00&!u5O670p@-QPM,0$0`s@|!   0($1 SIV|VVVVW@WLWXWdWp 1$ ƇPЍp 0 ,⽇,0S$0gP@0 0↯0 000000 0坎0CP0C!^@HP@@P@8P @00&!u, OO-P`0I1P/S \(E0(0 00f0SvU ( 0S `Pp S  1!5:% 0p FP p Q 0, ($!p p $ 2P] 00 8a4Q101S/,,4, 2Q0 7 J 3" 7. 7p0S@0@-S@00 0S/,80O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 娏pPP2@0S- $P* 0 x0D 0S,,ϔ 8,@,4 ,,p 8A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ,,ϔ,,p,,\0p@-T00P PDPPp0AS@  1SAA,P,, 0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^ @^ T 0S",p0\ Q0/\ P@ ^U Q0000@-,0O-`GMM40X2@TL2V 00 0 0000000@@@@ 0hɀp@c<   G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 x0@W 47 `4A}ᮀ4 VL0 <0G, ,,L, u $,0@-PDM@S P08 @\ 0@  Dd  0 0DЍ00S,0@-@DMP. P0, P\ 0P  0T   R X  0S0000000 0DЍ000S,p@-@Q`P@M<n@P   T0 0SP@Ѝp@譄0 @00 D0U@Ѝp,17@-@SWTlD\t Ѝ0!|P4P2P<<0,P0<0%P0<0P0<04PP<0 S, 0<0 P<0 S@  0"W|080#Q|0,0$K|00000@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 70 $< / <Uͺ v0$嫼P 0|! ぬ|Ѝ0,a@-80@SP`4Mc00 0┣P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0c  ! 8 0p@-PQ0M0@$ 0x`0 6/8 D`Px1px1a1S0C€10Ѝp 8p@-@P 0P  )Pp0S@}p P Pp0S 4! B! P  Pp0S hP R 0L  4Ppp 8@ 9 9A 9$ 99O-uM Mp, Z-RH0cS_ C傫0SSzB0S 㸁PBԒ0SzIJB0Sz2 P     P x2@    PP2 HD     P0x0001 @@K @P @ PHPP< ,h@ ,D@,1K 01R010|100P P 0}p@  Pvz} 0S10$1S 10 0Suݍ Ѝ&PaHPkPj1S |!R IP &!,,,p,,4,,ϔ,,,T,,8,,t9M9,, @-@ᨪ00S @P, 9P@-@PЍp$QU0 Y`P PP> C 0 1/P ,0 0L$H R>,80S @-0 %/g!#0 m 9dG-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $Q$00S U 0 |1 08Ѝp`P P P Q Ꮽ  P ̭  ᓭP ,A-M|P8 U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 p`XEH2 08 8/PD?0 !! `b7#Hp0  3/P"#"#00 03/p p0` L03/* x♭` 0SWp`?`B414!44,0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 0 `04dRP  v00`p 0Sv ѿ 0 |1 0?!"g!#>  9d,G-`RM@Xr PP dP`T `TP P8  ,śp 0S  姀ߍ<08 0(0`0,0 000040!04 04$0D0(0P SyW[  圛pU p喛p* d`n` 8  <'U 0YU $UU QU  MU 0,0GU0 CU m ?p 4`?`a8SкPb 0  00*0P0  0 *0 h\@dAdehs@dzhGhhhhhhhA-PMPp`;@ |p@P  P03PᴙU 02 " ݍ /O-T  0 Y Y 0 0<S, S 0Xpp ͱ @PS ( P#2Q<ЍR <00$Q*P$X( Q   T0pTp 0C pW W0 0Q4<0p8 P 0,4 W\,Z7 SS  Z" 0 S 000 TpTp 0 pW W00 S 0 S\p\࠱ ؀0@-4MP!!0  P PP@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-` = !) <p@-`P Q@@d`Q8M2"€ 0)r000% 0S 0L0 3/P 0  ** +"+s  S   "S2006 ְ8Ѝp,p@-@^P8Q @ 2"p282w@-0p@-tP@0S0S 0DHSTPSD  p# @0p,,Ϩ08S^)/,ߨ, p@-@ 0(  P0R0PS 00Sfj ppC-@`PNMM< Ѐu0 ` P `Pu000 ;4@PD ևppNލЍk y 9dyG-xM` @pᜐ壠KP! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P H L0RPP T 0$RP0 0   x@ 04/@xЍY Y ZL   YZ( (  =!!* < 8 51 O-`p@BMMP/0I;@ ┥0P0p X@+4  yj P* Åz BލЍ}iP (0  h 0  ]j0/SX k0H,S k!14"?s0So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q 0ZTm "0Si[@AjpPc P 0 8< 4V , ( $ 0 (,$E , ( $  QR@ Q  A R !Q Q Q  "r    0  峥뇦垥00 " "No@ jU01U0190.UXRA-00MH`LPp t1t!ttBPi@PP0ЍT00P0 S` 0!?020 2002p04 pj 0PS"$ 0Q00 L03/P Q P0Q    R D0QR003/ <!+  <>,ϨP/A-2u_Svwo10000B“TBpLҁ B D',pA- @P^U PP0 8^ @T hP ` ` `b` ` ppS` 2 q!aPaa Cj00`U08eRfP08}/ ^Q 0Sp`82S011111111108 p2aq40S0Sp  P P2S222*040UP 2SX =3O-bM M 00 QP $00/;|P`bލ Ѝ$ p y?`00@ 2,(0\0S 2S 1SP2P"PP0@?0 Ẁᾠ        @T!? 0 Up㣫ჄG (#hPgbV nq ( l (P T&RQ 0 0 $pD  W p!p'q ?p? @p   W p!p'q??p0f@P#  0GHe   g?WU E ,(  g(i?W U `@dg!+ <Us@-RU0 S@+`d0T `Š#+ Q H `04 oЍp =z!+) < =@-@ T  ^@ @Pp` ^PPVPU Sx   D L"<0"8 0"4 0$< 0$8 0$400 0<<@0,Ϩ,$O-P@dM0p400 5Q 0 }Q Xg QP08B^  RW* 40'D0Q   R0RS 0}υ^ @^TX 0SQQY WpdЍb400@F@  0T@TT0 @04@P SD 0`P P\ X 0`VBT`@00T04R21 SR8080<0 0Q80$02ơ 02< 02S01  (, ,(0 PH W2r`!R   R 2S SX 2Ƒ1 0 Y   ZW1Kt "QR 0S1!02#38P0WZ ceV,0$ S <02o(0 0804pPC @0 Ă2Z02HY PY g L0S 1P0S`10T08<  01Z o 0  RP   0SH0\ \2 P H,Ϩ = =g!+;T <!+KlO-@|MHX0(S S|ЍS S7 |( [h8h(hhdD S0@ }(0$00,,QT@ R4   (R$  Q000S 0[SX770QP241(0$0(00) 0P00U00( 00 0$000 0 U00040 04 800,00 0, S0 08B4X6u?v? ( $R BT@200q? r?`h0 s?` 080S000T0S,0S0w < NepP< =X50C\0o_P0"H``V PV jfš0( 8 @0o/O @0S U SQ0/  T0 000?01o?0R㴲<0$ 07 ,0S00AQ0P0T00#!+[ < >:,$UA-`M{@XpP08 P34`0 P(0 :0 !!0"0 "U 0 0 9P" "#"#(1 0D0|0 P 00S&!003/00S(4`0 xPX`ЍX0 0  #1/P0(@#S 0P 0"P25/0 # @1/0,!Ps@-@P04P00 o0S  `VRUp L~0P 003/P8oYdUUdЍp@Qd 9!+h k <@-@0MP M 003/00; ޝpP pb`P  }-d~ۍ ЍO-p0\M0SR `H+b@Q P0 P0-cf0@>S@ P0ރ P0cU0@SP0 0LH S  0/ 0//Z[d0Q @10`d! ἐ 09/0P@\ЍO,G-` p0P@LHR0418 S ^ ?Y R  `0 X0?Qࠡ࠱000^ 0 G/,>0@-@0M 410810!]a0 P0u0L ba0 I0PU ! 5/8Ѝ0, %@- H~@ .}@-@ 0  <6Q0 ?.&9@-<@0s`}(00pp=c0Co&"4--$M ?0 0 }$Ѝ0-4M 00 000P4ЍO--pKMDT~ " ~h4`p p!`V0 R`V$ 0R 0*`ğ $pS0S 0s 0SKߍ0S P (d30SP #)◂P|#[ 07 ݮ{@0 (A@{{:?dSd( 0#ex 3P 2R - BP   BRڛ 2図"B "( e"2YP  0Ÿ R#3SPfS0\10(0eL"@ PQ 0 0SZQ=9 =:pk{1@Q08p@{PR!5 Q; %#3\P/  d! !(0eP!$1@Q0& d( [P Q * 4"%+0!V5 ԁ@0S(0d ˁ@0 0(pp{@YA.----l;-/+-G0-QQ0!+G7GAGNGcGp|--~@FG} 1 0 Q V0@ Q@k{H{7{j`0V0P  儁P@<Ҹ(0`<pe0 o@  i@-%@v!@SRG-@  700pP ąP:<`X:00X 0<P N@-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  EbP&@Tp@-@Pzp  `z@{U700@pp@-P 4`zp@  zPz@p@-M@ "|p$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M 'p 3ݍ Ѝ J p@-P R`@0 @ { 00S g UP3PE Ѝpp@-P@@{pPppA-@Pp p` j 0W0 |0WxX Uh0X`0 P  0h0H (ЍU0 P 0 c]Q0D @ @ @ Oj@-`0tM0F?oP2p @^pK{ {pzA{@Tzp h2S{p L0V#4 - tЍR{h"5zpp@-@0  y0 S " 0PUPUp@_0S   0 0S __0S   0 0S __A-p@PMU `0S@PE7  p0PI00-ۍX?700S @ Q@BPE@C0 00 pL#0S 0#S @UX !, @ @ @@-M@ H 8yp8lۍP  !,p@-\1@0S`M @@>  <P  0 !   xp0 S 09S 0Ѝp0 S   000 00P0 PS @ d0 w pDL  Ѝp@ p @!,!, @< Ap@-@$`P\Pp0 @ `P0 002 0pp@-SP@`xM  Xj0 0xp@) xp'  xp! xp  xp  P  L0  p,4xЍp x!, @< A0 0 s@->@P`Mp @ p0 p`` P0:p @ 40 pЍpX!, AHp@-@PqP  9x01pP`qpJ &x0#1pp@-pM0 p @^  xp x@pЍG-QMڴ700ۍ E  Y  @`V w@pP`@-`R00 Ѝ@PTp \@P  Q*@ 0S0S0 S   0 0S0 S*\P ` ]]0ST  V 00000`0 @@P0   <@-@%@ !-G-`P0H0$:@0 D  10 D&00 0 sH00"4S4 0>0S0&0 Pp0P W  g080P040L1p@-S@T1S#d1S.RU9lRUppbV:l@]lbp1C;]L10CL1L1PS3]0P11C-]T10CT1T1XS%]0X11C]d10Cd1d1hS]0h12,P0C2bV ]bp2,P0Cp27@-@0 PP! H10 D18-0@@ CB Ѝ0@ Ѝ0Q@-@  M  bvP p [00`5 Ѝ@ Q @ 00 pЍ@ Ѝ @!-# AQ@-@    bvP p +00 Ѝ@w 1S70|\'ZP| 01@ 40pЍ@ Ѝ @!-(& A@-t0M0@Q0$*p Ѝ  !-9 A0<1/@-@de'P0S { P 0800L0S S@ L' AD A:Z@-p!@RM Qt0 pr Ѝp1S AL0@-800@@@@ P@-@p t10cSt14y Ѝ@ @d 0 Ѝ AT%Q7@-@  ,,b _ Bup M Pu Ѝ0@ P 11P,|1@ R  |&QAQP |`00CS`0 X;}@ T0 p 0< Ѝ0@ X0 X Ѝ0 @!-K&90&8# Ap@-PD\up44p@ @4vp p@`u ڴ Ajp@-P@ ` 08 l, >U\& 0 0 008 , <1pp@> Azi Arp@-`81P:81x1S0p0@Tp 0S    0@-@T 0S  @@- @T08 0 0 Ar@-t0@SPLM 0$Q0@(p 00 p0 `P q LЍU @ x  \z C`H1 0D1xxP3`!- A AO-@cPP  R ' 0 08   L0 0 UX @M 8< 0S 08   Ѝ A B7@-P@@0H!D Ѝ0A-鸀@x0P P ЍA 0  0 ` { 0  0x1PU 0" 0SHP ЍAET 0S 800 XP P Ѝ B B8 BDA- M@` P,L`p$ PO 0S PuPU{ 0 P8`V,P  E ЍA^$ X$;080SV $0{ pO0SK D ЍA 0S $  ) d p A ЍA U0 0S V [ P0S t`QP  E,t R P 0S P; 0S 0 8# ЍA Ѝ Bo B B A: B!- B BZ 0@-@x P $ LV@ L0p@-S@P` 08PU $00P   <1 08006? $0080S  p, A p  p@!-@-@8@O--pP`G M8@T1 Ѝ  P 0S,W' 08،#0   S0800 0 ?X 0U0X0S @ GX   - BC-<1M@ ` ЍPPf q`0 P  , qpP1 P P2 P7 PP@ P8!88T@p$o! IQ0S000 000 1 +p x$D!\10B0H1x=l l<x Pʌ!. @ C_ CA CO B CW B B- C C C! b C) C0 C9@-@  ,cqp  ~P81  ,7,gq0,1ЍP0@D81 P$5 @!.% C C C Q/@-@  0S@C-q`@ xf @P00@ 0S  ~0 Sx   0@ Ѝ 0 pPt< @P 0@0PEW  x) PP 0S  F$0$0> R>  **X 5 0S .@0 S   000x1  @  0SP P0 0 S   0 C D!.4 D D0C-MM000@"0qp)00/P؁+ rpP`UpQ v307S /0 S W h0 0\!`1  `Px1 (ލЍ PpP  R쀟쐟PU hVxx x 0 S   x0 npP 0 Px1p  P  0S 0 p0 P!.K D3 DB D3t2`Q@-@  llE+p07S@Y0 S 0VS0S@ @!._A-`R@p@M PP U70l0h @ЍAm"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *P 0S( <0 *D  <0: | 0S 0d  r 0S>0 P 0SV>P  *@ЍA;!.q D D DO-p@`,$MP=P   6P 00A $ЍO'Py "P000 pp X SP     M0pG 0pG0 ZppIBU3#pp pp T\p#3s <11<100x1Z* nPx1C <11<1kP NP  6Pp4PpUPpP xP nP p 0S 00 P  YY p 000 0SZ<11<1$Ѝ |P  YY p 00`` R00T0 :0G [W 0 \00x1 Z R& ` @BP `[` @H0` 00 0 W W W 0S 0`0 7 0S [ x6xy0P 0S C[{N0 xr E E E E$ E4 E=&2!/ ERip@-@>Pp 2R0P0oT(0000> *> 0Cpǒp@-p1PSM"`! *%@P T 0p1!V  T 0S X\{QP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   0 @ FP 0  @  B.(0$p ,*l1S L L/+!. M M1 Ms M] 0 R/ 1/-/A-@P 1 !  SXpR0 qP 0`0S000S \ \QP0 S   00S000@00P10 paU0 M!.G M M0P@-p0p ppq 00P R0 U   M!. Mp@-T`P\@0^0S\*\@\0 0SZ0 5Qk9 <R0p@-`pM@Pm (0l``FSЍ R*p 0  B\  L *R B  ;G-PP $L1L!LL Y@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@6P@P0S 0S0 @@ M!/ M M; N@-^000 Ѝ ^   ;@-0 Ѝ@-@P`p, 0B0 0p"#k ЍbMB@p@-P(0 sPUPUR PU PTP,PP@PP4PP4\pQ@ M!/ MP)@-0 I0PT0/ M!// MP@-0 :0T0/ M!/: M//P@-$0$ $$'#08D0 M!/F M@-,MP` %1U0@0$00  0p@000 0<0S rkp,Ѝ8010C>SJ00@( ( 03(00@000 0<0S80 p @G M!/ZY M@-XRP@P lpQ@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0SQPU `0 P  S   p0 'k00C0H:Q0HPLPU0 P(P0P0V00 S   0"Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pbȂT0SY 00C01@0S D3/2",(PU0S Pg0S R=0 S ,  003/00400P4P+1 P0V0U0SH. L0 S* ƥP& HLH R 0|S0   0    @@U 0 H"O0SPp0S| `Ѝ\r P RUj Yg T0d0S 0S   PE  \P 03/- M!/l M@-8 0D(@ e3p@ t@Ѝ&9A-`M4PspM yk0 op@ i@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   CR&"<&9-@-   Ѝ Ѝ/@-MMP`@p0  o R 0rpۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/&"< 0p/Q&"PXMUEV0P0XЍU<700p@ `R40 PU B0>000 <0  ,> Y!PP> * N@-@T}>@Q/9@-@T>@0P/ R R /0G-`P M0(0S @ 9P P 2P:`P 0 01 0   08S0 00 Ѝ080 00S # p`P `P0P 0iS.S  `P04S 040:S&@T0@-@PDM QP@T r00p@DЍ0U  tP @0S@-`Pp@MTЍ 0S P 0S Q 0  p=@P @-.000Q/Px1P/$0/@-@M    n0 hpЍi~O-YM `F/@H9X0KpP pYߍ0pJM 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 ⪒PAT1S@\1S`1 ✒P5\1 S S R@L1SP1 ⋒P&L1PC_oSRPU@F P0HS 0s0P8AN@$@P00SLQU KPP6dh1 KP Pd1UP \@ `  0[$0C  H `0 S -9X001H \0gp X0 nB000S0 35S S  CR0TX X@S y r R 02 > 0*<1 T48#88 S R p S 0 S T X @@>@0?H0vp 0P0H0}>H0 @J000L0PPP!/x NC Noi N NA-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T~00 Ѝ S @f@-@Op !p !p`"fȀ %0R* -  r % A  !  + "*   )  Q%£ £   + "*   )  Q%£ £ /A-`P̆@P─@Ѝ pP\[KYKP0 q+P pP !/A-PR`@ M 0S0T00 Ѝ/pP P'0 0 0 0  0S TT 7PP/00T 7 N NO-P@'0"S0Z"SJP Y ppP wy70p0 ЍT WsYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8klllkllTlllldT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: HK U*`XJ:0\S 0}   0P0N[ SP0Sl  'KPTPp@]p&@TP /0 S S /S/P0/S 0 S S/0/O-P?@P ЍOT=`P hhW ЍOI U qWI@P  ʞP 1 A Ѝ=0@S- HP'[ `PI ``HP 0 0  0 0!/ Np@-@P tI` 0SPmI$` PP(0S $eI0(0$0p,e P,e PO-4M10C`p@XPSTTTTTTTTTTTTT{|||}P}d}~ ~ ~l~~~sP~sPLTsPsPsP<TTTTTTTTs@sXt,t<sPsPt\tuuLu`usPv,wtsPwwxxyLzsP{`{TrLDXlsPlTTT0X|8s`Hy8 8 DLvTt(xpT(<y8y8DpHU- `Pp $tP@ P7 7  '$ !P`0@T\0S @U0 @9 0H050U/ H0?0P H0 @PA t014ЍFP 0 pp 0S 8P`H01@U  ChUH070 0 JpP! .R 0R77@0U p 0/pPT H RU H0@1Su@H000{U P0H0q ,0 00 0 lM,0S _ vzU ,0 01 0 ,0 S< I Uz 81C80w40b儒000 0 PPP00 0 P  p@0  @P  UL 8180w40b儒0p00 0 PP00 0 P  0@H0:0H ;P0<0UH& 0S# /TPp؀  #P00<0/B`P 00 /0P0 000H060U ,0 00 0 L,0HS  <h 0A  a,pd  P 4p@AK0  U , U ,P 0S U 0 p H0 50a h050,0 % 00 0 ,00,pYP 7$ UTPPeUj700 5$)0 5(@pp 0 '  0 p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 K,0HS 7U H0P SPH0;00H090U ` dh`,<pP C`P 0$''f C]EFH0Q7;0UlQ P0l1 P0l1 P0l1 P p@E0P p1tH000zU10H 2tP0H 2l P 0H 2d P PH V H000PH020KU  0pPl[ H0 S;708H0203H060.H0;0)H080$UV 818b0w4儒00 0 P000 0 P0P0P@U2 818∂04gr000 0 P00 0 PP00 0 Pp@0  @U =AP bp PWH0p000 SP0<00 P WH p P  PWHp   P  P  xP  dP=WH!  BhP T  ($p 00r ,p 00opPf $ ( H,8  P: B5 \gPWH B$ $op; @pP7 ((o (l H$8h  P  B O&"8!/  OB OO OlG Oz O O O O O P  P, P` T+ P| U P_a P P P P P P P P P Q Q Q Q Q" Q< QE QO QT Qc Qp Q Q Q Q R R2 RO Rb Rs R7 R \ R R RQ R [ [9 [ S@ S/ SJ Se [ [ [ [ [ [ [ [ [ [ [ [ R, \ \  S!/ S S S S  S S S S S T (P  <PW ,0 00 D0 I,0HSr  P /o"Bb ($Py/P0H (0Pi 7$ ! (0'0D ($P[/P0H  (0֘PK 7$ ! (0 '0&UX H0 X UP|eX0 3&70 0 + 0+0 0P7}0P7 *0 000 0@:0030 0 5 Kp Y ;(0 0 0 |00 + 0 P#Z 1H0E,=P0047s(8P,:t؍<Ѝ80ܔ$080,CP(/p,078247024<7囗 SJp,8>@D7囗 SD@>0H'87l"L'<7@7D7p"H7L7808 p,20!+ (U(P ((pW 400000(0 00L@(0S 0 S S0P\S @p p8000SS 438 P,,00  CP 0}?o20804P0P$0pD( (P h((0S0' &  PP(PK Z&d hXPP9@?0t0@(0S 0 S S0P\S 00@0:0P0 ḃpPpP80,C'P(0)S YL 400(hQdqfyPpdq P DP0S (P  P 0S (P pPPz 0)R00S P W400000(0 0  0y0S D4* D000X!6!7X- @ !6!8 TJ@ڽ Ouc Tf0Q//Q *///G-p0@0P `3P Y 0 0 `R:S@C@3@D"X HGU( HGA-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS  V!6 W WAp@-P @Pp"=@-p@-@Pp PPpT0 p@1@-0@T _0@0T0S@-0  X!7 WA-@QX2X"XXT0p  Q0<1800` PPW )pb%0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . p0S p0S@hPT0$0x x0R lD@ t0 p0S ( X+!7"; W X? XF Xm X^ X7 XOA-`P Pc_@T T0pS@p@-Q Mz0 )T0S0 PU|0h xPc_`@P 0 @ Z  Ѝp X,!7) W X X| XG-Pp0M    P @<1A0 <1(P  0Ѝ |B F@T{   ?T0 R0 0800+ P T8vp0SS90SSSPT0c K`P| 7 |0   P @T T0R88tPY0Sx x0R  vT 00XXSP  P T T0R88BP\p0VS t{c_ @TG 0`SS-90SS)PT00S8 00 H:* R S  l p h0S d0S =@T R00,, h@P!74!6!7D X X X X!7MQA-PP@pQ_`  0t0cR0a100FS  A!/P@-;000 00S /00 X!7h XP@-Q000 00S /00 X!7v XP@-}H0H H0S So/00 X!7 XP@-D0D Dw0S Sp/00 X!7 XP@-H0H H]0S S,0@o/00 X!7 X bp@-@Q0 ?RP_0 0`S0 SQ 0` Xp@p0 p@WW0 p@' Y!7{ X Y 0P@-x0x xxQih0X  P R !P BR #@@ Y&!7 X Y2p@-@P M0 0S R 0b0?oScP 05R &0P0 Ѝp/0Pd`Q 0000P 0  X!7 X-( Y>'A-0S00@Pd` pW /0000Pp 0 -( YV!7n XP@-808 88tQv(0 0000 X!7 X Ypp@-@PQpWX!7 Y}C-`TM@ P `gp) 0 h ````h1pWp0`V& g @ 0 8R@ gT  ~@TЍ00C>Su00`"P!@03@000C>Sd00p"P!@03@0!.!.!.!.-3@- P kp@Ѝ0@ Ѝ/@pA-@RP0p`@0S p YA-0Pp`@S:0SS 0  RS* R0 `V1S* vP a 0@DpR: Q  Y!8 Y YO-ATP` M zyB@PAD@0<1 Z  wp 00PȀ P P P P P P pPpZ l Dp \61@ R H:p 0<1#?Q0800 00 & &(p L0S% S% p H p P p $  p ? pw P0S t0$0Q0p P pe x0SA0 p@ h-PH 00 \d\$kP|$| p* Qd p-"p]@x p 0S P Q [ T  2Wp  #)WpPO PJ PE P@ P P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq2Mvp@0&j   epb 0!`pZp  < SpP 08!pGpPA 1 RZ  P4 ЍZ p pk!8@ Z Z ADZ A: B Z D Ar Z&!7 Z3 Z? Zg B ZP Z] Zi Zw Z Z!74 Z Y Z Z Z/+ 1 Z Z Z Z Z 3 dp@-P@pp p@=RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U p A: ZZQ p@-P0U@Sd` 00p P@ @T:p/ Z&90@-P`1pSMAT  p@lEЍ TgPЍ@!R 0$ 0 0 p@ #@aV 0 !p@`P }p)0S lt00#40  LLD SP 6 0 (!8I Z Z!8Z [6!8e [ [+p@-PP 0S @0`0S @@p00p SU   \@ .S0.S0_S-S.00  @R"0T0 0D0p&@T @- @0P PT00Q  DP `00CS`0p S00 P0S X0X /XkU&8p@-h1@SPoPPE @p 0.SSPP XkP HfP 4TP 0  .ᎵPP(4 [p@-@P'Uc 0 S0 tS0 dS0  TS0H/@,8)0& (#@        S0  S0  S0 S0 ~S Np@tԶ IP [ R+ P [ [ [ [ [ [ [ [ [ [ [ [ [8 [ \ \ 7 \&90 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP.]p000 RQލЍA. !. d0h Rp`0SPE@Ep 0S:0@0D E J \ \&O--,Md`pP. n}`  ]@P2 0S  LP@ FfP@,P$ X^P$0X22-00,Ѝ P,P, R /P,PE0S h R* 0t2 0 7$ R, R P 7$ R R ,Ph!@P !!!  \5 \< P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@~V00ЍPWt"0$?S 0[ PW RPPUT  PU70 R.0 I@0 0IU:D XC0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"p  & Z/Z#T [\*00 0000K@P\ZT [T [ KP|&@T!8sC-QM MP<p`8p; @a>pE <Qp V=p =4 QpTG    0 Ep P; EcP E/    Qލ Ѝ   P20IV0042 0@E p  @pP0P@T*p0S4 p`@tT*T 0 hdQp @ p 0 PQpv @    @  K 8Qp^ @  .0E/PS E/'QpM 0S @00S@%<Qp=009/+  v (OA- PpU@M ЍR` R 00P0S 0 -0 0t0#0Q0 XV 0 00 0OP0S 0 \Z \@O-4MX@p 0S\`d` (0S:0 `p20"4ЍO7 0  ,   pp0,0 ,0SPC<! ,4p 0!00,/4ЍP V0 000!0  ) 0,pmp000H!\ `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,P!8 \u \ Y \ \ \p@-P@`P 0S P$`(0Sp,e P,e P  0J0@-MMP+ p P0@ۍЍ0;0 Cw@P |,P o@- PΠ R^00\L  ^@-QG00P`PV0 V=`V xЍp@@T   00x@ `DPЍp`Vx1@P 0>0S *VP PU@oP P~P`/0P@-000 00国Q$0  @ \!B  \ ])@-` ,M޿00<0@SP  '0x Bfp 0pt0 0 01 0 0S0S|0@0|0 0  X40Qx0 xmPT ,Ѝ0 8 0@0S 0xPT A-`@VPPFP|P2Xpx`E,P x倂|"x20 bV0  |20|2@-`@MpP!  ( (➪X( 8pHPU@ T2700@Ѝ *i///0@-$!M@ 0  #+PPЍ0 3"Qp 000)00bHp0000@ 0THplp 00 " 0HHp< hp  ]j!B* ]5 ]C ]Vp@-QUp@p G)-0x1p@$-p@->`FMV 0P0Fߍp@PF/ c9  0t01 0 `埽0 HF?EHP 0> *0 F?7H ii@-@MP4@ $⋹P P@Ѝ!B<Q@-<0< << 0SSP`/// ]t!B\ \$0 /Lp/@-Q @ p000t0@0Q00@-P@,M(    ᑩ PGp 0 00S p,Ѝ0(i8p@-@MP ɼ ` ļ h  (PGPЍpi:C-PQSM M3#囻T0S3"`V2"@p@"ᗼ0B01801T0t0 H00C@L0@T3H @0H0L00L0 P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0t 0`00p0H0 L00$L0T@G120@ 2ቼT@@D@@0@L0 X9   @L0  nXH@L0   @L0  XP VUPPEPP@ D$r \Ep`Sލ Ѝ A ;XH@ X,!Bg \ X X| C-`p"0M` 0$`  0,pP @Ts+Ѝ`*PPA   0,p0 S Z+@ ``T*x0V*00K+T00V:0 (P|P@ (ͻ tY 0@P!Bp@-@P`DM p@  k   T0 U134  R2$ (@0 DЍU@ii@-|@QM  A00p |2 0"x2EЍp@-]MP#Dp PP -R g000S0S S SS wR0S HfpIVPS CQRS@ 0`  x@P -$0 Bp 0S$ H׺ H{hH Ep 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0妺 HJ150H \0Ep[0S ܻ01S hh0Sc0 0 000 0 0`BTRY>S SM  ]ލpRIx{@P= @9 3P0 0- H)MEP[%0S" H⑺M P N000Si@i!Bz ]@-40 000 0R+Ѝ!B2S/2S00/@-@@ZV002@-S0@0 @@LV0002S 傘/!BG-PM`p (PP^(@P0 0TT`0^Cp<00 ]I QCpP0S p Dp PU0S p JCa)@! (T( Dp | PDp 7/PP Dp &P Ѝ@ ] ]@Bq ]ȀBlBp@BfO-@p`0M00P U B0S9P 0 0 P  R P崡 R V 1!N P    ᐹP0 PPP0PU:000y Ѝ@-  $D ЍBgp@-0M2S`P@x (bVP@0 \(CK00ލp@ !BB-$M^ * ! .B$Ѝ@-@dB {(@x(@-@pp Cp` B~R0-0 P 4s# R0p0p@-A^ Tݹ00p``0@D^͹"000œ\p@Tp0,QRO-M@@00`1Q V00ЍP0p Q :8Q@SH ᕸ딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C &P 0 B0 Y 0 S2XJ00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S00 Ѝ@-@\0S \0\0@-@`q0`BA0`0@-@08$@0p@-800@P >0S0&0T0܊T0x1 RpR 0S TT0Q  0800 >0S  p@ ]p@-`PK@%Pp00,000SA/00/0KpcScO-@GM`ḠȐ{p0 mGߍ0RS*R? b8  00K C%PP0 d R FQV (P Q PPh   "  > BQ00 *M0 2& t QqR) o T  K$$ A\  D^V Vd^ h  \ 0(/$  H\@ ȟ`$\ D\V R < R @HT6    < @ V60HS 800007 S0@0(1S p0 H0S=00(  ն(100@R01A F Q&%0 p Fr 7rpVd %Rp#  HR+  %A C0妶0V % @= W`V H %R3Vp p  0 RN  HRp3   000HSf 7000  0@"0,2 S380', 4QnKp     HRB2   W @(1SlVp 000DKP*0W(1S\(, 03s0  PV:0BST   0,00)R\ Q:(,q  P V:@QT ,   D B W   HR9    @ B D $R Y  HRM  $A 0ҵ0 40@(1SWHVwW08 2Sn F( 2S P0Hw 00PQ0 0 2 0000 00@V5 VpWG h 6SC 0HSs^00 &A ℵ 60@3W08 2S'V00<1 0 Z00 HRP P0@W 00  ^00HS?t000@0D0D0 HS4<0 0 " E 2V0@ W}VzS Q0000 00@ 0 0P0"9 0HQ 0   @}0, v$ ^ ^%cSc25 ^M ^h7@-P\ R&@P\0S x0x08  Ѝ0PP @ 40p &&H ^!C\@l A@-PR1!q`0@ 0p\ 0C R1 0R00  06 30 0 0P0 0:0 00P00;0 00uP0060 00XP00 ЍP 0000000 00=p0 001p0 00 ^!Ci ^C-P@UM"P, 0P`00P 01iH00P0 0븀x0`  (#0(10: cV `7!P (8@  ' 0ta&!P( ``(1 (1  0(t!p0 +"70 (P 0 >``v` P( `"(1* (> >Qߍ 0*   AD!Cs ^ ^0@-p0i0 MSP`$M i1!pp<p@0S i p ۍ$Ѝi@ M0 Pp <1Q50 00FpP P(b ₳ ^&8$ _ !C} _ @- 0080PP `V@Ѝp0S t @P  b00O-IM PpgPHLL `PR R @P0IߍO"0,0"600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T=`0 rP =]@PIߍO@=0 Px ZVT` 0X`0T=0 4`G=P _8!C@ _= _Mڵ _`O-@pP`QP,b尠,`2S$P㘀U`,@ ,TBnPMB, Q 0S ,9 ?B YP,`0!C _m _uRO-00!`p@PT: p T  X ⢱00U *o"0 p Ѝ0R0  _ @E=0 Bp ;=  Bp W )@-RM MA00@P0BP Pp` 000 pۍ Ѝ` p p @< gBp 0FS/+@- 81SsQ S0 00 05PЍ 0SDPD3O-04MS@ h@@ ԁ`P_0 o0 00 00P # 00 y00P|# R @ ^00T0 @P0g 00 0`P^ 0 $ ( XXVpP 0$,0(,8/P@ Z!\*{"0 0pP 0[ $0*(00 0, $0(,8P@0 Rh0` 0h0  0304Ѝ$ ? Z0 j"( !0,  t  00 !0lPu @ q Zp0$00S,0 DpP@,0$ S S S0,00(0R41S 2S00s(00t0$(,8P@00 _}Q0 _O-P0M040@p0` `2''pp'ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S t; 0P /pߍ00 `2(Dp (r  0 p 00 `2,2p( K; 0 py (?; 0 p,3; 0\ p'0}0,404l0 40po'0n@0!04,0 40p`mp`jpggpn,0 !P ,: 0,00lS  R0 `">pP 000100,0H0 p 0 oY00, }R0S&P 0I p p  00V,0 !P !0 `"P 00 0H0p0  09,p _ _ _ _ _ `@ `pp@-PUp@0L0pp@- P# M p 0` 0 ` 0@9p8@ Ѝp ` 09p )X` 09p  %00D0 U1009p@-p@`PK<1.(080000&0S  0R  @dp`H Ѝ@+@ ,0p Ѝ@ Ѝ!CB AO-`@p 0帀SP$H` {000 0 0 `00`0! Р20 `  $9 00003H0<1v Hn ЍO:<0 $9 000x3@0Sl3H000s$80409 DS ,00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!9 00B*S:kG{{'{*zda8 S zkg{{'{* z0S$h9 005H0S0ST h Q 0R<0S 0S11H000s8040 P14 `P18 ZPp10 T#\0@ 0R0i ,0.0 0p  0h` % P0 20S00H A P 0dh0 ЍO Ѝ?? `( `G Z `N `k `r `z ` a5 ` ` g aR'H'2 af a a A aY a`A-@PT` R0A h0`  | R 0i0=eP 0S <0S $8  u .p0  p pp 0 00 0ppH0  00 0$0 F3% FAd0h0 aO-0R\M@`pP 0$P X0 #3P 0 RT0l 00 p` hPP. aL0S0 0@S@0#/L0}̀?H00P X0 "2P 0 Rzgjzzz{T0d0S  $U P $[ <X x$ 8"0 0"  ! ,  0  <  @ , D  <H  $P(P Q48`LPPPTP6pX pQ  PPH  0 0h1v`00s0 10 E000T@0` 0`P10 0\ 0`"v 붭04S"1S0<10  \ЍOp {  0S @\Ѝ7S Dz a!C a aCDC b+ bS b` b< &@-`@pP`0 h0X $7S R @`0k0  `, C7 0 Ѝ@4   @ be a e bp@-P@ $ 0 00L0p@ b '8p@-PUp00CSp@0@ J$ 7  (00-0L0p@'H b 'p@-P `@p800  B\000D 0<0L00p@8 # b c'8 ^(tA-P`@ A0h 0R0P3 0<1HAGp` P0<1( AP     Pd0d ddB 0d 0 P $A c! cS c\ c!D ^ h00h0 C-p@ PR0  R $ RP508̀ `O6  Ii@0S PP y P0 q lH<18!4?788'00 Ѝ@ 06 c B&0@-@4M<13(0DP 0S 0 0DP00  6 000 0 0 4Ѝ00    y5  4Ѝ0@ c0p@-8 PR@    P   0,Hp@QPpp@ c! cSp@-@P ({h00h00L0p@6 c ,-0 00$0C40 040800 080ꌑ0 S0&@TS 0SP 0p0x0Ѐ60L  NP$ ЍCe`0@l0 $4  X=0S 0S 0 S&$z4  H0 <`0  @ R h0P ЍC 40PЍ!DB A ccSc d B d d<,20p@-800@P  D$h00h00L0p@ 0[i dV d~ B\/ R/ (>0/ Dd0S 0Q/ BO-0M0000PSp0T @R` 0 ЍO> R*GP 0S 07S Ǜ ǛY  S3  !  Q 0 S:500 0p00 0 ( ЍOr Y 0 0Cs0`o0S0 S0L0  p    0P 0 0 X0SY0A060@ 600 0Np0 0  `P  >0 S 0<1vi@x6P `P0S0 0<S<0P0Ѝ 0    0P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050X%O70 Y ,iu0 #4 @0S0  l P   BZ0S Y Y 0  Br.  Br*0 8- $P0 0 0 RY * 0  3@ $ 0P 0  S 0S0@00Y$00D0<0<0<1(?00; P0 P4 000а 00 0 0P00 S*lP *   pV @ 0vЍO!600 0<P0 0S * AP   p'`<1 000H 0 000 `0`0a\0S   0L!*YP 0 8 R @ 1ЍO8Y Y) Rr   0 P0Pd0 Yk 0 61 t ЍO f d d d d e e e _8 e+ e'& e; B ee ex e e e ep!D Z&& e e eA-h0PR@1 0 DA0BS`pbp I0 Ag$ f6O-`Pp 0x1吠@ T ЍT 0S R T0 S> R *⫄P 0 9@ feO-,M@PpP Q0 ,ЍO2PE ญUM0@SI 0SF UC:aV?0U<:0 "R3 U0:!DR-   Pp%  R P  0  Q!   p  P 0  0,Ѝ J 0  B@!D0 f f@-` MQP\@M  0p000 p 0S TH  ۍЍ 0a`V \@T @!D<$A- p`@PpAPU0 0 HA0S 0A \0S 0A!DI fA-0 ;M0M`pp@P @ p030<000C$00(00$0C,00@pV004p8  XXPU0`$0 0.p 8ݍ0Ѝ!DV @  p@-@PT  (@x1S0pSq Hx.02p r.02022p R Rp07@-PX0B @P 0S*0>0P 7P7;020C0s0S0270 00,3 Ѝ0@/}`x zgjzzP;R, z@ 0 Ѝ0Dz f-Lp@-@P0( Uph0Spp@`-LO-P`@T Q Pd0S  0 t_0`d0P0BQ 0S 0P s/  +0800 |# 0帀8!=0 80 $ 0R0hd`h08 R0 , 00C0 x40800<0  P`00 0 00S $0 pWp1s00 2   0P C @R 00pwpWL0H0Ht0p g B g, `G0P s/0 @Rp@-00p0`PQPE@ `㛣 @d@$,b pP/1S P///P/P/Q 0\R/ 0\/P/ P/00S/x1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1@PMT. 0S pW$ P b .PP@0Sh0S d0S4$墡Hd0 0S PPPЍ|0d 0|0 00d0 00090~ P]  PU9$0 00 PP 00d8dXO ßPP |0d 0|0Xx>U" 8P|P ᄢ |  ╟Pp|0S rP 8 m P  JU` P < 0$Q S "  Q  cPp h  5< 0   h[pP; t0<0t0Q0 0L0 80GdxQY X= /P M  U pP <ȐY $0% h  5< 0 A  $0<0|!74 g!Dc* g h gp@-PP1!s np`01S 0S 0S 0S  0 @T 0Q0 PSP 0U d0S0h0d0p@ Yp!Ds g h(p@-@T PP@0Rp!DG-Pp`PE@Ѝ0E @P00 4b@P 0P000000 000.,>0  {0$00 pPP,0 jp&0S p0 CP  0@R 0 0000@@!D WY hC hb@-@0T PQ8 :* SP h0S dP Hd` Ѝ$`  Pdp (0Q,0Q  l `P 800000( ,0@P0S  0h dW $0Q 0h0d`B0SH* ht h0S/0S/   O-MH08PR 0` xPs00ЍpP Ph0 X@ XP R R R0 00Cs @ЍOP 0S3Y0000000Cs ЍOt46 @PЍO p    @@0 0* 0 I/ S!D W޼0S/G-P@M T 0p `x*00 0@0 0 @_@ЍP/@-@TP@80S   01p@-@PPP (000pU P 00p0000 S0 @00:S 0S @\S000@:S @-0&@T0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/&&P 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO4E`VK `0P0E@ 1 PP 00pCލ Ѝ@@;04pW p40(0= zP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S 0(G p PP ;000P6p 0S#0 0 0p8`@[ +  '0P R 0'0SJ @멟@ '0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ 'G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S b'y  00,  @ ` P D,0v  r,0@PE_ P0S ?'$ D0A00T*q PPJ 0P-0&&P @-0  0 Ѝ@-(@ P Z0 0-00C-BMM00pS 0S`! \0S)  R&    RA^0C R[ 0Pv Ps @ Y Q0-P ލЍ ~0P P 0@PY0 PP U L-P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  -0&@T p@-@PDp@NA-`= @P@ d PPd f 00@^S0S:S_ p0 R0S@Ad{ PJU \Sp0S:SH 0C^ 0@0LT1 0L\s0TSpASBC\ e$e`d eXeHd d d d d d d e@d d d ePd eh0bC|^ 0 0 00:0 0Pd @0:SS0AR0@A  P A-p= `P@ d PPd0`F 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P ,P-H hG-Q0S `pʯ  PV00Ѝ  NP00CS0X Pp0  W00S(@ P   , P P00SW  X  R00S 047σ,P R   S@T PR   R -H-p-P@0@-0S yP `P-H-p@-@WP08G-Hp@-P@PPpWPp-H@-@AP M 0@87ST -H-pp@-@ PS P@p p@-@P & 0@87ST -H-pO-pWP`@P @ ЍZ K P .PT  RT@ Z //////O-Dr@00S `P$  4PV00 Ѝ  .P00CS0kW Pp0 0 党 U00 S ֖P  P P00SU00 Y00S P ~P00S  P P xP \P DP ,P$~ :幋Py-s0@-4@0P *P- hX0@-0S ;@@0@00DFP0DЍP--@-@`0P0`Sp 0`+P PP Ѝ-@-@P08D-p@-P@PPpMVPp-A- P@`pPЍ0 `(0P84SUP @-@-$ 000B;P Ѝ-A- P@`pkPЍ0 `(0P84SUP @-@-$ 000B;P Ѝ-@    /0A-P<<`0@ |D0p0D0& SQV[ 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z# 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Ppؓ O"ғ I"̓ C"ƓA <"00@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-p`TM00`< @P^p TT0 t#p@ 岐<0@庙404 4/,00S 0TЍ&&T| h-A-`@ 0s P0"0p0pGWp0P"P @P @pT 0@@PP @-p@-@P?