08.@j<  .@jit t.@j@@<@T 08.@j<  .@jit t.@j@@<@TU .@jt`A.@j.@j.@j$h .@j.@j.@jA.@j.@j.@j>A..@j.@j.@j (0A.@j.@j.@j?A.@j.@j.@j7A.@j.@j.@j?A.@j.@j.@jpA.@j.@j.@jqA.@j.@j.@jrmD!.@j.@j.@j (08@HPX`hpx$.@j.@j.@j (08N$O.@j.@j.@j@HPX`hpxK$t.@j.@j.@jM$q.@j.@j.@jFA.@j.@j.@jtC.@j.@j.@juA.@j.@j.@jvA.@j.@j.@j|!.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@ja.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j!.@j.@j.@j4!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j B!.@j.@j.@j B!.@j.@j.@j!.@j.@j.@j"!.@j.@j.@j"!.@j.@j.@j"a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@ja.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j!.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j?\!.@j.@j.@j>\!.@j.@j.@j=\!.@j.@j.@j<\!.@j.@j.@j;\!.@j.@j.@j:\!.@j.@j.@j9\!.@j.@j.@j8\!.@j.@j.@j?\!.@j.@j.@j>\!.@j.@j.@j=\!.@j.@j.@j<\!.@j.@j.@j;\!.@j.@j.@j:\!.@j.@j.@j9\!.@j.@j.@j8\!.@j.@j.@j:\!.@j.@j.@j7\!.@j.@j.@j6\!.@j.@j.@j5\!.@j.@j.@j4\!.@j.@j.@j3\!.@j.@j.@j2\!.@j.@j.@j1\!.@j.@j.@j0\!.@j.@j.@j7\!.@j.@j.@j6\!.@j.@j.@j5\!.@j.@j.@j4\!.@j.@j.@j3\!.@j.@j.@j2\!.@j.@j.@j1\!.@j.@j.@j0\!.@j.@j.@j2\!.@j.@j.@j/\!.@j.@j.@j.\!.@j.@j.@j-\!.@j.@j.@j,\!.@j.@j.@j+\!.@j.@j.@j*\!.@j.@j.@j)\!.@j.@j.@j(\!.@j.@j.@j/\!.@j.@j.@j.\!.@j.@j.@j-\!.@j.@j.@j,\!.@j.@j.@j+\!.@j.@j.@j*\!.@j.@j.@j)\!.@j.@j.@j(\!.@j.@j.@j*\!.@j.@j.@j'\!.@j.@j.@j&\!.@j.@j.@j%\!.@j.@j.@j$\!.@j.@j.@j#\!.@j.@j.@j"\!.@j.@j.@j!\!.@j.@j.@j \!.@j.@j.@j'\!.@j.@j.@j&\!.@j.@j.@j%\!.@j.@j.@j$\!.@j.@j.@j#\!.@j.@j.@j"\!.@j.@j.@j!\!.@j.@j.@j \!.@j.@j.@j"\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j \!.@j.@j.@j\!.@j.@j.@j \!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j\!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j!.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j$!.@j.@j.@j4!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j !.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@ja.@j.@j.@ja.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@ja.@j.@j.@j a.@j.@j.@ja.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j?\a.@j.@j.@j>\a.@j.@j.@j=\a.@j.@j.@j<\a.@j.@j.@j;\a.@j.@j.@j:\a.@j.@j.@j9\a.@j.@j.@j8\a.@j.@j.@j?\a.@j.@j.@j>\a.@j.@j.@j=\a.@j.@j.@j<\a.@j.@j.@j;\a.@j.@j.@j:\a.@j.@j.@j9\a.@j.@j.@j8\a.@j.@j.@j:\a.@j.@j.@j7\a.@j.@j.@j6\a.@j.@j.@j5\a.@j.@j.@j4\a.@j.@j.@j3\a.@j.@j.@j2\a.@j.@j.@j1\a.@j.@j.@j0\a.@j.@j.@j7\a.@j.@j.@j6\a.@j.@j.@j5\a.@j.@j.@j4\a.@j.@j.@j3\a.@j.@j.@j2\a.@j.@j.@j1\a.@j.@j.@j0\a.@j.@j.@j2\a.@j.@j.@j/\a.@j.@j.@j.\a.@j.@j.@j-\a.@j.@j.@j,\a.@j.@j.@j+\a.@j.@j.@j*\a.@j.@j.@j)\a.@j.@j.@j(\a.@j.@j.@j/\a.@j.@j.@j.\a.@j.@j.@j-\a.@j.@j.@j,\a.@j.@j.@j+\a.@j.@j.@j*\a.@j.@j.@j)\a.@j.@j.@j(\a.@j.@j.@j*\a.@j.@j.@j'\a.@j.@j.@j&\a.@j.@j.@j%\a.@j.@j.@j$\a.@j.@j.@j#\a.@j.@j.@j"\a.@j.@j.@j!\a.@j.@j.@j \a.@j.@j.@j'\a.@j.@j.@j&\a.@j.@j.@j%\a.@j.@j.@j$\a.@j.@j.@j#\a.@j.@j.@j"\a.@j.@j.@j!\a.@j.@j.@j \a.@j.@j.@j"\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j \a.@j.@j.@j\a.@j.@j.@j \a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\a.@j.@j.@j\ !.@j.@j.@ji!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@j a.@j.@j.@ja.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j!.@j.@j.@j!.@j.@j.@ja.@j.@j.@ja.@j.@j.@j!.@j.@j.@j!.@j.@j.@j!.@j.@j.@j B!.@j.@j.@j B!.@j.@j.@j!.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@ja.@j.@j.@j!.@j.@j.@j!.@j.@j.@ja.@j.@j.@j a.@j.@j.@ja.@j.@j.@j a.@j.@j.@ja.@j.@j.@ja.@j.@j.@j.@j.@j.@jbpf!.@j.@j.@j $.@j.@j.@j8$.@j.@j.@j$>.@j.@j.@j;$.@j.@j.@j@$s.@j.@j.@jB$.@j.@j.@jHA.@j.@j.@jJm .@j.@j.@jPXG$.@j.@j.@j`K $.@j.@j.@jhA.@j.@j.@jwA.@j.@j.@jxA.@j.@j.@jyA.@j.@j.@jzA.@j.@j.@j{A.@j.@j.@j}A.@j.@j.@j~A.@j.@j.@jA.@j.@j.@jA.@j.@j.@js<o4%腣!PN+ZƋV"scǻ>&| T_ uh G&+{#e^@ -,4H/,}٩hHNm6{~! #^];Waw9VdXuXRI|W(Fx@~B~I^ „bkno Ax Ss h(v|3 'U2|pEK<kAR; nN #L'lCq y}) ]mЅQ'<4P0h8,2HN ͕wt,o*8lY\ VGe>eDk}&(EԺ}t+C*h n$n44>J"z6B!&c+X{)Z3zw>f¼Vؗ^SF[ZFr7=!RW9g4=Rf}`/iw t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!4 (  $$$HH $$NetBSDAPaXNetBSDearmv54p@-D0D 0@`Qp(@P`F`F&a03/T@p$#A-`0`` 0PpU(pGpG@Pq`P03/T@0US [$\@-lPQMK \!\1 P`0 0R0819  0S  /S 0So10S8 0p ZpG2 pG0@3'q1*03/T@Y :p60pWH2H0@3(1*03/X@ ad 0 P0 0Ka<$4h#D#(`$8@-t ttJPl@dphP L念c`POU 㵵P 1@**ؿ%` P@-@O-`@@R@<2tH4M$H0[p \ePp@tH$H(  R  z@Pp0: S `0SЍ ^@P0`0vw; 0xS'x0SP0 S0 [ P  忴 0S;00 0  * P :0s 8#8T 5TH(T   P R(%%Z݀++%S3H0`  BR` pR RX X/(%%@-0 h`,ؿ% 000/%G-؀P x0M@ , \0R`p , 0P0 ;Ѝ%Y@%8/ؿ%@- M @00@  a P  Ѝ_/A- l1X0Zp 03 @P g0S@ ((@0X;0% P-  U @0`V/PfX`! pf0-S k@|@PhP ULP@ U(p0SX %l/v/%/O-6M@T  h@P Ѝ  p` &@5Xp0S 5%0 0 |5X 0S_d50S&<0epP(@ 0SN50S0Fp pPJ400<T$尠ES00CS0 r Pᐔ Pp  PYU 0 P00CS0 Z 0 X80: S  + +pP p Qt  X0 0, 0X3($05x000 00 Q00SD 0 0 `hJp8  p 0Y 1(#00 H 6 0P c@P㴂~ tY0S@zXK"I 0R 0Y0YY]820#0 p00 R0S -100S  0 5( Pʨ0S;a@T c@P@0 ?oR20S 0  H1 0R0fP( @P @0S "P0S %P XTy P0Rt00! P %%%%%% %%ؿ%/(%%%)%%/ %0@-MM@P  p  ;0U$C dP TTۍЍ08 P ,(0P X/%//%Q@-@ TP DDl,P $ 0P@%//%Q@-@ XP HHM0"P $ 0P@%//%@-0 O/ؿ%0$/&0$/@&@-%0@-%0@-%0@-%0a@-1   0 0 Ѝ0&@-1   0 0 Ѝ0@&@-1   0 0 Ѝ0&@-1   0 0 Ѝ18&@-0   0 0 Ѝ 10&@-0   000 ЍV@&&<00/@-0   0k0 Ѝ&#1@&<00/@-0   0W0 Ѝ&51& 0@- 00 G$0P@NЍF1%,0C-`A!圁!ᘑMpW0 |! R0B=00 B  Tɰ0L 8 R<B 8!4100!0ЍPP $=XQP 0p00S  0 P0P      0 3/R ! 