@0 ?@0R:@@pP p-p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp-&&TQ0 h|2 i`s! h i%J h  hM h i> iE iT ic itS i iO-Q<08@0(00IpPR @p+h`,@480T:(t(@#0T(:(t(#0@ (0T:  030H,@`(4 8 00 D3#00 `@4 #00c4 0300 `@80@j000 4/0SD0p -!D!D&&TQ0 ip@-@0`,0DPSp1S@-0D0P/-O-EAMHP MU=[`0, 00PP3p0,0/}0@00`o`L+m pp A>0t@lTllH0SpW W DP !P 00PpXA C9R񟗈|}}}}}}|}||}}}}}}0}}d}}}}}}}}}}}}}|}}}}}}|}||}}}}}}}}L}}}}}}}0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0h 0  ;/Qꃗ$0`S A%0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00叒t `| 冒j,`PPDAލ Ѝ, !ە4P 0H0- i&&T i iu !D- 0- H0H0S/-0Pi /-A-HAP|0`S@M*0S') 0S S f! 0P 0P@ @Ѝ 1 pW*P 0 000{0pX pƖ@ 喍`0p垖X0 T7/0S 0SP 0 P0@ЍAV-- H&&T| hG-\qPL @0P12C001b5R 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rᨒ00 0S0PS ♒&0S,P N,@GH--!\  0L0#0-@-p0M  L0@31 ^AP 0C! 0Ѝln-Ą @-L 0 0@11D ^Q       -A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zኔ$0 HD@,X#10000 2R01   0 0S0" V00 S  ЍA X 1(4/00~X0威0 SV Q`ЍQ0S /ЍA)`\c  Z- lŐ@l⮑%0S Z b0@0-!DC-Q`0MS 00S` R@P: 0s%@Ѝ `pᄐW   @W v0p0|0S0S +@PpWp00FV@@NP 00T p@zp\`W 0S:S*  =0p0pp-- HO-`HqL1P0SU#,@T,P@P5 &0B1 `P 1xh L0C R P!050%Pd @T:  _0 p[L0CY1T*Q@@-G-QT0Si:\0`S& 2 c@Oop @d(0d$00@X1 0S. S0 P B H %Q * RA  "0<408@S1:X 0p@D7C 0p03 c0?o< @@D@  kP  ቐOP ` @!0 a`2!! !00p30P-&&TA-p0@@ `P PP0`0P P@lⵏ%Q *0S  ᵒ-$00S:@-@@X-@-PP` U(0SP@P )@T \0@幓T0T 4/ԓ 00'0S 0 (( @!Ѝp-&&TQ0 j  O-$M@PpD00T0SdS )@TPY P3@凓H3H 4/Y(0S p0dpY`WT0W$@p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S   0@P1'0S 0 0@$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@0 f`[x [`K``fpP @P0p0 KF K0`F@  L @华%Q *0S  @-&&TQ0 jM j- 0@-M@pP,aD(0SWTP )@T: 0@嗒0 4/0#880 .P0U: @P  U'0S 0 |( @Ѝm@P %Q|0S0S P 00-&&TQ0 j O-@QpL$M(0S@ P x`(W .0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*CM'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  DÐ`P 00P`P0 0#  0|0S0S @ @pA,*`0<0 0 1p`  儍`P% 0   v%T#2QZ J*0T00S  DoVv광 00FP )0S 00@凑,0, 4/`P- &&T- 0Q0 j@-L0@'0S 0 00 0T Ѝ@Ѝ- J////&&d/&&d0p00/&@T0p00/&@T0p00 /&@T0p00/&@T0p00/&@T0p00/&@T0p00/&@T0p00 /&@T0p00 /&@T0p00@/&@T0p00/&@T0p00 /&@TQ P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/&= pY0 0CSp0 S P 0 /p@-P@,`ƋPp@ Tp!FT0A S010//!FT0P/!R/P/P/Qa/P/0p000 /&@TP/ 0S S//@-@!r0p00/&@P0p00/&@L7@-@PD@P 40R0PPU0  Ѝ0Q0 ( k;&9PQ 0S///&& 03P/bQ00 ACP 0ABs0P r CoSPS//O-MX@ @ЍOSQ`p rT} 04S`\xP0@`,S@T~L_Uᚔ!` @T`0`PErCT 04SX:`\V0㨱0 ∎T  Q \ ( Q  {WP@PZ P  ⵎT0`0S0?oT20S@W-Ѝ @&0R @T`0-@㑏@`00P  0S S @0V D X 1{D4@V X*n 00!Sh00S00/"<&@H k00S00/!&3@ k///@-@H1@P F(  @8&9Oԍ-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A ݎ00ЍQ@P ώ@p@-0P `| @P  \*. Q  Rp R  (  p 0 B &@T- \qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00R} Ѝ0S/1>3 !/0S 000/- \0S*p@- @PQ P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!9t0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ- \A-PRp `@P 0!000A-@Pp`0 SW' WV00S񟗋T\\\V VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (O0PA , (0 ,P&=&@P&@LA-Pp0 R*S\ ]\ t`@BX T PsP`&& R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00- \ 8 0 s000/`Q'Q!//&@Tp@-P@,`ᓆP@tp Tp![HQ 010//![H$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0P`&=&@P&@LO-P 0R@M  P&   P 000Ѝ 0@  pNPP ЍO 0 PS@ ᡉ 0 00<00S*^Q000800R ]R00-R f0S* ]R -RQ\S0]Sg-Rm0 Su:0S0086000S8\ 00000 5^p0a SaR ,0Sf40Sc$0S`<0S](0xY d 0(`c0@`F p@ 'Uj 00C0e-R [RQ :R =R 0pS:   0Q00`S0`000-S]S0`S0`0p4 R*000pBW R:0`S0`00 S=*R: :R7 ]R400C   0p pB{P⌳ 0w S0<R$ iMP    uP  p$0  0$ 峠0S00`` 0Q00`S0`000-S]S0`S0`0= r R:0`S0`00 S*R =R ]R 0S0 -RC Q@]Q= -Z00  W2 0S- W0`S 0`00S ,Z00W0S Z4 0LP  pwp400!0pᲠ40 P0S 00000 P  P{  [n 0]S S `Q\ r  0  EB#ЍO k k&=- \&@Tp@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&@T&@P&@LC-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  vHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Rt r I 0D OX &(  RPSxPA4#X z 0   000`020+U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP"  B   B0  B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S b^0<0S 00$000*Xe .X< 0e- \)>{^ ]&@T@-0@``P?Q $0As R S<dddhhddp^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )y V 1L   0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030` 0V:0S003000 <Q >Q q`x!P  &  R  #+S  *Sg 0S8* *B?RP {R1 Q. 2000' E#,Pt 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   h0 S*}Q00 0RX}QR  Q +S ( 0  BN  B   B0B  B~?S {Sz   B00  B 0  B%  B  B " A 0000S 00000- \&@T^ ]0S C- `M pQpG lpL@P 6W:0 ЍPPP P $PPxP @gP0 uPP 6   00 0  $ ( , 0P4 8 < @ D tg000G R:0S005000 S3:  P 0A0HP  %00Q p0 P>3S! 1St Sq S <0RpQ00< 0o (  {SW S<0RuQp< 000p000Q S S SS8 S S4 +So >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  P0S JPR, 0E10S*P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/UUTh- \Ee$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0^P`&=&@P&@L0p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@&=&@P&@LO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T *P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  t_P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O&@T n`O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0_0( 0(0 000p 002   0 X @ Q  0 R)  R # `Z X!,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(q P  @@ $ X0  QvW PYst va  r _V R  !    _X RG v@(@X 0x  v% YPt P vI_Vxtt xLt v _`V `R`V t@@ v(  P Px Ptv x N_XN 7@Y (@X fY0txPt, xt v  t v  r   _X_V Q ( X 10 _X @jth v xx ,    R (ZS $X $ 0` (ZS  P 00004Ѝ0S0 0x~ @P &@TO-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 c800@ 0 ZZR  D>sp 0 L800@ 0 CZH  D>3 1> Q p0p0800@ 0 p'ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  ZP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O&@T n`O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  ;P ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E 0000S0R0SpG pGPx0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T ?P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  SP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O&@T n`O--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 80S 0~ <``F`Z01S` 0s vQR\R 0C1!S` `05o0 Q[0 000,@4H80<@ PP 0 TX\ L0`/t Vd 00 S`FY1`0 0 0`,P XD0S 0 0D0,`PD00D0 0R < 0JS : RP Z Z `p4`XD0S[ 40S,0@7440S pi, 0@ R0%00D ;0$0 0D0,-P5DQ/*0 F00,`P& 0 0D0,WP HP 0000 0D0,DH0SPHDgX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XP4P HP PR [S. 0 Y),Q~ 4^e 80S 0a <``F`Z#01S` 0s vQR\R 0C1!S` `0n0eE&= Q00 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S8 0 0D0,`PD00D0 Z ` 0R< 0JS: fQP Z`XD0Sf 40S,0@440S  p4P lHP hlЍ, 0@ R0%00D ;0$0 0D0,!P5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHD^X 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPpS4 0 Y,Q 40S 0r 80S$0n <``F`Z#0 1S`0s vQBo \R $0C1 !S` `0l0Q0 000,@4H80<@TPP 0T X \ L0`qV 00S`FY10`0 0 0`,P XD0Sd 0 0D0,`PD00D0 0 S` 0P< JP:$0 ?PP $0Z`XD0SY 40S,0@440S , 0@ R0%00D ;0$0 0D0,HP5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHuDiX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPppq popm-Ѝ///@- // //0p@-8P00@S PphP p- h7@-4P@0S TP Ѝ0P - h@-@P 0S k@P/ybP0 0 0/ /0 0 0 0 0/////0P P@- B / nt-!h nlP P/ /0 S/ 2#0/O-$MHpL`@`pS0P *0S  P000` P000T000 R0030#$όZQ^A2 # T P@P U*00 0T 0C2@TPT  # 3S R0 SX00G0S.T0S 0) QX 0[00 0 Sq 1000H R03S XMX 00 $Ѝ P00#03P 03S 0 S: 00[0T #3SQ R[#  ) 00H0K?oP 2R0S 0SX 00HSX0 [ 0 H0X Q 00 0[HEI S 0h 0z0 C R9S? 0 S I0 0CR 0%2 L hW0 HY0S100u 0 S 0Aj !  0 PS @0CX 0SX 0 0$Ѝ 0 Q 3R0C\T00S SC @ PTP>: < D   20x0 R03S= " $Q0@-M@(,4`0  P"URA\ P0 `U-00ĵЍ~0s \pFW`&RA-M{ { tЍ`Q0@-M`@(,0  P"URA\ P0 `VU-00ĵЍ~0s \pFW`&RA$0G-M@0p`W PV P%Y P.X PmZ PNx P4 P 1[Wf  *[ %[V+  [ [Y  [t  [X5Z! L [< ZЍYXZ-  Z Z  Z ZjЍ Z ZZVY  PЍGL x X P ( ( X | (G-PQ00R0p`ᤔ00M 0 t@P @0S nS a0CSsNU2  0oSm SjPN ЍJjPZ V000U0009jP[Z V070U070P(jPZ V000U000jPZV000U000jPZU000V000ziPZO V080U080i0@q@iPZ: iP iP iP`ZL V080U080?iPo iP iPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000ldiP T]iP  t T  x L  ( D D0 A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  1p, 0 mp@ mp@  p@@@dm0 PmmPm0 P mP`Ѝm00@O-1MM @PDX D"$ "4"(0 p C. `tpX@D;@8 (X0Sl pp  ` ᰑ 00㨱$ %0!`p@ t0!0Q 6P4P 0S Rm001ݍЍm0S 0K0S R Pp 08D<4! @ P0 00Z  0o/0h,R <1ݍЍp ߸HtF t ؀tg0@-P@M 0  PLp Qp@ Ps Ѝ00 0jЍ0@Ѝ0A-@@0s/ PP0P 0 'p` ``J0`0l0pp>X`p l``20`0l 00,p@-@PCM2 /]P4 ,pPC ` @l000 t3 06{C.@ F {P4D@ @Fa0S VS00 SCލp|@@0S{l@d0d 0P@0  P@1:l?00@l00@0 p@-QMP4@SMY TE /\PB QP0s+ wgP QaP0 `&pG @0 @bpq> D vp7 ۍЍp)0si/q1p0 +W l@0 P@0 c P@1:l?00 p 04l0#S @ l@ l@+p@ l00HT 0@%t $ ,@-qP`O-$p(PW,0-R`@/U'Y1 0/7eZ0 01eQ :["J? P5#I x@t4 2px 2@zPYh@sUZ0J[% 0@-DM@ P, P < >>L== =A-P@U 0U0PUP!A`F?PFq ``6P 0!Eq1pP 02P''O-@ML008 p L@0 0@8@4@<@@@ @@@pj P0@T0\0P`00tt SD[1S P+ 0S1=S 0+ 0S1,! R Zt[( 1S * 0S!,!A R%R:}p* T  0VZPT ` <` SJ X*a !_0CU ` e‚!  3Sz2)t"`Zjiq;nmzZ`UME>h+ TeT0 0d0?`0t00T0?P0l0D0?@0p0<0?80h0L0?H0?X00\ 0 00#$Q `@0P"R" " #.0\ !#/2x"$0S"x`@y0`@0s `@ 20$P :$(\0<Q0(0 =S%0h00( @D0c0S`$0 l!#:6$00 0.$0Ϡ.>D!! 0!!!0C 2^!>0$0.S0( /2"́ ?0 0 #1?B! ,  ,$0 0S (0^ #0`@0%t%pq$$H#"" AAt!8l""""'%.Q\(\)(0`@S  R $ R `\I!:6$4&60 Ϡ $0! >0!!!0C 0Q ,"΃0/($0?,0S00#0S<,000, ,00Ϭ8(<00$ 0 #1?B #: 6 4$&60|!$,$0!,>Â!!!0C 0R!,"΃0, #1 (, ͌ , ( 00S$ %0 00D2f_Z0`@00V `@h2p0 P :Q00 <S$0h00 0 c0$>_ 0$"#:6 00 0.$0Ϡ.>#! 0!!!0C 2^!>0 0.SX3($d/2"́ ?0 0 #1?B! ,  , 0 $0S`@ 0 P0Y*0^R*{ r0s{PT 8<0`@0 dS2  Q9 ^ $ Q*&$ 0PT80<`@  P0000  R00SPT8< 0`@D0`@0  0C0  CQ $0 h00$%`@0 @0D 00 h$%s 0Sp 000000i$0`@2t rt p p _`@ 0  S  0 & D%K`@ D SQ#=`@!D SQD# &-`@  SQD#`@D !0 `@ D!0 `@ ! 0S(0Ss `@70P h: c0 $]$ ',:6$00 0.$0Ϡ.>(! 0!!!0C  0  " R!Ό "$!( h(\ ?x#" ?00 #1?B!  ,,$ 0\ (  R0004  Q#SJN S  PQ%8< &0dQ(00 3)!:60 0 $Ϡ0! >)0!!!0C Q/ 9 #? /" R  " R $!$0  0#1@0L h0 0%HE 0C00000S P 00W CQ 0_$ 0 0 0 C00 00S ^ 0 0 #\ bh+R" suO-M@p$c0`l0c0T`0 W0 0 2c1 0008 PP/ 0v> 0d0?`000T0?P0 0<0?0 80 04$$%"p˟$p 0000  000W 0;0d0PY 0TPL dPJ$`P0Sʼ Rʨ R ʰ R  0 0a 0S0`d@?O$@Tȏ(ET0}N0`d@00cDp@ 0G0LP\T<00 PR\p|hPv^DR PE pPQI d4 吠lpptxP[@SRZ Z00d|@x0Ut0Yp0[l0Wh0 Rd0 Rxt [)[8P0>C 0C 0t00@p0` VP x0S b0ptp0 00@ d0 0Pd xH( "ό R t0"! R RWv 1p?'/!! ԧ#./ B pW ?,?.P P00#1 ?Pv.C BL\Sx  Ptp PpDb 0 zqp 0pq2b0S@T` VP|0 ?oR20S b00ߍ 0bd@xq@0 Q Q"10!Z@%NS" \TPd0 P0,Pd000 0  ZR 0S 00@ a0d` Kpa0S  0X0ZS0 `ddp p/0dT0? P0&0d<0? 800dD0? @00dL0? H0 \$XFZP ?@{a0S= C-ßs"bW2&:##c2S P#m8PP 0 hß0dT0=L30@8Ra 00P` d0@fP ?/' Rß&0Q| 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W0mpW!10'/ "#Ό Rà3\"= #30, S0AA^ B0 0 0Epq; @(@A`#00`0SA㴰@0d0m@괰[@0"c01 2c1@TÏ 0`0Q  sP`T00`0S!10'/` "#Ό R`00@o`T00V`T00B$l*x\)P\( ɚv $I%@-@B Lp~T taX00 R 0 R 0Q/  /  \ x h  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/ H  Q j.0 0#  Q/<00Ɠ\ 0@-pPo> 0@" \ 0 /A-@P `p@P@0% P PPA-\@`@P pjNP@0& |P PPA-\@`@DP pH@P@0& aP PPxO-P M G pP9 谟P n`P P @@ % 7P P0S  Ѝz T W X  E0p0S A-pPQ `@Q P 0@DDB(000S  ` t@- M`pPPp) _ 0 0@0S _0"S" 0p000S0 7/ Ѝ^0"S1Ds\0pT000S @ Ѝ1Ds$ u0   ` D@-@5 3@0O-P`U M PP2SpPK yP@N P K <10`0@P6 0nS# =NPP00Q Q \P R  \0  KB" 0 0Q@00oS@d000S p Ѝ4  @Ä O-BMM@pQ^@0  0]UP:NPP  QUPn00WEP PC @@`K'0 PP p 00P0 0 PPp \2@P! H 0dSPkPU0 P p` p} D 0YP @PP0 PpS 0Q P< :] 00BލЍP/U ` P p@]0SQ  IPBލЍ  I0H0PP0 p=  H]00 P 0Hd! 0 0 0]0<0  0Hz]!0 (q`00'a]00 P 0H}U]00  P 0HqI]0\0 P 0Hf 8 4  @dz   P 8 , | L-{M 0 { PЍ -{M 0 { PЍ >-{M 0 { PЍ ?0-,M 0 LPЍ $--)0$ S   0/ 00p@-P#HU@p\?( ( 0P 5/pȸ p@-PGU@p\?( ( 0P 5/pT X@-V@P 0003/ D@-@P 0003/ p@-P?oU20S@ 0 0 03/pt p@-P`UV00P00S@p$ P05/p lp@-P?oU20S@ 0 0 03/pƨ 3057$ 5 $ !PpO-`@VPpDM@P؆,  Yp0@ U p 0@P UK UK HZ,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0 @V@B 0S1 `@@0 SS( S R 0C#@ =0 R,0 Q ,0 0,0 R<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV1 ?R20S/ 032 b0 B12 00@s 0 R,0 Q ,0 0,0 R @YfV ?R0@SQ  b9@S B88 C c3<21FV ,00 S Q 5075,50,0 5SQ= 305 7,5  0,Sf @ 2$01$0@@@0TS`VI2=0F?ofR20S00:FoFRQP Q P=V, Q05`7,505,Q,0 P,00,0Q  1@ Rf 0Sc @[ @ 0PW  @ ?RM0@SJ b9 B88R00F @00R%#jo%#jx%ju-M{0{0 Ѝp@-P`M0@ 0 4/ЍpG-PRM[  `TpPC/a@HP @1000< pp. Ѝ80S&  1 000< pp.X0S0000< @ ppX0Sx X0S X 0 < @X00X00 l  @-$$@M Ѝx؅O-EM M`X@P+p `E7C [0P@'T 0 [0P@T| 0 0EAP B BUEލ ЍW00W00  @-@` pMPRP& /Z 0RP$  rR$   P @0C rR  Ph 0 @Ѝ0 Ѝ@}0rS bW 0 A-`@ p 0P/S /TZP @0 Sp 0 S = 8Vp@-IMM@`PP p 0: S X0 0up IލЍpWO00@IލЍpW00 p@-IMM@`PP p 0: S X0 0Jp IލЍpVO00@IލЍpV00 H-{M 0 { PЍ 0P 8 Q  8 //p@-@P PP` \ PP u HP  p@*gPPp--00 M (0  ЍЍ/ 0P --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/ `00-@- M@OP  Ѝ@Ѝ/O- q`Pp,M< PR% Ppp0 0CS% P[ P@ 0 @[P N!,Ѝ000:Q!0P00,Ѝ   BLL 0 4z AL 0 '0S 0 B 0 b00  00 0p@-@PLppp@ 0RS00 /p@-@<0<00P  @Kppp@ 0808 00 Q0R00 /0p@-@`PKpT T   p@pp@-@P\ \  ` @KpTT  p@p0O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap2  W R ? \ QQ Wt ,0 000IC1100Q0 0, Ѝ0000 00w0@-@0@ 000 @T  AP80@080p@-@P AP80@0800-M  nЍ0-M  ЍO-ϟiM P̑Ёq QP@ P? `K͌U PD? K͌T {P? F͌(1S hP> F͌(Y VPl> C͌ X DP$> JB͌8W 2P= ̌1S P= ^B͌``=@ 0S078D H0P `P P  P P Pp PP P, PP( QP PP (P PD PxP'( lQ780H0x100C40S000C,0h0LP 0P( z(0Q0Pd  , P `P X hU1q @a0T0 @IT, 0X  p @dQYh`@0`@ ܼP`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`ƾV ,PY 000 `,0匰 0[p$0p1`㐀0@@p`SPp  W 0@0@S  P8<`@P(04 0R(0LPP1@0啿0S@@X!(@L 匿0S00!$0P 儿[T~0S0 0 v, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  P5U,0V00@ Pܰ封[ P@0ɻPP  U `X0pP @Y 0@X RY0,0P0  0, H V 少[0D|A>`Fp1``  0[`0Lꈰ  0PUMP  0@TPOQ @ 0PUQ @ 0YSJ @ 0XU @ 0pWWQ^ @ 0PUY,  `6,  B 08P< T$,  p , 0 H T0封1D|a>p@(8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  PU,0 V00@ P封Y P@0〺PP  U `X0p8@ 0<X\P@U.[P,0 CT', 40p! < ,0 H0X 0q1D|ad=p@P 00 0R1 (0SE ,00p W 0g1(0pS3 1@ a! @0T0P0 @`T,00 ` @!(0R1@pPB0P@> T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @ T,000 @,0,0Q@@ఱ>P`p㛹 PP U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @T,0 0P @Ta$0V1@V T  0 O0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a PwU,000 P,0|!0RP 0P1` @0P`R T  0 @  h50 0R80000S 8O-pYM|Cq0cS@` Q 00L3?K͌ 0 0v0S?H`3K͌ 0H0w0S?pp2F͌( 0p0u0S|?Pl2F͌( 00x0Sp? 2C͌  00z0Sd萍 1?B͌8 00{0SX 1?̌ 011s0SLN 1?41@BM@0810 PYߍ 00v0Sk H`w0Sv ppu0S Px0S z0S 萍 {0S  1s0S N <0@-P@L0MH( 00 ,0 40Ѝ0X00@-P@L0MH( 00 ,0 40Ѝ00\0\ 0 R/D@Q 0Q(00?H/0|$P0P0/ D <  R ,  R$ 00?H/|$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@Ub@U(  R 00/|$0 000l P  `0H?30\ -@@  G\,00G//|$O-PP 4M 0pS4Ѝ|PH D0 0 0L|!01:|@iP` `0D0ZP`@0PZ0 TP V@``@|I:L ?3Q 4Q<  H0 00DpL |"(099`P0S R@,PR @0P  : R0`S4ЍT `@004  0㔶`Pu @|`|$0 00]ݔ0p@-\0\ 00PU 0@S عPHippl0p@-@P 0PS P1Rpp0P0% H -? \0| DR0  0R0 S000 0\$( /ܬ|$0 000 00 /qO-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n \1Q0'0 0 0 0 tЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000ۨ h( d0C-餂pP@M uPP @@{ d"j =@-ÆBBB {`@C{@@@@0PV CM pQ 1pL 0p R] @B0 @@@(P: 0 @@@(P/ Bp+ #p' p0 @@p(P  'h,000S :3S ЍP [B2T @TPЍh0S,gApP_ 4n ]\A-Z`pPp ZBc2S @TO000 R A A ݶ@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0Dl0T0Ѝ!fkTkLj@0l 0̃ S/iO-C@p`ᜣM[ +(p($W 㩷0CS0SL3㫷8షP $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0Ch' Jl`p  \p  00(@T(0Ѝ `akӠ 4 ZLk4!i +!,!-%!.%0%#fq&i%"`j#%ok{% |l%m%<ns%t%$u%4v%,w%x~#p#r"dy"ezi@fg>Եpp<ϵ^̵vɵ8#Ƶ:õ0'#㽵z #㹵H#㶵p-㳵-㰵`_㭵|㪵o㧵p㤵r㡵y㞵z㛵{㘵@|㕵h}㒵6A-``'^` p @ 0^ 0(`V(PfO-`ܶ6 6M000ƟJҭp6 0000SVF , p ;p PP[ Q p?P4S S S|V0S%pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0Ӵ $Q B q 0 ;0 ĴpP.4 S S040S$ 004 0r0  cR$`S 404 ` pse0  ;0 啴p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SipP 0@  ^ $@ `00 4S  20 zS 202 `5 p_ p 0$ $P0 s 00bR40 ; 00p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100#?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100#?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 035P|yy\yXx,QutAs< M0(  0 + 0040 0/rlO-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 03P0@P@P@X@-@L>P @F>P <P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" G GO-08vSp@`M$f`ZP !U0 ʍr `r 0I"R 3S(0$00 0y;PK 3To;P * 0XSd%$ X% 0"L5`0T <504S0300SL p0SI 4SC 4S 0t24W】匡Tp2 >PN 4p2[  LAT `P P '@̰ɰoX4Ztx2 PX 04x204Y|2 Pl 4|2hЍH5S4S~ 4S0?o20 D p$l h $ <%$(lY :=P Z 3=P [ ,=Pp2?;~0p220P_0 rr 0H"R8YD  =P[2[x2Y  =Px2?;~0x2W  <Px278x2Z  <PL2|2[  <P|2?;~0|2W  <P|278|2w1S06 4S2{L%R/q[W]  <PXx2!78x2|"[Z[(`1M80<4 |2O[W,  <P'x278x21|29p2[x>\@th 0D@-,@@0S600<,@-$@@0S}600;@-X@M@ 0S Ѝ< 0000 060 0Ѝ;$@-h@M@ 0SЍ 6 0R  (00 Ѝ 6 ;H;@-@B@2@P$MQ :cVT0r3ppp>+0Saqp 0SO1p0S@ 0  B0A*1`00|PM 1@ 300 R 8 C 30 0Xz30](0  :3,pp4 hP`$Ѝ0`00|P @ !6 0R` 00 `500T @8 <300 6T::ll8pC- M0 P `  !U L@5<0@00:3S U  Ѝp  0 000:3S/B8T0T 00:3S 03@-ppp*P`/@-<0< 00 03, ppP`@-808 00034ppG*P`P0@-PPP M* 0Q0@00xP 00 02000*Cz' Ѝ0|P H00 020000*f' Ѝ0l/0@- 0 @P0:R M P% P P Ѝ0P 000 U208' Ѝ0PtP 4000 Pl0 000: !-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0\@Tp#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@TЍA-PPM Q@`Q00?`FV`V` ,p(L 0@nTЍP/\ 0,  B0/\//A-`MVP@,p(L 0@BTЍA-`MVP@,p(L 0@(TЍ@-PP M Q@6`pV00Ӣ?/`FV`V` W  L0p@T Ѝ(1@ RR( RR T 0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0>-弢Pp4S-`V@PP3@ 0 00p) ,ࠢ4, [ 0  , 0 ( lЍB0  9lЍO/O-:$M$pdZ0  r$ ,@T] P 0p p W VH&:0PSE  0 ᾡ@Pp$Ѝ @ P0S S6 SpUV&0004S$ЍODp @0S F0V  B2Rp  `Fp^1U `F 1Vp  pN1@p FPPQO-PM 4 3`S,[*Y= @00! 0@ @00@ ,TP/ { @p ` PPE @0S  0 <`PЍ` D  P 4A " 2:Ѝ @0 } SxP0  0 /404 000S :P /|8<0<0 0 0S :P /{404 000S :P /{<0<0 0 0S :P /{d404 000S :P /{-DD 0\ ʌP 0 ~z@-|0| 00@T 0J#4R B0pQ }8@.P P @zx808 000S :P [/yD0D 000SP:P4@//y000 000S :P r/yPL0L 000S :P @-ap @@/yA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AUB0tQ 7A-x-0    pw000 000S :P /wO-00 0 MX% p `P 0 p @P  0 Pp@ 0 5@ ( Ѝ@wXP  P /p@-JP }3S P`4` 30PV  0s3 S 0忝P 2 $R 0X0S 0D3 20X #$04p03ppHp@-jP 93S @P4PŞ30@Sp@辞A-`PY JSU#X p @R 3S$ S(XڒL0AQ0, X0p ,01B0010χL10|10\ b0 0XP 3PSSpP4Spp3PUpp@-@P PX0:"C0T0XppG- ؀\/P@p  `TP LTL VW PT WV  P000S<080 ?0 0 s,|O-($Z Ap`PP@8P ( I.T2P* T P 0 2. @00 *.0WXT P  RX8 @(  !c.@0r8| @-?S Pp0   0P @T1`a p@^`  0000pp0 H @ L Q Dm1S J0 (00P0 080 f h10 0S0J0 80 W B000 p@``(00P02  (C\00C00 T0,R001 @0$80 00 0 S 0C`C 00080   K bTdO-P,0M 1H`  00(U1 0p @T% PE$ `p0(@ U 0<P0 0@  0@'0 Ѝ-,0 (0 M0 ЍX0- M0 ЍC-@P M(p, P00S 0G`SLhPJ0 O@0H"Hb ``8 v 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00%0   0T S00% , W10X0pXP T0`ER VڜpPpV 0  pP Ѝ80  080 000 S0C`CLp@-`@P!pp 0p@- M Ѝp@-@T T  M` @P p 0 ЍpU0l l0 00S X  8Q Q @ ,@ /&R//T0H H0 00S 4  !R@ ,@ //T,0`0P0 T 0008!R !R @0<@0/6S//S<0P0 0 0001S@0<@0//S`l0l 000S X *" (Q Q @ ,@ /&R//S0$0$ 000S @ /R0P X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` P*  # D000T $000S0QdH0H 0 ?o20QQP T//Q80000 00 0RPT00/P0A-`@P` 80  QP p PeU @00PU C000S0Pd0 00O0?o20SRPT //0PPT00/,0, 0000P/P/Od,0, 0000P/P/O(O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!%pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!S%pW`YHp0Sa>0 S;,0 0D | 0 00P0qjpI PX 00C K0HSP 1TX[00CS``[TY0IS`YPY0 0CP!YN|0 00Kh0p@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/$!O-PP + С1D0, 0 S 1H`?c`` AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0C}QJ 0 00H0T0 ?o2R0S P (1  //\,-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  ЍGX (0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P$ (0@SpP0@-0^ @ 0 Q@R0dO-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dp80 `| 0npP Ѝ 0 S RQ Ѝ,ᦑP e,0埑0P 00X p  ``F , B,(`aaA0  U p0E`4uP  Fp`,004@ 0U` p0EuPT   PB  0SQ 0 0PC 0$ 0\R =PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP B0 PQ8 0 /$ $\/ P/?PQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ETpM D10 0 QT$ D 0R U EBp; 0D00  Q P@$ R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q?40 PQA-`0`p0*Â@$ PP q@D00T 0Q=LP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X K"@ 0 0 09@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0L0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4}ڌ`e@Pv z{툰 {^Pp,o xPP0b Y4& 800S0 X0 08` ``$T`L@0< H0|0P08 8!\08 `0d0h0p0l0 ЍGP4/  P) 0*Q! Q80 SpG V P  PʪQ Ѝ IGEC@? A-0QM@PP(C p`QAR   B P1 \.X) P$,PAPP H0 DH00R00D p0$`P!b@0SЍPЍ6@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI :L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @5|$ 0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0340@-44@M00 MЍ2QP-D00M  ( @05Ѝ2@P8 /00@-MN  P@N000 0E DЍ0QPO-r( P0@0, 0!0 s0PT( H00#E @ t@T,0Q0@t@T4000SH00SX   R ,  H DS400,01$00Q$0 0P 0qQ 0%, S00,0,1$0000 S 40p0L|@0H00D00fp 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Xp! 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 S8( 0`V 00P0 0CS 80 @@ NN Œ Č Ȍ N LL\80ɟ`Vpl$8( 00S>0X *1h"0( 80 0 @ `40 , 0W Pp$t00Sz000 @0p` 1`11qW878'880 }<00 00S 0X *1h"0`40V @ 60S G6( 0p|Q:0A0 0C0/l 10 0 S' PP 1 11RY@ RRQ 0   S %( R R !%`FPA p0p`P@ !?3 pGWaFaP `/0 < p  L  `P 0P0P00 PP0iP0D0T H00S y080  400 e H(40  p`\Ѝ8 L0h `T<00D RW 0 R PP! [R  f[ $R[  0E0 p0S  0E  <000$R ( 3 H000S2( 0<000h0S0B  0 0|P@t 4000Vg0 0C B!H00 R d1S\Ѝ4080 @0 800P00C\H00^B0SC V\1( 0, QA@`3`4! ,\@XP ppX@P GP0@, Q J   4p@,@ APWp@PT ``HL |T , rt\l`TPp P @0`, AVXDP q@DH P! X @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \0 `@00400   0}8 0'00@ 0C40c0 pWPx p p  P  , BQ 0` R G 4 DP @P | 40@ PL0Y0I D| p~0TpP:W W@ P q@DT GpGGD@c0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0 PU U R0a R  W R R"R10 S0@a 0 RAA LD8$ `P@@ ,@D@lT \E$ P0B `0 B8 B!!Z 00Cz 0U40P0 P,0a0 0R0h400,@P d1S ( 87 I <0@00!R 4Q R dP  .@ ``B 0E0p0~ 0E  <000P( D8(  <0@ @0,0 0000Sp 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  \9( @` 0 ``( <@0 0L0 00 -<000N( x>@ x0 `C0`  <000tW 5 b0 U<`? 0 0LRP6Pj <00 pCU YʕbH5Sp@TL 0$`P@@U= 8P8P `$=``O-x:xz0t*Mp$P( ,pP @*00\` S@@s  aRXAkHQ00) 4 @Y @B@0@T ROoB@TP `NNQS0)\ 0  |  bR\ L)` R&<) R! CP'I@, 4R S[80S 0P0$  B$ X@0C, 4R CPf S ^\ \( 00Q <80, 004(0RJ0H 0@0( v $P)0S700S00l0S# 0 S , 40R#0l P, 0S NP$0CP$D70 RЍ (70( M$(00 SBFf@`- & (00 S4$&P0C (00xP0S  P$00C$0@d&  X&0 ,@(@ R 50 60, 40Rp F f@` 0 0, $P, 40BR0S(0g 0KQcڤ%%  p p d% 0(@`V}q@nR @D%@ T ,00P0S 0P0$  B$ X``Q 0[^[ $ 0|$0C ,00(@0 K[V p<$ , 4,! ! x D @  ^$ $@$#0 P(0i0 Rv ,,Xqa00P* x# ; l# (0$0@ ?3S0V{( , 3\0$7 (000P )(0$0S p  0P0  G@$(0lP " 20,  , n40 S ^ ) D20$ ,B@0S 0P0$  B$ $ 00P0 ! 00(@T7ڬa` ! (@00T0!0@Dx P(@0S  0P0$  B$ 0, )a`0S 0P0$  B$ 0,  tdhTpht@<$(P4 |(D\l 0xdO-hsh3pdC@00 S M 400040(c`(,P Zm34@ 3`0T&"0C S402PK䢟  50@DS(00S00lP 0S 20 0 204@,P0T0hP XRP0 @P 0( 0CS vP 20 0 P1040 ,( Ѝ00S00h0S00~0T100 F@P,P  ᇶ<1(`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( l0  04@SSCPE@D4@P,L 00SL004P h,hltT@- ,(4 00@-  ,(4 00O-p1p!0 h *⨒YP!P H!