7000@080L$D0@&&& #=11@&Q1~1112,0p@-|@PtP00 R 0p800 p0  B0Sqs D&&@&0 0 0 /&@&@- v$ @-@- m$ @-@-80M@0(@3/P $ b$H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpc0S 00m8@@-@EPЍ@  8PЍp@-(`Vp80@  03/PP$8003/(Ppo2@-@P`P $80 (0(3/@b P bPЍp0&O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AF 000+ xpt| ]  ЍO0 P % pHp 81/qp4 # ?P p 4 #Ob0S4 tp0 0 0 0 "\0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0004 8pX  FЍ0&;x2@&222R/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-lBM0 0  P0 0  0 K? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`q49\4 " BXX P!d4^4&\4 " B   !d4K4\4 # B  d484\4 x/0[8p<@0! [` d @44[4 [Ѝ&$Mb&`3ZA3333U@-@RG-A `00P4 2#&P8P0 (1/qp $ "㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@!0  Z  $5&&% 4@-XAM P04 00#!8 ( 01/qp$ !P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `@&mS@-P 8  $   ЍH&*O-PxIM0@S`M. 8S+ #=$($0,0S( 000 " ! !}x00# #v|0 q& %kIލЍx'G=0J7PT.0.0 G>G=0IN%P8=%q=(%ؿ%~==\\6@0\\2@X X0p@-@P@@DDT ` U H H0Rp@\\@ppX 0Xp@-@P@@DDT ` U HH Qp@\\@ppX X0p@-0P0@44T ` U 8 80Rp@\\?ppX 0Xp@-0P0@44T ` U 88 Qp@\\?ppX X0p@-PPP@TTT ` U X X0Rp@\\?ppX 0Xp@-PPP@TTT ` U XX Qp@\\?ppX0X @-ppt t0\@ ^0@\\?X 0X@-pptt \@ ^ @\\l?5S %R R S R SSh -^L^S R 0/0/0000&O-QMTh @ `u @ 0@0 @0L0@@ @@D@H@<@@@4@8@,@0@5 SS$q\ Ǝ0 !00`V0S9 0 0刐0L0St ,0D0000$0S00( <0@B?N<$ppw<,0S d @?C000@$0D0p0H0D0p^<0$ppV<$0S0040080#0p~pF<,0S  @?CZ㸰张 0x#php0< 0\#p`p(<0 \ 0C0CQ0B003/0400S YT RS0 00 R0! 0L0S XP< x0|R@ D <0 @\HD5H 5 4P !p \t 88  4 * R(" $\  " & P , 0,0000000Sb Q? 0 !XX0$0 Q9 0 l!dd0(0$;[(; 0R  P ,P0@;0S00P00P00ԽPP\0.S0S| 0!!0P$00P(0 $ ( R P0P000Ѝ&PrVUUU݀O-@a!80S 42PP! x4rpW  ЍO2<0匑SB儱| 3@P Y@@2U@@S@0SL H50CS,|||\4 $ +00L0S \0.S0S "4@0S40S !4<0?oQ20S X p040 Ѝ&X==PH--G-``U1P0HFL0 8P0S$&00D0H0P0pP0 pO5T H0 `F0P 0 1P _5X0 s0X0d 0t000|00PP, S,Qx |0R4 S& S' S 5" L0S5 T0S50S4P$Q40V  00Ѝ10@GS$ppppppppppppppp8@<ppppppppԩp $<ppPhpppppppp4Xlp,\|pȩ0Hp\Ĩ0L00P000H00P0L00T0OX0s0X000P0L0T0H0D000P0L0T0H00X0:0P00L00T00P0L000\00`0)0`00\0$0d0!PP0<0080 P0 D0h l00D0h000000 0;(00p$00p$0,p0$00,0000@00 00p00t00D00h00x00|000000000D0@P D @<\0 SPW( ?R004(0\ SR PPP00`0S0\0S00S S S0|0`0Sp0\0Sd0d0*&ht@%=%Z x̲̹%=ؿ%&l@ؚ080p@-@PT @@\p&80p@-@PT @@\p&-L MRM\0 + vp >奿0 ލЍ 00 >04@p\l0l 0 0  L00S   F >ؿ%c>&&&$0\ 0S 41&c0L0S/0 0 0/@-00 SM    4 $;pphЍ\0\@ X0R@P0 B ?(8 0Ѝ@&&&*4>D>&(>>&P `00CS`0p S00 P0S X0X /X(%: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\@T10S H10S. 00 00,10'p h @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?7 0^T00S &V>&&*4>&&&&&N>&&s@-  P@@P `PU00S @GT CЍp0t  Q \0 \@-T (P@$U]>&&p@-P@Tp0 0C0  $A @G-@0M03,30S`V0Ѝ0 0C0v 0XPS !$ҿ0S 20Sh  4 "; $p| ⶿!0 ( p孿P20S 0<奿 ,塿(20S  噿0 : SF0( " 08"$4冿10SP :1!0 0O 10S10S : S0: S y`}P1q H1Rp@1 B?6 0O'Q Bp , ;l^ ,200S00S &&&&v>V>&*4>&>&S>&&&&&&N>&&&1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ0P 0 `0SpQPPU% Ѝ  B 10`    0S[  L0  $R,   V &&&&&%%&410G-S$0@010S 10S,0000 0 0P=0`VG^D@pP儠UG k0 0C0 W bp0S$,  `YpP R`&&&&&%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S$,  Dp` &&&&%@- M @ {p ЍT  P  T0=(P 00 0S@SQ 0  +(0ꀿ%0p@-0PS``%5@P 6P PA\@P4y M(P壽᥹p&->C-CM@4 `9 9PȐ`T *F 0 pPPCߍw ? P@9w0S ?@P?lP@0%@-U ݽ㈻>ؿ% 000/$&@-E0 ̽w>ؿ%@- M-0P!00A00P!0 0*; -#p1 Ѝ "$ 0P @000 h0h #pX   DH偆"$  (0z$&???]+#?{?w?/?N?O-L@PQM Pm i90Sq  ` P 0S P ԝ Bd00CS00`pp/`Ѝ0 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxS P XP`P`(1 04 Rt$tp x' 0)  0 p W 00CS0$p pYW 0 P 0S  t_XP `0: S  P8X P `0: SFpP` @`PKNc0S x (P@ ˵P13 [ ,#lP 0˯S ,!00  1 0! 0 pnp|80H0 &P 8x t#P W80S Ӝ`0;`0`P ȜP @80-S  廜ιPT`Ph0S  <呻O`$&4Q?/ؿ%(%*|?@??Y@8//????s@-@ `P_P0P: UGywЍpU =:\@ki0 P4)&@<@%K@5@Z@8@A-A~M0pSM P0` 0`孿P7p! p~,P 7@!1P~܍Ѝ0 0`卿P7 ~,PPʎ7 ~,P `0 0oPy7x W Q \#10 00WPa70$ i1%m@i@@@A4A00CS0 Ż0 /O- U`DMp Ľ000D$000 0000STT V"4`0p Q 30Sa4PZ|PZ70`$1叽000 0K4$qP60$1V 0030p Q  #TP0 060#0V0030d#=P60X#0L3000DЍp(0: S d0 S" ♾P 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0,qpz60S 0㐐唠0 0p) W W)2`V%  ?1 10 0R  S0R 0!CQ:++R:0'WW~Ta0@ 0 0T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`%H&&H!%%|'h&AaA%{AA%Am8@''(%}D00S/@-4@~M0S~, CP~܍H&%0@-p@$0l00S Ѝ00 0,0Q 5, /P%H&AL0@- R8\/P 0 0 P/H&Bd''KBA-p`P@ 0PPEU`@T@A-p`P@ û0PPEU`@T@p@-P@T0` Qǻ@P 0 Q @;;S p跻@P00T@ C5(0( K/( .%H&'BB@-,BPU` V0bP$00 p?W0 pGWhPh50 SV.00P ЍP#ڀ;;S 00 0@+0Q P?\PppD1$p0pQ Q(% 00$0SP ( .40S0040ES0040S 40ES $0Su.40S 40S 40SPU 4(0( .%H&Bđ'CMCBB*Ct!0SX@-dQM0S T100CSDA.Ѝ0S0SS/ 0070S S00&.S0S0@pT0pS 0L*Qo 0.p T0*Q00L 0;P000S$ʲ/H&%H!%CDmCG-P`0 P ,p@P"ڴAQ"`*Q 0Q P 0O*Q 4D .ЍP 0S%H&HD@-xaPMP d1@0S2 SU@D;00U0pp0 *0Q3 -Ѝ P0S(0S 0*Q3  Pڌ0U 0?N.  d^-0 P 0ᒻP3 0, -%H&xDDDD'AmEO-rM,M R(`RX0E@FP 0 0S 0 00 S(0S d  T"mP2p00 .00"J`J?00"YTo" ?>܍,ЍT 0S =! !A!0`;. {10Sx1pp1 00-00!J J?08!00,q0(`0 1娀(0 C0J  00 $0 - 0 l  0  `- 'TH!%ؿ%H&đ''?EPJEaEd'P &E& E'%EC-XRXb0TBS0000 Ѝ440 0 0S 2r0S Q2 啶! 0S 刺pP (0: S0 0Y p10S10S PP 0 0 0S(q<] 1 !00 0S000p000 S(00(000 P@0S 000S 0/P 0+0P0 , 0`&]!H%&H&4''0'<'d'Eh&H!%' Fđ'F'F'A-MM, gP 2#,E [P2" ,RB$0`SF 0`CĂ0S2y+p)/P} $/Px 0 u S( .pe+lc+h2Lr0`0CSXXZ+W+HU+DS+@Q+<_+P,.P000 0@+ 2 `ލЍ6+0S  R  sS SS YSOP+yS+$qx+l+<+P,.P 0S8 4.P( @,1P *0S(*PP ŰxP0000+*D'$F>F%H&'d'\F%%FFH!