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU,@0@DaQaS@00 0 Q  ST 0Ud0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/<O- MtuPp) h5` 80s,  S̠DD Pr 0R!1S5@50  50 `\Pᴖ 40 0~0P 40 0s40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q WS~VZ]9 Q oSf2 Q 4SSVi^* Q j^S! Q WSVk^ Q S Q[-S 0Y[=20  0S0*Spt !-=000 0R$"R 2U8Ÿ= @0A004 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RYPU Ѝ0  00!R 0ʀl2 00 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S\jld1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /D1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/@-@P@M&\\ Y #3t P P 00 C000 0mЍٜl`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 0Xz\@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\  `0פy0 000:h/Hp@-@0@`P0M*l"R R`   P H00 040@ 0 @ &ЍplX02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R. R !p@ '( V@ Ѝ1=00QM0SJ\1p20P10 0H0剑Q:20t1=00Q!0S0p20l00 0(0剑Q:20h00 00`0pY0!Q 00pM0!Q dl0 000/p@-x0x 000@00CS0 S p0 S P00pᯗPp00p@-0CS@0 S p0 S P00pᑗPp0p@-,0, 000Pv@pp@-Pv@~p0 000S  @-@J Q P\,Q    @/ќ00P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0P`Pp@ W nvP 0 0C S0+,+00FT0 S80  F2 0@ᰰ0 @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p rPP+  U  P `X(0 SCJPC0 0(0C\00CsG`$ЍQz TP P  D0|0ip H0@D002 T `V `tV `` P|ϴ0 000p@-@Pppp@p@-@80800P  @ppp@ˠ0O-<6dM0@P$0 ^ Q| 0pRu`PyU Pq0P0O W 040P0[000P0@SE:I.A@`0XP0P00PEPUO000 00PS0408 00 0`P0p @R@+40T R80 ) 4000C?00tP`FtPH` t$ \400Pp HpG`0 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!p! Bp G" RU     HU pG4 S0 0 P` 4,8p 04,0@,@ 0<8>PU 0 4Q00C  00 Sb 0( 0C0, Q0 00PSl 0002 Et$ 10 P 00  0央 0 K00000p0[000C?00'tP pGR0H`FKtP 0I pA! Ww 0H 00 0ᰡpG W!D0|0prdЍ004 p` 040T pR0`40 00 0P} 0GPredЍ`rT0 00 b0p@-`@Ppp p@T R00 JĠ0p@-@Pppp@ =p@-@@ @  `  @Ppp p@'@0p@-@<0<00P  @ppp@ 0p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``ÐO-葟MS D@HP 0X 0p`@ 0 0[  E4/ 0 R < $R0<SP10000#10#.Q00S0> P 0 0@0 0x00 P00 Hr R0S0 0?P4/[WЍZ00 Hr R0S@0刀0pP4/pW„4Q" @-@ RM !R "R pPĜ\  00@]Ѝ/0Q " @-  MS S PpP$R (@4Ѝ/-4M0 Ѝv@-@000M, @ ЍvLp@- 0B\\@S ^\1  @ % e ,\'\ { d"LA!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\  "0  {  \ @ o% d  + {o\\:\ { cQO-M  nPP 0  %  0  S  h `\ @u,S 0   @0S *  QS%S +0B GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 Soq 00PЍ%0iR@ 0 `fv`  00#1.R0*R0 S l@0 S[0@@00dR% d 00 @0@00 S0[  00 @@"0 C0 0 S[ 00000 K0`"@ @ 0 @00 S020 0r 0  0@ 00 Ssؑ00s00 00 00 000@ 0TX 0@d0 0 r 00 C C00 0 <0  0 @D@0 @0T0 S\R Z I00 S0   ot  000S0\S 0 S0 00 %p%c%+%cD$</>p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0LlllTplA-@0MS0D0@!0@p0S? ` 0!1!1P!1"b2cP@AL0L  00210B P0 pW$P@WP 0fSPЍЍP 0ЍLNgȧA-@0MS0D0@!0@p0S> `Y 0!1 ‚P P@0!0A1 0120BP0 pW$P@TP 0nSPЍЍP"0ЍLk>C-@0MS00! 0p0S2 P 05!`1H $@0 x 0X1@ $A0!b4!b @1c1c0A 0 00ࣀȈ(!h!bC P㈁ 0tS0cS0S㤠 0 @0Pb 00< ?X 00u l4t, Ngȧ4Lk>|L?-S* #A-@`p0\ %\0PpS sS lS@ 0\TTW l000P1CP0@CV` 1D![00O-霮pQ qM PP- 00S0406 `$  0l@H 00S1  RS G@T l P p 4 @@T %T@%T400 R,:PjP 400P,%0p,00=0,P0 - ͟00:T T) `DV%?#"< / XT c`Dv`Vfz t``` 0`D@lQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0Ds =R=S2t 0BXaevV.`^`0^@ C @00! Dr 2\* R:0Z'TOP ͍R'R ͍T0   R'R'Rp@@pI@['hP 00040hP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 34 00`Q,\*P 0 ‰p 40P040`OU; 01 1`0@1O1S  0C-11@ST #Q,%*P  4 @@9AT @D=AA0@a DrQA DR3@D1@ؕ& R ?R ;RL  pR 0%R 0@a0Ds RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU5 =1 =10@1@10Ds R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@ps!R =1X@ BT! 4 Q`!`10` Q,0*S 0 ᯈp 40040@M, 40,qߍ! 1JZ00@QU PE=1@Q@1OU =0@01P@ Q$-1 1OS700PgP 400P,V 2gP 4 `V ``&``VP``P``Ì`@oobP``V ዿ`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2Vg0PQ 4 0,0S@p00@ 0 n00 @00 '8V [`000&@DQ0VT&$#"y p ]K5#C0@0C!@D<Oo0B0050@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/:A-pQ@PM 0S! XB %fP V`V! 6 0v0* V Uz ``ЍpP0U0b ``U d 0 0 R Ut VU\P?P0S U( A Qp 0S R s0r (0 000SU00DP g0 p0(08P g0 p00TU@4    ` @th8< <    l0R @-MI0@S G ЍA-pPRP U) @`TV 0PS |t@P0DV  `P XoA-pR `Q 00@ PP{ % P P H$0 GS  neP  0 /0r 0 /r 0R0 /r R0 /r R  Ͽ|Q  Aq0 pQ?Us0p pWP·Q| 0?s0S # pP  o   1@pP V0?s0 q%dP v0?s0S  pP  q0Q ?sp!Upps0q@pP 0?spWC 0岀ḏxS$pCPC " X9 $ 0?"s0Ž nP6 sPD fP*0pS  U R00000qQ 0:!KdP DdP" $ pP qe$pme 3dP$0V0 p03?/U  R000000 /r R0U0p0p?s0(C-Pa@|!`pM0  P 000S= PЍ`P Q P 0 p R 0S 0PP  VPP004PbЍ 01 P @``+ P *v`PF `EE8O-M M:S&0:SSP 0`S:Spp@F T R!* R @ 0  tDlP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI P5=P 0 ۍЍC0P p! FP20 ۍЍCl0P 0S/S pP PdX #0GdX P 0 ۍЍC0 PۍЍ p 0dYW L0L 0 $ۍЍ404 0 $C       A A G-p`@P  X0@cT  NP @\PPP P @T  @0GUvDv-@-@ M^00 Ѝ@ Ѝ/F Ѝ@ Ѝ/@-@ccc@cc c0c@cp@-@0 0s0?0 0?0P (000p 0p@-PS@:pS bP!pa@- ^ @fR^ qSnR sRq^ 0  Q A- 0X p`fR0X P@Ot P0  nR sR0?s00X0 0 R  0PA-P# P 00`pp0,SS00 0\,\@C`P   p`p@ ` \G-pl@`PP#;pWU*nUL sUC fUH0D Y%R> @aPH H0D@ / H0@0 H0SH0nUp@0 H P4 sUD fU< L00L0@P @QP00W ,00 ,00 2` 0S0000  0@SH  $03?0H00H0H0@ HH @,0s0?0H0@0, H0(H0, 0H000$P0s0?0H00H0 | HO-@ M rPZ p kpY ` d`(080H0_PS 0  uZw /   v Y/   00 R0 , 0R0 < 0R0 0L0S00@ Ѝ>, R 8< R 02L0S @,@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\0A-p ``V@PR `P A0u0W00 x /    0 0 0P_ 8  O-`0@ $M 0/P pDaPpUP5  Pk T`0P  0)a pP|@P PP@@:`Pa $Ѝ  aa0,P U 0(0$0,0 @ p @2/Rq 0S00eP^ PU X @/r `0LP@UH0@0D0L0; pfS0  0pg 0 @P PU  @Ot@0nS sSqpX @p4Op ` $Ѝ@pOt@ ``@o  A-` ppW@P R# _P 0uϿ   v0?000 0  0 P]0A-` pW@PR c_P 0u 00` 00 0P]0O-LM<  <0+, 4 0OpP |@P0|0`PF 00=ZPT 6PE2:PP^PP  PI V 0FT 0:,P `a 0 `10#0 $00 0p0s(0p s (00UPi ,PC 0S@ $ .S  ROSQ = pP# @Pe pp`v , R 0?s0V 0S00 R100 D`D0 0SP PO 0 K 0S% v0 L 000  00 n0P l_PLЍ0TS 0  0 00 800 S,0&Y0 ,o^0 [  y@0@SQ p@t`00 0 0f0 EPdX ,`@V 0 V P ph (\VQZX %P^VPj `@V 0P & 0GSI( r (0tP ,)0 FrQE F/RVTSRQPONMLKJIHGFEDCBA@?>=<;:t76km3210/[-Y+*)glh `V@ V%40`  @ `00@ @%40    `p` `p,2\0 :08 ` Q 0?s0T R 0 0P  `p       08 x ?V  #v 0 S00Pd0`@P00 T0@\8 40 08 HX00S0`@ PV```pI 0 00 s0 P ,'@ p@tj p@tG , R 0?s0T 0S00 Rn00 0S00 @PWQPOT` P0 I 0  ,P5 P p`v0[ 0@s 0 P0P 0  `|]LЍ 0   pd0 l < (p( PHz   | 0 | h P/$P00//@-M@f0 0!1l!1"b2cNL 0@@0#@B!A@C0PЍNgȧ P0`0K?//@-M@+0 f0 LlB N0"0L 2<@0#AB@C1dKPЍLk>$0P00?//,@-M@0 *0L@N $@L0B!b!bN?AA4 1c1cL0P0@$C!d!b8A@C19PЍL?-S*Pp@-0P0M`2@P 0Ѝp,], 0 0S Q20Ѝp4G-1!0  aP P@4 04 S0p0p2,0APP0  |Qp`  .WPeȄpEQ  #W| 0 ȇ0H00' kp&@-@P \\\ \$ \, \\,00!R  !% 001/%|001P//%d @@--@ X@X0@0@0s H PJI HH @iPA--(M g7`0@[TpSo[jW4C@-whO<(q*]{b~ y\[9&Eo8k  )SRQPO_LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{WF{{l!00 (ЍP P 30 00WB0h {kWkcT!00 P ~P \# 0W 00 "P  0cP0L30{kWk 0 rP  0cP0I20[DW{ 06{kF{{\Pm  0cP0x20W 0y0 "JP;  0cP0y40 W"  8P:  0cP0}10n[DW!{ 0a2!"SJ P,  n0cP0%ʘ0 W"  R `0cP0$d10W 02P!"P  N0cP0$10W 02!"P  <0cP0@00W 012 "P<  *0cP0@ʜ00W 00 "P  G??i P $ l  xG  4  0cP000[D{k{F{W{ 0! P  0cP0tT30{kWk 0 P`  0cP030{kWk 01 sP  0cP0m20W 0^2""aPD  0cP0Kʌ20W 0<2""OPL  0cP0H20W 02(""=P  0cP0D20W 052""+P2  y0cP010e{W{ 0 P  h0cP0ʀ10T{W{ 0  PA  W0cP0@10W 02!"P  E0cP000wWB 0 P9  40cP0jʼ00W 0[2 "P\  "0cP0%x00W 02< "P   h  H  ` x t G H 0cP0000W 02@ "P  0cP0(t00W 02 "P  0cP0ʴ00 00W", sP  0cP000 00W" aP  0cP0<10{kTF{W{ 0 MPm  0cP0d30W 0r2#";Pc  0cP0 30W 02<#")P  w0cP020W 02""P  e0cP0Xʘ20W 0I2""P/  S0cP0IX20 00W" P  A0cP020 00W" P  /0cP010gk[D{W{ 0x P~  0cP0ʈ10W 02`!"PL  0cP 0<10@W 0% Pa  0cP0Z00W 0K2 "P  0cP0ʸ0 W" 4 P  0cP0qt00 00W" sP  H G P ( h 0cP0_(00W 0P2< "KP  0cP0h00 00W" 9P  3P  00{kF{W{"00 r3030vx300#W""00 _H30@300#W""00 O300X#W""00 B20{kWk!00 520200"W">"00 %x200p20c0"W"!00 @20|0p"W"v"00 20200H"W"f!00 1010$0"W"oV!00 10a10100!W"HC!00 `10:X10l0d!W"3!00 (1000!W"&"00 00000!W"A!00 00300f0 W""00 00  L X   < D ,   d 8  ޤ T ހ H T ބ00 W"T!00 `P00FX00`00-htp00N0| W"!00 G00{kWk!00 7300#W""00 *30{kWk!00 P30uH0L#"ZH _H 0#"Wr"00 20{kWke!00 20{kWkX!00 20SP"00 K"00 d" \20A  PH  T@ 7"00 2"00 -!00 (!00 kk!!00 "00 "00 !00 "00 "00 "00 !00 kk!00 "00 0Sh !00 |0S1 !00 t0S !00 l0S !00 dP  ^0S !00 V0S !00 N@ !TD- D  ݄ 4 0S "00 70S !00 /0SO "00 '0S/ !00 0S "00 0S }!00 0S u!00 0S m!00 0S e!00 0S ]!00 0S) U!00 0S  M!00 0S E!00 0S =!00 0S 5!00 0S -!00 0S %!00 0S~ "00 0S "00 0S !00 0S !00 0S !00 0S "00 0S !00 0#[D"M~P !H H 0#"0SK!00 e0S !00 ]x30cp# v"00 R"00 M"00 H"00 C"00 >"00 9"00 4"00 /"00 *"00 %"00 H mH 2x""2l0 02L0 0 2,0 0@2 0 0\20 0820 020 010 01l0 0"1L0 0L1,0 0!00 P10 0T,10 0|j10 0s:0 @@0 fL0l0 0]? ؈ ּ \ ` ׈ ռ  ո Հ ռ 8 x h X ` Դ Ԁ H  l  P   `0P0 0-40p0 0$2X00 0|00 0`0 @@F0 s0 @@90 100 0u,1P0 0,P1 @@0 oe!00 10 0!10 010 0G2 @@(0 82 @@X0 l2t0 020 0+;R\0@-L @AQ MO!Q0P PP 0 0 QȠ\ 0;B{ 7G 0 Ѝ0;B Ѝ03Q Q 0A@@1 0^46 0b0X #6 !k(7(@{6F{7{   ;B Ѝ0s<r/ /P 0S $0S 0S P? @4@P//A-P08pP`& , R0( 4", 0R40G@BT@! V @D 8,0400Gx0, #@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTPo @$ @ < ?40P R $ R  R S /0?0Op\>0U) 0PEt@T7p0pp@$>00Sv ~=0000CS 0S =007s@ Q=0 C0 0,0`S P?N?P:0?5 Ȥ?M ?Q?H?A?L ƨ?J L?C `b4B ?9?:?;?<?8?R?D?7 ?K $?BY X P ?O 4?E?I?6?F 8 @?? X T?GX ʈP ;UT 0PEt@00SQ! Q6;7sD@D  0;=0(000q^ ^  T:PEt@ T*U#   0s 0 @p 13$0 [U ($ ,U 0PEt03>0@\,( @Dʈ+7~M<2q@D0 D0B$0Sp0  0p2@0V'8<#0#w[ 202HL0  200@S2D0x pn 0S 3q0P0;T02@D0 C@3q@D07s0D@C s P7l0{1r0ರ^l[PEt@[UwR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0tP `40s (CP @n 40d@ 0p040H 700p_40R4l 0X[qPEt@[kU 0C00Sq 0 000(1 T*U $((U_ PEt1岐@^ Ԃ 7sQ0D7{D @C7s0D@CqCD6L0$ R'400  0r@6p0> 0sp0@+JP7s@DZ 0ಷ@D'q@p6l0 00` 0 0P00p0P0 Xtp0(0$P$(00 70( 'r0R0S(07@D0مSR: @3 0@|0-8@0F(80v 0s \ p T d \ h tP 80C pC90S800p@-@VPP80S ($03/$0(3/00pPA-@`>PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  'P00S  E B0S  00?>?RP 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0NP0,40p0 x0 0 0 30 Ѝ0l0S  pl0@@@ d!?S??P 0S $0S 0S P?,A4 BR/ Q /@o/?AA-PXPx@ 0!(`3/PPu 8pWG  ( 0(3/pP00@c  Q 0  \!P S>0R:oRS B P T  B T p W0Bp3  (08#d8pPp  BS>00p000@ Q 0  \ BP S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-PM@ @㬰(0VU 0C0 0$SQ $Cp0`0 sRpW($0p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 0s0^0U 0 CP0S 0SCUP!( P 0, ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 280%R00S02000@04000408@0D?o2<0,000 0 0 0C$0 0R0pP0 R`0ࠃ40Nࠑ@00t000(@<90C1@ R@P00F3 0S $Q Br R$AVJ  ` V$  \ F C 0 Y( V F(*Q BR  BRW < Q  R^8 %Q  RX,  BB!   S @1P ,01( 0 (08 $ 0 00 40V@PpMO-pX04M3 00C PU?PU@PUAP0UAPR@oPP 0C R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 00 0  0#400 0 `0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000. R0f9S H0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH 0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 D R}0ES IS= [S8 gS8 40S0CkWi D8 RC0SS@ S   00#  #800#"0   < ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0u0S 000#400q00]0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S/t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&s0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0<00S=p#  #800#"0 00]B 070c*W6F &R< \ R80l0 C;0,0|T 0 00 0000 B 0L0DC0C t0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC U060@! Rppp@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ 2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&Ī-M 0 BЍA-P?PUPr0 `0@ 0S  00 0t!(3/@PU \!@t 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 F, @@ AL DD <&!70 0C006& 0&;> 0$0;/O-Q$M R0   0S "r ! "0o P@pLß 0@$0*  ")z0 (ay0qx0t0@Ar0 ! P1:SuPQ`&9SuPQp'8SuPQP+P5S>3s0uP1@$ " "@QP0@R P \!R!!P! \  ++ +P ! @$ @$ $PD!" ,!$Q"0S 4X @RPR@$t@a@R &P%uPQL T%$pAR%D$ pQR$T% pAR%D$ paR$d& pQ@R&T%@$t@\%  C R  00#s01^ #$ЍT 0o""1CBQ) @pmHLtC-PRp ` P  0!\0 0#@B .P@18R0  C @$' C-PRp ` P  0!\0 0#@B .P@18R0  C @$' @-@Plp`hPp@` 0!ȑQ0 0#B    @-@Plp`hPp@` 0!ȑQ0 0#B   p@-P04`^00# @L P%!p G-pR'wph Q RO SRCW-o`VA0A0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcV V-2Q0 pGN0 Q"R 0pP1W1|G.7&c2pG0N 1pW|GpG1^NNQV=F10C>@AP  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0A0C 00 pP80'7b"c2pGNq%R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/ \U/0S0`0//L 2i46@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-DM PX%@QX 0F  u pGjP0P4 \AB\S 1vσ p P Q-0[P4尐&G B&Sp  @  ipWPQ=00ද0 K`{P0: `;VT`+0I AX{T4T+ pQ}Qp0W20|q~6x `00[0` IT$P0>0 0@00 0p0 S[0 ⵟ0  !  W X SA ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00U0 0S@\ R @02^02N00 R0@\DЍW@  yP 01LX 1R 6 G2#6pP^p N j p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MVPPR@ʀk` W !.⾐ἠ i5Rs0( P000P#406IP0cZ3s0V⾐5s0iS0P⸠P0%TPVIPeQq BYr 漖P9s0000P#406cR!0C 6Vj VPT@Q p` 0F?oR20S RV0XW R+}~ʲᰐpj5WPs0pPJs000p0#40vPpgYww0 UVA5Pps0k.00P0p#406VPcQ 0C6PT@ Ѝ Br 9 kV0& PPQ^`徠἖0`j9Ys0`J 0 00#4 0编0iQq0  R0἖`g)0 6b궐pi5Zs0P000P#406I0cW3s0 Y㼖P Ap9s0k.00P0p#406VPcQ 0C6PP) P V# Br 5 yO-ʀ6knS㼖0M #P  #  # #  #  ! A@b9 Ts0@p000@p#406 B0c^~00἖&R @ P$ pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಐApi>Xs0000#406I0cWsw0 0@弖^ `D Br @n9 Ts0=@p000@p#406N0cR#r0&0R἖f b9 ^s0 @Pk`0`00@#4PP0 B0`Qq0 k0&Ѝ0἖=0἖9м00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I, ( &&LA-@ k΀`P s0! Qr p p "$  aS2s Ak> ,u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ M, R 0p&]P+&(+#0N  q/ ! R7@P j   Q&Q3 "[q6k S ;p3 s0000 #406 cPp 0Ck N.V6 0G. 0R0 0xS0   0LSZ=00IX  &&0 Ѝ  \ R+R +R ,RE R  Q ,_ R3 "&][Pj 0w ЍO R \3 "[k. Z0q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦|qk>0#40缦0j\3s0 J Z㼦syzk>0#40缦0j\3s0 J Z㼦T@|qk>0#40缦0j\3s JpM⼦k> / ! Zq ! 缦jR!r JPἦ L I  Q3 "[F@q:sy:s0:s0 r :s0]q#r 0T:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  P0S A-P p@0 C`~0@>HTUT @&P &/@- MP`p;*@P @, P :Hp , @P  Ѝ} 0@0 Ѝv@ Ѝq0@,T  Ѝp@-P *@P @@p[ 00p@-@)0P 0000J 00Gp@-MP`)@P @ @Է00 0Gp ,@Ѝp+0@,T $@Ѝp0p@-S P@0 C`0@GT  0 p&0P@p]%aray0p@-S P@0 C`0@yGT 0 p%0P@p8%dict0S p@-`@0 CP0@TGT @pp/0S p@-P@0 C`y0@9GTp%(0P@埽p/$aray0S p@-P@0 C`U0@GTp%(0P@{p/$dict0@- M P@ Gp  @P Ѝ0a@ Ѝ0\@ Ѝ00@- M P@ Gp < @P Ѝ0F@ Ѝ0A@ Ѝ0aray0@- M P@ Fp < n@P Ѝ0*@ Ѝ0%@ Ѝ0dict- M} Ѝ- Mv Ѝdictp@-@P"%0PPpdictp@-@P%$0P p600pboolp@-P`@P  L0@E$p@-@@ @-@@ @-@@ @-@@# @-@@9 @-@@I @-@@_ @-@@v @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@~@ @-@x@@-@r@"p@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@#pp@-P0`Pn @P  x0@q#pp@-P`\ @P  f0@_#pp@-P`J @P  T0@M#pp@-P`8 @P  B0@;#pp@-P`& @P  00@)#pp@-P0`P @P  0@#pp@-P` @P   0@#pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  x0@q"pp@-P0`Pr @P  d0@]"pp@-P@ #(0P p$0P 0pstngp@-P`@P  A0@:"pp@-P`@P  00@)"pp@-`P@"<P pmP U [pdatap@-P`@P  0@!pp@-P` @P  0@!pA-P@"X0P p&`P  P `(stngp@-Pn@~"(0P p0P 0pstngp@-P`!@P  0@!pp@-P`@P  0@!p@-@R 0@!p@-@c P@"$0P p`00pboolp@-P`%@P  t 0@o!pp@-P@P  0@`!p@-@2 @ @-@, @ @-@& @( @-@ @> @-@ @T @-@ @d @-@ @z @-@ @ @-@ @ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@% @-@@2 @-@@= p@-P`@P  0@ pp@-P@P  0@ pp@-P`@P  0@ pp@-P@P 0@ pp@-P`@P  0@ pp@-P@P 0@ pp@-P`p@P  x0@s pp@-P`@P 0@d pp@-P0`PM@P  U0@P pp@-P0P:@P 0@> pp@-P`)@P  10@, pp@-P@P m0@ pp@-P`@P  0@ pp@-P@P L0@pp@-P`@P  0@pp@-P@P +0@pp@-P`@P  0@pp@-P@P  0@pp@-P0`P@P  0@pp@-P0P@P 0@pp@-P`@P  0@pp@-P@P 0@spp@-P`v@P  f0@app@-Pf@P 0@Rpp@-P`U@P  E0@@pp@-PE@P 0@1pp@-P`4@P  $0@pp@-P$@P `0@pp@-P0`P@P  0@pp@-P0P@P :0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  z0@upp@-Pz@P 0@fpp@-P0`Pg@P  W0@Rpp@-P0PT@P 0@@pp@-P@(0P p0P 0pstngp@-P`@P  "0@pp@-P@P ^0@pp@-P`w@P  0@pp@-Pg@P >0@pp@-`P@<P p2P U  pdatap@-P`@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P@P 0@pA-Pd@AX0P Np0"`P  eP `{$stngp@-PF@#(0P p;0P 0pstngp@-P`@P  V0@Qpp@-P@P 0@Bpp@-P`@P  60@1pp@-P@P r0@"p@-@Q h0@@-@R 0@p@-@0 P $$p@PP"0S "pұ"0F@-$@@"аFPw|P 0R @-P Q o// `( `P m0 t@-0  p @-P Q @X@ @0@ f0 ( (0( g0 ڲ < p @  t  0S p@-\@`@@ PdPpP p@ vuA-P`p# !@P  I`P `pp"⛰P` ;" K#" `@#=#*utDp@-P @`Pp5P p@L@- @P $ 0 0 0 tXA-pP @P"  0 0 0 5P `P  ᕳ` P0 000 ,0< -@t d  h/@-@P @ e 0 0X  | }-A-M `V $P0 PB@Pd pP  0P~B ;ЍAЍ/ЍAЍ/ 0 0t ߱ ,  0U @-@P ĭ@  0 0X ı D }p@-@P x0 0 0R0 P 0P Q # p@Mppq Zpp@-@P `0 0 0R P0P Q # p@pq0 YP/0 0 0R /pP/<0 0 0R0/P///p Y|0P @-od  QP  QQ U#/p, XP/ 0 0 0R/o@-@P \0 0 0R  0P Q ,#00ox X@P/00 0 0RP///o XA-PPM /o00 0"P R Ѝ R0 p 0 pG`P 0 S  R H  jA pP` !  00n - W WA-@PM 0 0 0R ЍQP 0 ᛬ 0p `P 0S d P 3A pP` R!000( (0( $0 ⅰm , V4 p ; P -/o<0"0 0^ R  RN/lP/D0 0 0R /@-P ĭold UDP/D0 0 0R /@-P ol TP /ol00 0"\ R RP Q  Q /k Tt ThfP 40 0 0RP ur/k TfA-(0`SM.P@U Ѝ P0 P QpP 00  0P* S'P0S0"Q00 2@P X i0 0 0 @Ѝ( P p i lP 00#  R0SSQ///@-@ h77p@-0(MS-"@R{S#  P{  @` `P !P H(Ѝp(ЍpL P { ?0  (0( (0 J Hh H x $@-@ح6@-(@@լ6g@- M`p@{P0 PN0Q!s*0 00 Ѝe0"S@- M@pPZ`0 `$pq 0 00 ЍE0"SA-Pa`6Sᇬ@P ~KG(5pP  l:n@P e2wḬW@&, ,0, (0 ⣮5Hf@ TM0P S0 P \0/S 0 P */\03#//2P S0 P \0/S 0 P */\03#//0@- P@M @ aЍ00@- P@M @ UЍ00@- P@M  @ GЍ00@- P@M  @ 9Ѝ0@-@P ,0 0 0Rc /P/0 0 0R /2S!Q  P*0  S */@/0 SR* R0:/ /c4P $0 0 0R //bxP $0 0 0R //b@P $0 0 0R //bP $0 0 0R //aP/`0 0 0R /2 S0  P *s00/S :aP/`0 0 0R /2 S0 P *s00/ S :a$P/\0 0 0R /"0R 0S/ /R0:`P/\0 0 0R /"0R 0S/ /R0:`@P/D0 0 0R /2 S0 /R_P/\0 0 0R /"0R 0S/ /R0:_xP/`0 0 0R /2 S0  P *s00/S :_P/`0 0 0R /2 S0 P *s00/ S :^P/\0 0 0R /"0R 0S/ /R0:^ P/D0 0 0R /2 S0 /R]P/80 0 0R /! S *s00/]XP/80 0 0R /!S *s00/] P/00 0 0R /!R0/\P/00 0 0R /!R0/\|P/@0 0 0R /2 S0R /\8P/00 0 0R /!R0/[P/80 0 0R /! S *s00/[P/80 0 0R /!S *s00/[TP/00 0 0R /!R0/[P/@0 0 0R /2 S0R /Z P -/o<0"0 0^ R  R/ZdP/P \ /QQP/ZZP/P \ /QQP/ZYP/P \ /PQRQ\/YLP/P \ /PQRQ\/X@-M0 `000 00S ppP Ѝ@( RP +B 0R xR#  P 0S t tP DЍ P PS O-\1MM0(@P00 p$0`0$ 0 0[ Q` $ 0`;/0 `(P Mߍ {P 03/P 00  $ 0:/P 000 PMߍLh0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-IM袟P @p ` @@@$@@@(@00 S S   0CS R0fSE ;"Sm [SbL20 @3/P 0 0  0S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0  S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0 |$G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮otfe"R /R@S00S@Ѝ!1 0    0OPp 0 +r  RA*0 Rf \Rc  uR_ 9PZ +r PU6I %" 0 )Ό" Ƞ"̌"< 0 Č 0     SPY& Yy  ͕)   0)#<  Y,!*-"-    )&  w tG-@`pp W W00 GR0SWL 0<0W0PPF <W0@@j\r\\p 00 S S   CQ R<S+  ¤P)   ἤP#  ᶤP-0@S@S -S 0@@-S0>S @ 0@0S>S 0 @>SSS @@ @dP (0SP  R @W' W0S@@m@PV` :P @P D /P0Sx|D %lBG--`MNJ8@PY ,[1ppP 2pP 0PH h``S`Hp0"  zPPR1u3    p `2WЍ%  XPP01u  00 H0Fp^23`1-Ao/A-PP P`p @@P@@@P p4.0,p0P4080<0D@-@  p@-(@@ ʣCᆣ⃣@-@ @O-4@T p`, pP @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ P p @-R 0P< P 4Q ,  D D0D )0 ⽥, ,0, (0 ⴥB 0 \p@-@M4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% @`ЍpS' R<s8Ѝp 0 Z0D kp p0p l0D b\ \0\ c0D YD D0D @0D P pX Ly (l  HiA-@`,pPP W 0 !Ꭶ,P0`,P0`C-`0@SPpMD  ]P00Ѝ!0 AP ,0SU !0 7P ,0S(0S00  0"P 0S?0S0"S 0:S 0 }R00 "R  0"S P  P @` 0 @P k, ,0, (0\ ⢤ #x "  L0p@-S `  Q P@0@p 0  0 |= ,0S 40 00$ $0$ @-0 f=$ `  4 @-R 0, B4 P @ @ @0@ <0 K, ,0, (0 B 4 XO-80M@ Ѝ@p`# PP @ ` @ЍȒ j ⼡PP0 004QY  4 R] ,剱1Qw  ` P 0YIW  B B!᲌,0 P 04 `<0 04 <0 PȟP,UN<U8U+5Y& 嘡 @i P 4 hPP) _ ,0,S<SS> jdP\ @ ,0P`<04 0<0x< !],0P ᏡYP {,x x0x t0F/wd d0d W0,nL L0L 0 e D:x 2 | X4ޜp@-@PPH0S L  Q <0 0 p@9 0  0K/88 p@-@P 0`0VPP l l0 0  0@S0<  pPp( (0( $0K/ 8 , d0O-0@SP MR z`40SM x `P@ ЍmP pP 00S 0q 2 00PX 0S. @0R* P# [` 3P 0<P 0S 8P' X D` ЍOQP 0  03/P  40R 1#PP 0 0U/v^ 00C 0P `N@zh h0h d0U/]T T0T 0]/T7 865 X5 8`| TXd@-@ؠ0,S<SS 0  0 ( d@٨PG-U p`0VRV@P7 404 S `  S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0S P`P :  404 SS`  `D D0D @0c/⿡0 000 ,0c/ⶡ3  ! $7G-PS @- Y`' T 1p 0R Z R P 004 00R% OP ? 0S 0 GU:d d0d `0i/q0,S0 000 ,0F/`1 (1 D,ֈ G-PP' 0 0R"A4pP 40S @,0aᄡ1 ,0`儡40@T:8 408 #p00P 4  Q@-P80080//p@-@P80080p@p@-@P 80 0R@ pP4@p/`p@-@P \0 0R@ pP`00S@#:p@/p@-@P@pA-PP 0 0R4p`40S @40S ,0 P@b `.lA-@P 0`0VpP0S ~P @T @ @0@ 0]/⁠@@s-  A-PP /o0`0"Q@@T @0R pX K@P @T M@ 0  0]/G-  $0P \@- ^ 400\@/ 0  0F/(,P dLѨ 0P o@-x@ T\ @\400\@/ 0  0F/+ Ѩ @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0Rp@ S*,P$0 B!400C40<00<0{ y h h0h d0s/⶟T T0T P0s/⭟@ @0@ <0s/⤟+( du x0ϼv T Ϙw P/?o0 2 R0S/0@ S/)0P -?o82 ^0S 0 SV /)PP/0 0@0R/)P/0 0@0R/( P -/o<0"0@0^ R  R) /( A-`P @PpP (0Sp 0P  pA`' `='O-0S@9 0@S7  ` P. X8qPp u P o P @i P HXP0UU@U !#10< ,$V P?@O 0 s0 ʞX% XP0@#r 1P7 0 03/P0  40R 1#P' `P 00C 0dP  @ꀐ pG \ \0\ 0 И8 808 0 Ę  t40S 0C40/ 0  @-0 ⪘ 4 0p@-S `  Q P@0@p 0  0 ≘ @ip@-@P 0`0VPo0S R <0 0 p@bD D0D @0 a0 000 ,0 X,   ~|wG-S *X@` V 0P 0R `00p *V` $V 0S  Gr@ @0@ <0F/A0,S @ }A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p @@-P80080p@-@P 80 0R@ pP0@p p@-@P 80 0R@ pP4@p 4p@-@P \0 0R@ pP`00S@#:p@ p@-@P%@pp@-@Pz80080p@sp@-@Pn8@@@ipp@-@P 0 0RP`[40S ,0AT Rp@p@ 0  0O/J zdaA-@P 0P 0R@ p`-8040S ,0X <0, 0Q<0@@>@D D0D @0S/ 0 000 ,0S/ 4 y ypp@-@P H0 0R@ pP`@p A-@P1 0RP`4P%80,0!qW&  P  1P ,0P < 0@ 40< AiAD D0D 0W/⤖, ,0, (0W/⛖ x, w0P -?o82 ^0S 0 Sd/hp@-`P pP@eP (0S p@  C 0 //@- TP0 p0 I xO-IMP @ @T p `0 R 2/0S\ P Y  9/0  paPV @T!1 0 003/Y@ 9/T ST T @T@" 000Q 1/0S' P70S+ 03/P. Y 9/S@T 0 0( ҕ 0 0 ɕIߍ 0 0( ⾕ 0 0( ⵕY 9/Z 0 03/X X0X 0( ⢕ wHP v@H v( u u uXP0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0BP 0 $ \00 Mߍ0 000 ,0H $ R00 s`# 0/0/@-@@A-PPp`M2 0S/ @0U  UU 0/P B 0CU/PU  U0 0 B/Q h!0C@T@!  5;@04D.< 0  R0* 0 0dp@  (V 0PZ @ Pۍ?00@ۍS0:p `Hp Xp 0P@/` p@-R 0@S PR :   PpQ0P  , 0`0` `90 `L0L L:0 X808 8;0 Pp p p pp@-@Q PPpQp@-0 MSP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPU pp 0 >$QQ Px, ,0, 0 ⏓T m 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@  k#0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Qp@>c 0 Q0`  j0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P p@>  0 0| − icA-PP4 Qpp0` XpW*@P&  P <V`p p0 8/PP`<``Q# P P P 0S #P P PP@ @ P P 0 hdp@-P@PP  Pf0@a@p {z011/A-\@`pP \1S 0 €  P 1JP1 `p P 0808 8A0 Α$0$ $B0 ƑH g`t g@@-@^ P ^%QRS  T00eNQRS"  TŒ 00 0 Z0 ↑ fDG-@R00QP(M P 0 ` p Pl `'0T?o20S00(Ѝp`0 <0 2/ / /    Q /0 2/ / /    P /0     Q /0     P /p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0KW P0V00(Ѝp@ R 0S V00<0Q000 00/@-@bp00T000S@-@T @-@T000 000S/@-㽒dt000 000S/@-㭒$t000 000S/@-㝒t000 000S/@-㍒t000 000S/@-}dt000 000S/@-m$t000 000S/@-]t000 000S/@-Mt000 000S/@-=dt000 000S/@--$t @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#t 0 01/(001/0 01/0S@-@1/00/p@-P0P0 0@0PS` Ppp㷑pt/000 000S-/@-㥑-t@-000 000S/@-㒑tAo//0@-p@P M 4 PS Ѝ0 0 ;0 ptv ]$@-p@M L ;P pЍ(0( (;0 S@tw ]H0@-pP@ M T T T i 0 Ѝ04 @  Ѝ0 0 :0 *t \\p@-@ @ $ 0 80  t^ \d(p@-@PP (P$Pp0 70  \p@-@PP (Pp0 70  [p@-@PP $Pp0 70 َ8 [@-@P  Y.<+ < 00 ;0 ໎ [8`@-@P ( 0 70 ઎(| [D@-@P $ 0 70 $4 Z$R/-ptx` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@  P//-ptx` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@Pፉ80 0 @  0""048# /UUUU3333  Lp@-PQ@ : Sv P Sd0 V Sb0?0 r-w - 0!= S [ 7SJ @Sx00 r-w-0  R< R7 Rx 0 r-w-8!@ T. T( T0 T x :0pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- A0a0-0$0$ $90 #u UxO-8AP@:  ỈpPA PA  pP% 00罈` 0@T' (P0=S AP` AT BX ! č뿉ᙈD0D D>0 Ռ 00, SdC-@``"`2`M 0P$DT@Pg p`XP `@\@h@d@l@X幎pk p 㲎p` o{{o{$P  {p[ p0 0S08@R0<@@@@40040,4--0-<L1L0 00D000LJ,X  #ꐎ0S pp@ i e  ЍoЍ @l0 0 K E A (((@dO-PMp 0GW"S00`0w@P-TPh +T@`0A ? 00㈇ 0ぇ P p   @00Ds \a0DSW0DA0DS"70DURY :P Q   S  R  "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`ō00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 lNW ppm N<00 0M0Ѝ1.O-PMp 0GW"S00`0w@.P-TPh +T@`0A ? 00㷆 0㰆 P p   @00Ds \a0DSW0DA0DS"70DURY :P Q   S  R " "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 NW ppm K00 0M0Ѝ1|.O-MD@؃ [0`P@HpV:V^ U0DPW p T"S 000@0`Ѝ0凌00儌0 0L0|@z0S u00p000S0S Q .:[ 0:0SV00ЍW00 Q0!:[00:S0S @ d0d dK0 VH0H HM0 "00@ "00 I H-M{,0,0 0{ {000{0mЍ4hO-S$MpPP@HL T P0S X0S 30 000@ 000@0 `P0"SA Q, 0b CR!o)pp y4$;R`P  `0*S# xS! S: "0 @`P$Ѝ5%%;R`"00堋3("0 X0 00T0 0P000sP00S6#0Q``PU 0NZ0V0P 0$Ѝt!0 ?/%1R`:*%6R`0$S``  P01!%?R`0 0 T50 0 P0S-0 0 $ 0PT  `P`m` 0PT  `PUbt,8 E@L D( D~L<@- M|d"{@{ @0S D <0 0 |0 30Ѝ yAh4߬\i-M{(,{ Ѝ 0 0 9/ANm00/tG-@SP, pE`J4Q# 4Q JSPЍ0 00 Kj /0j0 p@-@PP U ڽy00QUPQyp y00QUPy00Q0 /0 i .|j@1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P RtP 0开D00p 00$`,@(P0R00A-P`p@PB 0U0" V W- p`Pp`PCP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`Pꮄ00|dXp@-@PPM& U 0`1S ,0S ⌃$0S ⅃ pЍp@0@ @<0 G(0( (;0 >g8 +0g fH + f@-@P 0S$ x0 P @0P 0 0001 1 00x404 4<0 5 0 e *PfTp@-@PP% U 0`1S ,0S $0S Hpp@0@ @90 ځ(0( (80 сe )ed )hep@-@P Fx00CS00 PDxpm?P0 70 ઁc (e--M  GЍ Ѝ/ -- M0 0OG ЍЍ/0@-0P$M Rj P0@S&  S$=}0  B!  0 $Ѝ00+} L000 C0 PS@$  eDdcdP 4000S$/00//dlcdPcC-PRSQU D0Yi Ys "0  G7pp  T0P  . P$$   " 2   0~TC!1  0~V:!1  0~[1!1 _ 0~'0$0S㌡ / x!P  0  6P1P! @0 6(1(! @0 6 A ? 8'* 0P H_|____ ,_ _ ^ ^,]y ^]z T]]|{ (]]PTT]]]] T] 0] ] \@-HH1 0M`P000@P< p T T+ R/00@ 0 0 0 300Ѝ0U000 @ @P00P0ݡ0.0@w)@0U0P0 000 0( })D [XZ$ @-@P @  0  ~0< } ZYO-((ǟ GM MtčĝĝP ! $ $0S 0Se 0Sn 0SU PI CP@80X D,0( p `h6P000pp P@P!  Pd00S! 0=S0`S"`V`X`V `ሀgP0#S )PU (000C00pr~@p P@5塄Pp@( Pp P4厄P 4  $j $j 0S000C00  0PP400pd$h`0 s x  ?x0X0H@45PP0H LPڶ5 ,0pC [0PTU 0Pq0Sh Sf Px   Px  Px   P4 R1("2 0 t4 30Gލ Ѝ0@~]0  (@t  040040 S  P 0pW 0 ( 0   4`弃PI PE Ps!1 H 0M|x!x1x 0H C|0ST!T1T H 07|8!818 0H -|$0St!1 H 0!|jI~0S $00p"'|LYpYXXXXpz VlU T0S XSS (SSP TpS( SPRTTx7T|TC- Ÿ TM@PLЇP`pA VJ WS X\ !u0,P  * x00000 $( 00 +PLQ PQ,P[P*iP0 @a !0 0 L0 306TЍ 0 P 0{V 0 P 0v{W 0 P 0k{X 0 P 0`{@ Xt@ 'pk, PPPx $PPL PP P|OH-M^ЍO-llŸ \M@PTpP`က儠刐W U` Vi Xr "4  w0 000 $(,00 0 凍Pc0Q ,  hTP 0S 0 @峌H!01 0 T0 30C\Ѝu0 )@ 0 i\ 0zU 0 j\ 0zV 0 k\ 0zX 0 l\ 0z@a d@O&(mhPPP8 dMM 8MM` MM4 MME-MCЍO-M嘔 rX  [  0S 0 0Go-0aP lPe 1 S S   #@ # S]  0s000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Us0S 0S 0 '0_o0p`R0+S4 -SF 0wPPUpw[ WPW6 Pp S 0QUp @U40Sa QT 0 0_o00p+SR0S @S#0 PP _opR0S @S&0 PP` _opR _op`RU6 ! 1 0 2 30:ߍvPPpPp py S!@A< 8 _ 0 d 0_yx x0x td 0Uy[\ \0\ 1d 0Jy$($ JG J8G tJGO- ß MM`PȍP@yr T{ W 2U0&N 0AM.0; 6PY 0SV P +fl+`f 0  0  0$ PP @PP3H0: ST 10P! 6 K6  !1 0 8 30_ލЍ` P 0 @GPP * *6T100SP<104!414 t 0xT!1 t 0xWz 0 t 0xp5 ȁdP \0S  S 0000H0000  @P&$$aIQH` QPHBHG EE GD GHDGtG|G,A-@P`p0M- V6 W? 0 (y0 0 0⼊P @T@T 0 pPP 0Ѝ @P0Ѝ| |0|  0xV\ \0\ X 0xW@ @0@ < 0xHd F B E<B] XEB^- $MT00  4 (0 0 0 30$Ѝ# -|| $MP00  >4 (0 0 0 30$Ѝb#0O- PP`w p B~x0@00 00Bq PpaBQWpBABQ7pB R0 S1 0A0CS: 0 $S'""  0DSRQ0 / S ,*@D T0T@0 T:0 00 0 FwD[00T0S  [?0*00 0} .w00D\0\ \ C0"w }@0@ @`0 wCl BB BBT XB`Bd (B8 G-t1@0P?  @RP>T !6*>@ Y> l>P=O-0"02 0TMP0L00`w Vk 0  00 0 0 !8 @PPP @p10000 p@P< 0+S+0S((YP,00$00 0(P 0$T,$ ,0S2 0 0 L0 30*TЍ0 9P TP2w00h h0h Y0@ KuL L0L X0@ Au} =D== Wp; ;;pO-!1 0pIM010pWW PPN @`p 0 `\@P; 0+S+0S(P  0 P  0S}W2 0 0 1 30Iߍ P rP<2v00< <0< 0P tu B;l;l UL9t0/U0@- 0 0MPP000@' T [0P ""  0S0 0p d0 0 0 30Ѝ0!@P000 040 wt*  9 9@-!1 0FM M@P0d40p/ `᭐ PPd@"+ P uv0@pv @Rh \0 0 d4 30Fލ Ѝ4 404 N0 (tH 77@-0 0dM@P0\00p` P^ xTX P0 0 \0 30 dЍ0 000 h0( sl 74688@-<@<M@ ia0 7ЍR6P1Spp//0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 sC| L5h 5G- M砐 p@ e$UP'0G T09pPUo0 ;u0+ @P   U0 U zu0PuuTP ou0@ju@  nx p0 0 4 30܍ 0kPp x`|P`<0 - M Ѝ@-0 0dM@P0\00p` P .X P0 0 \0 30 dЍ0 000 0 r< $33O-/? 0M@Q000 < 0SD T@@P 0\@ ?T P @`DPPX@*p@@$@``@n*g\ !4peq(p` eq'pd(PfQ }adP8`da!<`hda& g! `dl@( " .%pPm` ,* )g  g* gtp捈@$@x@f ,譊h%fQ(! PffQ%|` . Pj(]@$ a,(@jA!@jA$͌@e! j  "+&0p'`) "M)l. '/.e,$ e.d, e ! ]P P!*L  ( !$(*((**() ()H'p0p ))''p, pL `&" po&` o&p p`(da `+da&++`pn mg pdq0 *@* O*@,nA!@͌pnA$f!@ M$lnq fq,p?菠fq'f1/(`/"Ho"_! _%,p% (( P !d!,( 0P "! ;!`$dQ  P%P- n (]d,b!On"@!O O$$@ $@  ͌O(e"nA 韠@ )..))),le,O@( /aA,e!@$`_@a! P " _%_% ,_%,,0_%MPh _aQ)_%(!!-_%$dA_%%Ph$_P+❉bQ$齋i P%0韃h P菃b  )]O坉$(((O$O$O$@kA b@$ @/(/"(/" , eQ( (/k% (/k!Mi%_䍈 o%dA_%_%i!$ "_% $o&& o PhQ$iaP%Po&o&0*o&-*`&$ha 矃`&]bA `(m@$heQ b%O)@@,捈?b1/"''p . p/".p /"$M/"(  h / f%  &h1f1 ?0dQhQd10_fQ``1d1`QP0Hp?h1P0m?#,,p?# ]?#?#0,0n1`1nqp?d1Ϡp,(0@!?!$,,,0fnLf}`efe獈n@gegf(@!!!0@, ,!hghA@e@H`,P!,_,!!!`h`M PgnQ`Qn_͌hQ dQnQdq p_`QLp P++,P   $lQ dQl_nQ_._%_%P0P}.`.aQ.lQaa `_dQgAaA`gQPOmlA(P`AgA` OaAO!O$O$!]!!f`$f͌菂g''( (''eqfq(e `qlqeqlፈ,fqaalaaqpoea`0p_/l!%)_% ''(0_%_%|Ÿ)'0'韌 +4$0 + h1a10h 0m`0韌h! a " =f 韌h! -c1f#韌( 蟠 )((,돌)돌$))ppfqb1#o0#0&a''ppꯌo&bqb!! "= `!-!c1``#O @ b1# 韌0#abb!!(p뿌0 "= `!-!o&c1`q `#  b1# 0#abAb!!_0 "=P `!,p!-c1ό``# Zyn롏bv! !" ݴ!b1# 0#0 ao&bpb!! "0= `!-!oc1`a`# 8P͌ < @@nDPbb!# "`0 0m0 `0 0 30Ѝ1!0 n 0S(1(!(0 n7@-@P 0LL LHH  004 404 0 jngE#ͫ2Tv X!!\A-PPp`8 W, 100.!0% "0 ?0%0?S@@h rob0hS@H"#p ` *X0V@@p`F AYoH H0H 0 $n, ,0, 0 n @ @  h p@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( mTH H0H D0( mdt Hs ڠ tt0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 emr rD pG- MM砐 p@(e,UP'0H T0:APUo0 ;u0+ @P   U0 U No0PIoTP Co0@>o@  m x0 0 5 30܍Ѝ 0wePqPp p`|Pqp0 - M Ѝ@-0 0lM@P0d00p` P" +X P0 0 d0 30 lЍ0 000 0 lmoo L0 {,!0 { / gE#ͫ2TvO-tM, l 03?0\ 0 Pp (0 " 40*i (0 8` h;" 0#0<8i;b iˌ! @D`ah`#h,bhD͠lbˌ Pb+`c! . `P% PH`b,`+` ak,`&iKL` c c;lk"`&0P`;a;abk `&T`lhlˆ`k#`& X`ɠbˌb+ck! `& \`b)`+` ak,`&``c c;lk"`&0d`c=a;ah`e\bhl@` `@$e{@bk `&h`llˆL`Kbhl` `.i pp'`#. 0dkŒȌ̌iˌ pzhlpbb+j{c!, `/&hl̠L`ˌak. `ak&` p@c nk,`nk&c0c=da;lk `lk&aa4n`k#``k&nXlck!`ck&lT`bhl`kk`Hʠi`ˌeka. a)` 8p'⢘⋜搉e pxd[f{l c P(n[,Pn[%c 0\PRX\Pd[@踠jp '<SNzmv3he;#0T0 0g;)0隠l c{0P $h{cp0fa"a(f `hHekb.b(e P]@a[n&an( h4bf%bf! Lp `$ 8q8pP` ``$0` (``0PPP#P```$0`(``0P PP 0d``lЍlЍ'G(0( (H0 cDB@ ,T@- M`#]tqt1pP@P`@@T 0Q P Ѝ$ ]P @ Ѝ@ \P"0S- -S?@0 0000 P Q U RP +R@@D!0DSX \P0S +S!@?@!@@K4FX ?P L0P00 1 R/@P/!R/JP(0 @>R0 00//I@-M Pp @be`P`W0D>S 0!3100 0JeЍ>SD 0!3100Se00Oe00I/-p@-M$eP@U@0 ` ` yPx0x 08 R;0Ѝp@Ѝ/0 a0Q( ( [Hd@ҨA-@PP`pU =UB 8X ERR14/.-,+*)('&%$#" Vp&2!0` 0`00+XPp -X% =X00+0E0VpPpp-0V0\0+00+0`0p@00,0, ,]0 b00  pp@-PP@`  0RuSpWSRX0CSG5 +p à 0R ^ PSPQP^  0    T0 0+S -Sp0$ $0$ b0 b@I O-0xSpLM 08@ (`(0,00040= 50 0d @ d@T8 P0p000003  0a0GS] SJ$00+W@ 0-SR=W000 0` @X B R j b\S  "=W  R"   P:0$Pc @  c R $ "@P0 偡   n Y# @ T:$Pycp@  qc0S$0 @"@DP@ @T X 00X  0  0pW ,Wsp`TS `! Z0$PJc ` $ Bc R$ `"`FP`0 `偡   ` =W +0G?oY20S# Z$P c` $ c0S$0 `""`FP` `傡V X 00 00X00` `Z$Pb` o b0Sk$0 `""`FP` `傡 0T0 00  HR;I?I00 HR0 .]@0P R.@ hO-P4MP@\p{ WoX0S2 `00 S 5 000 0?!S5 0 0 0;!WgW0c Ya X00U|5Sx50 0 0 0 0@0` P(0`0t 5`0$0XX 0S90`lW ,A0` QXW00V0SP@ ,(05#K 0P` X $ 2@0 @$*&  # $#. B@T$0#"A $1?Ϡ "!,:#  0`V4Ѝ3 00 0;!k3 0 0?!dp30$0H\.d0La#0L0|2pST0,@` P !WQ 0`V ^ @P,x ^[h"$:600%$0L"%>!!!0C4"0T,P%"1 #1O"QX00 0" 0$0 0?S%D P P@d`1T101! T$?01>! R01"_0`A(0|10X00`d(00@t`dP(0 wW  R21@$Q5j 0A`X0 0A$0PE `0P 0  `2`2 0 9@ 0[ 0 8@ 0[y` zGGDQ\(\)ۘ d D٨SQp 8$ ،O-PP@`Mq Ty V 0 @@T:R P* $Ÿ P0 P R# 0Qz SQЍR P P PP\@Q @ P @0 @0 X^ @ 4^ p0^p 1^ @0T^Pp# W @ 00 0 ZT0 0 ZV}0 0 Zt(@^*?[!]-Ҭ լլ ՄՐ \p@-@PP U p@KX X0X 0 ZU8 808 40 Zp@K Ԙ ԬtEp@-`P@P T U pPpPUpH H0H D0 Z0 000 G0 uZ Dq ƄӬ@-1 0M M`P040p@' T P+P( 0@ $03/ 0 0 4 30ۍ Ѝ` `0` \0 8ZH H0H D0 .Z%% ҸE ҐCG-P@K TT P` ``a V00"5SP0 pPO 0SR 0p R 0C à 0PP0 TP8 0 Q 0  ! 0`V#*_oRepP U !Zx x0x t0 YT\ \0\ X0 Y[00BP ,ĸ O-Ɵ MMMčƟP pTDe0< XE 0SN UW V) 㰰[U00U@@ R R00C?o2$00⃰0S U0 S0E0@0Sy00 000SgV ̠+ F 0 @s 03/0Sr 0@ 850000,00G(003/P   0S00 *  0.S  Z0S0 W: 0S $0S  ,P80: S P (0JQ/03 10J10 00@"P00$ 00S  0{P80: S5 0# $2 MލЍK0S0S + .P @Z0 4/P 0 000z0   `0NVD 00SS ̠+ PR  v 0.Ss0S^ 0. SmZ0Ss  @p 03/0  00.SG V P 0 @JP6 @n  2/0!1 4 0]X!1 , 0SX!1 , 0IXX!1 0, >X0Sl!l1l h, 02XUP!P1P L, 0'XV PMZ00PS P$P-H 0@ 03/;Z0S* 0H3Z0/(0 0@  03/0tHH0o$ ""*  ˤL/ d|$ <d P ,ʠ tO-PPß KMMPčP`pؔܤ9 UB WK YT \[ /\@ @ 0\/\0   T:"2 0 4 30KލЍR_/\8T*P/00p/\V4"424 @ 0WU"2 @ 0wWW!1 @ 0lWY!1 @ 0aW@Pp PP 0   R  F 0T/S 0: S* S 0 0 0 0 pX P+P 0@ (03/0S0: STm*/800 0 H 0W/Y/8 0V H ,Ǵm Ljn Ǵ\o 8DSO-XşX5M$M 0PQ000` 2 @~\< 0  pH 0S/S;R/ 0B0 4ZS 0H*0; ׽P4S 0 0CPR IR*0S0;R X @H p0\  0  *\2 |@\ ?\" [\!PI 0^N \@000XS 0H 0< S ?@ 0< 0@Ⲑ 0R  R QR Რ@  P+j@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 p-P]^ ~0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 FY0 [0!P0@ E0 0 p3P0P0H*0 ;P 0Sꀀ@p@p0P hU0\X U@S@QE?**H[-]X ! {TA-`QPM+ 0  0 S -0{S @ p0Q @{Q0 #P Ѝ0}S0S ЍAc8 808 0d DUlW 0 z(DO-@PM`pM R T  D TV^ @P}\ @\ [\ {\PU PE0]\\ \8(PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(G 0}^S0CV  F B   U  @ ]RR ]RR zpPpp0PpP  \0TWgL0 D0T`8 808 $p 0TT wHl w0HA-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 RKލЍ$ $0$ | 0)T@\ u|p@-`P Pp@0T1@D 0CP@DP t000p 0  0 T u40 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/p@-@PPV 0S] "S "$ R6  CQ   0S- @ 00 CR S 00p\S 000#  00p0"S0@000 00 VS\0pp r p@-((1$a0QM`M0500 S  0 0 5 30/QލЍp, P00 @ 0 +p x PE_0 }\PD04 P 0 x4 0 r8`D05C-0$eP`M |500S E@ p#S"nU0 !P$ 0S %P @ 0ST0SЍt `p  0@S0 0 40  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 OP 000#3R0 x# 000 OP 000#3R0 (# 000 nOP( 000#3R05 " 000 0#S 20@ R@@DP00Ѝ0 S Sd >OP 000#3R0 (" 0@00q (OP  !OP4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP ` 0@S0 @  NP =Q D 0P0 0 NP=Q 0 @00 ୤D 0P0 0ڰ48<X،8׼׌$ְt ltՀ k8Lp@-PP xNP c@PLPPP 00p( (0( I0 EQ,| j4@-,@@P00O-ȟ MȟP P`@ pUpVpWT 4 Gp00; [Z QU D(88 0 0 30Ѝ `s?0l0` Ⱘ'p 00X L UX 000 2c110 0 0p0S( A8  $0p PpR<000S[ R000@R@Z 0B R00p PZpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #Sy R BqQ #R I BqQ #S H BqQ #S G BqQ #S3 L BqQ #SN M BqQ #SD N BqQ #S: O BqQ #S3 D BqQ #S E BqQ #S F BqQ #S 0S:U 00S! R B  ἿP `0000  00 F  SS0,Z *p0S R00 0( RW 0 \[ R000J@Q@p, 0P @x  L# 00 0 #   2000s00"   2000s0000qp00,(@ ((@(@00,0l\  㯽Pk0Sk[y+JPe2"_0 ^OAQ00X ZQ_  Y P0`00y0`0 0SpCr X  pGnw0060 PQ0SpY003[ p0S0 P  Np`00C0A  ? p p p[Q GkDH$@ c<x4h0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF2pP P ЍpʈA-P`? A@0S( A@Q0+pPpPP &@̼P  p0 @BAQA3M@ p0 p0 ,0, ,<0 bN _Xp@-p`pP`P@T T0T0 R@@pdP00ᅽȴȘA-P@P`@pw0S |@@I R"@`iGO@8P00;P0@VD(@-  00 pC-`4MPH@P 0S|0V ! RUpЍ ℿ0P;  =R6 0Q*G B&R&>$#"M = -࿠໠෠Rp㴀Y WꘀqvK SБp0X{FH  0\dɌļ,xp@-P@\ *Pp0Sp0O-# BMM $ #S  #P 000 0000+ 0@Pm 40 4A;P# ` @FP 0#S 0000P Z20 $ b@`P 0#S 00P 0xS0xS0S 20 0sS(0wS%0S"10qap`0kP q00cP q!h1 0 4 30QBލЍt10000IP q00AP q 0`F +": 1 0 0`p -@P OHP`[[ IP000xS0xS0S: t00P^ dIPY.,Ĝ ZĔô08 Yu YLbLuDp@-d@@0S P Hp@P@P 4P pr0 "C 0 ip@PK -RHO-0p M @6p` P ጹኹ10230Y ߍ&PT 0 pI  P: [ ; 0` 0P ႸP) @@ 0  p@ 0 P0P S P I ">0 "C 0 p@J -RK4O-0p M @p` P 10230Y ߍ衶PT 0 pI  㕶P: [ ; 0` 0P P) @@ 0  yp@ 0 ^P0P S P XI ">0 "C 0 Yp@FJ -Rހ p@-T@0`P@ e0P0S SP p Fp@-T@0`P@ 0P0S SP p Ep@-T@0`P@ =0P0S SP p EL0 00 +L-H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/5ڄ-H- M 0 S 0  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/,ٔ -- M0 0+--M  --M  A-pPPp` Q @Q ePD@L0 0000Ak$0$ $0 G~ B$0P R   0//{O-X'X7 0LM@P0D00 8 P7f/0G0 0 A0S 0* R 0 :R|R PF@   x P P\CPuX00X0-4: P & X00X0 $` kp<E$0 @(0`p$0 00Xp5$ 0,  Np5$ 04 E @P)l 0 \5 0 L 2p$00% ,00  E @ 80"p840$4 0<p40  p40 p40 ph40\ pD4$0P8 p 4$0T p3$0 3p0`0*S$ 0P3 3 3!t002p,t6p"t!,̠:p<#tp` t0448",#< Bp0@a@P8 <0@(p ' R E8 @0s@qTP?  A@=@9@5@1@|p (   sp$   lp $ R  , ap ,(BpE UpE  P <E 0@1 00Q`BP#$#< \P00 1@2p0@$0t@5T0A1@00ӵt!0 0 D0 30LЍ p 41"0 $eBPX00X0!1 h0 E2 {<(a@pX ~pdd PM|P$lDt4p0؂VEWTt :{@ p@-@P> 0S0 @0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT E08@@0/S(@@ @@ RDRRCA-M@PF@Pq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,p`F0 Z0S@ 0S 0StF0"S D8#Ѝ T1r0:dF00Ѝqv{pX$ @-@P1 0S* ?@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0*E  T <@0@0@/STOOt@0{-DM  {000p 804S DЍp@-`P*p' P@ p V U phUX p` V@@}pP?o?o 0C-@c^?c%^& ^ `pCc&Pc2681E270G2&0H 0./ "0;:(0C0 /0 @- /0, 0-;BP @@ 7[D0 0/E0E0C004 0-;BP{$@G{6[D0{7P/ E0E0C0!/0Q Poo G-@a^?a'^( ^ @pAa&`a43V4X4G0Y@000?!1?1>4!50;:(A100 /0 @- / k{0   ;B 0/AC0C0 [k{${@{7P/ AC0C0 JR@ @-Oq@ JG@ @-Dq J@ @-q J@ @-qPP `@-D00p@-@PP  p@$ 0 10 Bg 08x؟?0/R//R/?0S/R/P/R/p@-PMP`V ⳱@T 00}CЍp{ : { *p@`($ w  /00 R ,@-D00 0S@o/0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"QI$\)P A-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `}=@ :PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @E0(@$0(O-\ϟC 0C,0  !/"b!!A0,0 W0 0000 0YWP 0  R0( SP 0 00HWz 0AP(0PW%S(Pk6 ,0 6,0,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04#/A!b!b0C P0( 4 0 Br0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, p,0 0CWP0(000c c0 ,_P([(P000yW0T 00. 0 GP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( $0 0 R0Y R0P ,P\ !/#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,04 00N(0~0 S!0 @pAY_"pG@D  W@ 04 0N~ Q @(0P 0(P00\)P\( ( (h 'Ql'I$jtj@jnhWx @ QD(PP @ ACLC|q \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp#/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍA-1@0QHPP P MK Q$`10 P1#L@p P@@ (. R! v P`U Ѝ0 P0  P La@` qU->T 0 Ѝd   0!>00  *`0___fffg__@-0M@ 0P 00Ѝ@-0M@0P s00Ѝ@-P@ghp@-LL1 00Mp0,00`@P= U2    P00Q Q Q = 0 0 0 ,0 30"0Ѝp [ tV dQ\0\ \;0 o;D0D D:0 f;0,t,t,tP ]E ]xp@-@PP U 0DPp P @pD0D D70 @;U(0( (80 6;] ]] \G-pP`' X/ Y 6V @P0PES  R  D#0PEV R  SS0@0D@ D0D DH0 :X(0( (I0 :\4  \<\@ \R@- 0BAs @Q 0CR ;@O-阡PP p MU WC j6@PI 7PI  6p`M y64101S Y7 Ѝ060P@r6P- 0 0P M60 0 ;=00 ;l0l lD0 {:6<00808 8C0 k:F7Z Z|P Z4RQ@-M @PЍTT z<@Ѝr< 00O--ഁ M Mpō@P`pH 1PS pK @\D LX0 ^00ptS0 O⏩00 T>R9 q@0,  (@P . P 0 0 5 30ݍ Ѝh0h hD0 9<00@<00 T<$? X<0   M Ѝxh--M  #Ѝ Ѝ/ -- M0 0 ЍЍ/O-鐒@P p`M X X00?0-00P @ P 00 P! !  F1XPH  .VP WU V[XPVppPpW` D 0`f`0`ᐧpPI PLLL1 0 0F9W`!00!1 00/ Ѝĩ0XP C0PP00 / Ѝ0 9`OpP V HpP `@0@ @?0 9c\ pV V,AT HT@-@ Mq/(0S2 ,0 `0( `1/pwqP0)  0 0 PUR <0PUW/ ЍPpTP 0S  0CPB/:00pP9/@-P M)/(0S: ,0 "p0( p1/`vq@0/  0 0 @ToR <0@To/1`V ЍP`T@ 0S  0C@o:T00.:00.p@-PPE 4A0S5 @Tp1 Rp00P0 ٨ P 0S P0Ϩ 0c0(ʨ 0P0 Ũ0 S,P 4P 8P p@豨T0T T0M 80Sp000 0K0 8eEQ QQX Q`p@-@$PPGWp@@?}@- @@9W@3?}xp@-,PP, X@%p?P}D@-a@P`Mc P10`00S p  0 XRp p 0@@SE @ W8 CR67,0L0 S0\^,*N^(^& N0 s0QW   "\ ^ #R.S @A a  00C ƒ@0@Ѝ "^ #R$0$ $F0 f7O O4  R  *4 8/z 0X\S 040:8 R РS /iBx@-@`P89LpL0ppD尀 T   ҊED@-P`@<90 ]A-hx`Pp@P1 T&  p0 SSS7 S300x S(-#g\*7'0 67'0 6|70000F00P00 00#R00 00;R c\&V Psd\ 1P01 0S1000S0d\ Q 60100 R =R R 0 0460000  m 7 Br 000" q00BQ00100C0g R R 00\ 50000  N70Bs0 0 Kd00  00Bs0@% 0W0Cs0 209 0?X000 000000*-X00 ^XT0000 I 00Bs0$ 0W0Cs0 0 00BSD0100C0%50#\X00S00%0H?o2300&0H?o24 00=Hoᨂ%  00 3010";R |30000 00C 1 0HnSrXGFEDCBA@:gSJIC:-$ 00 B 0J00G 0 0H00? 0 0@ 0 0; 0 06 0 01 0 0, 0 0' 0 0" 0 0\ 0 0 0 0 c\^d\w=0 Br 00Bs00<00I00xM LL L   x$ O-PR Mp@E W9 [`G 0`@0  0D\  S@C< 0  @[) 0V1 00 0 !0/4600 Ѝ 0 /04 0 }/04 ;vP T0F0600T0@D0 9D, D,C CC0  0|0z  IA-R@P0`Sp ""#b! DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@!00@1003/P(!p0 $@ v0V0 p00 R (6P000P3/P" Up  R  SVp  0ST2P000U oD3>/n0n00<Hdn//=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@!00@10 03/P(!p0 $@ 0V0 p00 R (㢡P00 0P3/P" Up   R  SVp 0S㞢P00 0U ll.lld.8-Fk-t-DG-@P P.`P (rp^u  0F0\c<!"#b!0CaqV; Y D0PpY` $00100S p | `1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(P`0003/P 0 p 0000SXP00}00j3>/i+i+XiPi8+ *h=G-@P PN.`P $rp ^t  0F0\c<!#b!b0CaqV; Y /PpY` $00100S p `1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(\P`0003/P 0 p 000$0ScP0 $0~00hgp)(g (ff((PfDSR: G-P0`00Sp 3/0Y @IOP k T 00 00 Y @IOP X T P00 D0D 0 p`P/'eePe@ed&SR; G-P0`00Sp 3/00 Y @IP # T 00 00  Y @IP  T P00 D0D 0 p` P$/&pdhd0d cc%O-PPM M Q@ \ /\C ᱼPy-P8p/\ @ @. D\k `P /RR.\' B Rk/0  F0Z2 P 0E PpE 0: S 9S0/\0Sw@/\` FQ .PQX 0t/S0W0MʨP !QP uM , \@  2+/\p@` @kލ Ѝ.<0X0/ލ Ѝ @2 X 0/ ?   P@Z200 @2>00 @2?00 @200 @200200p@-@P Q Pp`\P90@P P`V 20"S p200p@p@-La P`M=  *,00QP0嚞P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P 800  I2 0 @~_^^p@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 /(0( (0 /7 7) 700/(p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 /U8 808 0 /p (6 %6lO-ȟ M MDčpĝP 0o 0Sx 0S t4!S S,XPP `P  㓝pP 00S `D R!' Ჿ0 00 Pi 0圹0P0s` @ `PV 0 S( [T :SZ \S S S 0U:HƞPPE VpP+ dP @0` S[1ZP#QQ ,Ph600`SP0@VE0AX0 0p$&6 0 D4 30dݍ Ѝ:SZ PPEV  00 0S mK00@ pP< 唠l5@00PS0 00@5p0040$0(`,= Pv :SL 0@S t40@0 0$<PK0C 04 8 0S:S XE H R0 0  Q!000M P@04@@0,* m0:S !+ 00UOPK0 E0 (10 S:S008$ 0S:S00< cD9aX@P p Ψ|0 00 _T-H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 @ 00 0 0 30KH Ѝ/2__^x4@-K0 @ @0)?O-`@$MP}l20pW^  0p0 u0?10KP Zp P p J } 0J0PH0 S#: P)% U10 r 1$4S1$ !t@00H uH0S "<100S (!0 0 0 306 $Ѝ U r `pP Р P 5SX0( ,VT00#    $PH OH0S p]|`?>|>8\<OH ʜˠ@-(@M@@0=PЍ<  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A@{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T D)P0 0# 00Ѝ 7)0Ѝ0-$M  00 0_P$Ѝ0-$M  00 0OP$Ѝ0 -M 00 0 >Ѝ c j0b/C-LL sMPP`0 V8 @X0^00pAtA0OM0PP P1{0p0>TA{" 0 $@9 0 0 1 30sߍd0d dG0 &VH0H HH0 &R XDW<T  Š0   M ЍVO-ϟ MpPÍP0^ Yf 00!R !Z P   Q!P0%%Z * 0S0 R 8/0? 0 3 30[ ߍ4P0 /!P 0C PS !000C 0 `0zS|NQ~|{pyxwvus1jhc_^\ `ZEU000 `0CP0PE 0SF0 0C0000 000S0  IY r<oP0 j P 0P0CS0000 @ 0D SU*r? (0R0 (0 , 0C$00 40A@Qnt#zx 0 S0 00 1YK @@0 " P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000, 0@C0 H9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0TS XRm    0 (0     7 5  0 00 0@0( 0CP000&     ( S@ @& YʱY  P6P&P0 $Y464&40 $Pp _P @0cP P  0 S0 0C0 S P @00CS0K 0 S0  @$ 00S P40SZu 40AQ0Q 0 Sk $ @00ESZ P 0@0CS0W 0Y0 O @0ES$ PSZ R0 0@0CS0  0 S000S @+ D  @AQ X2 @ P 0@0CS0Z000 0XW $+D @@P 0 R0 @NTA 0Ti@@P[ 0 R0 $ @XQ[@@P  R @0 00K? 0r?(00Y D  ?o 2R0SY 00 00C@0@00<000WS0,` `01D00(0H@V< * P 0  B0=>J(  r#0  ۓp P p ٓp ԓ=>3PSx $0S0000PS`FP Z,`X@ $0S0 00 0000V0VPU   h  @ |&t !d 0 ^P 0 0C P0 SPP 0^Z``,401#Z`Iy @0&0,(0( =>0#C0,`-Ql ]QP @0c Q: ,`0;00<0000000900000 000:0090 00|0:0000s09000l 0  H  0 PB P>  +"7 $3P1000;000;0A00=jIT  , BR@ 0Z0 @$P 0 R0l @X<0#  R @#  R2XX  P BR@ $P$M 0 SJ 0iT nT  , BR@ 0Z0K @ R񏐷D" AR>  @ BR  0X0@ NR-  @ BR  0X0] $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0Y$@Y,Y0$ 0(0@T 0<050 (@* n00 500S @0SI 00 0!Z] >P 0@0CS0| 0 S0  @]0SHP 0Z 0aP 0Z 0 p00 00= 0#P 0X 0@^@ =. #RRc @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SP @X A 00 000rP@ 0 S= 0@@Q#dP2 0 S/ 0@ XPG 0 SD 0 0 ( ?o_T20S 00CS@0 0 S000@00CS0400 0S0  @0 ᄑ PW 0 40H0 B=>  @JH!r0 2p= P p yP 0Y0C P 00S"0,p `0#  , BR@ t 0 R0l00 (@m00 P Z 0@003,  ]R$ ZzPp80$0 0P80,  4`, rO<`T xP$0 0P(0080<$VPR 0 SO 0M}P 0X 0$@3qP= 0X: 0@fPD 0 S@$P P; 9XP 0 S1$1I/MP 0 S 0$ @0?P. 0S+ 0 @0$P P +P 0Y 0@/X,` @ t,TP 0 ST @tZ( S C@ S  &P 0 S 0 @0002P $P @-  , BR@  0 R0"  ,$P&, WP 0 S 0$@ P 0 S | Q 0S@!0@3ZS 0䞯P P 00 0Z  ` `d0$0H00 PK A=>0 $ C 0r⛏p5 P&ZP@DD 0S#T `Z 0 @+ @D00OP0T0SJ0000rp0S:P Y ` 0@00X_<0< <08 700CZP@D` dA-@P`p0 0@@-@`P MDp@0p0 000@ Ѝ4A-,R@QP`r v 200S5 n0P1S010n C000Pv`! pW@0PA ႍPPZ 0 00  C `C000I0  Q  Q*RQ0 <00@8 B`0*P$00P0s0 ȋP B/0T0T T`0 { B0 `48< p@-@P ᬀ0@p@-0P$L`T M 0S pW  07/@P  Ѝ808 808 90p_@ Ѝ (0 00M 0Ѝ1A-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p 0$%@ Ѝ t@00 0M0Ѝ0A-0P$L`TpM 0S (X 0 8/@P Ѝ< <0< 0y, 0(@ Ѝ \00 0M0Ѝ/8A-0P$L`TpM 0S 4X 0 8/@P Ѝ< <0< 0D 04@ Ѝ 8x00 0M0Ѝ.TO-MD@`Zp@P] U? 0ST$ZE 0SB [? 0 ;/0S) $\U 0S H[ 0 ;/@PЍ 0 0 30HY@Ѝ0$\ 0 0[ 0h h0h 0Jh 0D D0D }\ 0 l x L 08@-$$@M vЍ,(@-0P$L`T M 0S 8pW  07/@P Ѝ< <0< 0 08p@ Ѝ ,l0 00M 0Ѝ+H03?0/@-@`pPtt0l尀 T  )@0 .O$  *(t"40åO-ğM `@0  0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b ɋP  00Ds0S0S0 S  \00t0!#300@ 00@00 @0`PUb*Ѝ@\ M00 勋P-  R^^? @ 0 `0  ላP 0J ZS0 0 0J ZS,t1 0000 Ѝ0S0 01 0000s00\0`0\00 00 00Cs0S  ``a00\0`0b00\0`0t00\0`0n00\0`0v00\0`0f00\0`0}r00\0`0w0\  @`q*PqA- Q@Pp`! 0P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0* P0 A \ A-P@`ḊPp .T Tp!0D1(0D,TS0 pAl_T %(0$"0@ !1 6I O-ǟ UMLǟ@P `|  ?o2V0S Z Y y P0P0 rp 0P0 [00 x190 H@ U1 p00PU`p! X U0 1 #ដP00? PP P@6@&@0 IPU`p0pGGq WP1 P! D-`pPI Ƞ  @0S V D0 G0CSax1  * 50 0  Rx1  ' X50 0  Rx1 00x1 00x1 00x1 "00x1@\00x100kx1 eД U $`xPUk 0p 9/P600`ᗉ啉哉呉\$84 0 L1 30Uߍ 0S IP/4$0 <P 13#z0 3#0 3#0 Z3#0 ꈓ ꀓ 0 DpO 4aV$00- 0S 0S 0 xY `0$0C0@4@0S 嫛P ,0 p( 505ᵀN@@!J0(@哚E@B 0%$0< 0%$0 r p@UhpPp@-@P T UUp 0 pH H0H "0p , ,0, (0p  lp lDHA-PP`F L'p@,0 $5 S9 S@T @NT V,0`<,0L0`S00/S , @ f00 pp@ S00P, ,0, (0| ~, k81p@-P@PP 0P0S 0`0~0Sp@ٙ(~(~(~($0$ $B0 P,tl jtA- 1 0 0PS`@(M @Ppp 00 @0 P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<0801"0 0(Ѝ0p j j@0 00M 0Ѝ0@-@P P PP 0 *0 0՜ i@p@-@PP U p@ P0P PB0 U404 4C0 p@  h h`p@-@PP U p@ P0P PB0 U404 4C0 p@ | hT h(O-PMp 0GW"S00`0w@c P-TPh +T@`0A ? 00  0  P p   @00Ds \a0DSW0DA0DS"70DURY :P Q   S  R W "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`)00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 NW ppm e400 0M0Ѝ1P.@-@0LM`Pp@0 P LЍ`0 LЍC-1 0MM`00<0pP{x@P V h1 0S {P(1 |  P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0n SsP0S  }}j@PfPdP(|(}[Ptnfsuniop@-`HPᅗp  @PpD0@南?@p`@-@P @(0( (F0  @ b @-M @̘p 0: S  Zp  IЍ 00ЍO--3$M0`@0 ;#;$SP00T00S00 e00 P@Pp U * d|@P 0G Pp@0  p P PE U@*0S_ PU{0 G Y*P 0   U1 T 0Ḱ @[UizPPu Y#: 10 001[ 00 @c0 P @ 0 S0S[ | @W; 0p@D@@0 `$0@$Ѝ0 |00 000S0e0UzP 0 !ᇖop`{ 2 P0P P0  ! @  ^p@-P w| @T @q|T0 0pp@-@PP U   p@ D0D D:0 U(0( (;0  ]@ ]/O-pP M@`0& X. @T Pf[ P@ P  P  8/P  00[W@D:P PU ЍD0D DD0  X,0, ,,0 u , \(0r4 \sO-PLM`@< Z TV, <000$0@ y0P 0 Za <0Sh V0P@000p000F