%GG$"GmGGG ;G0'FFG H+HHHHfH HMHlHI7I00@-@HpSp`L!%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S *@DT  AR0d#0UPTP*PV0S p|*@X`ꓢ" @2/PL0 !ᒣ#, 0:KD'O-MPЍe0H03/P0 03/PP㈒D50 S 05帴P -%'50SuJG>P 0(03/ 2#P 0AS0@0 a3/P|4C003P H4 C(P(40S  ₵P T 0 0  wP 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXP9(, A S0 0  6P0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 Hb X RP$PP ,1P0 P E @ ;/0S0S P0S 000[\000*4S 0S 0đ''L!%RK' 'D'''$&''' &'%&''4'<'l'P!%0'G- R@}P T T 0 9&@H03/P0 03/P0SB0 Y Pq0 09paMP P: 0 P0(03/P@F P0 0 @0S 0' 00OP@' ሲm?P0 0 p0 0S TQP \0 CY yPđ'gK'4'' &0'<' FD'd'K'T0@-0S\PP 00H03/P@ꨑ'đ'0O-MMD嬀$0" PP0S5  Up 0)  L"000SPER0  !: 0P! 0p 0P0U00pPF0P0 000/`F p "00`00Q QQ P0 S  PF'(%NT'đ'p@-0@0PpP E&0Pp@|'(%A-`PlplU@0@DTj@P U@0 !00`PE'(%G-P`ကpU0@0@DTG@PğU 0@0 r&0@UP0 `'(%G-pM =@ P`!X10S ᏮP&:8$! U00 J(A 6 0 BR P#?U0 P0PU0o0^PJj&8h @D 0RP J(L JW&80 _ `ލ蔑'A'(%NON Q/p@-JTUPŬP;&0P C PpP/&4$ 7 喥0 40p-OPO('0@-PM@ Ph00S Ѝ0 $ R\ 04 0R\ 광'aO0@-MP @ϭPЍ000S0: Sx$#PPU %0D ᜭP 0%0 광';O<'PO0@-M@, 0000S# Q0S 10S ℭP'0S% X0 ?A3c000S&!h0 ?A3c0 ỬP %0NS %0X Ѝ0}%0< 0S jp\!%X!%MbOOp@-@P`nP p P $0V%0 ^p<'O@-!@P 0sB%0@ I<'PO-P0`/Sp/M/@P7 P. jp /00 P&  P!00S  ǬP ܬP0 Dx Ѝx'G-@P 00/S (QP 00Q  GAZP$0 0`0S PR뤀夐p0 座P$0S@$<jP@D0 40 @D('-P PP'<'PA-M`P@p`P5(10S Ѝ 0RP  0RP !0: S!P ါPZ$0 bPW P F$ P W0 @D광'P;PP0@-:(4@: SM=0P - \ 00[ P0 p 0: S ,Ѝ000  tP:P/  0 fA-pQ?ZdV`rP#0H!@1@0S/0(DS7 (1!0 0 0 00! "4S piP#p0 ძ"0 40Ѝ@$<@0(DS PL(DPL(DP 啪00 0-Ox'|'\!%X!%-Q('O-J#Q30` P (tJM Mp40CS񟗄803 P x30S >P0: S* XP2,3,0(So0S| (4S~ 0S20S 4m0C?o2 000! "p"▩p*#0 "1X!#Z/ Z\20S0 0 D" J>0@Pz=0 C1z᭩ Jލ Ѝ  ⎩ Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40 Pz ဪP#╪P" 0 `0 + D`\ QX00O0S0(4 008 00d'\'x'|'\!%X!%DQ'PmQQFQ/O-p@M W 0DQ 0S08 0<000SPP0C080pG0S 0`S : 08 0 x! x3  P< J"@0  0R X2@ @?{Q*7"@0 ?0嘰 R ᶠP` dЍTT / U ` `@QQ''Q' 'Rs@-Ѝp@ 0@`P8Q!08  7P!0 R8'Q0@-@MPP_00<00S  = J"Ѝ08'G-`QM MJP㠔@ Y #p P 0p 0PP=! SR J(Tݍ Ѝ↩PJ!8 = $ HL0RP J(L0 00QJv!8 PT*RA?R`RG- QP 000aq@T+00CS0opT0 0S0T@ 0 S@ 0 P 0S@ 0S0 0 S P <'H' %(% 0 0 S00@-@R00000S0@000S `P LP40P蘑''<'' zR8'p@-PP 0S|p `@P` @P0/S000000f PR @@@pRR<'h0 RX R  H R/< R/ $R/Q/ <''''l0A-0S X0XP@0P`PpT R S> x0@8'<'ؿ%RC-b@ 0,MS0S/,Ѝ0 0P50C S>$d$,$d$#D$d$d$X$X$x20S 0X0 00!P 0 000! " PPP  0!$:$!5 0!0 㓝 Iz X B(4 : S>  S8  S%  S04 0L! H0 J $!?19P6 S  S0  S04=! 0400S ̈́!!" # "040+04 4P0P 00   0 O<'8'S6SRSnS d'FSp@-8M@  6D 0`P`/U`$ $ @ 0kP8ЍpSSA-t1hM0@S T|hЍA`Z(V="(<p@|1WpP0 0000p084 X40CSH$0"60"$J0( E4 CR+x <uhЍB>'P3S+<  l4'*SSSSB@-@XM="p:(0 XЍS7@-@Pp rP Q Ѝ0 0  'J Ѝ0@!J0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 30a@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 0PpANQ0 C S*80P @-  //ᤑ'SA-@8q8`Q PC-PQPUPQ S A蕥Aj :UP0 dd巡? 0:S@ 0S000 t,`'%"Tؿ%9T/s@- `0P PQ10*@PЍp0S @mR! bR kR% + 0*S xS SwR! /QP0@P0$+* &0!SP@P0PA- 0Sm`PpP Y0P# X p R 000R p0000S , P0=0 @PᆜRTh'fTTs@-@`P0C30 0  R R00P@P0@( 0ЍpPE 00h'@-  H㌞ؿ%T0 Rr @-/H!%@-4@4H(G GGpؿ%-UUVWO-px 5@ \Pp`0, [/00 `rXO-lM/PoP{c@P p`0p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <zP񟗳8H62H68H6H6H6H6H608H6@88 8(8H6H6H6H6H8H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H677H6H677H677H6H6H6H6H6H6H6H6H626H6H6H6H677p7H6H6H6H6T8|7H6H627H67H67H67H6H6H6H6H6H6H6d55H655H65H6666 6H6(6h666666666H66`N>4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<= 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eB Q PAAAAAAAAAAAA !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0㕚1Pd Hd'\t'h''0%X%H!%ؿ%<'%'X\&X'X!%Xx'|'\!%'4''fT \!%!%!%|!%r!%h!%'0 %݀l'sYXUY0Y(%O3Y\YXY+ %MZnǀZ. ''T!%~Y8''`.YYؿ%Q' 'YY'ZZ'*Z&'''''P!%`'t,`&y' G 0.đ'| %%Zh',% \C#%L#!QC'0   0G 5가z0P  , G# 01F  1@ DP00F *8P`1*PE 1E  1D s1 1C1WPC1PB $2B  42A  D2A  T2p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C }0 0S3# C*SS8C0U Pg000Sv|30UӈePE3PhPN0000S 3 Y0P  /h'l0P/`0p@-0 PL@LPP@0@kP6 Bh'đ'ZZؿ%d'\A-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ 輑'p@-@@0/SN00N P\WpPQP`Q*C0CT030@"L00Q*pQc\@-1MP M AaqRP/P :0P0Sۍ Ѝ.S@T|`l @ @ d'\\]#] f,] N]m]}]]O-cM M33 "@pe 3]PW0`0 00S 0f0 0 0UP`` 00 ;RSVz @0 0;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 受 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S 匙0S s  0l 0 x{@T *0S0T00  R S 0 $ ' ] ^ؿ%"^]C-`PMM RP p\SP RT P0S #  0S"ᮔ\S R. gS PS$ SS GS  ᙔ 0 0=pS sS0S00 R @@@(PP+P m@P p P ; 0 0T ۍЍ,^^^ 'E^v^A-PP 0Sp`p@PL P40  R p`@@ @^^ 'X0A-@0LPL`LpT  SZ 唘0@ 'ؿ%$_`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  ٓ04≳P 0S/  00p0S/  0`0! @0/S000 0D  / '''('N_k_0A-j40@TPp 00S0o`0 00/S @Tx0T0oBP0 SD fP04 '''2A-0@SP' 0`.S0.S0S/S XZP 0 Q CR S.R  S.R0S/S  10S410S 4P:4 CSR ! Q`V 0/S0S.00 ps  00C0V0<0J `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@%A-Q@pW : J($S20d 000CS100 0=P  0 R ⨁0≎ᩑC  S@ 3. b 30   J(T0Pu[[P081  1 Є0(p [P0<x TP0@ MP00  0 DPP u00 09Pl #PK=Ђ;PP P <'fgCgbggggg'// Qp@-(0PS$ l` &@P|-t 0000X0 `#V0  @p~\g'hUhO-P`P Ѝ#p :0J84YqW V#/00p0K0CSt3l IPi0<00H3  _  d ( |qp  }? $004000JH1P tn@0 B(1<P l`<0 㓍 H K06S 0S 3 CRUꨀdLgSy K CRZ0 40r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $ R(4  @0&"*4*0000 02S($0 *4($040)($84  R KS 0 0 40r;;00 00KS8  0( $ ' 'hh'zhhhO-z4@SM- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA 0CS@P hDP0P 0@00aT8@pɪ,'A-ppP`000H6@S60 0N6000@0CS000SA8'4'p@-P`@T PV 0@p@@-PG-Q=0@T: 0S SW@0 Y =!P P0 =W CWX00CS00 V 0 0 0{@p`,'kD#%kkH#%C-3sPc 0 ^p3@0! 