`1&P #Qt PFR'000  0 0!܀,UPP@P@ 06&```00A @tl00A0A100H H0H 0 6vv v D0uvTuhv u Ct@-(@@ @kt0@fttp@-@P PP P @p@p0 A0 z BHA-PPp` @P# P# tP  kP@3*"00@004 404 V0 00@ BzQ:// BQ://G-88!000s0S03 0p0Q= `AQ@PP 0 `Q ̀@P   0PR@  uTl@0@S u000  B BG!D`Dsxs<\p@-@P P8PpU0 =Sp=SppQ0p@-@P PPP@Ppp@t 0 0 ,q8 ?@p@-P\r@P 0 P0@pqpp@-@PP LPp P3#p$ $0$ 0 q@ >O-10  MZp @To p `P P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 Vt 81 0   `]0S:a  D!0 0 @ Ѝ0Z   RS@ `/0S a1S  Ѝ PP,$p@- @t,PpP 000ppA-l`PP` p\@P 0=S SP(00@0M@,@-s@P_0@m,@-r@PQ0@m,@-r@PC0@m\!00-!0!Q00 000000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1  p@ Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPO-P@U`pX 1S P@@E  7/P/@P@@ @@ģXC 1Q0000/ @0  0000Y @0S0@0 PT1S1 S Do  00000@ @@@@0@@ 00Q0 -"P 0 PC R00 SAP 0@/ p@-`P@T0^ \ > R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! O-p`$oP& 0Q@@PppW@Q0Jh `X  0PX@aap(OCp(0pG.wZ_TaB 2l000 D.@-n,@@0@P0S@iM-`@P@_}P(p0@aao0Oo00ZO.TTaXPB(0( $0 0 t0p@-05S P,pP0SZ sX@ 0CR\pp@T P UP@ pDbhb`b/p@-@P $PpP p$pP pp@p0 0 0 /8Mp@-PP@ T $0p@! 0/L L0L 0 T, ,0, 0 /x /Lp@-@PM$ P$`0.IP  P pp(R00S 3/Ѝp003/( (0( Z0( .L .h~~A-$P0@MSp p0(`0 0@0p$p^Pp0(0V,00S 3/@Ѝ 100,0(p03/?pP A-PP@M) T2 0S Ѝ $`0P o00 @ pP fЍ00pL L0L H0< BT0 000 ,0< 7 ,x|| ,L||O-d`yM(p`vn,PP } on@Po 2 Xn20 RF Qn0!$@ !  00✊0 4L  00 0. $(p,`L PP 80 03/``3nP"   !0 0 1 302yߍ         Pqo;oP 7o5oP||Pao+o``PXoG0tD *z )z )zxP00/`@- 0UM 0H`0L10㬪p! 0H1G@pP0P`p  S 0$< ,0 0 L1 30Uߍ0$_p@-`PP`@M& T. ~bPЍp fP aP  aP |0 0  PL0L LG0 T000 0H0 L(x 'xd@ 'xp@cH H0H X0 9, ,0, W0 / q|qD pqp@-PP@, T Pp bP 0S S`P p@`p0p@/H H0H x0( , ,0, w0( \p@ opp@-@PP U p@ bL L0L g0< U, ,0, h0< @o8o oo0@-PP@ M T# z`P Ѝ0bbP 0Sl00 cP P0P 0L T0 000 0L  TnLn (nnp@-PP@" T+ 0 0 0S p6`P !bP ,`P  '`P p@!`L L0L 0\ UT, ,0, 0\ J Hm@m mmG-PP@; TD  R R `V V  0L0 00 0 `V000 0`V 0| 0FS84/+' 0 0 0 I0l Tp堀 pl 0 R R 0h ` 00 00 0000 0L llHl l$% @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0@ @;0 a(0( (:0 Xj jlY jHC- MpPÍ`@PZ TO A< YPE Y`S 0S d!\1 0 3 30Nߍ(#@? R R  R P8 R   l p0S %% 0p 0 0 0 p0p p0 P  B 0ꇥih ,hh hhO-LLğIM,M IM$J͍$@@Pp P0`S S  #3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " " < J=00h#<0I8 0aJ=00|4 0 hP 3J- 0SJ=  0"I 0  ʼn J- 0Sv 0S? S" UV J=00 O J=00bX> O<  XPf 0SQ |0S 0S  0S0!S S0S UVJ= 0 0"R #< XS) S LJ͍0 F:01 00000G0 ,0sTP @z., 00SLP$ P P J=00X0  XPJ͍bP eX JfeH 0O-\\ğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04{ 0S SY^\#T3 0 0 30Ѝ4#(3 0 0 300 HD@pЍOQWX00RTVWX " 0 ឈ X%:  0 t" pP5T30Sy0S D 0" |PTVT00P00Sj!0 eT@@O 00!0 VpiT 1i #kYyp`1``PP0 ppW 0@D    2T00? pYp} 0蠟谟 P0 pY 0@Dm    T00? D PTpyX  BbPaaaha0r`{r`\{T__G-` 0 FM5 P@pp, P PV  PV> 0@Sp000 0qo 00  0P 0 0 1 30Fߍ Y:wp0SX 0S P 0 90Ģ8,A-@P`p 0  0P Np@-MP`P@@P@T 0S  R0S `P3@PЍpP+PЍpp@-@P CpPpPFp0 @0 8 \T0. AASq0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M 0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S R' 0S  0S0S0S/R /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP0 PG@0S0S 0S  Ѝ0$0$ $n0 bo \W@@-PP@p`M( T Q Q Ѝ0SS ЍS PPW0S# S!  0p 0  0#00S SH0 P 00d lVlVDU8p@-PP`@ V T! 0pPpx x0x t0 V\ \0\ X0 T@ @0@ <0 xUUP LUPU$  /TO-Ÿ2MC `<0 0\P0  03/P 0`&<00&,SS00 80R0SQ c RD(ՑU? [=:E$040@,$0 C 0\@P0  03/P @[] 0P0V]`S]Vx80Sg U &<00Sj&<00SD妀!P` E/o0"SQ[Eo᪢R,0S 0DZ@0P@C<0D\; Z^7 @0C 00P3 0P00,00,0%SF @%4 0, 0 30ݍ4Ѝ\00&<00Sc &<00Se  E'UR!`y [I_40@Z,PC [n H0@0P0 p O-@Z`PM $#  R[ JpP 00P0T0X0\0`0d0h00000 00000PS< S5 S CY00YP( P& PЍ0 %0 #04`T` 0 0p Pp000 0000 d1]Ѝ0 4`#0 4`# #ppP 8 pP  }\!\ T0n0 0 00R"  0 P  0 ` P4{004000 { 0P^Y0 Rq대Xnd1lXF_00S !j (<P001\//i;hp@-@P P@P ^^Tp 0  0- T:X:0rO-`P,",2M 0D000 0 p@P0S A@\ \T P-  KP @!x1 0 0 30UЍ0 SRB P> 0 o@P30* 00S  Pg X0 SR eP 0 I@P 0 00S @P _@@ @P <ths9O--ϟ MSp 0E 08 x0嘀K  G C0 0` W( 0S0S  ` 0 . "2 Aߍ0S0S;0S^>3> `p.p>p l.0# `P 0 0Q P 0. ^ 0S 0A?o@2T0P00S0S  p Y P`@ 0S   0?ST CC" 0c6#PY$@ 20 RS S0 00c`P  `<00@(0PP`$pY i792 I120Y0 0 S   S  R  R Q ^  ^ \QRSQ PRV  0PsQp X+0 0Si QRe 0S %0P,0 6P , 0 B  ` 0"P0Y ,00 X,8`. RX R R ^ x0S  YYB@pTP0S~ 0``,p@b S R \  PW \D @T( T d642 D52 0S0 S P  ^&S㜐Q^.\+@`T,p7 W 000`P 0 `pVPUT Z0P$0N ȇXP 0 ``P`T{]PXP=$[0S5 0S [ 0`@/oQ" SCR㜐  `vPQu 0PM RJ 00SC RQ? 00  P 0P1 P㜐  00SS㜐RpmRo \;R P @ 0XP 00[0 0[*0e/0 5%0 @Y XU`0@S 56p$P(`X0000XP X@T0 4p0$P(`pP` 000 VP@T 0S S00S0000 0  `}P `@/ T; W8 $ 4  0. 00?oR20S u 4@,8`ù tP1x00x0 Y긔`PPP@ `0V 00`YT0`}YO-PLM` Zi  @㰱q p  KPP0 0 0PF ``0S S S T@P `0S `(0 ( (`,P00 U `V Y 00  Y``VU$@LЍTT T0T P0/}Z8 808 40/r $# h Ҩ## iG-XM`@=xP pP @800  0 GxP 40S0- XЍ PP X 0 *xP X8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍjxǷV$ p|G*0FFi؋D\׾k"qyCI!%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ@-@P 0D DD@  00,0, ,0 ͫgE#2Tvh A-PPp`6 W* 0!ᣁ000?0"@@h>V0: ?0hS@H"#p ` *50S@@:p`F AH H0H 0 W, ,0, 0 M  t4p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 갎I` H `0| 4PG-@"@2 0M000(2("00P003  `p0\ @ 0 XS@@|Q0 C" T. .0N|Q0.\'^V*004!$1 0 0 30@ЍT  Aa r  B8 LR\ P 0FS0 S S XQP0@^*0^0 8< 4^*0 8<H GF- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D걍EE  A- rM`PpP: UB @X0^00pAtAQ0OTQ01 000TAΌ L PP5  0 ypP& 0@oQP 0 0 1 30 rߍ0 <0 Uh0h h=0 P 'R00 0P0DD$BC4H 8 4  0   M ЍBX -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/Ap@- M@ Pt00h` 0`0 `P@@X@0@T  Ѝp=A|@-TT1 0M` !000lp @P   lp k@ 0 0 0 30*ЍykPpW @@T PU 0S*P@GT00@>00ꏌAi@ 0p@-P@0 0p0[Q(0PXQ(P,PTQ 0\0PP 0P 00,,HrP 00p 0@-@ 0 0 0 0 0 0 00@- 0 MP @0Q 00P 0 B?o20c Ѝ0H4 00 0p@-@P 0U0 0pp@-@PP0PPP(0PP(P,PpG-P0Pi `^Pb 0@00 S S0 S S dMpPQ 00pZ p8 (<@P 0q0p0S S S@ 0A S  A$@P0  0S 0000OP  FOP0@ @0O-@ 0`p M,0(Sw: (T[0 T0W 00SS 0 RM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AX000  %0S000   0S& 0p@O0ppO(0pO(p,p@ ЍOP  (,@y(0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0Cp 0$  $ 0 2 Ѝ0O-PLMS `E$P@ @0 `` QPR$1MpPN 0 ``PPC$PPU 0`@Q QD QR Q1 0U00Sz MPb  `000 @p R  R/ RY R 0 @Up 2O 0J[0H 0 LЍ   @QA@ 0U`   (⼐\p 0  ,  p0p 4`0W G`@ @U 0N00N `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QAR`  R  P@T( Q  A X # X/ X5 p X@ P  @U)<X X X 0` `p  `  Q@` ``  `p`<0< <]0 7N   `@-@P @*N( (0( 0$ @N dH/@i'QO-b PPY<K(0p7W `$ :6o@2/0p $` V( ,2(-P W0#03V,0( 0!( -0P QKU00⛁!Q03SQ: PQ Z5VV030#1!S 0 M@J000V; Sp3 p#P 71S41pG2s2pGs1pGSpG0f0pGwp4:0;p0Z Sp3 p#P 71S41pG2s2pGs1pGSpG 0jr0pGwp0809ppp p@-`M5gp& @hp) P0u0'{0 {@Z0@2gt h0 0)P Ѝpchg00g / @-\(,\ \  Q:^: A Ͽ|q<Ͽ10000C-P$0@SMT 0( _4p :`I;$880IG81GpB70 B-0P % P 000<890L>1 0 00LЍ 0 /?Ͽr s0|13? <Ͽ2/05 0 0@-S@ 3/@L@-p] Qdc @P 5_2/P ` 0@ PEPET% B B&"@@" PEPEX% B B""@@A PEPEe% B N B ^ w" ^ v N1 $1 0@`@DF$FA!B@  D B &"AA!@@  B B!"AA!@@ a Q@'P 5_2/P `<ϿL,PE PE T% B B&"LL",PE PE X% B B""LLA,PEPEe% B N B ^w" ^ ^ ^ , ($^$^2 ^. ^0 `1@^ ^ N1@N1 `1@}^{ ^ ^ ^ @r<`@^lhdLHD7y  @-@P @ L0 /0  @p@-1!00 P@0 00D@1011.T 0@\0 S@ P pp0  00C1000L  00t@(P ; C-P Mh 뀐pM%ᙞlaapGQQNHH0  @ N 0! Ѝ Q@-h4h$00 0`P@  @0C0APP@@ 0P@pP Pp P0pC0QPp@ 0@pwP  0pC0.S 000@000@ 0pp@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0BdQReBn`@BdABdBnPh00p00 R 0pGqqp00 H 0pGqp0000pG00  9&xO-`!0@@R@@Ɵ GM MtčƟT ࠤH8(00t6G0P40 0 0T6(`0D0h0,0$&$6 0 < P< 0`P@00 (cP?o0 2R0S 80`1  @0`V 0` 0V X DjX/`0S\ ,0Te?pH5`00` 0VH W,0?p 5 0= 0Y& W0 ^j@X,0? )R 04pdp`  ( ]P* 4  w,X4  p0 84< p04 p04  p0 `0S&IP F0P40[ 0 ##<3 0 t4 30Gލ Ѝo\3` 0m_0S 00ST80`1   K  i"2 0 t4 304Gލ ЍOHph,0!(?q0 r iW^t2t"0L0l2 0XP T@\PL i`GpFW.pD `R- V @ Li  i Y 0 P1H 0 00 .+Y`G 0 pFWT@X\Pl 0   VL 0  @ 0 zP   WiY 0 j0H 0 00 .y+Y|J  9i]k!!% d@#8thhpLO-tM@@ `VPPh0 P p 0. 0  0#$`14 %S, %ἴ0 徤   (6< 0 V 1P80 6< 0B>PU  0R40008 h`1S   ;`1S0 0  0PJ0  0P7P  PP$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0:hnpW 0pW  0Rx 0'h[pWf 0pWa  0R0 ,0hHpWGpWD 0 PS00 h`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0B001p 07001p 0,001p 0!xt1p 0[DHL gtЍ tЍ 0 10 0  0 0  00 xx0 qlH p\ h ߼ߐd8ߜߴߔtT4@-@`00AMM0 400p00 ?PP0S tD 80 0 4 30AލЍ./A(0,@-@ M pp P?`P:P 0S <0000 Ѝ00S.S 0S Ѝtp@-|0|AMPt 0 ` $ 0 @P "8 00 0 4 30Aލpxp@-P@Q`  @Q ucPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝڤp@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp0@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0 pڌH$p@-Q`M x00<@EP 0PU  0VЍp_40P 0`tЍp @@؈0@- MP"0@0@=@T  0U Ѝ0p0 0POU:L@@ Ѝ0<00@00 0P> Ѝ0t״0@-@ M T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPؤpׄט|Dל<lXאhִ֬ֈ0@- MPA@O@ uP Ѝ0 0( 0Ps Ѝ0d0@- MP&h0h@0@B>@T  0U Ѝ0O,0@ 0PR Ѝ0 Mp@-@ML 0 Q0P0<00P@ ` 0. 03T @D D000T H0 0 <0 30 @Ѝp@Ѝ/.0 Ty2~ |՜ O-PM@PP p|`x0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`z 0 T @ P  S#3@ P 0RQ  S # 3!# 0TM 0 T @  P  S#3@  P 0R \  S # 3 # 0T 0 0N 0L0 000J 00  0;TO-`Q0 dM R R{20\0QS0N0<0l2a!##\B2b1!AP2aL5BX2dD@AEW0E0@02h8's2Q>?2crlqqHL01NਂhL΅ReXT P0HP QN} } }[P0 T XF Z H Y J (0L0$0\04 0@0,0H0 0<0p 0D P40C[ BZ BY BdЍ00N\0`R`(`m  0 0dЍXZ HY  8gibMӈQΈXd|h\@-@P 0D .R\0@*S0T .S@@T QA.@S@@$ $0$ 0(  xh͈͜@-$MP`@P`]0pv> 00pp< pp_p  YaPc$Ѝ,C-@P@ `p MPOP @U _P@Wt Ѝ @Pt0 0000 0 P"@0S0Toᨂ# \ ̤C-@P@ `p MPx@P @U ^P@Wt Ѝ @Pt0 0000 0 Py"@0S0Toᨂ# Hl ˘p@-@P00CS0 S u P `0 Ppab`u0 0CS0pSr P 0 /Ib@-M@0  0000 !R !0@Ѝ@-0 S 0@Q0 R  004S c0@l@Q0R Q    R Q  hLp@-DPD0P`@0pp 00p@,X0$ tLp@-@ @ `@0Ppp0p@, LA-DD p@0P`p0 A LC-P0 `0pMpp@ H 0D @ <8 M@ЍL: hLC-tPp0 `0p MFp@ ( 0  @ Ѝ*: L0 00/ @L0 00/ L 0 00M0Ѝ LA-TT p@P`Mp 0 Ѝ L0 00M0Ѝ hLC-tPp0 `0p Mp@ ( 0  @ Ѝ9 4LC-|Px0 `0pMp@ 4 00  @Ѝ9 L0@-P@000 00M 0 0IЍ0 Lp@-D0D 0@0pP p@Qy9p L((  M  0 Ѝ tL( R) p@-P`@V :P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` i0T  0C0 ЍH0H0 p<0<07/0K 0 lO-Mp`@PP*W3*00V.:Y `8 @1@0 p pZ, `aP 0 P0 P 0`000000Ѝ0 P`Ѝ ` ph0 qP0V0`FV0S000 000 |ʔʀt<p j8O-M͍0(0=000=8p08<0͍00\@P 0 P, 0PzYY~ 0IS     E!%Bd[k 8e jDR_~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! +Ps R 0S .S 0S 0S00S.S=<0@70-< R' 7d 0@ 0 PE0D0 SiL7L.4,00$,0PJ00 CY 0000!( !, p@B <[@$p@D0 PYʠ0 zP  0 0pPd600#$ #(#<0 0 C0( ,600.0 r  .00Q$0 ALP00Z0D:0<H+B 0?R0S %T5 0 0 30  ݍ ЍX5Y =<00S4=<0@050S=<0@50MH0⯽00@0 0 0 P@0 50P,0$ 840H0寽00 @0 0 0P{%5P"5@5 0PD;<4@@2 0 0 P_00 0 B0mPU0H< 0R0JZ0S~#3 0T t=<00S4@0D;p3d 0P 0 P(0 0 B8P H00P8p4`@C 0P'P 0 vP0  P0=<00S&40p00Wd 00D{L20 0 PP=<00P@C 42 pPQ W[ 쁟W# @PF 0 2P0T0 0 E)P00d0W0@DWp 0 PP1d 0X 0  PGP 0 6@P 0pD{ 0PYW.  0  P}&=<00@C00 P ( TTp|DX `i,$ \<8x%@H  P( V4@*t R P P==== P<==UUUV`   @0@d 00 0 P0P0d 0D 0 rP30d  0 cPpXD{ @QP0d 00 0 MP0DK0S3Y  0 >PDPUD  rp0X1 0E@HS Y>g=<00S]3@Z30 P@D[2d 0 @O 0 P P:;3 @DK2Sd P05 0 Pz&3@DK0d # 0 Ph30D;3d 0 0 PV0 0 BfPN0D P@C 4> PpPz(4($0 @0ZDn: T 0  P,0 @C40+Yi =<00SD0@d 00P 0 }P 0 d  0 oP0@T0DK*4UpPTDK 0d 00 0 RP=+L0X 10"3% 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L 0 P0D0 SQx@pT P0倠t @ Up  R @ Z$ v0d : 0 P@T+A0X 10"3@' 00;A0==0;A020 0;Ax7;+A0X'1 000';A>A C7;=+L0X 10"3' 00;L0==0;L020 200;L0L00 0<(;L>L Cw 0 0  B:P"0DK0SPገ\0 p$P倠P 0 W#  R @0 Z$ 0d  0 bP@T0-< L9!?C0 Sd  0 KPP10@)DK1#0pW  0 2Pm=<00S =<0@90[ 0 0  BP0D{0PCUQPH@  @UG1 X2  0d E 0 P=<00S =<0@:0"00P84p@C 0PPo  0 Pg 0  wP_X  0 PW0DK00CS' @;00 0 B[PC  0 P;{DKp0PD[ 0d  0 P%0PD[ 0d  0 P0p 0P 0<@d p0DK P 0 hPH=@ <<0 j 0 VP=<00S 0d 0H=0 0 APZ0pD{8  1R@P` @@@@0H;-P $0 0$)YP *( >0@@$> (04/$0Z= 0I0pHD{> 0S@t 0 P0%$0d 0>0/ 0 Ps=<00S0@0?pD{ @@2 0  0 PU 0 @PM[ p_ 0P @DK PA 0 P:` @ 0 DK P0 0 0PP(' 0D;  0P0 0 B-P/@/0P00( D[@=0@0 p 0 hP-< X=@B!?C0 S< 0 UP=<00Sd=<0@<0~=<00S0SH:=<00S9 L0@d 00s P 0 &P00d 0Da 0 P 0 d S 0 P0PD[S1iB! 0 *P0=<0@;0$=<00S%/0pd D;h;0# P 0 Pg0084`@C 0 rPZ 0 PR 0  bPJH=<00Se= @ 00H[0 N#᳿T *0(`+`  0P: L08/= 0 @D@0 PH[0:d 0 0 P0ZD1*p@ЉЙ 0 DPZ W 0  aP p 0d @ 0 SPpG@P 0 Z 0 AP|@0 0@ BP 0 .PPDKg. 0@c.H`.  5 )= 00@P ( ,9L0,P@8 05/D@H=<00S=<0'@7 01=<00S*.0D7d 0( 0 PMl 0 0  BzPb0D[0SD'C1#00 S( 0 PL= @ 00H[0 W"ἾT *0(' 06 p08/0 P- @DH[P D[@= @ 00H[0 1"ᖾT *0(&0 0 6 08/0 P- @DH[P D[@ 0 gP=<0@50%5 0T  $P0 PU0D[:=<0@h50{=<0@T50u=<0@@50o=<00%@,5 0n=<0@50a=<0@50[4d 0d 0 PU P0d 00P 0 PUDK l 0 P PDK 0 zPg 0 Pz0 @dDK00`PC@ Pk 0@{Pc0DK0S 0 PUP HpP:WW Xc`@P´ 0 P<0T0 0 EP300d0W0@DW 0 P#=<0@20P< @PT@T |rp`Pᅽ 0 qP0V0 0 EhP00f0T0`FT 0 YP=<0@10= P 00H0 SU@9*( 10P1 05/+h 0 -P= P 00H0 -U@*( H10HP0 05/`UUUVD<4  DP$DJ >E8 4PPh{h,DX l`tx`\<@ $X$\`||\\<( .+qpP 0 D P<1d P0P 0 yP  0 P 0 iP+P 0 D ]P=H{ ` 0PPV *0(! 0,2 09/=`F ``pH{ 00 hP| 0 ,Pi+P 0  D P=H{ ` 0RPPV *0(" 03 09/=`F ``pH{ 00 *Pd 0 P++P 0 D Pr=H{ ` 0PPhV *0(# 03 09/p`F=P `H{ 0 0PIL 0 PA*t@ 0 DK @P3=Hk P 0@P)U *0($ p04 07/=PE PPp 0 0`HkyP 0 PL 0 iPl 0 `P=<00%@C5 0=<0@50=<00%@C5 00%@C5 0| 0 8Pvpo f`@P; 0 &P0T0 0 EP00d0W0@DWQڈ 0 PI 0 Pf`=<0@601 @0@Y0D:-7'0 )0'@C7 0"( 0 PoDP @_pP`WSW xg`@P׺ 0 PS0T0 0 EPJ00d0W0@DW 0 P:=<0@80  0 P,0 ऺ dD Gl A-Pp@KU`, T @ W0``W0 .pPE^p P0070 2000 S037#Q00 ^00$ $0$ g 0\0x ~~/o/zh///@-` @0 0DM0<000p2 0*0 RP , 0 0C 0< 00 0 <0 30DЍe L~d O-H2HrP0੒ 0 M #r $rgqC2(0B刀B# C@$AQ i!dP`3 @@CB*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MgP Y W 0 \P@D 0 RPX  @0 HFPWY @0@ @e0 | Ѝ :$I% ${  {A-`pP-0S-@ ⎺T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@b( 0 p@-M P@ ȍP k`\ PaGo4 (0 0 8 30ލpd  0-@- M0@R0  TIPP * Ѝ@Ѝ/ * Ѝ@Ѝ/dPRp@- `@BPPqP0 ?p@oD_00pPRp@- `@ PzPOP0 ?p@PD=Ժ00pp@-@Q `PZP/P0 ?p@*D괺00pp@-P@DP p@ p@ p@-@P 0PS <0S P  00p舺00pQP@- 0R R  u00p@-PP Q@ @Q Q QT0 D32]00pP T0DS@pP p@-PP @P  T $0S@d<@mP$o@P @uoP0 @n0Z@ @FpP@40S00""[$D @nnn nn9*pPPrP4 oPPgP am NXH ,3Q 0Y0jQ0S {ǻ {:S03:gXK{ZZ k6CHJ{{ ;R{D30SYj{{L0$&00G;{ǻ]Z@4VnTnRnPnNnТ6{@{7{Jꪻ XK{ZZ H {g[E gk k# 0X:0:g{ { آ 0$0<Ÿ 0 \0p0 0\@0h <D tj0@ S$Z==L0S46S`b{ f ^K{^CZ\EjMPzP DP|{p`kP{'P`U{Hq5@H{k{&{VP{XNPpa5d́H[5&BHJؤH 3{{ ;R00S{ 0R{ 0 $0 00Co00XpT@H?A?5?? ||N{ 0 S0G{0Z1k{&<00;R`@P{ǻJ{ǻtSR0 $4@ ` @ P@ TPR 5Vl@Wm0D Hgk 0S3 b0A!Fk{1[{'{'Z<00;Ro5&H [p  $pI(R ⋀RЎR ($ 0W 0 0 R<0<0C<0kP<04"0<00N@4C0Co00~0S40S0SD X@lll ll$0Sq kW{{&;Rp{QcD\ ;hP%46H0L $ H X(04 Q SL0 H$ {{7@{pXL0S㐀\H 46SW|0$0jS  Q Rk&BHH{{@{?5?559Pcd ?L004H 46S<00kS~0S0Sxm`P\  nPoH $0@S00< kS:7SqSlQlOl MlKlg$0S H 00jSQ.LQ S& F H${@{7@{@J {;LL$LQ*p S  c+6C#: :L H0%Y!SL040!@$I1R 6H00L0(jQp82Rjm`P mPpՙ0 $&p!knP0"@$0 00M 0Ѝ5 2A-PU@`ҭ0pS  6P 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 ৱ$0$ $f0 ]H ]d]t ]DA-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l C0 \T T0T D0 S< <0< E0 J \\< \\ \[0 0@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0 00000S wS -S rS  0S /xS  /  p@-^ PB2 pβ 0 pP P//0S/ S S/0S/0S/@-@K0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 +/X0 8XH ??SQ $0$ $p@-0 /W WP P P`/AQ/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/WH PW`QP0 ?0/@-1 0  A-8P 0`00`@p PZ0S0@t @pp@-@P`M P0ES  aЍp  0PiZ0S 0 0 Z0 ౯U Up@-@PpP Q 0S P/ 0PS) p@& A-PPp X P@PEX `¬P@`( (0( 0 t` TTO-` MV " p@IV PᙬP @0SV F!0 `F`1 Ѝ Ѝ ` \    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0\ P@ 0 (Ѝ X00 5CS @/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0NpD0D DL0 ੮T(0( (M0 * Q* QO-PM`p 0FV"S00 0\ Ps@P-UN +UP0+ $p㷫"@; P00Es Qa0ESW0EA0ES70EVTPSQ |@0U0 V)  `0q 0T00S0 S` 0J0 ЍS T 0P 0T0 0R0  Ѝr `00XS 0A0C0A PSVr `Pr ` 0 ?0 g8 @00 0M0ЍT t QO-PMp 0GW"S`@ɨP-TP0| +T S 0T W p  Sv?00 O 0 G0 P @p Q 6 P Q  S  R-  " Q 00Bs ^a0BSW0BA0BS(70BS%| YZ  P Q  S  R " ꗯ"00ꐯ"00 0S \0F0 ЍS@ `" ?00 ܨj  0h00 R0  ЍS@`_ i0T0] XR" A B0A PR W p Pp pLp @` E404 4?0  W6pp6d 4K00 0M0Ѝ p8 | 0 Q?0S @-X-- Mw ЍЍ/G-PP`Q VY P00 !PER !U6@  PG0 PU pWU@jPp X5 00+  @@pG  p00 趮 0@00T0T TB0 yV808 8C0 o, I IlA-P@iH`H0``@p =T  P A mp@-@PŢ00CS0 S u P `0 P㼢pL>`u@-@P 㣢 0`00@袢0 60  pH- M 0/ Ѝp@-PP@ T 0 0 00 pD0D DD0 T,0, ,,0 ! GM!h GxNA-pP@`% V. 0S 0S 0P Q00 00 R` FQ`00L L0L 60 फV, ,0, (0 FF FFXbO-ß OM4`|@P `pPdh V V 00堭/00 Z.` ޝP 30 00 [ !!.PQP\.Q O :!ṝ!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O * P00 0J ` `Ѧ0 0C S:: 10  `  ":[ 000(0,$P0岦 1 !01 `0 $V P00 0 0 41 30)Oߍ Z]0000<4 3P@Ux x0x t( 0ඪ7 T.R  : P u]V j jh b. g4C g $BBO-ʟ UMMLōj|ŝpP`xU刕 0 0S 0  R0 R R 0l*0\: 0 L5 30UލЍ<:0$0(0P00 0 ZS#``P 05 0 0@P0 $03/P Z: 0B?o2\0R0S80q P0`PLP00 V T00 Z@05`F00 0@P0R?D H<0p4X`P0 C 0?`P!0 $03/P @ ` Ve00p0 S(,0WW ,@x TH:0040D000@Q 0 d0H 0R \ Q  RL pp TP@`BZO[P0 0 0Pm ! R soQ \ V\pp0XP 70$05W @0ST0 B@Gq 0P^!P" SPSP@Tp`0S 0 0`@D @PC0@P0CS`@:Dp` @呪H0T C0 0CS`:僪080S0 S R:  C'SR^0@ r0Pn0%L P'K RSNd5 0 <0b@PD0  ,0@S<Y 00`V5 <``` P(0U7P0( 0S 0S @0S0P徤P( 0@T`*X0H0Q*p@0`@0,@Hp@0 R R ,$4 0@ Ҩ 0SL#3 @ 0ƨB 0L0?R0 0 @P0 > ,0@SP D001Q>*0PiP P`Pb0` CR00S]D0004D04004<_PeLpI0`P@ CR00S#@P`@$03/P `00D(`C 0P00P  0 D00000냪 0  0% L=a p  0 Nύ00;1@!R7P0徕0pP`pH v6P 0 ^@P@0 , ,0`S@0S00PD000գ@T Hp@0,`!0%L L4!P D001Q *0D0P00YP 00D(@C 0P00P  0 D0SD0400 f f f  ' ٔ%|;< d%T; x TA-@PPMD 0 S`05 S Ѝ0p 0PP> P9 80 0P咷P  0 0P'U 00S S 0pة8 808 40| x 0 ,6(5G-30BMPP040@ 0 00S0. S @ᬒA~ ` p0v #0G7P @T *X` \"T2P 0 <"$2 0 4 30Bލ 0    ! 7T@PI Y`PD 8 0 0@YPK` 0 00 00000 0d0@TA 0 p pIP  00S 0  0pW0   0 0+ 0 _ 0 0 0 ¦_O 0  00S Sy w_R Y55` Y 4 T3P2O-PPM@ 0X0 X0 @ߍ0( 0P 4000 00 ` @ p 協P 0 "00{P ? R R R#[ 0 R@ 0PUI:PE0S[PEi p @ i p[PEW R 0 0 U00 R R0 S S p4PP  Jo P JP !Tk*0@ZU  0쁟pP`P R R R RZ T4*P  R`~pp ᙡ U:  PEXA Hq  PE  W  | U*(dP@D `( p@ 0  0ࢥ 00, (J P@D pa `@0P`p+ `R`P0 .|^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 00  L5P   0 0 0 D0 30LЍ5Ptpp  @ T@ @0@ <0 P R8`.`0 Qd-L ,,pA-PP@M7 q`p@T) X pp00 0 4P   0 Ѝpp E@qT Ѝ4P @, ,0, (0 ̤_$ |+x+$ G-M0`p@P0P0 V 0   0 pPЍ 0  PP 0   0 Ȕ*<A-M`pPǦ@P , 0 (   P0@˦Ѝ0, 0ЍA-@P M`P@pR UV'0S9 0S0S9 P`8818,!<P P0 0pP 00 ЍU U- _/ 0 0 Ѝ0S T 0 00S000h S S 0SP` @< <0< 8 0 0 H) L p(O-DDğ DM<h@P 0 ($0P P`spq0 `'PP P ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0ɑ$0@P`  s p0S S S@ 1Y g*@ᰑ@P 000S 0 R0 ?@B 0I  R06@DQ1 壤  @D2 T!:  @Dp0 Sq CF P`0  ᅤ@D q [p>`PT* P`o 0  0d!P1 0 <0 30HDЍ(PI `  6P@d P1 0 0 0m0 J P`00 0 0 00000 `N`P L< IHp@-M`P@ ),0,0   0aЍpV8VP@-M@ $$ 9 ЍUU@-M`P @pP0P0 ɠ@0@ 0   @0PЍUU0@-P MP@T 0t  P00 000i P 9 @ Ѝ0⭻@TW 00U,UTC-a@P`PMD UL 1 0`    p 0\# 00 0 L RU0100 L.\3W 00 @Ѝ R0 XS 00 9\0 @ 0 m0 U0 n0 \ @ pG W QU$ (,000 FD !( t O-ß3 0,MPQ0$00@`N R Pk PY0@:T000 0n Tp 0,#P P` `@0 3P _ ZZ @ `V pW` @$pTᰐőK0S T0DE S0 s\b 0@@r@ p 0I4 ∡V@ T T[ /00!1 0 $0 30l ,Ѝ!1 0 $0 30`,ЍO@:TP p̓P :V=Z& 0S 0$ SPq1pJ04 ;T TU 0 0@ ,N0S m 0@ !C00@ @$pj@.T`@$pTP]ʨLTi D X ` BD B , `<@-1 0,M@P0$00`P& V.  0 0 0 p D1P* \ 0 0 $0 30,Ѝ 0 X0X Xh0 ๠V<0< <i0 ௠bL @\ ? ` 8O-ğ lMQd@p0 R P P% / 0 p$h4 0 d0 30lЍHHTHdP`0H sW T~ T0 h 040 $(,00h1T@ RT@P  0 q0S P q u \P 0SP qI u00 \0S PZAU00@P40@ 0b0T0` VN*:0TU0O "K 0 m0YP?@T$ 0U00S 0S "2 0 d0 30x lЍOu0P040@` 0bu PU 0 S *  0CR00:M80 S8: 0 /Z Z9 Z@P(1( R0  KP gPP`0P`I0 ◟T T0S 0 0 : 0 0|00@SPl :0U0@t"K > >p X < @< O-ХM@P pP) 500SL Ε([P U U U l 0 ȕЍ0` R 0 ? 0[' + P%P 0;/pq 00P @ P 00 0 00 呕Ѝep p*P0  * R + L UY pp 0*P 00 0 SM  00 0;/pq 00`QßQ <`V;᱒0 P0 ;/yq`0 z 00 0`VßR <0`VßpX0P[ Rh0坓0cX0`[MS  00Qe <`800C`V0Z & "  RY`L0i/  0`;/pq@ 00 `P  @ P 00 0 `Z 00 A\P)0S&: I y Z1!0 ?00C0Ŕ2PT` 0S  0C`ß$1$!$G0 "A`V0 Z 0CJ `J`P @0P 0000 00ቔᅔ! 0 }H0H H0 0 9L  ( @p@-PP@` R 0AU0D qV p<0< <H0 ࿝Vp0Pp \O-P$M`@ T\0000 0 00#pp0 0`' 0`B0S0 Q; `V00S  F 0S` 0 01 PP0  0壞0  T? X0 00P6 0SW @@RY00S@ 0`V00S`V[* P`Q @ PR  _PV 0Q @`帓H04 QY0 ᖏP, 0 S# H @ P00S T0S S/ S4 T: P@000S 0 0帘V $Ѝ  P `BV@` 0r ^` D0@@ yW TT SSD D0D h 0@$F H  L `p@-@PP` U 00F Gp 00p0 60 Ud0d d70 0 0@p诞0TS00ϰ     -M0 3/Ѝ/0@-@PP M U( 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0D0D D0 ?U(0( (0 5    0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 U, ,0, 0    p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0 Ǜ, ,0, 0 ཛ  ( p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0$ , ,0, 0$ X 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H00 PU0 000 ,00 E , 80@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0@ U0 000 ,0@   % <&0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0P ʚU0 000 ,0P ࿚ E F0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L Y0\ U, ,0, (0\ |  8e0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L a0l EU, ,0, (0l :  <0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0| U0 000 i0|  D0@-PP@ M T 00vP00 Ѝ0L L0L H0 ՙT0 000 q0 ʙ ,@  ؜0@-PP@ M T 00P00 Ѝ0L L0L H0 ৙T0 000 ,0 tT H(0@-@PP M$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 `U0 000 ,0 U Xl8 , 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 U, ,0, (0  L`, t A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 Ę8 808 #0 ຘ xnP * \A-PPp@`M3 W< T% rP RP P P ЍPX  00R X# ЍAt 0 & 0v 0  0lW 0  0a P@ J0SP@@ X h^ \<_ Dp@-@PP U  ;p@|L L0L H0 $U0 000 ,0  h|H <A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0ۗ 0  0їXl l0l h 0ƗWP P0P  0໗ D$$ ,  0A-@PMP` 0A UJ 0pS SW Z  dP R`V V V Ѝ00p0SP Ѝ W`# `0SPV 0 /0 XUh h0h d0 M Pp 00 8L   p@-@PP U p@T }P P0P L0 U4 404 0 #( Xl8? , 0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ000 3/P 003/ Ѝ0L L0L H0C/ϖU0 000 0C/Ė (W 0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ000 3/P 003/ Ѝ0L L0L H0G/U0 000 0G/t { p@-@PP U p@UX X0X 0K/YU8 808 40K/Np@= <P p@-@PP U p@|X X0X T0N/0U< <0< 80N/%p@d جx lhTp@-@PP U p@X X0X 0R/U8 808 40R/p@  p@-@PP U p@)X X0X T0V/ݕU< <0< 80V/ҕp@ L`, @-M@,P0.S00ЍO@-M@p  B0?R0S Ѝ$0$ $0 0C` | R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / L0 00/ 8// 40//O-0 MS P`ȣȓ Rl Q Xg@.P` @Pc X[@RAS0SI <  cSB!  S   XG` #SpP@@P   pGW`W0P@W `0FS0S0S V*0 00R0`FV0SP"P2P 0 ⌔ ЍT S (00`AQQ!X@R P\! C]R% X!q#c!! Cr   "!!1Cs0#"1 0@0Ls 0;S!S" Cr 9" T*00Ls`@S \S X 0@@DQ P`S pg' 0`B0j pg'!"p0`50]8000X.0`0b D lQtO-Pğ@ $MQ `0Xt P`p)[V> MP @Qa BP @Q`P 7P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b"r R` V` v`A ` @R^ .R @j@  0D0C  X1](00$ЍW00P  ` < V   \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00`   0G-\AQ@M*p0S& RD @R`P001 0X; 0s00ࠟ   r \ 0 Sp00 @NT00Y0Sx x0x t0G/⅒AS 0SPQP!00P0X(0@0 p$ hPhRO-P3P#RP3 M0U 0p`\ @X @RI R R5 u(00 ЍQ*@ Ġ[? A @ GRPR@\ 40S4  0@0[0Q0A[0S 0 0K/  Y*@T*0P5 0A\ R!ɑ" 40S 04 0 - M{ ЍO-S@4M p0S0h 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@ВU `PU00 S 0W*0 B>^A ZP `00  K Z0T?\P0` RP SAS^01"0!0\VP`ᆓ(00X0S $0 Q*0F S(0S 0 `(  0AU0S"  !  [)@bZ0 p w(  ABQ APAU QpF  p  r  0B>SE0A S0AP`0S 003(00@4Ѝ R p0S   P\`B0[,? 0,$ @C /Q R!1 0R/ِp00 0 0R5 P`00j,@J0? Q0S 0 |0R/ⴐ sX \Q\ @ @0@ <-0ࠐD |޸J |$ބ$j {p@- M P0 `00p @ !xp < 40 0 1 30ލp@< 0A-P 0 0M `0 10@0 (q\p 0 ph0 (0 0 1 30ލ; Q:/R/0S/S:00/@-\@3#* 0^ @R R R H(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C (00/C/A-@P`TP% UVT P @TP 0?Sp ޑ00ّ(00QSp@-`P@ ֈPP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP薑(00葑00ꍑ?00Q @-A?SSRB 0@S Ar00m(00/-- M/ ЍЍ/@-M@ p TЍR/0S0 \ S 0S0000/O-P M@P 0DT"S ` P-Ya +Y Q0Yc T@ @Q :pV`Ppg:pV`P" [-SQ& K0Iq P0aIQW0IAIQ70IS| V[SQ;+ ΐɐ0S \0J0 Ѝ`Q0YXP A@0L ^P @ꢐ0 0R0   ЍQz T@@z0 ?0 \Y t00 0M0ЍG DA-00 rMPPp`, V4 @X0^00pAtAn0O `p00TA΀`L PP &0 @t0 0 1 30rߍX0X XF0 V<0< <G0 9 |  r r0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ O-@SM ] YXc 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8 EP 9   ൎ U 0C  pSmKP0 0@pQ 0S  Ѝ薏T 0 @00Ѝ808 8@0 \ꄏ 0 0 p,\A-@`Pp˃0 z0@˃$0$ 0 M Ѝ @T?p@-0 000St@@@pdPddPD2@PN@P  0000 0 t??| p@-P@* p@A-@`Pppp0php mT  w1<0 |  AY $`l@-@YP0S 3/000S@ A-pP@`  F Ju000U@P p@-@P։Ppp@@-@!1BMM 0`PF040@@@ @@m8xqPpU h10S \!p0@  P8A0@ P< 1 0}!0 0 4 300BލЍ夎P ࢎ@P  4/P Q Q 0 0|p0 00P 0 0 偎 @W7 L<, @\ O-qQpMPW Ap@e $a` Q00]1PI 0SP p Z [ @@P r0[mpP h0PU :Y _P``S@PP TP 0@U:W I0@@00 IQx00p@@oЍPЍ<0 0F| l x;, :L99 l H0@-@PP$M U" 0 P' 00 0 7P $Ѝ0`0` ``0 aUH0H HH0 W8 hL~4 h$ɰG-@PS  RL `10\0SA HaHHqP`p #)/0PS-00兑 000S 0 000 00 0 00 0 00 h G~P00H H0H D0 dpPɜȰȤ fpA-pP8 0S@P$0S!0`PP @0S PU @@P E0U@00 Hs\@ 0@ P 0 000 ,0 Ⓤ6h5 e ƜƤO-XğdMR  0 S X (4`000SYD@0S00 30#003 0  0 0'0P YP3s003@0p0VQ QN  QI P0S_ 3/0 0P U@p@ SP00SJ" 00C0T@dЍhB,@@@]20\ 0,0Sq  R20$   @$(0D0 L00LP 0S 0 <00@00<00P 0 S@!$0S(  ( @0PN 1S@iPQ 00C0 d!d1d 0&( ೉0S X @0!010 ,0( ⣉X!1 0( ☉00$   @$(0tP @$0S(  ( @0@J$  $(0 lt4 |P44\ x3 (3d3(  a a`ta a4X¸b1l  C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0rT*0 V @0S00U0Pep 0PZT*0@0S00 V@@W <0Pe 0P@t4 Q 4LO-ϟ M|ϟp `0S㨐嬀m  Yt 00 0S` %SP %0BUSU7(! @jJ.'1  {xYE>]-= 0 |0 30Ѝ POd @040 $ (P,9T-T##P-cR:H-c2S<=  PP 0 0C@aa0C0C Cr  \\x=N>?#c!!"N ,  "bQ-5:bQ , !-#c!!2N 0  T\0 S 0!Y&0`0S00 Y `0  p`0 S00CL  B2;Q/0A!b0dP  Y0`0S00 S 0  B20;Q/0A!b0dP  Y0`0S00 Y0 p`0Q0: 00dP Y0`0S00 YD0 p` 0Q09 00dP Y0`0S00 Sa /1 b !Q 9Q00dP  Yj0`0S00c SB0Q0(9 00dP nYR0`0S00K S*0 p`8`p0 w`-p8 Q0 0dP  :Y0`0S00 SQ!