0  0004 B @3 3 00`D5蒟 0@ Ѝ/R@R R@ m&@ B&Q ȜȜȜȜȜȜȜȜȜȜȜȜȜȜȜȜȜȜȜȜȜ ܞȜȜȜȜL8< Ȝ@0=S0  "?R 9R:BPԜ(t0LD|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]%' 'k''k0@- '*l0s@-0P`0oZ0`0@S P 0R@P@<  UP@40S00S ,0ST P000 R  Ѝp'$'8"%Jl [l@-L ^ ,Tȡ|l`@\T @@~, \ 1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !lllO-`pu딠P @%R@W &R X(4! 0[00 @P@ P@ Ѝ'l@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F2P@$ P@D ;X'rp@-@P0)Sp'O-@`p04MTV TY T( T) #T! @$TU "T 0@#SP  +4Ѝ'0DSYG x@W'0I @S 0 0@SP'Y00p0p!ւ W! sz! m0  @@P! `0  @PWWM'T@@p@P, @⠂ 'lllrO-p`M8P谟蠟4!@ 00 R@ 0DS U# 0 \ 00S^^ :U 00SY` p PU @ 0DS Ѝ'` C-`p 0BS00@SP! @ 00 TPP@@ Ѝ'G-`dP0@S! p0 00PP@'@-@MP2`PL0P  IR NRpp PpEp@@0PS@ $z2Ѝ'lPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P13/3Sp0@*2PH0@P 0,bS@3*,"%4"%'$'@P/-0 /RRR00'@-@PMލ0/S X6p 1p 0RP 0RP;p@-`\1@}P 1D0p@22<0"SP Vp5'mp@-T` RpH0@Q 8 PP 1pp@'!%%mO-pMWR 0S)P t}B000000000CS020S 3@T  U tU`Wi10828b0400@/Sp?EpPI0S0/p0CS0oppW00E2000pA0P00 }00-1 hU \U00CS0810S 00CS0 0W00 pR0S/S0@D00 2@ P  R*0000t/S0S P 0/0CS0 pG0S 00CS0001@1@1@'8'4'"m%m,"%'4"%f;A-`p0@00咄P 00CS000S q0P0CS0d00S b%@ HW 406 R0S 0Q8'4')m8"%'G-2BMQ8)r0@T%,V@P' 0.S00.S000/SSJX20Pp  `PF s~ ePZ( `V+CPP "` B0` E0E{`@0-S0SH1@T@<UPU0]Pw0S S 0pP0: S W F/pPXP PW ^0S| Z)/pPsЍ8"%Sm,'Vm m'cmomm@-$0Q @ =T @'%mmp@-L@Q70P000S LTPP 0S}@@OP 101P00CS00 UP 0 7P0p}T,'m'mH#%nG-pPp@R` V101 Pp Pp `b\TQ @0T! \0DQS񟗀 (ܷ@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 O 0 0SY00CS00 O 0 O 1 0d1@ @ @ @ @ @\@@H#%knA-@ ` PR 0R 0S S\Op0S0 R O0S  OU  OTO| xOb Td@00CS00 >O 0 AO0#%$'x'}L#%D#% 0@-Pf( 0圠$'@-@(0Q nP$'@-x0@T   @@@@ @@00S 4060S 'jЍ$' '8"%-$0@- R    뀓'-@-   0@-뀓'-@-0@0z H@-P@`o =@-@-   3@-@--@-00T " ЍЍ/p@-P@H p@-@-   ЍЍ/ 0H P @-4 4O,P / p %n<'0/H'p@-@nPPPP ኀp` 厀`P ~p` 傀`ps@-PG50@T t0t`6 N ^2h0@T PPT0 0@ ?Q@DЍp,'*8"%B H'x'A-`P0@S'X<0P 0宭`p0 ' |06S 00S PЍk @0t0S0T.S H'N@oam 0    /H'@-@TЍ0Ѝ0CSDDDDDdd  000 P 0 ;6@ 00 0@-@M PU PP 00zp ,P   HPP 0!zp  ,  Ѝ0 x0 0H'!%!%@-@P 0S0S 5P 00 0\ Ѝx'G-`0S q0P00 $@儡T0SX{'@d1$@00CS0D10S &Ѝ00S P UYlz1  R *P00CS00S UC0S8CUP-@ &0S#8'4'H'oC-c@PP^0M& S'_,똓sQ$Lx@d888888888888S#$0@30S rK0S 2$P@@T 7L^0S 0S@-,T ^0S$0 0 @^0S 0S$0S 20S H, @@$@+!,10S pH0S hHo^0S 0S$0S @TM$@P10S RH,10S IH 10S @H00S 7H ) 0$ 6 $0?o2$0-0$ R  h00S H 6@}L<K+  Ѝ8"%'H''o0#%G-PMp@k+0 `㠀堐堠APP +Vx0$`W U ^0S W P 0`SO+Ѝ$'#%8"%H'P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/,"%4"%'H'A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S SH'8"%G-P䑟 M^`AV $`*pWT0尡p0p00WZ 0S- |1|a4hKlfK dK00CS00 J 0= IL00CS00 J 0 J  N^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 l* Ѝ8"%H'$'P'D#%^A-@ M p(* 0 0P{@T/ 0S0$`V@ 000;P 0`@0T$0 R ^ R 0 R 0$0 $0&* Ѝ`0$'H'8"%G-`倂Fo@p0媢S' 0S$ L2LRH23J8JY8(JVJ00CS00 8J 0 JQV000  'P7 V a< 0$000CS0l10SG  E >FP P00CS010S 0C00CS0 VVp00S $0$0CS0|00S 0S0S0000k3%J8#JG 0I8"%P'D#%$'ooo8'H'4'op@-42M000000 20S 00S 1 `1=3II0Q@TI1vIPP& |1  1@2@0S @T H1 tD@I8I$1SI0S  1$ ލpA 0 000 0BP00CS0 0@ a0 00x0 ?00CS0 0S IlIL0IX00S @00S ,'8"%P'$'oD#%o0'pH'8'p4'0@-00`o00 00^0$MSP4P @(000P  p}&P 00S {?{0 p000CS0(00S ($Ѝ8"%8'p4'C-@?uM000@H0?_00?0P@ 0,@:(0@ ? `0d00@T 1PPpo0 `0~@T pd0hP 00o 0lP@T 000P0l $00`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0p>0S$0S ph@PnT@ xP H0N7S 7S7 >0S800SD -0000,0(00 0p(0P =&0S67S300S 0 0S+00000\= 8 z =, {p@ P P< ,`,Pz0 < M8 <V  ,( z%P000<<0S @3 @J$ 0 $ R 0T<<<n1(Hh@T: =pP `P I00CS00 G 0PppH@T4`@T @ [00CS00 G 0 H@`@T0k PU#00CS00 zG 0 :[G 00CS00 fG 0  ^BP @P07X:0P /PP@HP$: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 vH$0SP0077S 0C8#8S0$$)SS C708#8S1CP0 Q A!QF8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  88 @  (00(00@070040+7<000L(P7 x7H 00R0( ?$0SP0078GQhJ 0d'000 000 L7 0D'0@'00$(007  10103/$0 6 G6& 6& FL0S PL8 6 d6 @ Re 4 0  ` $E ,6@, Ux,&00CS0 sXX60S /ⴗP (60S%,0yS56$5 h0 Md5,( ,0Z0000",0( T#0E$0(0S,? $ 5 50S 4,0S p-xt<$040S 0 @0 BPDT?0 0<0$0 0C0 000$D0004 8h\X+R00CS030S ,P) 40S*T0SXRK8 3 X3 T3 \ 3 0X3C*00=<3 0 0S '|0R"C"0 0 (3 B hOL00S0|P}0x"0C0000QBK8 X2B  $2  2 \ 2 8*00 02 T0S!00CS0 1 R   01D0S$uߍ;10S 0!SSsX1 08 L0H@lKi|10@0@0S 0 @0ST1 0$ @0S  0@0s0 R#0S0   B  @0S @0S7S@<N D0 L00S ;x'('H'$'$'8"%` '8'p ','4'P'D#%4p`#%,'8'l,%H#%0#%L#%'p0''!'(' 9pB H' @,0S0  =,0Sh@@P uFH0 H ,000hG@T(0Sp0 t0v,0 0r,o)DVHE0/H'0 /H'0 /T'0/T' 0  /H'P@-@(P@a<0 QP cR   XpH'0 S0/H'0@-0M0/0@0yP wP 50: Sl  S` PЍ0wP0 : S}# PPx'=kjpp@-Px@x`M$P*00S v#0`00``005"`$#$ЍpH','@-h@P$0'0 RP  B R    H'//C-LM*8^8 p@<(P@0` D, ` 0 DLЍ*H#%pA-@P`u8pWU WNI" 00s(#p4'x'O-pWC R``%` P0S:S2E@А @0S,W@  @0T/S/00Mq0 00S00P R:R0:SPPP@DOi"S","%4"%|'@-@MP/p gP㨐K  0 @ T9vp0 @~0!0Px 0pWZ0S 0 `T0S 0S 0 S^vp @O" f`P T T T0{@@T >0DS|'PA- @PM`Rkp1000  8p"XZU hCB Q PBLBQ8C 00AS 00CS00 B 0* 00CS00 vB 0 ЍQ PBB000M |00CS0 TBBHD00S ;,[x'pppH#%8'ppp4'pp@-P@@Pp 0S%SpP @h p@-P8@Pp 0R Pp@ - @0@ R0S P P\ 0!%'G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00lPPp8''!%4'A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@H%Ppp0V:SP0@w@x''!%pA-`P倀000|Vp00CS0T00SAl0Sp00Ml@T`8''4'0A-pPS R+<`a@T"W p000p 0 @0 0 Ho00CS0H00S (` P `@|'8'4'p@-P$@Pp0P0@ @-L@000@00 ,l00CS000S@8'|'4'O-PM/`@ 0GP @@@ (otP000 0S 0S 000Ѝ#   P@ |j3P @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ  $P %pP A0000S R  pJt#P R  R (sP0 * R; R 60@@Da P R  +k T@0000S R    BR =D R9 7 ax'p!%|'D#%p8'q4"%q4'O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hB?01 P@PЍbPEU00p`@[ Q Dl|V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0STYT 0s P k@Tq,''H#%&q'x'!%p@-`P0000S S@~K000 00 00000CS0p00Spp@8'4'0@-x@M0 0000\0P>00$K 00CS0$00S Ѝ0@Ѝ08'8"%4'@-gP 0S;KO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0R\PW>= >0 @ TW 8L> P 4>>0 R @ T Ѝ>>A00CS00 0> 0 00  x100/dPXP! l zZZW Y{>x>TfqPWn>W~`F3kWxWtWq ~W 0` @ p`*>`'uq,'yq q*qRqqqqqH#%x'`qqrr.rKrO- MLBLRp10@0`V' VV:V  VF /V   BR 7` F RP! R  |a[  0000SH9B@P   ~p[/R 0/S 0oE_P  Ѝ_ @TW 0 BR  R  BR    BR  ^ Y 4"%''8"% A-(A0S 0PS0 0aqP0S00 P000h00CS00S P 0SRh`hp0P RP000g000CS00S '8'4''s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@L `M@E0S00S=STL00 <0 R0AD1U0 S 0S("%'4'A-dp`0PS@  R R00PH @'O-rPԂ0M00B00 00$`0040Cz $4`PP00CS0E0S00CS020S  H6nP+0S 000PDnP 'g P >10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (Q P PAP 0 SR BR  R  B ~  ` B `FAQV  RP P'4"%8''4'H' 1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xQBP  `V' Q`:00Q@  @% Y0S" SP P@P P DoQP @@` '''t#%A-XPX@X`P0p00-f0p0CS00S '8'4'p@-P9@i40@ p'@-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc  \QQ PP$` $0( }}P1 0$0 $`( r}P%H0r,PP0 QPQ P !$ P80QP*0$0eP e`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S  @p3Xr O- P@M0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ R0A$x RP R  \$$ЍlPX9$P| 0U0/Sd 00E pP $0S/00E0S``0` xQP 0S V/00D0x RP0  Q: 0 R /00@>U0P .Z. B/o" R  P V0 f$';4'0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P }$$$pc0$000CS0H00S 7 0S }0P'8'4'p@-@ PTp 0@ @@'G-p 00 S QA0P 耟`V w`R`F@ V D@@@@@@@S`` S =QQ RU  N0P   P 0G-`@ M G0P 㯂(q000e U00SV-00E@`PIPE@T Ѝ00CS0@'O- R@@0`-SPM S! C RL8?So @Sy 00C Sh70 0 zH`/0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666Q0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w00 00v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   _ ~ Y   0S  QAQ$AQ!   Q R V  BR + `w~  0 BR儡  BR  ~ ~  `K E~paQ 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  004'' '' 8"%'l'("%'t#%O-$M000 Z0 0H'0=,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0o@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A9 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Z6@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R'%%''L&L&L&L&l%''''X'3  AQ AQ~00AQ ~ K R  BR ~0 0  BR z~0 0t @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00qP 000l0 GR00#S00 B00S0p0 G0 B0 [m$Ѝ|00S[0000p0SQ ''4"%8"%[r'' $'srrrO-0M Pp0 5 500 E 00B 00~S P0 0`Z Z":Z =Z Z! Z     BR  W PR 0 AAK J R񟗋,),,,))$+x**Y 0S`Ѝ0S 0S0@S0=S( ( # #00CS00 w /00w00  4#00CS0 0 u #000P00u00"00CS00 00 00(0S 0  CR  SR`0C 0 Y 0"00CS00 v 00v000aS000 S 00CS00 ~  BR   Zl!`00000~00  `  000{  BR !  P  AA ^  ~R[=Z0SV 00|i d ` ꌠ't#%'4"%$''G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S7000`0`0CS0!0 0@#p  G 0  X 0  R 000 0p 8"%'4"%',"%$' ' @-0 @4"%O-XAX`0$M`F*00V00CS000S 0S @pWZ00萠@ q0 ZSꙂ! P00 R @|'8'4'8"%A-`!@S1p@!P H ' ZTl1@WVK \1N0S. U 0S0PS\PX[V 1Up>U $$060S& $$$V' 'U 0S PP ZXZP HHpV WT 0  ',''|'8"%!%tOs08 N R S  0S  P _8"%O-pR0`BM0 pP 0S0S ЍP880@000$00 #"P%:T 0S0 10S 160SdTf P c100CS010S 0S  02, \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00>TP 000ꠞ'8'|' '8"%D#%4' G-pPE@P ?P1N0St `T@![T @[TpT m`㜠@0S0S 0S0S$`@Y 0 X 000 .8"%!%jt|'A-@P*P PT0Q 0S zlP@ pP@ ZP@z|06 R0S@@d`Q 0p* 0 0 Sku,'8"%H#%O-PPdPt,M @P Y8 U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0q(P I,P p0S 0S@3 P#Zp `X*00SL T0 @@0 00 00QBZR00 RiUX '*Y ^  pPX2 R  Y RRU@ *260S'  @ Y00P'  P0`0V 00' 0V0S(0S0S 0S06 P 0Q p$@J0S 0S @sԀ0U0X0S 0 S0C0 T0SY UX ) @0S 0Su<'|'u,'uu8"%p@-@3X``Q000 R 0S <1Rp aR!r0S 0 00D1  S @` 4` V0P 40``0S`0S]00CS0X00S ep800P0V0S 8'!%t|'5rO4'@1A-Q40@Sh%P`q0SP00CS00 B% 0 &0ZRp {R.?!%PlP000T0@0CS0800S |'u*utH#%!%t8'4'@- @ 00*,'@-@ @*p@-`@0 0 p 0Qp\ PU=%00p|'uA- 0p\b0@PU RP@ЍR R =RU "0Bh 'Rf 0 BRcXd eetdcddc) 1PU ^ S \R0 R  p ` Q\1 0 0A Q "Q" .  Q1 01p0} 0$ S0." W p 0p: !0}RQ 0 0\ $ `0" X00z Ux 0"  @PEr|'C vv$v v~'v!%*v0vA-@` tMTg 0SdPUf(iggglgffg hphxhhiiiDi(fidi|iLiXipiiigf S0S p#$" 00CS 0SDA0#w$;P  @`@P@PrUV0S 0S Pl\ЍP@@rP i 0S P ]PRPIP\ |klh0`aHPqPLUH %{ 0 SsPoE Bv P5 P2 P/ P, P) P& xus|'1݀W|GvLvQvTvoMCXv\vcvov3gv^nvtvvzvvv;v>vHAvDv8vvk:p@-@P\`TpU 0S@ @Tp|p@-Px`x0PP6 R@N0S2@@@0S. @D0    p 0 p|'8"%A-@1P0pS`3 R4 0N0S- PfUV0H@0S[UV0H@0 @000W0܀ ܀AUV(0H@V0H@U '8"%!%0A-(MP`p 0 000jT배p P@ `T0 @@ STO$\0 (ЍvO-P 0rM00S `1Q 100 0000S @P`Ѝ0SH  0 Q S/R LCUPͱ Q 000Z00S* 1P@  Q:Q[@"00S+@HP>"@00CS00 ! 