/ b !Q  '0 dP0  Y0`0S00 S Q '0 dP0  Y0`0S00 Y Q $'(0 dP0  Y0`0S00 YU&P#U"P Q &0 dP0  Y0`0S00 Y 0Q0D6 00dP Y0`0S00 Yj0 <008@0 0D00dPH00L0080 0X0% uYm0 `0S00e YD 0E0 S0ڜ YU0`0S00N S-YH0$ `0S00? Y00 %1?2c 1 R11Aãd0Sâd0CS0c0`4dP 04Y0`0S00 Y 08  8  p80 S0R`050dP03 0 Y0`0S00 Yp0 p`0dPS0003 0Y0`0S00 SY0" `0S00 S0 p` 0S 8 @ 'pq   Xpq 0AQ 0! S! -Rk Si! 1Q0!Z0S$)@Ϡl  ^Z R SH*ȟY`` Ји  v@@PPȟ%ȟ堨 ,H)q Z.px hȟ5:ddX@ $ ^, LΌ3# `_ 0RS@wWCYPP  `E@E@ǟ'ǟ|g ,F|t`(ao[.`gl 11 :Hg$@ >QQlO-TTß M@P  0S0 0` 0  0 S  0 020230ߍ0 0  0 \ 0SV  R 00P{ ] pP"rNA U p"^Q# Nh-X0X0XQ RO Gp `VE 0䈁mQP 䉑m&R0 o00h6h& B0 00 0y0S n 0 0v0 0 0f0S 0h&?oh2A 0 B U 0 VMT00 UG00) l190@-mΠ0l6@NBW@122e3cPL@/ c0 y4#(: 600+$0+>! 0#Â!!!0C0(AX Oÿ2+" ?00 #2>[?W'`F@PG`@2#2:#0D"D "Q0 3 #101`0U15? B4sppp0/S[0 o c0 x(a!(: 6 o`00+$0+>! 0X!!!!0C0Xÿ41+" ?00 #2>`T[h@t c0 nx $: 600*$0*.0$1110B@T0 I:#$B0Nm:.EQu_9k"mn /гcSI$ňQ\\(=p * *Q\(\) )s c0 ,x(a< (: 6 o`00+$0+.d01110BX|0;#(0``0 0 cQ @R0!T BqgqgYpC(1 ?  0c0w0,!(: 600)$0!)>X! 0Â!!!0C0x!Xß)" ?00 #2>r/E B  P2?A1c1c0R0B 0$2!502c4"2c2A" "b1C S/  `008P2P":#"0 όB! TY: 0"#2>"Q0030#0000U  PE0 S0  P P$ 0Ѝ@t)1? 0 c0^w0t#):60 0($0#(>!!!0C#0Y("0 #2>t<0P0@`! 02P"> 0R \   10! S jh}00Ѝ0 S, 0Q0% V 0? VQvŸ0 0#́P0PQ  V0" RR!Y0h&P l6m&N R0 RRR@ČR RP)0OCN  hyN,h 000 R( j0p 4$h`@,P,0^S0 * P4P"<$1PP TZW [[(p W0  @`  0^ ^4$0^$!? K[ ,P04`(0V0F 0 n R !0S ^  0A0B 0(1 0S,pA0o R !0S \ s 1PpN h x0 P@P0/C0XO0p CU, "/ ppcW  (0]# 0 @ƨ T0 hNhO-0|M<SPM 0@S|Ѝ0S >S`@@0FSHypP Z 0S10ƒ!1 hh "00xY OX10\1 001Y" <Y50 S0S >S@p3S*S0S -S0 C R0`@0F0H0N<)`h0hlpt Px|Ѝ*YY -Y00I S@0IS0   S ,S;SQHAL c ;S,Sb ShH^%- Q 019mPhj`019mo\` @KOh6Pc^`̠L 9 bp&kg.htlw@0 0N\hPw00 @w @ P 1 00 A1 01tP00P 0,Sd0,0P 0S  H LI$ bh& `p&g.tl6w6` p0@ `pĤĄğ@(4$cR0#034 1`002c2c# b?0cY[  Z  R `pJ  ($cR* $L2P 0 S 2J` p0@ 34@0 尃@0 `0pcP0#031`002c2c3?0cP`cs \pP  P003:#cP* 3301c00 `Z00p4@00"0` 8p @@  `p@D 40g p 0HSh0Ű1` p0@ x,w ̀\) \({ 3P A-PQ@D 0S! pN,00 01h6l6h`v`P 0:S fP `VpFPW N hp0PPT`V_pHPNLg@P`WgPpVE`P q4A-A`P@pP pPPPWrPqpATW  P>UH QP |1|!0 t0000`0V m``@ v P =D0C0CS\@0d/@D  w@D0P0T0S00#  1PWPࣶ N0I0Uh,nhP@P0P P0p0 000ވL  =HeoS ;ܨ0@-@ 0 0!R ! ;D@ ;(@-\F0 n u4WW@-@P d0#3@d0 ;0 mLWhp@-P`@i R T0U:T0T:p@oR~V@-p@-@QP> 00!R ! 00! \ uP 0B RQ`0 Q0AP R 0 U00SpbP#aP `aP0 \0\ \<0 mD0D D0 Wm 00Bo 00tUUTUA- R`#P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0 SP0Ã@80p@,1! L0  A 0Aop@-PP@ P _0000p0 0 mhLSC-p@0T@1WP` M o o0S* D!m00@ Ѝ00o yn0S 0   n0@Jn@O-P4M@p `m0  00ShSf  %R0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK 0V & 0 aQ S  T 4ЍPP؀PP؀010 00C0B Q$ROLP00n x3 0S 0V`1!'  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S pD 0V`1!dx$ 0S 0V`1!W V  x 0S] 0V`1!F +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py xp qp jp& cp \p Up"s R 0Hp0y  V@ `1 | x 0S 0V`1! | xm 0S "pT  0V`1!t ; x 0S4 0V`1!e ; xX 0S p/ T- * p# p$ p7 p#l x 0S 0V`1!'P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S bpx! 0S Vp@ x 0S Hpz  0V`1!  x  0S 3pe  0V`1! PZ X PU S PP N pG PD B P? = P: 8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P p p  P d p pO p P J P E P @ P ; P 6 P 1 P , P ' P " P 0s 0 S ~p  0V`1@! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S pP  0V`1!p PE C P@ > P; 9 P6 4 P1 /O-@Ο oM M0Pƍ0L@ H@p @0Sc 0L00!R !0w00 ` 0S   R  @, 0 䰍D I/@$吰\ 00000d0X00PU @%U PU `DV0pJ00S00`00pU 0Pv0%10`(P 0 0FZSeA 9^<.2w>rAB +P[P    R\00sX @0S Pb?`1RRY`O`.>TQCgˠNP`G0L,@ \DLt/0@8D@P@[P@@0@ 0@00e@00F p`A@00F S$V (@D T V4 $P|:,0   S !10R q- 0v RR P @TP@@ 0R00S@v0bo,dp @_TP<4P$0000S 0#0儀0@0S0000XX )8 0 6 30 oލ ЍV_ PP0abv0@T0P0<040%!(R PQ  R8  儠`AV{S 0000S0v00%1S \0000$10000S0Z @DT0 )00Sp0C0 (0PCU80P00P$U0X0Sz v040 0S@@0S , 1 0,040S|00 x0 6 pR10P | 0BD00?R0S 00S q0P00 x0S-0v00s<0 ` `peL0 p 00 ,@p0 \< V`'Ҥ55D͐( d ,  ` D ##^# L 00d0,  v :I RB 01  vPc\I 0,0  0R00SJ 0 , Xbo wd @jpHXKdXq XPPv0T @P < 4 -000,  > : R 01 0, SH 0H x %! * ʌ R v  \  wS4 , R boRdp !". #2 g d @H, 10  g00R00S 00@d0G @pH,` P00,0`@D/ dVH0,0boH0 L0zp ,@_F@@P`Z@P`P`P`[ `*V} 00F S0 0 `! 00F S PPX4<,  n :c RU 0P1    R%a, ` 0`w0X0l40S0S00D <0@JT@T ڔ00Sp@0x<`T`FV<0pX0Sy0 00  0`0Sbo `0 0JZZ ڔ0 0Sp0 `Z `FVV0Eup$p@`FV; 0Sp 0P 0(0CZ_Z ,ڈ6F0`0 @ p$P`pGWQWPpGW F p 87 0 R00 #:P$T0$ڐ` ᘧ   `$@K[0S`0 PK[0 @0S0,800@0P$P x 0 S 0bo`R@)D @R0p 0 D `@Vd RJ? 0PF$V$d9 0F @$Pp`FVQpP$`FV pF 90Q`0v0NP $T~P$]d0Wv0! XPPT @P < 4 U0ڨjp$`@PEU 0S` 0RPPEU00S0(;0P0==P60H0R)p],P)$U0000S0;000G0 00 `000000S03`V 0D 0 000KR,0  H0H0 0 S 0 v0,0Sj R@D @@HVV ,<  , 0`=000NSn `Vv0r|p @P@ T@P@<@6V,}p$p@`FV 0Rp)P,)`FV ʜ  0R`)fg@& c R ,0P1sb 0 P 00@0 | RH0,0  pH0py0R0@0 L RH0,0  pH0peYP)$rQP)$uP TQRӸ PwhP4P $`Y @ @LTT0ᐐ @HX \ PvHX@ P0\@P\PT/? 0, _|00CD0[P8P:$v0vV0t@ 4P$P`@K[0S`0P0(1<0 S+0S cB-0C R)1ھύL1BcR0 0a0  AC LQ;*JopL0 `0d.d>d , 0}_H.H>H D, 0s_0S0$>00`0>EPSH , 01H S-0`v0͵ 0S? PCR ,0P 0 -H000 H0,00,06RH0,0  H0 `4P0S0=00`06P$.X 0p@T P 4 _gPr$G0w<,04 04bo,dX v,pH PQ$ < =  S5 , ;0 a RH0,0H0  ? 0 I RH0,0H0  ?  Re ,P  S ,S, H0! H0? z,@pX R <A R R R <PXT@0p_4@`Vhzp0v0XzpTP$~w S4 ,,  S bo{X `p]L 0 pP" 0@00R ,01 dR ,01 \R ,0P1KP8"828 , 0,[\| @B0?W0D@PH0H3u^ 0 0 0@ 0pxg^ 0 0 H0PpH0P$`X!X1X D 0\0@ 0ap 0SH0 ( H0f@d SH0,H00, 0?H@P ?H@H0PpH0JXx |4 3  X 0XxD>T 0@00/0S~ `,@'`00F SG@A@00A S$Q0S+ 1 0`0:$ T P   SH0,H00, 0] 0 0 S,H01  0,, H00@ 0p> 0SH0  H0 @&꿍@-@`P MDpQ@0p0 00^0@Q Ѝ )A-@P`pQ0 H0@QO-[T/ M p0Piqa \ ЍO{[D{&{83`):Fk{J @ H 82k0 c01{{&""{ {0 k{{& {0 P{  { x C $00$0XCZJ40S[00SWpP( @PPU 00S0SA UPYH Y @P= (AP9W;  W9RpG  Pb8m@P&@P [0 (0P(0 ?@?@$@$0SW F 000 0 `0408`(P p P0` PU8$$$&$XQP 40SYWQ+ 8` (Z 0SZ  pP`U 00 E0K[ (A0(0PP1 0`00 (0S0P(0 0 <0U  p(0 !M `S;%{K0F[kF{7@{*0 0r  k[3{Ck6{9J\0 0R?0S@ z0$000 P {'{0 {O{;0 Q {'kkKE{{*N{7N BB*N@{*0 r  P`w< `  s0R @0P0`kW~ 00 pS`C  @P 0Z 0P0 P p 0P00W0SpG P)pP   ! WPP 0CS{  s9R @ r `  0P0010b$04u(P]00C 0T@P 00SL0SR E0 LMWXt 000pPQQ@0S Y Ys U8`W@P (P9X\ 1 @$?@$@[ LP0: K[{[$kk0kP0C [@0" % %A|0P(00@   1 @Q Y! Y {7{E{ P@e P@ 6W?X 0009 QY8`d 9X a9 pP 0S0$&R !**R Wp@ P `QP `N(M0SEP`F 0SrPU1 000P ({0 {!` ~0P0 L0S E0LL)P8`9X8` WE 0 L A-@P`WUT0p  R*P @qWp@@iWpR bWT@p^W@P0D #460/\460//P@-@00 R@oP@Rp@-@`0P0RP*^0PpP R 0 R VpP 0@!O-0@ MSY@DPqap}QV`q!%:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-0UM 0,@P.0L10U {{{ {d 0 \      gVWV8 <d@-@-@-p@-`P@ TP P0F R h@P  VU00pT P,0, ,?0 T0P4p@-@P O`CPP  1Up0 :0 S@-M Ѝp@-@ P` !LN2Q !@Ap- M$ ЍP/D -0")2b3c1@2`M1 (ЍCރ0@-@PPM {  0{ Pp`Ѝ0(0( (;0 S  X p@-0@Q r P p0 S P1 p PP   ! T @0O-`MpDw@0D0QP095X! @0S S[ @Q 01 aPp P T@@>  0  "W @TQ @0T020&  0 W` ЍQf@0 R AX0P @0   0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 ;T@P@00T" 0 @000 @ 0Se0T0 2a PPl"! 0#000 ^ @ 0 `@P 0Q/ R  B / 0Rp@-@P*`0B @!S@ *@B@DQ@@@ >S0  `f2& pS@ * A BP   )Spb  PPO- -pM@ 0M 0(l x t0`-P-+*)('&%$ ry000P0 0 00@ S 0 040P@1T00PCT!Ђ0 @t@00@ S0\ @0 EQ#0 00 tp0t00+S -S,0,00t000C ^*0Stt00S 1C\8Q 0l0 08 000AS,g Sa ?o2<0Zg{0T@S{pp S ڐ*5 g{0[1k{{05[S,0S ,0S, %0aS+pAp|0 @0p @pw Px |0p0 pLW|0[ |0p0|0  A R@ Q KpCW@ Qx pqm0p00040 S|  @00S 0@000(0 00T ,00 8S B ۟˟p?H0 0( PT0P@h P|  T ! -Rx0] @Pq x   !!RpP|`; PE b R(0H0P  C0E(H PP0C PEP`PU00 S 0SPE`FK(0SEQ=s,0SV[  P4 A PP/ 0S0S `  <0 pSp Pp W@ 0Sp# Vb@0 S0l0 x [0[` KQ 0Z00S800X00Mc000p 0#Z00S|0L0I hd `P dQ|~00xS  ! x Px 0 S B\z@0 S.p 00 B0p  W%L0p |000C?o82Q0S )K{8Ik{JZɋO0S    0SpЍ ?@<V? <Nx?00XS `t`0P P0 0x Qt000Sl00l0R x lЍ ZiS IS NSt@rP 0 l0000t00(S  000nS 0x tpl0Pd  ^P00CtT0y 0C Q@0Q0t(0t000C Q0pC,0pW|0@0(W,  @P ftp8000t0PW `00W'"V20{r@HТ*:?C0C0  Jk'AQZH@ rR,zGpGp04656 0 kF H30@{  0QF @0S t00S l 1CQYt`000CQPx0Ct00C YLt00N0C YL\>@8,Q8a8Xx* Pxl p00p0t@P& t00Ct0Pt0 0t0 00000x l0s0pC,0p|0@0pg  5k01{{{p` W'"!@50{Xudd@HТ*:?C0C0  Jk'AQZH@ uR,zGpGp04656 0/ kF 60@{  0I<0 0l00 0 Pw|0@00pCW |6k01{{'{PvV  OV 0I8pX00p Px  B\0S> p 0 0R0p 0P 0P00 00@_ \ Pc HP[xP Px @0| 0C B@0|  xV0p0{k V0 0ƋX00000H^8pU|Zk書<0jSI8s Sb Njepna `P}^{ڂ{I{7{pl0X 0l00Sp0KS0 xPxA  |00C |0  0r pnPlj |0 R# 00S S S[ x[0x00 l0000 "AQ!*yN 000  0c2300x S 40S 0P 0l O"0x 0l0Q000l0x @0l0O"0x 0q `BxPx |0p0C|0??A?qHNG]000 l0x0 uO"00 0 0000P@i!0!l0 0I8X000,0x00<000c<0 100V000 P00S0 00 0tx0!Pl0x S0tpp@00x@0 |  |  W p00[l K PZpx @0p0C|0 fPxP !\ \ \ \Qu}0P^8|0"S|0|2, 01H0|0@0 0&| H0 `0"k <5S,0Á!{{'l 0 G  {.P p00S800:80X0相00cX000S 0x000 P J@XPX!Ђ X@\00?0S!Ђ ж0 480< k 0  B1{{l00{0 G P ? |4k0<   b{,{' A1k{'l00{0  B+pB0H05 `hS!00pl03 A?Vpk 0S xp0 |Q0x ! 0 00C lp |0Vpa!0Zl0 0@ R0 PPN FP0l0|0  0Cxp|0SPx=0P00l0 1 @ 0 00lx 0S]0SY 0px 000 0|0P0l00Z!05 l000# [00Sx 0 VZ 0l00p 3S 0l00 Px  p`1`f`Pp00p0!0l0@0 xSl !0l00S|0S40040v|0p 0C|0k@-}00kG-` 0Q`ppp@PP  PP`q0s z #8 *8"80 W# G B0W   3`Ea V F A0s#8)8RᶐL0L#Y 0U 0 Q 0SPP   ! L@P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   JK0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0p O)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 O-M<0 喺XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 00Vp@ !xJT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0SPX 0Sa E0 0UX 0p 0 Q U P  U UE^ PLU 0CC10BgP0DSy`0 S0 S C U 0S S S FKP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S $000 0 b@0J"00@C }`P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf x0 S_ J@"00Ѝ@P0M@E PL `K"V`pKW  ` 21p 7 ` PEG@QP!80Sj80S 000i U U EP 80S800c8080S `{T0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPU 0 BP @` pV  0 BPp0U`890@-M@Pe a  0 B0C2S  6c@ J@{k Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ H0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/+\|+0X+A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R @-P@M: Q @ 0 R Q ~@ЍA-$a$1`pP0MS3 U10AT !0S 000ε 㺴@T 0 0S00 0Ѝ@0!0D1S<000妵S 000垵 t*DH <0p@-@P0p R pPQ`00App@ʶD `80 0QApp@s Մt(H(0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P;pP   ! G`~P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  mF  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1t zPP4 @p PU `@00SaPP# 000S 0J0EPU 0C  pPph03iV0S <0( ,0R0i ѐ%tq$HR#dG-P0R@T`塢ڃ0TP$ Zp  !pE0   a!  \2)0L0C\0003R @@HpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @00S 3 #V0`F`F` 02NS @0@PpP 0!Q@3A! p@-@ AP`DD 0` P0R @ *\ l1 0DR%& 501 P%&0;Bp0R `5,#511,?C-` M[Tp>P Đ4$66U0P 0Y0 0 CII50c0 Ѝ 0P c2# R   Y C>C0C012`0S0/0 R /@-`ap`@PMA H1P4PP2 pP,0S  Q5 Rp 0: S.CP 0uPP0@ 0$  0,  0( 0 0ЍE00Ѝ\PT0T TE0 LCtE00pEO00 4eM$p@-@P 900CS00 P9pP0 =0 CiL\@-@P 00CS00 @ 0  I0 BKi<hA-@PpS 0rSL wS aS_` E 0 \`0S! e C+Sr ^R)# `0S``0[S0\S0TS0USP`0 >0 BJpp@-@P7 0S=  9 P00P! !& 0S 3/PP೼000P @ P 00 `00aa8d0`` 0pL6P404 480 PBxD 0P0fI`@-@P 00!R !+P 0C 0 ;0 ,BfH@-@P 0 0 S @60 ;0 BeH\p@-Q@PPR 100S4 0 XV 5000S: 0#$0 3/0P:s007p00P @ P l00< R 800p4A0Pᔱ'HᏱ5P00s06l l0l J0 A  0@000 pC 0 @00 ĈtFd -Ѝ/p@-@P@TS S S C 0 pH0p@[,0p@Kc0p@e@600 0 00000/<P 0p/@-C/41Su C- Pq M  a 6/p0`@0A/`_pf APpMOĀmZ@Q 0piPU`Q 0piPJQ 0piP@ Q 0piP6Q 0p}iP,Q 0psiP"Q 0piiP@Q 0p^iP  T Ѝ/COB,<aQ@-P @41S  P hP0BA-4!@ pPP/1S 0L1. @P!'BPPPUQPMoPP Qp  W Bp_oRBpBpp@-@P 0@@A-@`㴯P] VapP᧯PQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V "B0@BB@SSO-P M. St$ATp`$q(a qp A`TP XX`A( [ʋ Q `0(qS 0P@  Ѝ0Co$!?P (xp ₰\x Q @pT`x^x0TC G(VB ( $! AT$$( [ `( A^ \ :0  @PA, \$!H(1s V(0 X?T0 N?䰟 0 E? (R 0Q0(0$ 1@($AQ 0 aoPi D0^0$_u==|tu=XPO-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 mPPu/  $`nPB 0 $ `P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ L`PP  eP 0 hP@00,Ѝ$`p  0pmP   eP(q@GT 1S(Q0 @-@ ! \ @,d@ 0 ,1]@0S@-@0@ N@00,1R@-@1  @0;@ ,!4@0 0G-ḕ0S MB Ppw`R@P WQ   | @P 0 Np P0, eş0  4` 8P  D>@ >zPP X PP0U4PS 1P3\ X\\\@4O: P3h` ZŠ   0 `$ fPf33  JF<, 0(@ HPQPXIK $P  0p '0~ Xk PUh A/ Qp APW ` VS@ZO2  !2/@PG(P QPC aD0!B1\0 Q!NX Q5W0 pp$4q$PPx b"0bP  @0B 0!p PpލOppᇭ ?p| P? 0 Op ?p ?Qo?`V/ P<Ƞ*  008P4` aD=@ =>PP R >>@p>p>p0|>@>@ XXaLx\O-(P`P10p5fS@(Pp5 RؑͫP- (2 ,0[ D D S 1"1 Ogꂡ ጪP ر $ J*= ׬ؑ@-@ 13/, (Q0@-@Q h.00 2M> 0 O-鴶MS `p & 0Z0 P!U E QX X R Y 88YYY  >00 Ѝ P 5%0 ؕ !9@P 0 10$!12 P- 0@S0 200t5V00h500`50 0X50 0P500H500@5000 S S =00P 5p / 20 2 80p *0aUP U\3UX# 2Z 00 20120QSE  000 1S 08pE8`@V*v`V`3w`0 ,P0 "  -P 1S0S1S -0 29 20 29 20S 28 2DR3S # .  P~P s R < "4 <(P0"<S 04,8<004$`8, 48 |&4 <0&<$0%4<0 %< (0.4<0.<,0,44<0,< $(00*4 ,<0*< 40P$0SM(P`|0| |0 7_P00@ @0@  06?ყp(0T~~A 1Q=00/C-A MT' }TP# `P  7\ 0 WAT R0 X 0V@T Ѝ0)_P 0 00 0 1 01 0/p@-Pp U@ ap p80@8@@@-!1 0CMM0,40@P"P: T10P!,` @ PB*F{0p C{{$p@ p#  p U p  0 0 ,4 30CލЍt10PW80 PnN8P@J8?00 @|| P{O-h@dƟ` TMQLpP >(00 2mU  !800%5 0 L0 30rTЍ0w 0St1S7 'P䁄0  0少0 0!00 BR{?Ⱐ0张:1S ZY0 0cP 0尐00o(0S !'( 0P0 0(00U P0尡 1 0C SY*0 00 P U 20 2(0} 0{w R!/*R$: pl 0800 @000S$04p<0<040 pW 0000 H000S$0,`D0D0,0UZ &P@ 0010EJZ㪠*z0Q* C00C 1! 0Cs0 ! 11 0 0(0  0RG 1S RN  RQB  ,'m 2 T  0zpM 'PF ' 0 QIY㩐J*yI Z0 0mP000s000 0 1 S0"1! ! {0!10CS`* v00CS010{/10 b0 4`600\0\ \b0 4D0D Db0 y4, tu ttt`tO-(0pM D @a0cPX0P P FP1uP0y1JZap@0 R 0 1S@10CS㣰M* 0Ks0S0Cs00 VqS10C1(0 . Ѝ@ Q! R b0 `(0p. 0  <PL qp P jp 0 0R1 S0C1ȁ2"b0 3Ta Y 0I 1p~P(00(0M QPEUP*0EY!:YQTQPEUPi*u00CY Vp崑 (00(0N1!0b 3u00CY*0 p1HPQ Y Q F%PP @ PA4PA(00 (0%0!0!0```@0 `p崑P j %PPe 1P0CS㣠 *0J 1P(00  %|0| |b0 J3(00(0 ~%@0@ @b0 83r<rLqd(qpo oo hop@-@PQQp $P 0 0S%Q $P 0 0F%ppO-P,a V0Fh  1$@P `Vp0ഀ0 0 apo 10CS0*S0ST P P 1!b0 2  H a1zp0FV㴠p1p 0 R 0 1Qp10CS㣰4*0Ks0S Cr   0Z0s00R10C1 $ R bP  0! 0 P$ $(0( (b0 l2m mlp 8lO-Pp@Q$M $00 2T T z400@$Ѝ(  @i @$Ѝ007ķħ0 0 `Ph  R ft@Y* P 0PbA 2@D @aT㴐: 0 bt@2Y:@I0Y0*0S0C0x  Pr 0pp 0BRs00010CS0O*SUP@0 #pP 10CS0*SP 1 ]1@0CS0*S#P #l #fT*TP]@ 20 2$Ѝh5h%hb0 1T #858%8b0 1 #Y꺐Ioᩒ #.`0 @0# PP 0 RH @`|t S9 `V #q,Z@ t@@DXA #q Wt 0G 1"P AᴀW@DT@:b0 .13#b0 %1 ^#s Z# "pPH Pd D3D#D0b 10@W1 @t@ @01p 1 0@1@p01-# "P@ Iy 0  # "P 0wd2d"db0 0@Tx #T z200m ` " P_ ,p 0R X "aV@D "a0W! @0F 1C"P> VR  B1r T 崠0@D1 %!0Ist0`崠1 加1 0` " "P@D 10CS㣐:0 b0 X0  " "Pkk di4iDhihDhDgTgdffefd d0@-@PM 0 0P Ѝ0 50 0cO-Ÿ JM M@Pč`pPg VW00?2$0S 0SNIPIT/ g"P 200P"D2 0 4 30Jލ Ѝ$ > 0X0 0UXS 00; Iw0. T:+[) P0K/S  0n0P00: S 1000S0I S1?00(1(!(C0 /QP PV# 4- p!10S X  \0 RK [ !P100W 'p x&P 1@om |G | aR Q0P:Q0Q:q0@-@-@@ᇞ $ @ 'p@-@P#+`P$ p@ںg '<0@-@T M 000 @P 0S  Ѝ8G & 0O-TM Pp`0H0 @8  8$(4PD 0,0`< @@pLp PP 䢟䒟䂟`p  @$ "dXb`%0# `!,l(a `& `zcna'b(*abf ` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah `猈b,) &`dL(bdl+`|.`lXpp<%cjgpl&`` `ga*aldH(d` &b() `b`j+g .pl\c:%pWpl̠UЍ appePU3 ᓜ @@P tЍf0S p#)0p 00  \0p@  ߸p +T$ -@ h O-PAPPEY0!Ÿ\M `T B000 0"3*S*s@? N: R\:Y#Y*W6 @s@ T0@P00W@@PZ%YQT!L1 0 T0 30J\Ѝ,!,1, ($ 0,@ 0 0-WZ @  -@ B 0 $ 0, T:YY p p0p l$ 0,YYW@3 pd oVVXV8VVU0O-00MpD`$ $0(0D0H0,000L0P0T0X0\0`0T!0 <  S P ^@# ㈱CP ^荐      @PF C-Z3 Z0  D 0F r P  P 00e @@˛P0 f0`00d X (0 0 0 30Ѝ n TTt   p k0@- 04M 0P0,00W @T d 0T T H0 0 ,0 304Ѝ0$ K \ k  k8A-$!$1 0HM Q0D00@P `$ @xT( 0TК  p` gV 0V  d  h X0 0 D0 30 HЍ$  $  ꢚ j   jC- 0 04MP`0,00(`@ $pW:T p 0T r(T H0 0 ,0 304Ѝ$  e i  i0@-,M P 0 00$00 @7T ` 0T P D0 0 $0 30,Ѝ0$  7 h  hH@- 0 0,MPQ0$00` pj@ T 0T x l0 0 $0 30,ЍP P0P 0| *$ U f g  gO\NA-@P` Aq08c8q0P00P 0p0S   L| P&00  000 0S$1  @p  P 0  P 0 0 0\O-؁HXPp`}* @x08xc8@ 0 7 A@DT@O*t@ @0@0 @x@ⲁᶁ A@DT@I*t@@00 0 00 0XqpGpWwp=*W 0 rP@:각H⨀Xx *X 0 0@sQ: 0 b 0) 0 b 0) 0 b 0)h h0h b 0)L0L LL0 )x<JhJJ<J`JJ(IJKKO-1,M0CPSPᰐ0(*10C 1R0 0r0 0'*0S8 @p`4 0004 00 P$ W PP0ES%"! ~01P0P0P Ws*00CV 0@p P`Uv`n* 0Pu@S0SZ 000pVwp: P$@@Tt@*1@A(0  0R 1 S0"s0&1!V 00C01ő YP0P 0Ӂ p0C00 pV@n* ⋰ppR V @Bt@Q񏐮uka401 W00:!00Sa*00CV] WPU:00 (01 P0P P P h01P0 P0P ^TP   r` @pv`R@Vt@@Tpt@A*0 S10s00s01,Ѝ   r   rpG P$wpD 0  0}(? 0  0s( 0 b 0i(l l0l  0_(`@pZHH DlFXDDF`0D`DtCFC-Mp`@P%  ~PP 0!0 000 0`r 0@@!! 0 040000 00i@PЍЍO-M@ p8OPPc 01 0 0 0ءR 0ⲡ 0 1ᰠ0CS`B*v0Z5 ء H`PG  00 00 00Q㲡!0 P/ 0 0<0 00! p(SVp@PЍ 0p!0@PD D0D b 0'6p 0A`AtO-dM`0匀pSFL0H @(804 0 qPUp XN*1$0Cs0 11 " r  0 0(0H0LPS a,ZE 0)  ) )$  00 00F 1pP% `V 0`0v`0CdS#U  HLp  ` PZ V RdЍ0 0封10CS<*0S00000#P `V 0(p,0 000CS?1!00 0R0 0  00!0VS00 HX㨀*x戀10 0 \XP0TXP2/0  S  0 00 !0 00 0 궄HX 010<0qpGWpH*< wpp0qሀpG0wp0qqᰁpHX㨀,*0x0,0LpS\ (0S  2 0 pPB   aZE P 궄HX 010<0qpGpWwp*W 0 0 sP:<1  刀0C s0 11qpGWp*wpW 0 0 sW0 0,0LpS VP  P LdЍ 0 S10C$s0 11  R00000 0H0p 0 P 0 0 0b 4@p00s H R jcHX㨀<*x0V* C``F Y0,01`01(p@c` 000000 qpGWp{*wpp10<0@qpGWpf*wpp10<01b 0%8P 2 0(6p00S S , 0 0Hh!h1h b 0a%L!L1L b 0W%wp&,!,1, b 0L%!1 b 0B%p00b0 $7%0!l 0 q$ 0*% 0 b 0 % 0 b 0%yeW@@$޸888@8T88,ּ78֔7749h9< 7<7P77(O- M  @pPPd 0S9 2 @0) 봠Z( Q0? S   `PL A`@DT@#*t@@D @i P"0 0RZ @0`10CS@;*t0V 0 Ѝ0 b0 $0 R 0崠 @T Ѝ  0崠 0R )P 00<0< <b0 g$ 5(584\L4lO-PpQ`,M 00 VV 06J  (0`FV񏐑ea0FSY&00@,Ѝ(0VP ,0`1V 0 `1 0`1 Iⴐ0 1H @P a`FV`:趟覟&  0b  # 0 a`FV`:v` 0b`  #1ᰑ0I`1Y婐: 0 b #1,0`1S  1`  n@P 10CS0:5%b0 # @崢 @P 20 00`(0r00@(0帡= ` 2@ ] 00,Ѝ0SR 0SO 0@TJ @崢 0rp@; 0S "0!0  @P* VJ VG V(0%Y]Vi ` V$ @P 10CS`*0FsV @崢  f긡0(0 @崢 y Z@ T @ ⴢi @`Fv洢 c(01ḡ0CS㣐z;*y0ZV> ` 3V @PIya @`FV`: 0 b" @괒 @,  1 @P 0VSRa V0F 2"b0 "괢 @, 1 c@P 1ᴠV0CSz`!*v0Za V0F ``f1崠አ!0 @ 1 ;@PU1!b0 {"0Cs 0 B 0Fs=0!1 `0崠C 1 @P- 10CS`:p0p pb0 N"X0X Xb0 E" 22ѐ1l\1|-̠-,˜,+,++p@-@`PP 0 00(0`00Q(0pO-@`ൟM, 弡 pPJ 1p0C0SsP7*U/ PrU @t@ @ 0Es0P P 0%0!01@0 @ 0Z @Jt@ m0@$ 0b !0p 0Ѝ 2 @ TQ\10CSP*u0TQ0 0@p WP P ἐD P 0㼑 Z0  u00CR 뼑 Z 0I 1+pP Q0YPEU0P:434#4b0 f! " @QP@ Pr 10CS@t*0D@ 0PP` 0㼑 Z0Y s뼑0 Z* P0I 1pP @YT 1 @Dt@ @U0PE1:1!b0 !1@Dt@U @PE!' @10 < pPP 10CS@:`1`!`b0 7 #8 @' 11!b0 0PK{0 1 0p1pP01 lP0  p0Y!0s00 !+)(XT(h''&lh&|&&R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P L  0 0@ ((!0 "O-@P2M0\0(P 00$` p @ ` pP0%0g#" 0," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ°A-@PP $`?(p7 )z 0(0 0`0$0d0N0  Sh e  08R(@R )@ bV 08 O )8 bI $0A-1?`@Pp @f(X4 @ $0刁0$0 0@pG0( 0p * ?W9@`G?`@`(`0@ @T 0"< T"?pW (qO "0 "?W@`G?`@``"@@< T"`R @-/ Z@-@P P Ό 0 0@ (0 "R @-{/ 5p@-@P X00m]\`  0 P0 $$pO- 6LM0^o~?,00p(@ @,@@0@ @4@ $@8@HP $D( @<@P04P@Pp `( ` `@(P@P$` .w0` y  ,`0 .) 'p',') "!p00 "`$   " p 0%/$! p   !p 0 ($~o%arp' +lc  !``&``&!p` 0,p `Y$`3,0~?000@4      ( 0! A"Ġ0̌? 0#P$Ġ_̌#,,0#, ' IG) "@P@P@!W!IYG`%KD "@@Q< ! @@8`a` A0iAqNf`&@4p0yAvN@$"#%C$-Q "P8`ˠČ ,0`P0@0#<`@0@`Q `.0@@4p0 P$ 0 /P)Π+! Œ,+N /)! B(p`@$,#,@$ &` .` ` " ` .0@,b0P PX $ X DP0 0 0 00 000 00000000000$00$0 0,0 0,0(040(084000 000 <0 0< 080LЍ\Dp@-@PP 0 pRPQp bo Q0P0L0@H 0D0 0p@SR Q bIp D0A-1`@Pp fPX5 !$0 #$ L00L0H00H0pGPpP +WF`G```$;  S$P*$0 $UpW Pq$0 #$$0 $W`G``P` $;  S$P*$0 $U`R @-/p@-@PP M0 E8R Ypp@-@P X00k]\`  0 PA0 $$pR @-P/p@-@PP 0 E(R p00@-<PM0AP@;P񏐽ndn<840PLHD@<84}yuqmi}yuq<84KJzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEl[x5P l5P 0P9@0ĠH 0P%0H 壍p Hߍ0?CP 0P0 !@0 ߍ00= @2S, DP400  r ,0Ϡ{000H {Yp l0 P@000H AHp DD0/0 0 !@0H .p HP ߍ00 d0 F0 y@0Ġ 0P@0ĠS@0Ġ0 d0 a0 ^0 [ 0 0 0 0 O 0 L0 I0 F0 CE0 D0 C0 H⇦PFL)H…P >0 *G0 @0Ġ0 0 x0 u0 r0 o0 l+0 i*0 f)0 c(0 `&0 %0 Z-{ {@ U 0 O0 @0Ġ@0Ġb@0Ġh@0ĠB0 - R xi\ Tp@t,  0 $0P P@0H A<`0pH0<0 ,0 @0Ġw@0Ġpܥ{G-P8M(p` {{9(J@U@W@V@Tn 0S?!Q 0S !Q0Sz Q 0{ 02{r"P 0 ! r R  #|:W UQ VPw  ` 0 " Q!W Up& V P`0P( U    V x! 00@`ψ 㷉8ЍV0 `,0S0 0 V0`W Up V P0`000 dP0SQ q0Sj Y @d0`0  V 4h 0 Ѭ р H , d Tp@-o0@T 03/@TʼnEPP 00@T 03/@T\Sp貉H00@T 03/@T$2p Ϝ X \ @-@M@P Ѝ{  0{ p P000 0A0  }LO-p@R M ഁУP `A80 S! 0SJ: K 0 Z 0!80S7  0Q?0 6 0 0 Ѝ 2  Z  0  00 0 P 00  }P00 2  P   P  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! {  PU p @PzpP pPO-Mq0 P0 pG 0  PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@5 P 0 a`F ) P@D pV: 1P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp 1` 71!004 t4PU 0<  R<<T@P\`0(A@ :0 <01248 Q!:0 S p<0<P#Pp01G=0(0 w@p40S(00S0!@Q0: Z Y @c/\Kc/G 0p 00S 0 Y@0 SR@T 00 R 00"00t'd7 0 2 30ߍ@2S@70< R,000 4`0`\ b,0(`4`,0(倀߂P 0  讆p (pV:` 76(0A_Wࠓࠃ604< X00So  0\ YppW` p``!XY0•2  \<Q(( Q )`p00S 0 SR@T 000Sq00t<@To 4Xu @ X`@n Z`D 0ST 0 QgP X^Y@LZ 0S,c/tp* Y3 0 SRb@T 000S $0S  !,0 0S 0@T` % y P0 SRPU 000S?00 XY@ @c/\+ p <@T0 SR@T 000S00c/\@ @ 2X `2 `0 R$SY`bp]Y``2 0~4P4S  $3/000 Ѝ200A- 4dpV:@T@T 0P0S  00 S  09~@P0`0dp@ B ! A-`M pᚚ@P0: St~PP ˅P@ P 0 ? tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0@ ߸ 0SL@-  00AS 0~O-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ 4   0 PQ 01 #}$R P0)00@000dS0  pq0Vp 0  $6/Ѝ 0000O000Q 0A00/0@-S@  R   0 =~0S8~p@-@PT @T 0 `pp@TP`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 !!!0 ?oP//@-P0Sp@M:Q !SV@Ѝ0A 0` P F @Ѝ`T 0 @00O-PP X 0S & % 0S" p@p" a,0T T 1 ! 3/PS00CS@D0 T,0@pVP ?0T` BB \|  i V`!  0 0C00`@000CS0 0T` @pQQ    D R ! ,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ ,03/`PY M 00CS@D0 T@0Tp   P @0S*V*  000P@DS*`A 0`V:|0P 00``F0 ``i ~ 0Y0C00 00oP  l 00C000Z` b 000YP sd0d dG0 & XH0H HH0  D00_@ 00[vvִp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 u0p@-@P0 R0 PSp 0P0, @{ P{p tR0 q R/ S/p@-Q@PP8 100S 0  R 0   p0 0c0'   0R0 0 P @P |0 0 $0s0 ,0, ,<0 ^ p s@-4aPP`p@M* W2 T: p pP0:*C/o" R  S L 0( 0R Ѝ ; 0 Ѝ;0t0t t0  WX0X X0  T<0< <0  r(,rrl@-p#p3 lS0lM@PP0d00B 0 C 00  $#3 0 d0 30lЍ ~0p0S, `y0P " V000`S0 rrhP0 L"L2L |0 0S$"$`@ }Pk 2 0FB0/Q/S-,+*)I'&%$#"! 83 )`00 5{ {4{ 00{ 0SQ pv 0W 00 ` `` `| |0| 0 ) g` Pֵ  4 pDho`Ϥp@-@0MPOy00TaQzV( bz0T1S Oy0T1STz0`: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A0@-0M000 000@>S@P  !0#00  :P0ЍM000 @-0M000 00@>S@ "0!,03,0  P0Ѝ)00@-@@0 00/ $-$0$0 0M 0։Ѝ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ t@-@p@-0@ ,ppPh0Pp////// d//1O-0pPW`,M 0200000"00 ( 05/,Ѝ辈@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW001 00 S0000t0t t0 *0X0X X0 g@xLh  DxD///O-DD͟ M00P0Q0S( X Z5 < 0 0 0< 00$0 0%SS  KS 0p  0GZSZXWUTSRQPMJ5~}|?>=<;:987643210/.-,+K)('&%&#" ZU  {HrW  ` P0,p` ,@     P  *  Q [: R  R0 Z ˄S0CV Z0Ԅ0˄PU*a 0 `CV`F[ 0 [04`V*U 00Gp! 00G S[      0 /Q-0s 00 R0 bp<p*WM 00G S4p00G S-p)p&P @T `v  ?0P 0CV  P b0`PBvp  xp $000qf QP^`P@ 0S  0 S00CN  P ( $ [R*  RP  BR BJ0 [4 R*DO p 0 0 000plWp p`  P0`,@, p倐p@  000  0p QP`P@0 ,  q QPu @ 10d0Q00 S 0 0T0`LV0 S B PF^5 0 @U  000 0  +0p 01p. 0pS 0 0(H5 00 < 0   pQ @#0""d e< 0p i S @#%:PXa`*aA0S`<$4&"j >0dU00`0d? *000D@Du0 O 000 0L000D0@@ 0c [  04   BR B  [4 R* R [!*  [* 0Zp˅  X  000  0g0 [0K0"2 0 0 30Ѝ0 0 / D   0 1 0 P F2 000-  @ 0 0  0 ;@9 ) s0 0 0e @00r  0@  s0 $A@ P0 00  0{0@  s0/ 0  0 0  00p0T0 0 \i hDCnm(mmT=l=ll`kldlX<@<(ktktkkj@-@HMwxxRx% |Ô0{ D   0  x{ 0cxxHЍ d@-AMT  w0000 00&xЍ@@<0@- 0 A0tMT0l00  w 0P0#0y @ 80 0 l0 30tЍ0@@ȗ mH l̈A-@Pv 1!01n0SPpuOPp ovp0Sp@-Q@U x3s|p u\01P o\01000pOvcwVxHvP //GP //gG-P`@>V%0VQ\@ 0\!R p Âp p "p O-PH+H; 0MM050,;@00eV0YT 0 0Y01'0`,4B 05@ d!A  d!. 0`11110ZP  LJ0@ʏ 0(S 0(S 8 R 00sS2 S S 0T( @8 R2 S S0S 00 S S SS@@ P `0 \_AP@ 0Q.0A#A'S? 7R2 S S00$R00S 0@0 S S00 @PP0S S 50P PPPPP00H00@06w_ 0R1 0IPe  PH1H0?:Q@ Q$10 p?  960@`@0O-4 Ep\ L` DX$`(>P>PtX@tX999P9@-@P00Q  P    $00<0 0@ ($ p@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0pdQA-pA@PT`QV0CM@P 0 P"P`p p``@7|A-p`@%MPP T  000P   li7<7\@-@@0/ 00(/000/004/00/p00/ h00(/H000/4008/ 008/ A-``PU 0AP ppT0APO404 0 ,(0 眪L"NN/-< <0  M00( $ NQ Ѝ4 45@-@P 0`00@0 50 AT@5T@-@Q q00 2 V 0 G-xsPp@M 0ㆧpE T 0S0{00 0  0 0$ -0{PP 0` 2* "Z &= " 2> 0  0 apq~ X X 000@f Mh@PЍ <R 2"00@QW 2: 2 (iP)0Z 2< 210 010010 010 0100100x100OP 0 R00   0T 0 2 13/pTd0-00WPP 0`2 2u00@Z@0S|X~ 2: 2p ๙Pw 2 @0 2D001800 48<,C-@`pQP M l000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH xP (0$( p 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ  Ѝ00PO-1PSM0:00 X1*q`I`[ p@ p W &0 9 P tZ 2< 2ЍЍKP O-MXr=*`00A̱PܘpP W [K DK@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍNKP"! ЍG-pZ RbM'*Q* U@0U @ RD0 l P X U 2< 2Ѝ@EЍЍG-P഑p 0@F `` I`!v` 0 !`!0 0CS @Qà>z0S0Cs 0 R 0 1P@10CS㣐3*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2~pl0l l0 T0T T0 < <0< b 0(p<((L(`d(`p@- @RP ` xPP   pPp@-P`@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M 00 Vu 2+ RI 13/p) 0 ! 2$  00 3 p`0 9/P 0 9/P  d0P 4Ѝp$ 0  rq0 P 2: 24Ѝ?p`(0 0,9/P 0 *Yv`G V 1 !0p pGwpI0`v`0s0抠G0Zp01`*0ಠ0`0p00xPP} Y```0S0`0F2"0y (02"0 Y0v`0``FVl*Xv`V \\\2 00 00000``FVK*Xv`> X 1 !r0XAq 0H0ppGwp `0`v`s0扐G0Yp01` *0ಐ0X0p0`0 00PP @ 00S;0`0FNЍЍ0 00 0 0 0 0 0e 00 0k 0$`t0t tb0  tLd xT0h(*0p00ᴀPP D0ZPPЍ0 P ]P 0  09 0  0/0 ph h0h d 0!P P0P 0H 0dfPd}<G-Ÿw?`0 (MR$@py2S:0JS `P P崐2S p 6 IP ZP崐7 Z1! BR9:0CS㣠S*z0Y(:101@0p扐0pH 20  2!0 0 $0 305(Ѝy C00C &0 pP202 Ⲷp 000 p  ` 0u,0, ,b0 az X D@--M0  @ Wh hP 0PSP000S 3/I WkYP 8 80 $0Q/ $0S/ LL<<<0 0R/$ 0S/ X TA-@T 0S[Yp`/XP0P@Q0@ @@^zP 0A/P n K&9O-@$M`j?T Gpܴ4$$0Rab (  |WpVՅBP b0@SFSCllllllllllll(8L\ 4>3 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$GI `3$d `9^$Ѝ $  ( ,  C # PU! Pp "P+^@PS= ` RPxB `  p  BR -pPG Q]($R0 U tWS UX,$R$ ^/Yp4 I+Yp0 W$RD $pR $R !]&@ $R $Yp P$R& U Q R  T$]&@ @ $<  ` &@ T `   p Up$R UMXp -Xp P  ^Xp U?@ PzX^Q0&A<&2-O&90x&9&8[]&@T</+O-@`MpPh=뤳3#@ @kCp#x3B RP!GP P( Xf@(hPF  H@ P@`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @-` `Z`r`T LiPP   Ǹ`Pd 0)ȱ0V!Xq``pVpP @ % B Rd 0S U X h0S X  R 7/ P  R ;$ =  $ =  ዹP0S P㯃X [YQ0%.-O&2?t /+O-PyM`g<0pI00 00 Ep8 PEU( 0R` S 0 0 ivPePRP&GPCZf0@S H0@ SaP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSpp"U0,U PE4'U& ⿷ P Q6P/[  00010SU0Sppp C C0S S/R 8Up-0SCUa(0S0S 0 0 Up !巂 0: S UH/[0%㣂 U0: S0( 0 000JPU   @0P0 0P 0)~0P @/P050CS"@@@@@$ `^<   `000PP0S TT0Sq 00   B R,\ L` V `,Q$ /0 !P@`0 !P` J/R  S/R/   C  R: |k ` (: 3 0S S/R% 0 SR' T0sX0 0H!LR\0X!\R\ >X00: S h C C `T0: S P1: S ,T : S!  Sn  Sf V S_ S L0S !XPM,0SL YG0(尥 0Z Z80 S80p1p!ppQ zTP!P1: S 00Z0S 80 0CS!800 UPR X0|bS 0S !X0S !WͶVQ0&El&2% 7%(/+I_|&E9 p6La p?lO-@Pp0 1000C00S8 000-S30 2R(0pP EP SP ^, (URsP xP4 3" 3" 3" 3!00000C0xbP=|tz^@P4 Pd`rnT$32S D#DUSQ\`PBa1S bVRSn᭺PL2S$ 2"nU8\ d2 0S 000S 0%hP 0__PᅺPN000!S 0  J0S 000S iPnxTѷ:Ua`0:E100S S m!0`0001rc Pzh P Sb P{r r r&@2S[`P@aKm&PW2SwP0"lT XTL@p/ P= 2S 80"@\'X7&2 r4&9"-OU|d`'Y$3>'[T4H_L'ZX'/+&90&8A-@MP`/aP@c@P2 pttB =p=X2Q=0 q E - Pf Ri Rk R3 0!BSQg NPb0: S^!00 {!Q=p10 ER!MpS{wPePLP PPp FP rf@PȈȜȤȜȴȼp000p0 0p0p0pp pQ |rrQ  LN@P0: SpGP \r@V'\&2/+Q0 OjvO-M`V_|V4^MlrPp@` <pH20!1S U``$ NPj3 `[A PmP pPP `|A8`P {_@ 2` px̺d000 00S MP"D0 0MP< 00 2[` MP/  Q % T: Lp [iP0S T* `[`Lp2 `Q0 M&2/+-Ot J O-JM MP^3@rb !<p1 PEUjl0 AS U  :|#PiP fP hP {vP00@0@ 0E AMpP0: S(!   P` !?z0P 0Y/S / J>00$C`İPE@D(0p/SP/P0 S: jp  {PPUQ0m']&2rA-`P@M^ D 4 0y LP  L LP  L LP  L LP  KPlh3P0`3P P$PD3( 0P+( P3( P7( P;( P?P ( PP( P P8$@Ѝ(P (PT"㤮(0S (P(0S (P(0S (P(0S (Pq0S JP!0S0S p XZ`PPa D1R`-PU 0E /R .P(PU  ~00,0/00100CSdҬxҴ.P0$0u00S px랇0s00(?Ʂ( &9MP( VU% Oju)Ǜ'^d']A-@P\1`p l:p 00S VePxLP PP ``!P $ 0@`NQ0, &2&90&8O-MP\1p`䖟F 0:p 6@X/ʸ60S ЍfP WP! PP ` pRP dP vP iP0`0 prPxP ``0`0`$`aM [1ES <WBu帅PU =KP$0 S0Sp30 /@[*0/S /P0.S0S .S0SZk 4 0 R  @  0P0SP$0pS 0S@ 㦬`P PXĭPPL0S 84w50C SUdd4d(pddא0$S P P1 00$ @1 0w0S $ ?RR00R0SW2 $ 1  <0SX  NP Ϯ0 !!0C0 IP 0S' /0S 5S 0S 0S`JP0 0 I{X Pu%I0SnxP i0S 0Sb 0?S^ 0SɬL0S 0?S 0SS ,1 d000: S0S<x0S 0: SHP1 0S!  S/o" R ᵬP SKI 0SI P T0S P0?S L0S0S Q0b( &2/+lҌҜG-P@ZD/p8a a8p 1 R1 `0C@P iLpP vP0pHP .`0S zWP /P 0S 0S0`HP0.00S YQ0r&2( /+p@-PMd 7 $ 0G}HP}H@{IUITD GP00MCe/hP3 WP 30S S! S  3JI \3! d3 00L30S  R ,#6 R #!SR3 3 2 20S ( 2 20S i0S'002@T$ P0"@xB00CS00  0 < 0S60016 R0S 10S<} 0PR<0 01 10SO 10SK(xp1\1PML10S H10S d1 X1 0S 160S 0 @1 H01Ee(;:0S0F0S 00Ts0S0S 00G@`|P@To(xQ0D%( ( (( ( ( g tHa%%k(%0|( T sG-@MP SYS.2br@@0 S  $X "6pC 0 L1 0$P|7x $HPd -`x HPL-H8 HP4,T; 0DS 00S8 @0xL 0QD0@0 0Q)@0SZ L _PUta0@S񟗷8t@l@|fFP \t@@LJ P P BP 0@0 00 @L,L,0@0 00 0 PL>|7D0S hx GPT{,2JQ0&2&2LRX@ tBb@thm@tx&@T-O/+ntg@-}XEJO-M ptXtt-뚽@0o0C?o`DT20<$<4@@@ (3p$4 4 00S ST [@ Y`> Z``: (tRPGPP! H@ P,`hP dP fPvP$@``j1 00T 00; R4 : ᐭP @A0S #S!d2 00 0 偨`PXL 0pL#>. 2 P (Ƈp 徇p  Fp s0S<0 0@0050C SRH````,``,`P`[ Ὢ]@P0S? 0s$ pq-  p0 R qX  Pp P    3/P00 S R+$ pI- t pZh000S HQ0(9%&2B-O(/+O-M MP_Jq^nk_5005_5 035 G_<:p0 00+P  &pP pVtPcQ rA@6P񟗹`<HTH0WS }055050p B4pP P 0Xtȟ S  SSy `r050505484 P P 7ط  pʻ0"S erꐷ  p 궻0"S hL  p0"S P 06orp0z0500~00v01w 00 0s0g0e0c!%\Ɵ  R  ^%PS00 00055e46V0 }oGWPE2%R U%RpUQp0%0;FcP%5S 0DP80: S0550GSxU%R 2' WUz05Ur`³4P$040=I⛈p`)`'uPP }C\$iB$%`%#vTD00000 0B뀟PP#2 BC4CCC关Pc`0 ) 0S #Ppp@P*Sꮺ0#S  B?),D' &S0E?o2?  B `V4IPP#)f/;`uV `PDhIp00CS0 uP Pp PNU0 P00CS0u0 U0S:00S:0"2U511S)1S tPd`d!iB#%l+%UxIP 0T8P! `0U0w0 WPp0PEUiP@pP  f/0 ᧸T  -)x-P( Ds-O#&?X%&2(t 2)/+(&8 [ &90dm(PC-ʨ% 0P !@㐐`p@XPKH P)`00CS`0 I@T ЍX0 X @((@&8 lO-`@pP0dMԄԔԤ$`(`,`0`4` ` 01p0$@DTlUU!Z  0)tPcPSPPPPd @"nP tP0 aP` rUdU 0uAp0#odU4 RU SU" QU040  opUY [/lUT  (  $t@ $ Bp0 dЍ $f $ Bpo 8Y 8 Bp( 8⥷ 8IV  HCT@D$PP`p p `TEP 8 }Bp@P`("(!  "0` V!  P Q !6o0P04oTH 0@Sx2Gp/G&xX8 » P P% }PP%&`V080b8 pᨻ0PZS  ( : G 0`||Q-O&2ڴD~ÀDЀD{(D|%1D}BP]p/+ J &9araydict0O-`O-222 22223220PaM$0 00/J0pa?  Q2nPE 0000U1dR0 U% PPL0'p L#pP  PPL0'ppd2SPbAPX0: S0d2232d2oPPS}0 =_Pp0S H dzPGRP 3P@/PA1@P>S@'P6(0@<xHXP @4A@P(00I0000`P$@p \q:wX10J  Wtp* >W D$>B!140(S(pp>r037  7037h7 P 0@ Q S2S S 2S 2Sp 0s ` <>pD d2SM ?p W \1X! X1\!0\&2T72P7$$(G%T&&>1 SR !R QRQQS 18<4%0  %0\H2R0H2 1!8d CR`p|D|000   t 0 )     r Rn : TPh  [ /\  P/S0S R) QnQoQ0 )p"pBp$0P@1  /00,"($2$"02ލ Ѝ ˬP' ƬP" P  ChT.@; Yp@. A!C;P9pA$100 n/X`V  ,;p. 9 >04P)`CQښ. .a0C 2 0g(n(-O6&2Ade6 */+ 6&9(n@6(n8-%p5Q0(n0Ӭ6#66(nH@dz(n77&7L7uO-`@ṕ̑Q \)p%W㬑 0S 0S p10`VA 㞰P `噰0S H哰@`V-Z ЍyPmPPP fP !3n0@ S@p@@@@@@ 0 0000000000p@W 0AP Ze3Pa3P 9X9-O(s9&29O-4$M` A:P! m9P80pD刔刴00PPPl$(p3W00S 0S 0S 4oPp(4 a X' 0S00P 0S PY30S ЍzPOPBP4 FPo lWP@*P,l<D\00 *P2 $P20{00b 0 .Wp>o0` 0 P00e @P00^ 0 c WPV Q000M00J00G0 mV1 P :ff000001000-00*000&000"p 00000000P0SlbYPlW00S 0⏁P$`I%lVZ 7VZ((}-O(pPQ &2lӔ (#P_PPPP%PPQ(9O-@MP8@J0\(aPUPE10ųgvPlP,HP8 TP3@ ` 8p@-3  K@tq!'0 S # < <0@Zx em@ P !X!h!`!p!` 4"<'p(2 R Q!  R 1,0Q P,00S  0( @DP@I00-SE 80@0$0 ᐒ@P?Ѝ$0px1 48?$040P ?000R0Sp d```8,pX0S0S ~ 00 0@@`p @$@ @P Xn 03/p T( < -O~&2  [4D%P@-,@,@@#(%lO-@P8pM -,@G8 0f`^ 卼p 刼pd6 R0 l,8 /%4PP0\80\dpHPPPF U18vX(G` `F0G0`0IPHPU0  ;&pp 5pO005S 0(0,00(00 0H˻P7 PP%dyPzW`WNWU 3AWF CWPHe p  aW,e CWe LWf aG Qk'(%&%&&&%&&&%&&&&&&&&&0&8&@&&&WW$ lt  բ$ DR -@}K L J ~ dO {05xN 4Vt V ```CpM nH l$0%0 1 0 c 妢$0@S* cI V0 0`Pmp 00Jfp kW {m0G S=&#####&###'4b/b-[m2PH0SI0SO005S* L"PO0S U5S5 ( 6pH (0S  0C#P @P!@˵ጭp``@p! P! P|! 0S1`!}3/ 0↫t@ P` PP9@ P414!4i  HR #0 pBN P 0 Q 00 0S0 ӼpN%(%%@(0%(%&2 %X%-O%%p C4H*dn io i ium@-@P b@" P(Pp@-D@DP@( p@ (%p@-D@D߰P@(ܰ ۰p@(%H#H!A-|@|p `(Pİ,ǰ0`İ8P@弰@@4嶰,巰ɰᾰAͰ(%*\#*HG-`M4P[Ph5P0 p) P4T4@P DW5@2@P0"0 0200@ 5 Hp HQ \=5P S @  p1a 00 @ p0 @ t080<0@0D00P0 0 080$@P  83 HL@P@T@X@\@HPZ HV333 0400,0@@,0( 00PBpZPPUPh0PP 0/`Ѝ -[_B%\ATA(@d@x(O-p0`M(006外Fp0  `#p6V K pV0S`v```@@0V|P 0SЍuPfPFP RPg g@P00 0 0 0 0\10 0 0 0 10 0 10`0P0 {a0#S `P00 $M$00S 4 $A$00S FpP Xa0#S (UuP $&$0(0Sy  $$0(0Sl00i0P ᡥP,9q '9q "9 8` @f0KSwQ 053`33 C@QK 0cR pR= bRCJJK[[`0 0V9V 0V`, 808 0,3/8 R``W E@2Zg 2P30 0C?oR20S^ nX[J `00 0$,0$00S XV 0L $0S 0`0 00010S1 0S 0P0 0  Q00s  1000,0 028`3P8Z @0 $  G3/2`0d SR @0 #  83 02  @0 R T >2Pp(00s  12pp(0 @0 3Z G0U-O&2( /+ua(t?&@TO-P@`p'M M $PP !p*6춟p0@DT00SfT T!qJ@P Xk1P㈦eu1p`R90S*  XAP? a@PP񟗦8T99797999999997997978 8(8<5pP50S $PX _눥PX%000P00 0C 0Tp P  P P*P%  P p ڣP P( W_}p q]JPpq/R_00 000#0 00$00 0P @(WPPd8_ (uP(Y@X t2 POP(!|HP( (KZ@P `Hv0P 0(`p` qIP 00 00$0 00@P&Z@P Y@PZ@P Y@P hFP TAP H<P!Pf@ 4P Z P( (p` P( +e /Pm``ᕡ 0V@ dr0 0"0p` P!P1P,00S4ؠ00 000$00 0 ( y1p00[0Pa0SJ+S'- 29S!S@ 1Z)Y x\/Y`P'ݍ Ѝ 0^&2( }6-O96#v/+ k((@dz(Ade np@-P@;Btp@-P@3B1p@-P@+B@-5p@-P@!B+p@-P@Bp@p@-P@Bp@M0O-nMM000`4P+P 0~0 P RPG  >R~p> 0 gp@7x>?a0SH>D$RT$r R  $t ~ȥt00<4A @0<4x00<$ 0/p N <4 L!H 5H3`PEB@D4T񟗷A0G0G0G0G4ApG0G@G0G0G0G0AAG0G0G0BBXG0BlG0G0G0A$G0G0G0G0G0G0BBG0CCLCCDLDG0G0G0DDE,FEG0FDG0F|F00<@ġP} 忡Ps \< $t P @< m 0<$$r $e ]; `;$50 00 h0 | (;'0 01 00 H : 0 08 :  |:$ 0 01 0  n:(0 01 0  `H:,0 08 P0 x R:0,:@90S  P<: 000 $  01 0 .:0 01 0  |:0 01 P0  940 0c0 0 X  : 0 01 0 $ 888合@0S C.0 FPH\Fr崠P0@4k 孠P@e 8(-\(8@០PD40 t嘠PD40D4M T G 0P 0B ,000!0 0!8C1l7@u P00)7 000  7F:P吕P/ዕP p[0S` 0T40000PEU UZ ۣ zף0PQ 4S<4Z H$L40 .pj?H4LP4SL$H4R0l h&0-pP TC .p @= 4S@00\S 4E~G/KGLtHW00 4/>p5WHLt mFpP ?a[k MPP;d%LPPT%TO[W.p X1: S(%,4 $R ,@P%,SP$  啟P0IXZs4S04z?0$80Ap!x$,p = l$0vP$0 r0 4zP uP$,03}p,p40S0X44S@0S4 x2S "20# RPr 0T40S GP 3T#0S <>T4S\6P P3 2"pFx2ŸS L4H$Q*Zpp0 H$L4#"1 ^pH2 C  Z0- zpĮp~  0P 0P+ 㐢H$Lt?'"y4 S 0j2?0W0 &p04$$ST RQ 0 W0  +p pWR00R104Qf ;R040 Q$ Qq*4m(8ON&2-O#&9S(iE$&@Tj%X® [B0F(Td%(@;Mr6(E ] G 'eC^r$%Hh J OLH4 Q} QQ040S[R0[ 4S$hP 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,40 0 0Uu =+t 9+0S 돇p@) P+ 0d!t1>0]LyP=.X R04ʃ1$4Q :$4#+ T4S T g,d0<"t0z+***`+\4$H1L4L1x0<$0@ 0+pt⠝P Z > ⍝P┝P  4̄p   T4 w .0< H'O-0pIM M∹i4, pP_`9`4pGs04WZ h  Ya' 4S<44S$$ 4R0(c*p  h+p  4 SP,0S x 4~$ tZ0 0o 4r Q $<1Sf $4 $Q_*`XZUCUDPEUU8TTWTTTTWTTTTTTTTUUTTTTTTUTTTTV(TTTTTTTvbPEUUV\TTTTTTVTTTTVTTTTTTVW TTTTTTTTWPTTTTW6 (,&p00( R0C0s0SJ p :X044s04?0 00 d0 p610 08 ,V< L0A" 40 00 0  0 0: ;  0 0: ; 0 01 0 0 0c0 h0 050 01 80 ,00!0 0!40(40SW00; T$I0P0<$Wh*p 4S 4)PP#\$P`P#D  8(@P,4(0(00`V Z 00p"#8$p = 0ٛP0 r0 4ݛP ؛P#0YW3}p$p4S80S4\ 1S !10"< 0S,⶛P 3"b~11  $4 1 "&[pT2   $W% \wpܑ  P le $$t 4r(4S 0</?0W0  $tR $4%S 4$КY0; 4 440 W0  Q(pVpW㵚Y0:S $R4 ĔS  ዙ \g(0S Z _(c,  0uኚY0⫱ペY+(ŵ-O&2%(%diEœ;r6( 6 ^ PC^rG-GMM@ph  p40@D@DTQ@@5P^ ] ^0^@] ] ^X] ] ^l] ] ^] ^$^] ] ] ^`x] ] ] ] ] ] ] ] ] ] ] ] ^^_] _8_X] _h_] _] __`] ] `8`X] aL3n0403003a3((t|3 p0,@0p0H300083080(030# 3@| 2Dt 2Hl2"d20L0`x2"XX|2`"zP8`2@"rHH2 jp0V 0 2`W62 Xp0X01!N$ 1F`p0x0p0X1 h(p`P%מ  );`vqP˞0 S Ǟ  0`YP  TU0S0Sh`lP0 A/P"0 0 @x,xYH@P3U GލЍ &2-O,˕ˡ˫˷zN~6%O-` -PMp L`KP'tDPhU 'P&p4 ''p$ `8P $|pP$ 0{@{05S = 3# &P, C@4P`gdhhhhgdhhfThhheefHhfhhhhhhhhhhhhd<hdLdhdgddhhe4hepe|eeeef`hf<g 09 0 Pg P P  Q R xT 0;8;08; 00H2HpP{t" P R  s{ r;RPT P- P R / < _ 0< 0: 0 5T@0 010@;M 0@0 00 008;0T P P P R / 0P. 00~ 00{ 09x䰟 PEP ` PR |ꬰ P P R @R dmK ?A@bMR`)Pׅך׳G{?z׺&20Nj؃ؕ))Lت-O)ح :) 0$; 000H L 0P 0 000l ptP  P R  $S0{{Z%PZ<;Sڨ%PS0gPX$ <W@G8 ({*<0(+R[X= P10H2pGS1<+0X2 10S (Xp<0H1 ,(d;2S 0: 0 >00!u 028PZP ̌p ZPUpȌ 刀ppPt , <-SUp AeV|&2Q0)L)4٥&@T)x(n4S)4)`ځ)ڢ)%% H)) 0@ @ |0 0PUfPh 0C Se0400000,00(00$00 0000000000 0000000 0L`0p 4RC PPH*@PWC *"n8;p 00 HL0v%p 8; 00 L0h%p 8; 00 L0Z%p  8; 00 L0L%p@ 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;P+2(bÚP L0%PW;"0#10@00 0`K`QH `    ` 0$Pt3K0S PP K0$P& 0  00 3$Pd c%0 *Ss``0 $P`4$$!2P(104d 0`[[[[,Q0Q4QPPPP/ךd<;SʔT$>@ 1Vz{@ k::˟S$@ 3VVz{@ k9I:`"2RgdD' B{ @`30S 0 ' 2@MHIN2 X0弅#pU00 @+@0W0 00D{)PT2 ppW O P $2($PG`AQKY $Ppjc1{{7 (H{CAZAG@8HIN-T{({*X"@T7 0S3 K<'0xpT0T00p0p+t"P z0S 6 o#t;<000[ Y0 0 |G$  (d2"SS% 0 " @$?6C-A~8@@)P))*&90ٽ)x))EJ&9S)%< `I1 @S! 2R`2p0Cs0WPP0dR?L!L0 0 d20   O  `0/0h0lp0h1{{7{{{3{{ {  M@ X9: #Rpp: h2Y0@ph2pdb |#<0 00H 0"2 0BSA (SI; C 0;g(W@pCp 0h 0S heY #,2嶐! 0I0Css0S 0I s0r 9( 0 1帑;    0; $( 0@0 0! W |_#<00 H 0@0p0V 0 0D0$1 J 0 vP<0[NW D0 00R ZW |,#<00 H 0@0  0 I0D t'ppl0Zp'D0 ')%)Pxۣ)x&90)4(IZ^zܗܸ0CSx0yLyp{{yzzDzhzzz{ {D{h{0 P Q9xxxxxxxxyy yyy$y,y4y<|'r'0ߋp@0ntplhd`\XTPLH0 PO (0 PF Qyyyy8'C+'0 P' '0 vP| '0 lPX 0 cP Q Q }{0 QP {0 GP 0 >P 0 5P 0 ,Px 0 #PX 0 P 40 P & 0< 80Sg AS S W |!<00 H 0@0=p&H &?Yo݆ݖݧޜ0>cޅޱ1Mq{ߋߟ߱ ) )PSIZ0KWI7PU&DDD0J0ZD0  I)0K9+ 0KF E QJY0KWD03 +Y tP WD0 !&D0J C 4 ḛ sW.\&pDD;D0I0YD0 0J#1 K#+ % W%O-M`P%@0L-S@RP. @,4 t kp+40SP a`F0pP[P/PijQNpGK PN  MP@ \3pC d0@Shp|L@20SfK@HGG 0g 0p Y 1\_MZ'5F`PlP`0b 2 R V o0 S J EU+ 0 [!0!00X  p4 ,pc0S}Xg}` pQ0SGP0pp@@ 0L Vp&}`D*4l&2 1/+c7uQ0L *O-PAM Mʭ@`ʎ|P pĎPh70dW00-S% @ P ᐏPL@ p0K0\Z G`F0S0`@DDA@Dv  p .6p0StbLpPx63 Q \ PP -00 d`@Z-00  D0B5S񟗊l`0l 0P000 00S KP}K0 0wꨄ4P K00i00fd400b d4 ^0S LK V 44 R00O $P H  300S P60$010(0.0,0+t0C?o 2R0S0$0Pㄔ`ごP|D-v04"@DT 3a00@`FrS; RS iS/ #!tS xS:뜒+{0p 0A00@00S   0@T0S < 80R0B(0/S ;v(0S 00 @>h{0S (0S p|1 0h0PS 4L F(0S (0 @-6IZk,P+( 0 Pm@TZ)*@&2-O**րL%i!:&9bX%$<`?&90:L OjN$e|;O-PLM)@pPph/6 p\?,#@DRQ0I 4%@@0SRJvP cP SP- TP0(3 LP d0@S(4LXd0D003030800H00 30$30,3PP061  (VUsp0+Spp*h6 000 ݱ<0 0/0P& ! &T00 s000p :XP00G00Xpኈ @Pd@ 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0Bpq04y 0Q0TPP)*E'JZp3V t`(os`F wP% 0SU030#:U 5%P P p2. XT&P6K/r0 43TvPS0 0 S/# G@u SPE X: Pu"E0<6SR46SR 0&2RRPp2 01u埪6S 嚪R P0W0`W 0 {Q  u 0K/r0B ,6S m/2`P  @0PQ!.Veku]<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @= 믍 @r멍@?|0P}\*&2I-Oj`T*h<*4*(&@T&8 `7cD =ak*p>[[S1A-Pp`IHM p10PEU* HP h0@ S SL 8HHIIl1d1T1 P1 `q 4/P p 1!aqTPP C L<$@@p3@(@ @ !OP P0S PxV FP XC0 0000 K&2-O%6 **/+ tyU tC^i0G-`HMp0~',S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 a0@S 0@PxX 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTPPBV ДY 000 0HЍP PPp  B0S  {0 1`PMGPV qh V `Fm*-O&2%&90x{*/+C-Mp`ˋPPF! VF pSPU 6 `V V 60S aP& tP8t6 R l&   p@6U@0V`F V"@T ÆP  徆P=PV 0S A@D P`V  tP9@PA@3P񟗹,@Tht zP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03ʭ $0S=<0S800S3@3T P0$0:(U 0S# 0S 0S`V Q PF zA0S 0S 0S`V UUp؅P `ӅP \΅PPEU8P U3 UUU  U4 @U U0`0 0  UQa<PK+0000 0 P   $0S   ,ppqצ*`@T ͦ 0 s#&  @ #4$P @NP IP`!T!*&2-Om^ !&9! p/+ e I"b!!"""(G-@PpMaM Fp10S QġPE R ލЍRP fP74pu+P` @WOJRVP1 JgP/0: S2  S)J ]P0 JN@n` 04S00`^뺉0S N p DJ 3PJ ,@PJ0@$Z*&2/+$w$$]C-PGMM R90M2$= <8=8X@8DX2Pp=0D80l8"=`{C0D `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8 PP   tP:? 0?\L  P< <@P |P @0P XP 0Pl ShF0 lxP4:T{ |qP :h(s\hP 9T(X(i8 e,埃P 9h(g40GDS4 ,\H@P|P` P \h 8(V*S h8X(T(N T8,J8 8P 00S= 8 >8, ,, ,0 7,, 7H(([$8p[7, | 7L(w+Vs P:?@ 0 D7P(74w~[pP78x7 7<( 6T( X(L7 L6P 00S 70  6t(6 7x6P 00S 6 6@p s68p:[p0⤖80 P 0SL6t pW 8R*p(K+ 5,0 0l5L(5 [` L5`(d( 85uUW$5P հ@ y5?Q4KGލЍx5| p,ߖ0D\<<0P 0S Z 6Pyy@PxdD8SQZ@4 ZP r Prt TKCt LKt EK|t >K 8K\X$T2KPL$H,KD 8&K4 ( K$DHVNDNNNN 0S0SA  ;@288S2@P R<S P 0S IZ FZH2 uN @+r P: B?\5 081<Skf+q P*RNb0:vP 0XP Y:@P|9N p6N LT@PH,N@ )N0@`,rvPP0@P`5p@+q0(@0@000,`40U0 (P<P8[,8U0C?o20SP ,R  \0,0S Y,8S=x m,8S Q0+!@ aD rD D"D()D81DfDkDu CD&8&90E&2E V pD@DD-O%D+)<&9DEe5E$E<-OEREfE|g J EE00000E.*EFC7~F0F0 p  EE+.4  F(G-P` $E {h{塅ӀP03dp2S l PO<UXh4zPH t各9PB/PE0@ *  pX40pEWQU <4 000`P L,pPE0S#3 4# 3PeP ;vP303 D`pd \X~PP304jlDi4S 4SiP  ;\ P 4SqRhPl l e PnRy,1`<01 1> 11/΅01<2F01$1g(㄄#2Rip`d Pa Q1s0S elD^`qЁБgp00o V B/o" R hpP  \h=`S 0 0000 lh1s0S*v`#RS S=?o20 S S lh1s0S 0 S  ` S S SSgix+XXjXX~&2&@TX+X gVV&90X%,a%8XX++0 ?<X]XQ/+&@LQ0;O`@-@`<PmP 1 q px10SAQ\1PI 0pD1C@PP 0KP 1 nPbP9P0P 00@0c0@ S ˸˸˸˸˸˸˸˸ʸVP g   h0  X0  H0 T TTTN n2p0S'+_x&2"!%` VT&9_DA-`pB,40HXH r0S z@P {@|#P30# 2 -R R -R eB kR R|# QiR eRX#P#sPPPEP IP -Pd Q@"P8888888888888888888@8p8֠8ְ800~l2lByX2\H20P^Up0Sm ?SPPi20`^Vd0Sa ?S``]10@^TX0SU ?S@@Q1100FDꔱ<00 (0\  `0 !1R, S` \0 N 0Z(, ,An^P  ACY  w0S%   S`0S   Rڰ1\0 1 ,00,O}-G*&@T1&27=gNw%%%-O-L@@th,O&9݀tgO-@Pp`LM @  p1 UV P|p  T7gP uP GP000`0S\@0T PUP   p  !47pP0P 0S U7 p U Y p T p V 6 p|7PU sU TyPL@@H 0q6 A-O&2H/+5Z Oj׳70O-@ll%0h5M@`5`@X5b P5p@@D5b/~4U4@T0$%5%U5%500xP]e P P PdkmPC DP3 fP5 CP6 奭pP7 rP (p"0np1F0[\18\1`0  F1|!1hQdaB0  Ϋ@PwX1j >0[ >+00.  \18\1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯4<444T`lfP j@PP񟗞44X44 4444440=0P1`<?&`F@pԌ}X1F3X1Kw0000q0X1lH ۘ@fppcph`0 P ▪P X1P ˜0#P\ 廘0[ ê0  2@P 0 P rn 墘84'0 U00\1 !pxx  1S ᖪP K7m k g ` :0P ]X1@ @ Lp  p Ě( X \10 QP819:X!p*\1 d pDT 姚롘P)(< $\11Z RuPPY* 9Y) 9+ 0) X1 P{ P zS *{ 0 09zpHx  W 0S L ; PQ x{0S(  \!X10X1808"/0  ⏋\!2sP8"/0 灋2\!s"/ wp= \1`  ⃋P%D\!X1 0X1 00 87p 137 ݙ zxPtwht 00 7וp{0S $ߙ\1pGWz0STݙz0S z0 S \1X!8 0X!'zspz0S &|嵙fpz0S &H娙 IP q  垙w妙tw㎍\1 I S0TpT9 W_p5 P <\X1A>X10L1 00 6Ldpwlqs0L1 00 5LSp(`Op '_p P X10X1Q|P)#dX1 @0X1 pP  <8\1 X40  +p` \!X1 $  $$ 43 ˜p   rK♵p 00 4p@|!R\14\11  P+p0v!瓚P0!  R!00|!R00SRX1` ⋍\1 0㌃匓 Q01X: ~  ͙\1  k1PU3\1X!( ; W A? =% P ;1R@T 0S 0 @寕@ 0S   0S ᩋ0PpP P ( RW  R   0010 S   0彘PUQRX1@0@k屖묘`\TkX1$  E E E!. I I I&"8 ER EQ!/&2Q0 I C,-O C C$ C< I I!. L @@ J I J c]D Oj6!.4 J J1 Jh J J JM L J"X J J J J J K K! KG K^ K7 A Ki Kt K K E E E K K< K L9 LS L K Lz2+ L&90  Q/0p@-x@0Ppp@ P T04p@ 0 0$010^@x,]/O-1!bM0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $[w`  $; 0 0 +Hp0Gp( 80G( Gwp` x8_S0؀00 00 P00 @G0 sP x8##[`@*sP0 l8 40GPHU P0 l8!wvH@vH<0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/uuxud@-M @\I%Ѝ8h  0S/ -PM00 0 p 0 S 0 0 Ѝt /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ 2*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@1v@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251206NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv6hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d #c$a [0iƔhllr(u΄΄1Ny0ܨܨZt o` 'DT 'T < ", /$ 6D== '>><>D w>d>>> XRp .\ X:b@7~D~( `{D M aRl @ʄ!ʄ'ʄ~Dp.pJ 38ؔ %? J  pushdnepopdneo`I@@p `0x@@$dQ  e@ P@@?N@@$unblock and -DNO_CONV?@xH\100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkՍ ՙ կ&&Ҡ"E3ZG\v֌#֖ ֖_֨^֨F֨<֨>ֽ?PATH= ® `t fEdLEscYEmREl`gr  JponwEv b    EOF reading here (<<) document]Plpty~ `QV[`f :݄ }-+?= n@ o '@ݗ`KݣݚݝݠabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'( 0T(d1\(P1b(8l(0z(0(0(0(0[Z_ zJ XCO _` <\ %T " m (1V'*#  ! `Kx                  R OjJń8 JcoDKDyxOl)Us `+|ZJd]tcgmۄ &__u %@}4p4K܄Vë-l1NDu    Z}zh64W34   #  &  $  ®: !c0<tP<;';<|><=>= d>; 3 >K=>V? [>x<;t=?>ѣ>"#!3*#)31203736#W^ @@fGO ^@eWlZ3r y C$CC$Ca@@  $@,4 < O@@@@@@@@@@@@ @@ @@@$)/6>DpJQW^hpw~ @@ÁɁρՁ݁ #؁݁+):J{,?JSj 0y &,29@DVJ`PpYw12<FOVelry~+1 '&-6?HQ\epu| 0y &,29@DVJ`PpYw12<FOVelry~+1 0y &,29@DVJ`PpYw12<FOVelry~+1Qq'''((/(B(i( ( ) )4 )P )r)))/)))**?*S*h*~** *! # $*& 1 2*3 4 5+6 8+ 9+9+:+3;+M<+k=+@+A+B+C,D,5E,KF,`G,`H,`J,vL,M,N,O,P,Q,R,S- T-U-V-5W-O\-Ya-tc-~d-e-f-g.h.i.p. q s t u.v w.%x.9.U.f......//3/O/o/////00090Q0n0~0000000111 1(1K1^1m11    111131222!2;2K2f222223223 3)3A3_3z3333444:4p4  44 ?44{5 55D 5e555556 [-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] Z ' " ^ 'w12<FOVelry~+1returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read AO%@qT%Y%r\0%@@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-qyyyz zzEzNzwzz% %@%@w~z~~~&~;~M~a~o  $ 4 H `w12<FOVelry~+1z<%@q'''((/(B(i( ( ) )4 )P )r)))/)))**?*S*h*~** *! # $*& 1 2*3 4 5+6 8+ 9+9+:+3;+M<+k=+@+A+B+C,D,5E,KF,`G,`H,`J,vL,M,N,O,P,Q,R,S- T-U-V-5W-O\-Ya-tc-~d-e-f-g.h.i.p. q s t u.v w.%x.9.U.f......//3/O/o/////00090Q0n0~0000000111 1(1K1^1m11    111131222!2;2K2f222223223 3)3A3_3z3333444:4p4  44 ?44{5 55D 5e555556 %@%@T% @%@%l% %$@|%0HFS0eC1UFS0eC !haHdInotNeedEFI*s(ҺK>; +7$Qn|n֏- q+/;Qn|n֏- q+JTQn|n֏- q+ajQn|n֏- q+{Qn|n֏- q+=Gry=iG}M;t?WmCĄ 3KOOyD¢<#*=(РD3h& \M}- ޔM@jy֬+<-ıܹчHM-ܹчHbIZܹчH '|I􍂱ܹчH "I􍪱ܹчHI2ܹчH1LǠ6 %?aƝ'S@ۿ )Ѹڪ1*@ە )Ѹꑘ1ۏx )Ѹ_%<@%Dbackupstore_gptstore_tbl %H@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus Bprintallmaindo_setifpreferencedo_setifcapsiz%riy%Y%o% [c% ^!%Q%d%@%p%%$%%%%% @'3?G P0Y@bkp Tu  @ Binit_current_mediasetmediamodesetmediaoptsetmediasetmediainstZGeZp Ve V Z V`w@we Vpmedia_statusmedia_constructor>G٭N%SG٭N%٭G٭G%,QGQ>%HPG;٭%dG%paddr_match` `$t`L`settunnel %%print_link_addressessetvlansetvlanifu%z%t"hQ0setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanNQTWsethidessidsetapbridgesetiffragsetifrts}%|/%%0,%/%./?x *%%0%%4/p% X% X? *% Ou%t%P?==%Аinvalid major numberinvalid minor numbertoo many fields for formatffs@   CK } @   O#, > FYf|ë @@4 Z ' "MR ^[ '` Fdh p   > G -@ "'. bnorripbgensbextattbnojolietbnocasetransbrrcaseins p   > G n@ o -*o@ @&# p   > G  n@ o -*& @o1 CK@  p   > G@ p   > G n@ o -@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror p   > Go -@Z Vu @ b8 1@ @&QW`jt @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv - p   > G@&# 7o:QgH[|Bw%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@+B ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataQ0"\  H,  ,2 Q0,0 Q0,t  ,  ,  , 9 D,T c r,1  a, Q0, Q0, Q0,z  ,4 ,  , Q0,  ',\  ,3  ,  N,4 N,0 ) ,T 2 ,S @ H,R c n,S  a,Q Q0,o Q0,n  ,|  ,{ Q0,z  ,|  a,y Q0, Q0,collect     a r w12<FOVelry~+1NAME= ^ "` Zmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsw12<FOVelry~+1 edit_fs_type_ext c | L L L `` a oP ol1L Le M@u M0edit_and_check_label w12<FOVelry~+1disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz X ` , @ D l 4   @  x @  ` 8disklabel_change_geom!P!#h!*outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default,8,,t,Tpm_from_pepm_whole_diskgpt_freegpt_create_new!&`T8dt` llLP(T '1 +7 +7 "  ! <qyzEz zw w1-! ; +7$Qn|n֏- q+/;Qn|n֏- q+JTQn|n֏- q+ajQn|n֏- q+{Qn|n֏- q+=Gry=iG}M;t?WmCĄ 3KOOyD¢<#*=(РD3h& \M}- ޔM@jy֬+<-ıܹчHM-ܹчHbIZܹчH '|I􍂱ܹчH "I􍪱ܹчHI2ܹчH1LǠ6 %?aƝ'S@ۿ )Ѹڪ1*@ە )Ѹꑘ1ۏx )Ѹ1 > > >1. >A >.37 > > > ? ?mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new!P!+!+tTܼ4\dT|ʹL0 ll0ɐ4lҜDTlmbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************Q0GGGGGGcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2Ԫ- -dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option CbYcdne Nf Tmg OFh Oliaj k Tyl [cm Tno Tp@q7r Ts TZt Ou T Tv Tw Jcx Tz7y TA TB TC MnD TE TF TG TH PIYJ UK U L4M UN UO U"P U/QpS T U7U UAV UKW UUX U_Z A1 Un4 Uw6E U Tf|~ U} U U U U U U U U U U U U U U U   RH V  V [ R, V V& V0 V= VG VX VV V_ V] Ve Vr W] Vx V~ V V V S V To V V V V V Vdefault_configread_configrt_compare_protort_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initڽW [P I [W [a [jj Ouc [uscript_buftoenvV VX U  V_ [Hmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os ] ] ] ] ] ]if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp gE gP g\/ gkdhcp_bound gw e g g ]R e' g `k gdhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaqqqqqqUVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B k,L kl k"  k( kJN k.,L kSl k4BBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ kC&@\ kG!J!R kP!N!R k k k"  k( kJN k. @ kS k4"H"D"@cs_pathlX kY bc_base_maxQ0 bc_dim_maxQ0 bc_scale_maxQ0 bc_string_maxQ0 coll_weights_maxQ0 expr_nest_max Q0 line_maxQ0  re_dup_maxQ0  posix2_version Q0  posix2_c_bindQ0  posix2_c_devQ0  posix2_char_termQ0 posix2_fort_devQ0 posix2_fort_runQ0 posix2_localedefQ0 posix2_sw_devQ0 posix2_upeQ0 stream_maxQ0 tzname_maxQ0 atexit_maxQ0 kt k k"  k( kJ0N k.H kS` k4 !