0 ( `P@0 QH @V0 0ꠘ'П''' |'v,"%'vD#%4"%A-M`.P4q4A0S e 6V@oP 1T~!0^0\ 0P!1U00V0S^0SP60S .0S !PP P $ЍP ^X8 0P0C?o20sꠞ'8"%D#%L#%#%v'0S/p@-@000hSP00CS0p00Spp@*00S %00CS0 P@T` `@V0`0T0@0l0S V00T00p@P8'4'8"%p@-l@0P00#SP 00CS0 Ip@800S 8'Os4'p@-P@PUr p@-IPw@-KPwp@-PK@NpA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S ,"%8'4'P @-(R 00C00/w,"%00  0 00   /,"%'p@-@tPt`0000S0 000D0 00CS0p,00Spp@<00fK8',"%'4'@-D@ 00040 00CS000S@ 8''4'G-qA0@0000I?o2 V0SPkPP) 00>0 000E000PS V 00CS0l00SG E  P0(` 0`008',"%'4'T 000@0A00CS0/00S/8',"%4'p@-$@P0 0C0C0p,"%'p@-(P(`@0@D00C0p,"%'( A00C 00 0C0/,"%'-A-@P(MHp@`DpPVP u T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@kM0 P p(w T4O-` 0UPPm  Ÿ00 C RS ) W0:ꗁ;#p¿  M P  ( :PpJCJ$WP0 W k@  0@xt[  XxtRY  M p~ W @0 A W0 @0 5T0 S ]OPOI0SMڧ0HS xy; 0  0\1Pbx| ,' sxH#%xx1x Nx;xyx]xx'xx BR00/0S0/@0S/ R /0@-00@00C S  RR R1\ * DЍ!%#%V:A-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A v` 0F S@hȠԠ V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 #%!%0'4' G-pc0@0 T T+P,0S)㰀" PP @ុ @@`P  0RP `FFa@@T 0 #% p@-`0$P P g 0R$, (@R   RP3Pf    Q . 00000S@p 0 BRp@ Q080@ p#%?|@-y0 000#%@-@oPp@-. @fP P @0 000p` P 0`@`#% O-С`P0 $ @CPp/0 CR00SY%3PB'V 0 H100SD (100S @ 0YP@0@Y PX @PW W! V! s000 @(pGWoVP0V     y 000#%8 O-PKM 0 5@00 04 P00v400D$0se`P n 0S ? 40  |4 aet$0000 `SH4 ` o,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  ;0 0C0Ps000>0 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S Sd2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PP@0000 F@!00CS0 0000DP38 .1@@*pb0PC2P \00$0-,M00CS0`f R {00^#%,'4"%8'!%,"%'4's|0O-鼯弿pM0ϟ  Q"/O/0 0202280 `00T/20S0S 2Y I8lPh@PdT4H/Q00S; P.Q00S2 0P0C0p0000PbT.00CS0*@.0p210SxPpNTP"Pg KPEpE U0@#S?PPPPPPĮPPPPTPPPPPPPP<PPPPPp6p Pu00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@WX00@S"MWP'PGFp0000Pg<0 0CS00C0~00P00C0l0P@/00@S0P@" Y p0P0C0t0E`0@?o? @2;R0S 6\P\Pp ?PPpppWppUpW 6;E S< 5:0 S0 U0C *0?0%3?P00 Q~  B  PA0U!*00%60%3?00 Q~  B  ?PA00 QPA~P•3U5*00%90%6?00 Q~  B  A0%3?00 Q~A• ?P B 00  R P B ~ P  B u300%<0%9?00 Q~  B  A0%6?00 Q~A•  B 0%3?00  R~   B  U?p00%?0%p0PU 60 \0 e00CS0?H1P@0H21SZ0 0#<R00SQ 0SJ60PS܀V 0@P0 P>WUT@>P0 |P0 &PU000@$P 0Ѝ #%!% ,"% 0'4'|||||}'}B}''4"%% @''4"%) '(   P 0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0YP0  0{P BP 10 }0 01{W00E000C00Q#PpIM}PP 1 " )00 0: <}P,p @R<2 3 p BR *p) p|2  BR P=  ŤJ= P2 Y%W :W5 #Wh~` 0P 0 aU.0G P p BR pYpT3 0 @ R  B 0p3pP3@  BR 5p02!R1S $H<Q C d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 %0 0 0 S00aߍ0  p0 `0  H0 D0 H00S^S,0W 0,'8"%$'#% 4"%0'*N} G-Vp0 001 P" 000*P60000000T000<,<0$00pH}@P 0 R y0a` m    L0@0S 0 00zTu P0, R\Pz, 000@ 00 00 R, RʹP4 00300 0000    BR   00` P 0000 CR Sl 0 qP P`  ``s 0 0008 @0C 0 00`0 SlvP X@0 R   L000`0S+0 R Ӻ00P 0 R000 0  P 0@S P 000 s`@`0P0y0` P/ 00000PU# T 0S P0@P0@00S0P0S0S 000@Ѝ0$00p#%f}JZ #%8"%A-Q@`Q` @ p0 P0 0X@p 0EP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P /`P l0 08 00C004`ЍRQ#%!%|}} A-P0 2P@/ 000`(P 000p0@``@@P 0`0 U000 ~PPe``PP0S #%8"%}p@-@|PP (0 @P P 00000Sp $pp#%} P/0S/80 P/0S Q/0ꈜ'A-@Pp` 00p` P@-` <P0@ pT@R PP  ; Ѝ M@P;  w P=p(#% 0P/ሜ'RQA-`Pp%<pWpPpW@ U ;`0 R@<P P.6 0区;0 (#%~~A-`P@xpT@Q00C0U U w4@P0 P;ꈜ'p@-X@X`0P0000Y400CS0p00Spp@!8''4'p@-PX0@TpU@PU@TpPL;Pꈜ'|0p@- PR @RP ;;0 _P `0;D6 p(#%~p@-@tP0 S000C T  D;P 0S;,0O@dA T @0@p@(#%gfff'p@-`P0 Sڜ S  :@P t0 R@U :p_0S 0 S :@Q0S ꈜ''(#%p@-P @0Pp 0  0p舜'@0@-@ P  Q 3@:0ꈜ' 0 P/ R/ꈜ'C-LsP0 U00000@0CMS񟗮ptt` o:@P@2@忹 U`:@P2 R@Ux20S Tq X: T:`<"<B:@P2V0S' `7:p@! ;pP?:뷳P 1 岳z 0: S,:뤳00`l!x`\!l `V'jPP )5 0( V U0S000  (P @t5 0900CS000S Ѝ@pT 0PR4 DZ98'' j(#%8"% 0 ~4'Rp@-@P PP Up 4 |剸9p`U 9p0U 4 pEepO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  T 0S@@ `U H#%u*@0 3x$p@-P  @,9p R  #9p d0 Rp  9p 9p  9p눜'(#%p@-@PpD0 0RPPp03/8Pp舜'O-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P 3 8呷8Pz&sPP jT 80S_ ZPPZ8봡P000P000 S`|1 0R  u8pP\H B R% 3 ( C ]8PP ܱ R  S8PP UP J8ʱ R rP0 00CS0t00S T0 00`Q RPꈜ'`#%H#%D#%''~8'(#%~4'O-`0Pd#dCM`s`` `00 ;p(V( PEWUCc 0 pW` u@p00S0S9P20SU0SR0sS vS 并V`p0+S -S X嫶 @ @Q0 @R: fP     3PU 0 P0SAO0OЍVF p p0 %  " Q  %5S' m7p"2 Q  0Z7p0T հ00Ұm2 1 X0 M IU00 Dml,%t,3''0 H#%Z:yA-PQU 00CSQHq10SL R@ 0`0CS00 `01L00<S0S  H0qL0S 0CS>S0SSxh R 00CS00 - 0 ep@-@G,1P R-!Q)Tp D/o"PQ Q" P+ P' 060S  R 00S0VTp\ TR P R 1S 40 Ppძƫꘜ't'8"%8'4'@-@P @0P;WP4@-@P WP0  2 'ЀQA-@ 00CS00 P `tpt }?U UD?U!P0P0CS00 `$G-@Pp000 T`0h 0000CS0L00SGĴ0S 00S .@8''t'4'P P0  /\ Q0 S//ᘜ'C-QPbM pWw10S 0S@@U@21q0pWpS ,20S@20S YU U U@160S@@0S1N016 RC! R?0S@@0QM 5pF 0S1 T9 T ᆪp Y0BTV0000 00E>S/00 >5XppW 0a1ЍC親p@0N R UT Th ER60SЍQ Q"!030ꘜ' '8"%('PO-`@TP P@P ,ޫP0FpS`@ PBPBPɫP24 廫PP`tDa0S! 000-U 00CS0 PT40S 00CS0 40S P@U00P@`s䃟1 R 0PU TgR@`@VT @c儃Q0S 00S 6@@TP@P @HPP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tu@X P̱̑@DP; ?P`1 x10S PP0-S0SPV @X Xqp0S@ `p:0S5 0@0U000P1 qR ,pVP  00CS0\00S 0U00 P]L5qЀH#%݀'8'4'߀$AՀD#%A-@P P0` pUTA0S 00S Do0@0@000CS0 00S WPꘜ''8'4'p@-H@P02`S@20CSpᅨV02p蘜'40T0P?o20S 0S//ᘜ'C-p@`1010r!Q0@S10C1 ЍqXPU X2岼KP)1,를P 0S ᨼꘜ'l'@ 0P/!!R /ᘜ'p@-8P\2Sp@EB?