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%KC00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'B@;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54<Ҳ؉9I#ը32D=%[όh(doC_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<_fdopengetcgetc_unlocked__sflagsfclose__srgetlflush__srefillhash_seq__bt_openNEXTINDEX__get_bufnewbufNEXTINDEXNEXTINDEX_mkstemp__gettemp0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzVcrypto_prng_bufQcrypto_onetimestreamuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`_arc4random_addrandombt_rrootNEXTINDEXbt_psplit__bt_splitNEXTINDEXNEXTINDEXj ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHO_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEX"L"X**+$+ 4<NH'`{,P<X`d l LX`dlp x  ^                       ( 0 <K x? z   , hb -   T X>     p  L  >   \T    :P lh 0y       $ <p| x( , 04 8H ,<,@ hDhH LP TX \` XdXh Xl X) t |       L .  ]   \             $, 0 04 0<0D 0p|     $(4<DLP\     $ , 48!P!9!<!!!\U       f    !!f!x!!!!8**stngXT"8nmbrLdict;A FJ:H99:<:0 b **dkeyI@9#&H&Lg`#|dataXPVHXboolchdcp!!!!arayiomhg")`|(g`#d33383D3`3p33333344 4(44 4P4\ 4p4| 44 4S 444555(5L5X5|5f5AAAAAAAAAA$AAA@BAH\<BBBB@@@@@@@@AA AAA A,A8A@$AHAL<AXA\AdAh\ApA|AAABBBB!BBBB!EHETEXE\EdEhEpExE|EEEEEEEEEEEEEEEEEEFDFFFFF F$F(F,F0F4F8F<F@FDFLFTF\FdFlFtF|FFFFFFFFFFFFFEHFFGGGG,G8GDG`GhGtGGGGGGGGHHH$H<HLHdHHHHHHIII0IDIXIlIIIIIIIJ J J4JHJ\JpJJJJJJJKK$K8KLK`Kt!x\xt0hߤߴDhߤߴ4"d"T"x"t8(TVVVW W(WTWlWWWXX X@XXXxUT8(T8(T8(V68VV1VVe4e<eLeTe`ehepeTcl_^@^D^P^T^t^x^^^^^^^^ ^^ `^ __ _$_( _<_DX_X_l_p__________5$___`_(`^`b `` `4`<```h`x`|```` ``!`a"aa#a8a@$ aH%aXd|&cla`'a|a)aa*aa+aa,aa-aa.aa/bb 0bb1b$b,2bTb\3bdbp7bbcbbbbbbbbcccc c<cDchcp#a8c$ c%aXc&cc'a|[(cc)acddddYe|eeedeZ\]] ]](]8]D]X]`]p]x]]]]]] ]] ]] ff^^ ^^$^,^4d4d<dXd`dtdxdde0ddddddddeeeVVVVVVpxpxV%hC"""""""!F%%%$% z{{{{ {{{{ {({0{<{H{P{\{`{d{h{l{p{t{x{|{{{{{{{{l{{{{{{{bl{{BBl|fffffffff||$|,X<|P|d|||||||}}},}@}\}t}}}}}}}~ ~~0~P~d~~~~~~G~8\x ,D`x(Lp$8Lp 0DXl  4P| $8Ldt"x#le#te#|aH#U"%(8V8V44V?V9 V5V=p"""fffffffffz&@H~"(%qD-G*-F&1-G-Oi -ߨkHh8@&A&:-&=&> -;%q -Fx-O&9-G &2eU-FAa-\ `&=-&3<-ޠ"H-X-4-d- -F-F-<`!-;}&@L%qD&1-F-F-F&2-F-O-'-O-&=&2-;--F-q$ -G(&4xr-;&=&@T-F-F-F&?D&3 --Fx-&@H-;"<-L@-F"&:b%} s(&A ^t!&;-G$-F&8-F%d-{%(-O&@Pa&Ax%&U 'W HOP%H.~ cbnjjc fvh‚k‘l¡m³o¿oppÀpqr -utvXrw wx'Gx @z'zBҥCrJ0O:PISPTV pV[XjZhZszÉÐå ñú  8(s,u r,wrsht<({4{$|r{,$rshF, ñå Ðr/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin( }-+?=###%%%}((2a<DEVJeFRIXri\LlimqC n{fpbuq[]shvVVx(̂@=%%d xp _r ou mr w _r brT r8 +dAq  Iq h#8AQQ0l Q0DQ0PZhQ0 9YQ0cl@'%d' Y7 ... ...I[\[ap>ppqrTrQ0{{Q0 SqSS . הTLD ި% %AabCdhlNsuvW:w:z%%%%% %% %0 `   ` a d{a % ` oa %% %% %% %D%  `%| D % j% `% %y %%%@% %y(0%8 %ly(0%d %%%%%%%%%%X%%d%@%@%l%%%% % 8%YdY 5%dd U%Q %y(0% % 8%Y Q%d d% d %  L ^!% ^!  [c% [c / h%$ ٭%٭ 4Q%Q P%; N% N %  % % % u %l "h% !% z Z% 0% l % )}%} '% 't% t &x Ou% Ou ?x/% * / ? X% * X 0,%  % %TBK1H8H=J\CHPKJHPH.G0 +GVI(2H[IcHiHnIsH Y7  '@@ p   > G n@ -@&...... ...... lost+foundAd.##.k AI ~o O    < 'G V ڽ Z M _V Qei ^!"Qn w!~"# W]$%&'(l)*p+,-/11234556%y&9 $. (prog_root)` [&:0m&A_+00000*E~00  U`  w81  `   7t [  6<g  E&:  6 1  _  b  K1  ic  ]T  _4GR  /xa  b  Jlo  M   P1  _4  F1  f1$  f01*  f| Jc  _10  u|19  C T  6 a  /x  H'G  @p}  J %  Fwn  1>  ^`  6 1C  L~D  qh1G  pD1M  Y|  P1R  k1Y  N z  R1a  @l  Z*a  R1  P1f  u  61k  n.  qh1s  90'D  @1x  901~  p*?  P1  c1  bt}  /x1H  qh1  d1  P  P1  PÀ  JD?  H4~  Hx5  `1t  7t1N  X  _1  \|Yg  i V  r1  @p'E  @H1  v1  O1  D1  jT1  ^y  Z1  o1  g;E  7t1  H   t@1  \t  n/l  r  D  7,1  fk  kH&A  6l1  i  Fd  4t  ]  t2    W(  G/s  r  @$!> h1H 1RO, }H |8 D<<QQ!ۡ @<Q UL>Q VtQ VpQ W|Q H$R LCR2 N+R2 NcRQ B`.Rb C4Rb C4Rp RR RsR Q@?R j#R Rwn+(EZ3F"PVc1al?sVhV+ !"$'(+-.03569:fZNfqdfdfdf0fd3g+%b%%Ӕ %z  * . ` d f o404?sz _###)#*######%%&&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '('('L'L'N'N'S'U'W'W''''''+++P+P+U+U....////0000>0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ%%%%%%%0%""%%0%0%0 e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<llll is a directory is not a regular file (use -f to see it)%h%h (o$ooopp "p> p#p0p?;pJ ~x7pR p\ pe ps#p2p8p pp p(pp!pp9q qwnq&_fq))q5q?5qHeqQ:q[sY%qcqm6qv4pkq q+q,q-q.q*qq?ۡqEq/r /r'r%Fnr2 oco Yoqo o_fo? ooo B o o ooWmkRkRkYcWbkCkc kG ky wb YMYrWca%,%zz7zUb%@,% Lz}zB%,%zzc%,%{ {7{7d%,%{^{y%A,%{{D%( T{e%,%{{{f%,%||3F%,%|O|yg%,$|||h%,%}}2i%,% d}U}u}j% }}J%!,%`}}k%xH %pH PK%h,%X~~+L%`,%\~I~gm%X,%~~~n%P",%~~~o%H ~O%@ ~p%8H P%0 \iq% ,%,Xr%",%ls%!,%S%!,%|8Ht% XT% H^u%,%jV% pw%",%hx%( LP\X%A,%thy%,%z%,%"% d~%!,%l D?% #% bu%A,%p%,%P%,%T %,%L)[%x( 4%p,%@%h,%< ,%`,%8 PAb%X,%4%P$,%0 |%H$,%, %@,%('A%8!,%$Zj%0!,% t%(!,%% ( %!,%)%,% C`%,%% %,%%,%!5%,$Ou% X%!,%x%,$%,$8i%,$%,$2Xt!+5?P_jv|Ownpn .@%(F~MV_lxonD g',& (press RETURN)!!'!w%(%(%4tags643{}abcdDgGhHilnNpPqrs tw xy !:#=,E,E-e^H-i^C-k^UK& & \ &  oL% & Q0& MQ0& pQ0 & M(& L M}& , N &| &< QQ0F &| Z8 gQ0F&  Z j  & &&Q0F&< Q jQ0F& Z` k(Q0F&l Y kQ0F& Y l8 &# & &lQ0F &L Q e\Q0F &<N Q f$ & ; && s<Q02$& X@Q02$&Q02$&Q0 &LQ0 & Q0 &Q0 &Q0 &,[%Zc%uQ0F%lj lQ0F% f i0Q0F%j Qt m ql q qu mX R$ R Q V` ]u o@ q q RXu ade o$d aDg o0h a4\ n^ n] o_ oa P Qr Q$r Q8 ' QL1 Q` P P P P P' P P\ Pp P  P  P4 PH aT n n nW WQ rR W\S `TX W<e V X( XO YP XQ XDR X\S XTU VV `x O Oy O< n= n> n? n O O O R R R| _| ^ p p OdS np S St ST S$ _ ^ S Yt O,T OT N O) O N N N: n ` n0 n@ nP! n` T8 T S S n T T T\ pD pd p n T o o p j mk m T o o m N| ' N  m m m Nl m m U$ U q( qH q oP m V( V U U U Ul `4 _ UH Y0 ot m Z Z Z Z [ [ [ [h [P [8 [  [ N< NL N\ N u N, \P \( [ [ md mt M M& \' \( \) \x \ ]X YP ]4 ]$% \ ] ] ]| ]  ]h CK LD n Ll } L  L  L  M  M4 n M\6FU Y3a J^aeow?\Ic|G Rͪ,'ADGz_2O\z$i*Sm? (g .<C[kw\{$Oqc95i0Q`:-B!-?K‚—¶qUk8IƍL3ɷIfD ̉,1Uy͔ͣ!0>T]r΄ΎΚΪ'>PjφϜ?}Л*ѦҜҸդ֒֩ !AUq׏׺ -?Pbr}ؓجR\"f{p}فنٌِٳٺ0DހQ`uڊڙڬڹھd .C"O[ovۑۜۧ۴ܤ߮uBn To ~ |)2GnMqU|C pA`y5F1Xty5I]5 &tTb U$, ?0ALb?gzEJ]jptbŕo- >6Q^jy!BV|| 0t%,iL92r V?? 5pMr'=]FZ| %.?S{n     % / @ P | z   & 7 If ] h s            & 0 5 : L _ r x    5z        # 4 < G r h _ u           ) 6 B G T c v       V  T e w : r        P   A/ lu Մ ' ' '  ' ' ' 6> ' ' '0 ' ' ' ' (10 ( &' (( () ( *+ (%, (-.1/ftp +@ 8v '[ 'f 'n "@ _ '{ ' ' ' q 6> # X? 7@ 0Q <A .( B .- C .2 D 4 E .: F  G  H x I Q0Y Q0 Q0 t 0  а1u 1e |u 3N 3\ 3k 3x 3 3 3 3 3 3 3 3 3]\:p]\; L ]r OjQ0Q0Q0Q0Q0Q0Q0Q0Q0C k k k k k k ]R$~ k l l  ھ P l l l l  l# l30{,  l6 l: l> lB e' lF lJ lNj lRb lV lZ l^l lbd( lf! lw" l# l$ l% l& l' l( l) l* l+ l, l- m- m. m./ m/01 m!2 m%3 m+4 m056 m57 m;8 mA9 mJ: mF; mP< m_= mk> m}? m@ m[\ m\ m] m^ m^ m_ m_ n` n{ n{ n.| n<} nH}~ n\ -dd-ddTdd:dd:dd x @@`    # # # # # $ $ $ $ $ % % % d% % & & (& 0' <' H' P( \( h( p) |) ) * * * + + + , , , , - - - - . (. 4. </ H/ T/ \6 h; x; 0 0 0 1 1 < < = = > > ? 2 2 2 $3 03 <3 D9 P7 \8 l: 4 4 4 5 5    !  "  #  $  %  &  '  ( $ ) 0 * < . H + T , ` - h / t 0  1  2  3  4  5  6  7  8  9  : ;  < =$ >0 ?<@ H@!T@"`@#l@$x@%@&@'@)@*@+`&`'@,@-@. @/@0(`(8@1D@2T@3d`)t@4@5@6@7@8@9@:`*@;@<@= @>0@?@` P`!``+p`,`"`#`-`$`.`/`%CC DD E(E4F<FHcPc\d`dle ep#x#&&0 (0<HTdpt    @@X   @ @ @ @ (@ 0@ <` D` P T \ d l t  |@  33333333ff2242D2`2x3333?????@UTC33%%oqijpdj,oj33-8339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA&3&3&3&44 % 33UU33UU33UU&8`d&4&90`d&6 &9`d&7p&9&8-ve`eeeeeL@@eeeex   @ 333333333333333333333333333333333333 33 33&= "" 0000000000000000 -3333333333&>&>&> (root)`33%hC"""""""!F%%%$% %"@"D"H"!L&@|ΜΤxTdpʄʈʐД јP̜0h˔͐Service unavailableVA0aeabi&6KZ  "D; T7x-oARZ>J4T`0_! CH$ D4Ap%IwνIK)]~wz)8,e߫ۜR۠Ec+;}~ꬔ6y_鲻tڡ=-F_υQGJff9=57Ǟ[s=<y%dQ0lYvɨ'yc^ɵZ{֣fr,|_dmdF9fmlVdNd~5E㝨=z5٣9n=:u7]ʃ>o>;E}*k9\[1n_s˶[[m?z~?r)_.8ȯmbu?;D~{;D~_EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+s.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BH-P%q !A V%q !A $b%qD!ADg%qH!AHtt%!_,y%!a &A"&A"0-8"p"1"<"MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5771 5805 6488 6776 7484 7540 7614 7710 7885 7908 7931 7937 7946 7968 7972 7976 7979 7982 8087 8290 8529 8970 9408 9443 9458 9470 9476 9488 9537 9557 9597 9614 9631 9646 9693 9731 9779 9861 9985 10121 10162 10200 10237 10272 10282 10331 10481 10487 10492 10496 10516 10626 10646 10652 10666 10678 10689 10726 10760 10784 10886 10923 10945 11044 11099 11157 11168 11184 11236 11404 11611 11782 11846 11898 12171 12722 13252 13685 14023 14356 14469 14484 14493 14653 14824 14974 15138 15161 15185 15200 15275 15415 15592 15747 15759 15839 15940 15986 16012 16082 16093 16102 16115 16141 16156 16172 16185 16240 16251 16266 16470 16703 16732 16747 16816 16890 16963 16993 17031 17085 17504 17530 17559 17663 17769 17954 18066 18181 18285 18972 19231 19371 19407 19577 19618 19754 19777 19814 19859 20110 20206 20260 20359 20370 20407 20444 20471 20480 20514 20521 20546 20573 20608 20622 20636 20665 20679 20696 20705 20727 20745 20762 20773 20792 20818 20836 20859 20876 20891 20906 20924 20951 20978 21000 21039 21057 21089 21317 21391 21434 21480 21627 21783 21827 22106 22133 22492 22676 22828 23009 23156 23314 23335 23383 23393 23401 23412 23423 23433 23440 23455 23467 23506 23536 23575 23628 23686 23707 23714 23733 23754 23761 23785 23807 23827 23849 23880 23917 23939 23953 23999 24028 24062 24102 24137 24165 24213 24222 24231 24236 24245 24254 24271 24275 24280 24286 24290 24328 24337 24364 24384 24407 24426 24453 24475 24507 24523 24528 24538 24561 24583 24600 24617 24630 24639 24648 24654 24681 24688 24712 24733 24757 24770 24789 24814 24837 24853 24859 24871 24901 24909 24949 24960 24971 24982 24999 25016 25030 25047 25263 25567 26015 26231 26495 26767 26819 26855 26891 26942 26959 26997 27011 27018 27035 27038 27043 27052 27064 27075 27084 27105 27147 27185 27201 27232 27257 27292 27348 27388 27409 27429 27470 27499 27547 27780 27815 28022 28041 28078 28139 28177 28216 28372 28387 28433 28481 28504 28540 28550 28560 28571 28576 28639 28687 28731 28792 28825 28926 28944 29083 29105 29228 29242 29252 29275 29380 29436 29552 29583 29588 29614 29653 29663 29706 29716 29732 29747 29765 29788 29818 29839 29865 30062 30105 30109 30115 30121 30126 30137 30151 30180 30212 30224 30271 30321 30361 30388 30404 30413 30456 30462 30470 30474 30494 30511 30523 30554 30810 30859 31435 31462 31494 31522 31574 31580 31586 31591 31612 31628 31650 31679 31820 31954 31967 32103 32105 32107 32109 32126 32139 32157 32184 32188 32194 32199 32207 32213 32253 32255 32265 32280 32297 32331 32363 32401 32430 32459 32481 32524 32550 32594 32730 32732 32812 32858 32906 33011 33113 33152 33219 33226 33287 33351 33355 33362 33484 33553 33841 33979 34120 34201 34248 34254 34277 34323 34326 34352 34395 34460 34522 34592 34660 34753 34972 34997 35001 35037 35055 35083 35125 35169 35233 35283 35359 35381 35433 35477 35516 35550 35580 35611 35636 35645 35657 35665 35676 35688 35707 35731 35780 35797 35821 35864 36186 36189 36203 36216 36228 36235 36246 36253 36260 36269 36279 36296 36312 36362 36370 36378 36388 36399 36417 36434 36455 36477 36486 36496 36523 36529 36539 36558 36574 36592 36612 36621 36632 36639 36656 36675 36696 36706 36723 36729 36745 36760 36775 36796 36818 36837 36847 36852 36857 36875 36894 36913 36919 36938 36958 36978 36996 37001 37007 37024 37040 37061 37074 37082 37102 37126 37143 37151 37162 37183 37189 37201 37223 37237 37246 37267 37285 37294 37328 37351 37378 37410 37433 37453 37464 37496 37512 37523 37536 37559 37581 38089 38119 38150 38178 38192 38393 38615 38782 38869 38886 38904 38921 38950 38997 39008 39027 39049 39128 39320 39348 39466 39488 39629 39648 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5768 5795 6361 6661 7302 7349 7462 7555 7589 7608 7626 7634 7643 7668 7672 7676 7679 7682 7804 7989 8217 8737 9088 9117 9130 9143 9148 9168 9187 9208 9267 9284 9298 9320 9365 9391 9432 9510 9628 9742 9796 9825 9857 9896 9902 9935 10058 10065 10069 10077 10101 10183 10189 10196 10208 10222 10231 10264 10283 10295 10405 10467 10486 10605 10656 10708 10720 10739 10791 10995 11203 11394 11454 11503 11771 12231 12898 13322 13644 14069 14201 14233 14245 14423 14620 14781 14915 14935 14968 14982 15051 15164 15336 15471 15491 15603 15695 15718 15741 15800 15815 15836 15851 15872 15892 15917 15931 15955 15967 15985 16195 16445 16466 16482 16535 16603 16676 16713 16739 16815 17272 17298 17320 17427 17534 17735 17808 17892 17992 18487 18725 18876 18910 19045 19089 19228 19269 19314 19361 19605 19738 19800 19894 19899 19933 19967 19982 20010 20043 20050 20075 20093 20119 20126 20141 20156 20176 20216 20233 20253 20274 20296 20311 20331 20353 20368 20381 20395 20407 20419 20433 20456 20479 20497 20540 20591 20628 20813 20876 20912 20961 21052 21182 21235 21495 21542 21903 22053 22222 22362 22482 22614 22654 22701 22711 22719 22729 22737 22748 22759 22773 22798 22841 22874 22907 22942 22996 23021 23040 23062 23067 23073 23104 23121 23148 23166 23187 23209 23228 23238 23268 23294 23321 23370 23398 23425 23478 23488 23498 23504 23514 23523 23543 23547 23552 23558 23562 23597 23606 23637 23654 23681 23702 23722 23741 23767 23780 23788 23804 23835 23866 23887 23913 23926 23934 23945 23951 23975 23985 23997 24015 24026 24046 24062 24088 24110 24126 24138 24158 24184 24190 24220 24234 24248 24271 24290 24309 24327 24345 24568 24874 25292 25493 25733 25917 25995 26050 26117 26157 26180 26214 26225 26233 26256 26259 26262 26268 26279 26291 26304 26334 26378 26391 26404 26441 26455 26466 26477 26488 26505 26516 26563 26586 26635 26876 26909 27164 27185 27218 27271 27297 27324 27480 27486 27529 27549 27568 27597 27604 27611 27618 27623 27672 27710 27744 27801 27829 27874 27891 27992 27997 28074 28088 28098 28122 28245 28326 28436 28464 28469 28485 28514 28522 28563 28570 28584 28597 28605 28624 28657 28677 28697 28913 28944 28949 28956 28963 28967 28981 28993 29008 29041 29054 29109 29167 29203 29221 29239 29257 29294 29300 29308 29312 29333 29350 29361 29383 29561 29605 30307 30331 30365 30384 30429 30436 30443 30447 30471 30482 30487 30550 30671 30794 30807 30941 30943 30945 30947 30957 30966 30979 31006 31010 31016 31021 31030 31035 31062 31064 31077 31089 31104 31132 31176 31223 31239 31261 31272 31305 31325 31374 31474 31476 31541 31590 31639 31743 31841 31882 31973 31980 32041 32105 32110 32116 32225 32284 32535 32676 32803 32871 32908 32915 32942 32988 32991 33012 33057 33108 33167 33236 33283 33388 33531 33556 33560 33594 33611 33635 33687 33738 33810 33876 33974 33991 34022 34058 34092 34116 34140 34173 34193 34203 34211 34219 34229 34240 34254 34280 34328 34351 34371 34412 34711 34714 34728 34740 34747 34766 34780 34787 34794 34803 34813 34830 34846 34894 34902 34910 34920 34931 34949 34966 34985 35005 35012 35029 35046 35053 35066 35101 35118 35137 35157 35167 35183 35196 35214 35234 35255 35265 35285 35305 35318 35337 35350 35374 35397 35410 35421 35426 35433 35451 35470 35489 35497 35516 35536 35561 35579 35586 35593 35606 35615 35636 35649 35657 35677 35705 35722 35728 35739 35770 35778 35791 35813 35835 35844 35865 35883 35890 35913 35932 35959 35977 35997 36010 36025 36046 36060 36067 36081 36096 36115 36660 36693 36721 36750 36758 36795 37107 37284 37361 37378 37396 37411 37433 37483 37493 37510 37532 37591 37749 37773 37903 37928 38054 38072 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.diterGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5656 5683 6259 6619 7304 7365 7443 7538 7578 7600 7618 7624 7633 7659 7663 7667 7670 7673 7795 7980 8208 8737 9155 9184 9197 9210 9217 9237 9256 9279 9322 9342 9361 9384 9428 9457 9498 9564 9676 9790 9844 9873 9905 9944 9950 9983 10061 10067 10071 10076 10117 10254 10264 10272 10291 10305 10314 10346 10387 10400 10525 10583 10602 10721 10777 10829 10840 10856 10895 11145 11317 11489 11544 11579 11830 12235 12535 12804 13165 13345 13664 13684 13697 13886 14030 14226 14360 14380 14413 14432 14533 14688 14876 15063 15083 15162 15260 15298 15321 15411 15432 15455 15474 15498 15528 15572 15605 15628 15640 15658 15926 16245 16276 16311 16375 16450 16520 16551 16581 16673 17164 17194 17211 17351 17492 17689 17808 17955 18122 18680 18976 19157 19202 19365 19419 19554 19590 19650 19700 19991 20100 20157 20254 20259 20294 20329 20344 20368 20401 20406 20431 20447 20470 20477 20494 20509 20528 20560 20564 20584 20602 20614 20627 20645 20669 20687 20706 20733 20760 20772 20793 20823 20853 20878 20911 20946 20984 21237 21306 21361 21422 21540 21699 21753 22014 22065 22441 22596 22740 22880 22988 23173 23203 23246 23256 23264 23274 23286 23307 23316 23322 23354 23396 23432 23470 23507 23555 23579 23591 23605 23613 23621 23650 23667 23696 23717 23740 23749 23768 23780 23824 23862 23889 23933 23961 23988 24041 24052 24063 24070 24080 24089 24123 24127 24132 24138 24142 24177 24187 24217 24240 24269 24291 24313 24335 24362 24374 24386 24405 24439 24472 24493 24517 24530 24542 24555 24561 24587 24597 24608 24632 24642 24662 24682 24699 24725 24749 24762 24782 24816 24823 24852 24875 24898 24914 24929 24944 24959 24973 25161 25466 25897 26088 26323 26511 26553 26603 26657 26705 26727 26768 26779 26787 26811 26815 26819 26828 26839 26850 26865 26896 26942 26955 26968 26998 27012 27024 27036 27048 27066 27089 27134 27157 27217 27469 27496 27758 27776 27803 27852 27882 27913 28045 28052 28101 28124 28148 28177 28185 28195 28203 28208 28261 28310 28350 28416 28449 28493 28516 28617 28622 28699 28713 28723 28747 28870 28951 29061 29089 29094 29110 29139 29147 29188 29196 29210 29223 29231 29250 29283 29303 29323 29539 29570 29590 29596 29603 29607 29622 29641 29667 29676 29688 29742 29800 29835 29854 29871 29883 29918 29924 29932 29936 29957 29974 29985 30010 30188 30242 30933 30952 30987 31017 31063 31069 31076 31080 31104 31120 31126 31201 31351 31470 31483 31551 31553 31555 31557 31567 31580 31597 31624 31628 31634 31639 31648 31653 31680 31682 31695 31707 31722 31750 31794 31841 31857 31879 31890 31923 31943 31992 32092 32094 32170 32225 32275 32374 32469 32517 32607 32614 32675 32739 32744 32750 32853 32905 33151 33312 33467 33538 33591 33598 33625 33675 33678 33699 33745 33800 33859 33928 33975 34080 34223 34248 34252 34286 34303 34341 34394 34434 34510 34575 34669 34690 34728 34768 34804 34828 34851 34890 34920 34927 34936 34944 34952 34966 34982 35010 35062 35079 35100 35144 35486 35490 35505 35516 35524 35543 35555 35562 35569 35578 35588 35605 35621 35675 35683 35691 35701 35712 35730 35747 35763 35781 35788 35806 35823 35830 35840 35871 35890 35909 35929 35939 35958 35971 35991 36011 36032 36042 36061 36080 36090 36107 36121 36144 36168 36181 36191 36196 36200 36218 36237 36256 36261 36280 36300 36325 36340 36344 36351 36361 36370 36391 36405 36413 36433 36459 36476 36484 36495 36526 36531 36544 36566 36581 36590 36611 36629 36638 36682 36706 36733 36748 36765 36779 36810 36834 36865 36872 36886 36901 36920 37465 37498 37526 37555 37563 37600 37912 38089 38166 38183 38201 38216 38238 38288 38298 38315 38337 38396 38554 38578 38708 38733 38859 38877 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5750 5782 6274 6563 7108 7154 7258 7344 7380 7395 7413 7421 7429 7456 7460 7464 7467 7470 7581 7766 7994 8470 8804 8833 8848 8863 8871 8885 8903 8924 8975 8991 9001 9021 9067 9097 9150 9207 9318 9439 9483 9516 9555 9589 9596 9629 9706 9712 9719 9726 9755 9867 9873 9884 9901 9918 9927 9956 9968 9978 10079 10141 10161 10281 10318 10374 10388 10409 10446 10656 10831 10980 11015 11067 11285 11600 12125 12488 12778 13171 13306 13319 13330 13476 13655 13786 13920 13940 13973 13992 14075 14190 14331 14456 14470 14578 14671 14700 14720 14796 14813 14831 14847 14866 14886 14903 14915 14941 14953 14971 15172 15411 15438 15455 15511 15573 15633 15664 15688 15747 16093 16123 16140 16248 16358 16498 16572 16648 16726 17218 17438 17549 17580 17707 17743 17871 17898 17938 17984 18200 18324 18392 18492 18497 18533 18569 18583 18606 18639 18643 18668 18687 18713 18718 18733 18748 18767 18792 18804 18826 18843 18856 18868 18886 18910 18925 18942 18955 18966 18977 18997 19026 19055 19079 19114 19149 19176 19363 19412 19444 19492 19589 19722 19768 19960 19990 20312 20441 20581 20721 20838 20973 21017 21060 21068 21078 21090 21102 21110 21121 21148 21182 21219 21250 21285 21321 21368 21388 21405 21423 21428 21435 21462 21478 21499 21516 21533 21551 21568 21581 21612 21637 21668 21699 21734 21761 21814 21824 21834 21840 21849 21857 21872 21876 21881 21887 21891 21926 21936 21965 21981 22007 22024 22043 22064 22080 22093 22098 22106 22121 22147 22166 22194 22212 22223 22229 22235 22256 22266 22277 22295 22317 22334 22347 22368 22388 22408 22419 22432 22454 22461 22486 22501 22521 22533 22550 22567 22587 22606 22783 23067 23377 23557 23768 23956 24022 24069 24124 24168 24188 24217 24229 24235 24251 24255 24259 24267 24277 24289 24304 24323 24359 24370 24381 24420 24432 24442 24452 24462 24478 24496 24545 24566 24611 24855 24881 25135 25150 25176 25233 25267 25302 25444 25461 25510 25531 25547 25576 25581 25586 25592 25597 25636 25671 25701 25756 25789 25835 25849 25928 25933 25987 26001 26011 26035 26121 26169 26275 26309 26316 26331 26358 26367 26406 26413 26435 26454 26470 26488 26520 26539 26556 26713 26744 26751 26760 26768 26775 26789 26807 26826 26836 26848 26889 26934 26963 26984 27007 27026 27064 27070 27078 27082 27103 27120 27129 27148 27294 27336 27846 27854 27878 27896 27940 27945 27950 27954 27985 27998 28007 28053 28179 28270 28282 28346 28348 28350 28352 28362 28376 28391 28418 28422 28428 28433 28442 28447 28474 28476 28491 28502 28517 28545 28589 28636 28652 28674 28685 28718 28738 28787 28887 28889 28957 28997 29042 29117 29183 29218 29299 29306 29367 29431 29438 29444 29543 29599 29875 29999 30110 30172 30210 30218 30240 30289 30292 30313 30358 30413 30472 30541 30588 30693 30836 30861 30865 30899 30915 30940 30988 31024 31085 31139 31220 31242 31281 31318 31350 31374 31401 31427 31441 31449 31459 31467 31481 31494 31506 31530 31571 31597 31614 31643 31967 31970 31984 31996 32002 32018 32030 32037 32044 32053 32063 32080 32096 32139 32147 32155 32165 32176 32194 32211 32224 32250 32257 32265 32282 32290 32307 32331 32350 32369 32388 32398 32409 32423 32441 32461 32481 32490 32513 32533 32544 32559 32571 32590 32609 32620 32630 32635 32641 32659 32678 32697 32704 32723 32743 32768 32785 32791 32799 32809 32821 32842 32858 32866 32886 32906 32928 32936 32947 32970 32977 32991 33013 33030 33039 33060 33078 33087 33118 33134 33161 33180 33200 33218 33239 33253 33273 33280 33299 33314 33333 33878 33911 33939 33968 33976 34013 34325 34502 34579 34596 34614 34629 34651 34701 34711 34728 34750 34809 34967 34991 35121 35146 35272 35290 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..