\Bp蘜'0-MM01`"R !R X"R   1 1d"1!d2S ,DRPh1, ,;RP H!0,002R@P 1, @T0dS4`0P, U @T 0S ²P嬴00CS0 ! G3ῧ00 0$0(00D>S 000 2"!031ꘜ'l','8' 0@-`"dz똜'p@-L@('P᪙0PPp0C/U00p p@-T@TP0 0P0 `+0 0000CS0p00Spp@%8'0#%4'A-@R`P  #20PPEU`pp WDƫ0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S ŰsDP`0000 0C0'8'4'p@-@P@0SH00Spp@00CS00  0#%00#%00#%@-@ P奰*Ѝ虁-@-   Ѝ Ѝ/-@- 0  ЍЍ/0#% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`ᛘP$ 0S! l0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' ā 0#%0Q0#%@-@@0#%@-0rSɁ0G-p0 P0R(0帐@0=00Η=`ʗ`F@VPpPER000 S=S B`` R`ĥ`PG@4"%',"%0@- 4@ 00C00 0 0,Ѝ'0P P PR00/0@-HP@^ ^ R0L00 A-鸀(  R P(p`@pW p0S 0QPU  0S 0S   3/P@P00,'0SfA-@ဠPaU p`pp0S'STP@DAM'PP(  EB1.A-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T 4H#%O-@00Sp 00P㼀✠Z  0ݔ@PU* Ѝ`V Y   [ QʁeaP`0p','0@ R P=R/=R/A-`P0S=SPERPU@'\0\p!0qV@pT 0S 妃PVpp@','@-1`0@S @  PPV 0 `' Z h  `R Ѝ@'Dq   R <0 2/0`' 0R , R  00 0000@!L@0P U U0 Q00CS0`00S Ѝ@tY0#L 00P P Ѝ8"%88''4'-x0GM00h0 00MP  <0  40 Gߍ 0  0  e,'$'A-`p= P T@VPp ẢPZP0D @S= O 0V  @+*`ЍA50CK-GML000MP00$0 0  Gߍ,'p@-/X@P0`'@0U<F 0U`00 0p@'cj&"vTy!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝ'q('x'8"%'p@-@`TP000T 00CS0p,00Spp@@8'4's@-P@T@ aPP0 P00Ѝp@n` OP 0 @5F00000 00PЍp, 'A-PpU`A0  a&0\&@TP@ h0@00`,' @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =<@@L'C-pP@0聟rS``PW! 100S T! 0  ЍC]nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h@0 L @  !W P y,,'s@- P`?@P 0 Q   00 00CS000S 1ЍpQ     R T0000   <% 0 7%8'4' A-`pĀ@TP0U0  ᠠ !%&%0S R   0 02/0 %00 0000'#%8"%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@꺂,'PP@- 弪 W迂C-p000P0`-S㸁@TQ %@ 0@00`0CS0Vl10SR ЍCi Y@P=ᾒP ~0 @0 00  0 00 00000  0  RP 00 00=Ss Tt0T 10=S010C0 0P00 Ѝ8''#%8"%4'  'p@-@PTpt@p@-顴P@`P \!NP@ xP@ IP@P(P0 P pU߂,'00@/ 0S0@/s@-@ᒤ0 0IP`ቤ0S 0"S U1r0!l%*0S`0Tة000 @0C?o2R0SЍpj%{@-M@ (,P ލ ,P@D 0RQH0PP0@-M@ ,P ލ+P@D0 SPH0PP0@-M@ +P ލ+P0RP 0RPA-@`,PI0 0SC P+UA +PPPYpz+PJ! 0RAE#@- 0-RS# 0S0 00t% Ѝ0SX0 0P0S00 040,P$h ||   0@-0P!S@M0SPЍ0P{ 0SxPUo U U Po U M+P? <+PPEUR(pHXd P  P  P  P  P  P  P P p0St00@"+T @*0(S0)S0 0qop@-@`P(P} 0Sz00CStl,X oopP P0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fc0S0!SPpp(S0)S0S pp@-@P域PPE癟P.U)``0op=Pp0\0!S0P p(S0)S0S 劧p2 @-ק0F㍧΃D#%@-$0$0 00 x'D#%@- @ R1P\ * 凧ЍoO-@`@M"T0pD P-R lRC 5R -R| `'I@P{2 000E @PppGWP PW pGP〢倲PE0%S`|`PXepW ;sR R`6pTP`2TPU W@1 000 PPP@U aDP@ 1 6Ip LIP lh9ߦX奞@P H@P0S0Sp@IpN0 0 f `X0 R P!q *S07 0R dS 'pv   TƦTTs'o*%]ńH#%VԄ0@-DM/0   0@@DPU#D'@0 #   (0P x, pp LdDЍ0=tP <'|'x-Tt#%x0z&"vTyYyvp@-400S 0| 0x 0p0p p@0   PU P@P0P H0H P p  Pp0'0'8'L'#%'`#%H#%0#%D#%L#%p@-@ݜ0@Fa 0 0@0PU@0003A d0 R 00CS0H00S p@^@C0PCl'("%'8"%8''4'P/p@-@PTp000@p@-@PP \e 0\\ s00vZ t 0 W\\#LQ5$555555P5P5P5P5P5P5P5P5P5P5P5P5P55b '\ \\ "\  \M \^0? \^0@-000fnrtvaet P0030  C 1 01$v렓`P d` P  d2  Pd  x<s0 v0 t 0 ,Zp B`0 0 =0 Ht0  ?l c)v t0 < D"0P 00t  |j  v t  j 0et 0^p0P $0'S"Snt`X0S' L v t  ;0$0 $  0't 0 v t   0t 0NVBT\0 <aꠠ'H#%%BIUf%n(('d(|0C- 0tqMP` dp @P 0 Dp@PH 0p W ; PuY <YῗP0P 0ES, P cL0ES^Y0?S0 -S00PH0,Ѝ \00S00H 8APHH:  s@-0@0 0 \XPX`Q P 0Ѝp@00  P^ O-Mp:㰇PD[0䁟䑟䡟00SЍ @P 0S =㖇PP *[00  hc[h&P 00 Ta4i[DP 00 ,P |h 0$0l[P 0 0o[ P 00 P ]h 0(0 `Q 0 SP00CSH Gh0 0 0Sꥈ Ո^2و K2߈0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 /@0D 9K<@0(080$00= 0D00<00,0/+$@咖0@-0$ 0d8 Ѝ@-@4q000@-@4i000@-@(0(S00 0!0,0Ѝ`t p@-@PPٕ렖8垖<圖@嚖GPD[`▖U\吖`, 8q`V0,0p!@-@4'80,0@-@480,0&N@-8@F( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8y@0<<@00,0@-$  P Y Ѝt@- PYnt @- PYot p@-0MP`0@-S00(00P0 0  PrP 0( RT  0 0 S40(aJ03/Ѝp? A-@`PpQP-U@QᏕP00  PပP 0-U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp  h l p@-$@P0S -00Pp'Q+  0 BR@-  M| 0- BS^0@Q ^ 40 ? 0 C  / /''p@-hP@`V P,p葒`HV4$,!0'P;C-MPp`k@fT HV@P  @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        @uą0ST  ⶰlⴰ'" "X@ t@W `t @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY *Vl2<08 *(@@V  S W   2VxApr`VЍ00 d @V   Q  0넑0l  @ Tl}@ p/ems{Ŋ͊Պ݊  *1:AHOV^ds{  6LYfnt|Ċ̊Ԋ܊މ !)29@PW]emlz@-4 뿋ؿ%@-,0, P 0 0 'V?ؿ%Xs@-@`000 #S@P0S  0,V00S 0 VЍpƌ0S/#Sp@-@,P$pX 0P 00p'V@-PRP@ p`~p 0R" Ѝ貔0"S0SO 00SS  00@O%@-T唆PL0 Qp@0"SUЍ('(@-TyPL0 6p@q0"SUЍG('Wp@-h@P0S 0S 0SS <<< U   S(C000P 0p('Ėvp@-Px@Q dqUwP L0   P    pp@ @ ('0@-@PPM 0SLD00Ѝ000 0>P0 0 ꫍D'ÍO-Pp`PM 0S<;$ ,  P 0S _ߍPꃯ0Q 0S @s?0P P@ P@0 ST WpU: 0S  H 09/PV` 0`('ٍU3@-啓0S S S8 4 Ѝ S$ ЍwS7@-lP$ R\T;@ H$0S p (T T Ѝ0('\ 'p@-@P 0Sp@90PS 0P0Z00Sp@-2PD@D D`DpD0S00  ؿ%VC-P`PM 0S00(p/p0 AP" @/Q `0p0@1P T0p 'PH$0@@ 00Ѝ ꫍D'('G-@0X T HRD2D1H#<( 4 , (0 8 4 #4R! !4S !4S !4S h!4S Lp!P0S t0T!T0S \zp(HP8W ЍG要0S. a`` ᖽ 0^ 0 Y0US !S|  !3 \L0US:3 0U  $> 0t9pP% AHOV]d*mvBB(O-Q ,@QlP0QT 4QP@PQ,80S,00 80<0S804 <0P<PP<P1 QB"9`㤱8X0apS pR   <0RXP 00< S4P0S9`(Q (Q @P0S0 BS `a 0h R  R* P*da (Z̐ې0p('-ZCO-;$M p*bP 0$S  ߍS KP@T[D@P 늤40 婫X ZS' ("$0f0Qf/ j,2!S!R !SS0䡟1,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# S 0 Hp#> 0"448#8 R* 0S 0pjX P 0S 0 p1Sq j3  @21S jQ f/ j⥋01T T %Hl '('גVEW}}ΒWEV*&`'%A-P@p%P` %R 0R000005Sw D $0f0Q $Q  (' 'ړP'p@-0@kP  P$p@c$0@-0S ,P('@-P  P'O-@:P,kCM M00 86P( 8yP008C80p0SP :}P  @00 +Y x KP 1(p XE p@ =P$4 X p: 0 $0%P$0S  $02P P pGGqrP,圙圩$ pW 0S$00k P$00 P$00$0 P$00   @P pWa 0SY] 0 0$0P @2 8$ 1\ t$ +^P( $0S  S;Ƒ8@e0;RZ(( P  +%坌P 唌 P0 0$0P$0S ++RP0 0 1 |x P 0 0$0gP$0T0 <g P 0 0$0VP$0`0 V P 0 0$0EP$0X0 E P 0 0$04P$0\0 |4P l/P 0 0$0P$0d0 (P  50$0 P$07   P  l50$0P$07 { P  (50$0P$07r jd P  40$0P$07a Y$؋ P 0 0$0P$0x0P HNj P 0 0$0P$0|0? 780aJ0S0S  |aP0X: `X0 H0I070t 0 ST 7 . 2Z/ \_0S 1 #0Գ000S05 0  3000"0$0 0 0 $0]P @$0!S D @ 0$0|2$ 2 ,@pCލ Ѝ0S 0Έ  QP0 hP0!A"A师0S 0崡0S 0C RS񟗚PndPnddodPnddnddddPn Hڦ0S0 0S Pz  0$S No 0 S Pe ~ 0$S~ 9t 0STsl 0 Sk PI b 0$Sb >W (' ÍD-( I(]hm7MWP'o~FX'ƣh'ʔ۔ ,7KfD' %֕s@-`0PU V  P倅@P h(Ѝp`PD! 00x0@V  Q$00S @-00#%p@-@5S4 0PSP p@_Pp0S 5S 1S !N|Pp5S T \Pp< HPpr(( PpN('P'c/edArdAMs@- 1 AP(000(`;a5 S4 5S P0S 0S005S  Pt: p0pP;"5S ЍpH DlP8 WEV('fd^mdo#%`sP'gd@-@P f/T@P' 0 I#%'md0S/!  -3@-PT HP 0S S@@ ḎP@Ѝ0@ Ѝ/(%p@-4@4PQ@p@`  @#%@-t@t0MQh  `P0cS CS SS 4sS00ۍ0 'Rf-0@-MM@` PP 00YSP ,إۍЍ0nPVfx 0 '%@-@M0 vP  ۍ膝{p@-@$P  0p@ oꀿ%'' @-YMM@p p\"YލЍ<0< S <fCPژ10YS<0<0rdAߝ@-PM`p<@(<n=l==`8<== rЍ@-P0@ 0$S0SA 0`Sp7 TQ,BQQ,#Qt10S+ 8@0  000!C0ASx|x|x|xy|x|x|xx|xx|x|x|x|x|xw0yc0A R Ѝ8c< 0 ? 0?`(pV< 0|? X0> L0 80> ,0 0> 0 ' @@-\@\0MQP  HP 0nS yS0 $ä00ۍ '(]P `00CS`0p S00 P0S X0X /X*(%G-P 0p`0@P KpGiT@Y @ 0@hvHPPp E&p〠 0  a៵ U E`V `` X Ѝ蓞=8v%O-@M MhP`IX%XTuTT0S0#!pD P ₇P  P'p0 p( P   NTt`(p P  XP `v Z5P<08 Tt`( p P  XP R 0(0Ss`, p P  XP ; 0,0xSXs`0 tp P  nXP 4$ 000$Sr`8 ]p P  WXP  080Rr`4 Fp P  @XP l 040xRDr`< /p~ P  )XP  0<0 Rq`$pg P  XP  04Qq`$pP P  WP  04xQ`$p: P  WP 8 04(Qp`P p# P  WP  0P0P|p`T P  WP n 0T0ۍ Ѝ螞'%d! ~֞>Ys۟DeǠ*HgO-M@ Mʢp PS `V30S0`S<P`P8apEbWWnF`0E `F 8ġ⠃됳0A"S0#1` pVp P( ATPD#" 88h DžP0S  3/ PA W P ,ࠐRx%.A p P" 4SA4`S>R<4`P92a0C" 20< S :A( "YA x5|%.A  p` P0 x5< A B0qpA A 0Q<0PAHx[0x5< 0RA | cP 0 000S P0`p崀(V R s S 0 00 0`PX@ ލ Ѝԡ#%d! ߡ~! 5lŢ}Ԣ'% ' - BR0 R ' A-P@  R1!  0 0  廲X0 嵲X0 p寲X0 \婲 ( Ho , <k 0 0g 8 $c 4 _ < [ $W $S $O $K P G T C s0p 1R0S*0X`p\PQ 0 Vl^Acv+P" 2<HU\gluŤԤ!AiQO-pᔀ 2MSR R@`aX 8QU ,[R 0K0 E  ᜃ0@"  8 6,  / ᆃ`@04"  $ 0  !R21`   0S 0C RjSg44t4T4  1 0 0p 8QI CT  <0P+8܃Q* 8 0A0+ @y 2<0P+8ƒQ *ЍO蘱0 0 0 0pV  dQ 8 T ЍOЍu~P" *%˥ޥA-@Pp(D0 <``8SAau 0`  0`( "4`#/A-P@ "440 "440  ((,,004488<$<"444$D"444$D"444$P"444$"444$`"444PTTXlpXQl`pQ("448("448P`0@`V@  |0TP0A0T0A T"440A@'@-@l40Pm087f/rWEV@-@LP TP8#!00Q@WEV@'80@-0@S B08f/H' 0\ P0//@-$L0 D; <<k8@8P(` R 0, Uؿ%0$%P7@-@ PTiP0 08P8 0 p0 VF Ѝ0('vdP0@?o2P0S@- p`PB@P =P 8P 3P@V@l*PH@T@T p0 4F@@ ЍZO5J7('udP0@-PM xdP@` p DE 0 400+ +Ѝ0('zd@Ʀs@-@ p E0  0 0`P   0   0  h0  P0  8Ѝp('td@**Ho( p@-@PM`P = p  ( V V dPЍp (vzH( " p 0iE 0('}d(@~d(*<0@-PM @ UzP 8EE4P 0 p0 @EЍ0J('{dЀPC-`0@Pp!匁匑,M00 p0SP@TTA  p  0EeP qP p` $0Q 00S*Q@P DQVW RV 0o R00 tP 0S,Ѝ00* *  `@l,%u('|dx*Ä֨@-P$M /@P j p pD0P  &B0P 0P 0Pp@Κ&p@ 0x>@d8p@9U@@巚$Pptcidyara:rbmngnts30D S/ 3C5C$1 4! 8<0/0'0@-4A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @0' 213/P/X'A-PT0p(,`}@}},0T@@DA??@0'?0@-0@0 (20,20z0P!P300'> 0R//G-`0(,Bp Pz ED}@PPaW ,20CS(20CS GR00'p@-@`42SM%^ A E 82<"@: 0(2,"3Ѝp@.,峙<"82E@d`妙,"(20@X"\4Ѝp@0'%%Ԯ 3 s@-P`  0SЍp00S@0"S1Ds@-$M@Gz00  0 0^ *Bؿ%A-`P 0p @Tʬ@ /,s 0d  ? uqp  RЍAL`0S`@D@,z Ѝ%%ղ0'A-0ppP@`ph!14P S H d" R S R 0 lxU0'&p@-4@P0Sd( ~0B1p0'O-PTM0$ (00#,0x0@08030匠s0<080S: (2,3`E(0,4 0gy40D$04 @?\y$0 0Uy$0  00 Ly@ D00bd"P ?$0( 00,0 套 0 RL0 $R0 S t2000#1-R0" 8L2L`P@4]ux0P00S zP  yP  yP% L`k0L00 S? y0g2< tjE%KUP1D?C$5\"0xP@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0ha @$PTЍ P @꣹Z0'%%b'(%%ٳ-s@-@ =00CS0 7P` Pp pp>0 P00CS070 Y@oЍp@Ѝ/(%O-a0 p>Pp/B$0e@O 0sqp Ѝ  R ЍOt`0S 0 sqp `BE,Tx 0S %%0'p@-@P2S 0p`n/(2` VPmYTLE J$a,|U 0V!U ! [E@s_Ps wX2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t0000'A-\P@PAds 2Fw t B B$ a00C00'O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ 0'FkO-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y P =Y 200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$_00C0@@PAy`d1S  14P8 <   00P2S. Y  a14a8a<0#d1a#h#0)S Z0)S R0 Q !jP:00 0f0<   0S8&0'H# -**%%GVk_ͷӶU7RU~qzA-4RUP@P@DЍp(0PPPB1P@TaTaTS <ЍAe0c!14!8!< X1 11pJ 1E1!1<0 < 171 ?011!1<0d ( 1P# 1@?0ЍA0'j0*';N_qO-0P4MpE``d,0 q 0Sၤ0od\,("/op" R 4 0 0  ( [ 0[䒑 Yy @ `D pH L( @P 0d0h0l 0XS T0@Pt˟( ppPppW;0} @P8 21S /0.3p00102044p58<0 TTpQ4 R:HL"T /"R, 4Ѝ0(2o0h(0}H 0 (v 0 (m wpUt  @D H L(@P0PXB(@ Xv  0 `d0h0l9@`V2SjW 0l !? 49 r,pi  R    0$  $  0 0@PPT0p V0S P8`@V 0PS$0 @0v 000 U 0S@8Xb\" 0rSR ` 00 RV0P@0 0z P`@,p0S{ 0 00@7P2S W[: @P@~  vv 0@ pR,'0Q0Z08!2 @PSppaQ $ 0s ^A$ D 0 H L@   @P0|21S  "/0.0010T0 3p2044p5 8<0 T @P @P2Sp 0 00@P52S WC[ @P@ 0S7 2S H"%>0 $00 0S- 1S*  W000P$  00SW0!14!8!<!14!8!<W p$ $PLPD(P0 S( 21S$ / .0$40 81 <W S  PW 32 $45(, W\ 00$0`@P`3"Rq2S0 hz70 00@ P 40 00@ PWS (00D#$0 #(#< 0&4 0&80&< 0 0p `xR0 @2Sc BT0cp%P[ 0 1<Ap 04@@,2`0C 0 0@@(2 00p ? 0@@pp0`Fa ??`1`<A` 0@@,2`0C 0d0@@(2 00 <0@@? `Fa?`?``0S 2S@ @TJ041S0Sd 0s PX2 0 RS  0A04o(I0'j0*' n ׸)M`oO-HBp42MgS0HP(r(b42S 0P*U42S 0S /PqЁ 42RSfP: 42S]1!$1(1,ЍO0Sd S~^` d04兤Y2S lL` ` ؠ0)P\"PR SR0SЍOԎ+@ D0ЍOSP; 0Ѝ0'uX'7߹Yr|@-0@M0@ pp`PLp.ߍ\ o0  0OP \ Ott02S 0S " `P D!SR ⃾0Pꝵl0'0@-Xa0 0LAP d2S8 ]P(!p! 2SP0U0 $pt" Rp\EU$p0 00P d2SP #P@ Ѝ0P0!!1 %%0'mduX'' A-@T2 @PNqP IqP DqP@ `p@T 00S p`V@/qPD00S @@"q@Pl'%%A-Pp`s(@P(M(000 0@@@A-@pT` nnPP(0@ @*(@BG-M0h4 P@ TPD pP @ 0pP(4 00(0 4QT(0 ,0#(4@ 0#0@,0S @@((@`@,0s0000CP倃0倾P>PP0 !01P,30  ,3Q #  c0T0< dp@8 PA ,0S ,< 00S< 00@ $\P&0FSʆ`'P0S -S@= `P00@@P,0S ,fd^A0 QP (p8800  I0 R00S' 410XAXQXa400C0 Cv3r0S0Sr0S0S C 20S C (C#C$0#4 ܍p PS4 P~'*"13'? %%cP0/'0/'0/'-@-$@   пؿ%G-P`pTr@0S  0S X| U TY0S W0S@ '}P5m^-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝl!rGp@P=0LLD@rOP,0: S0RP00 0+PP P81: S  S U r+PPK.H.P%PPPU rS$PP @P''@->0P  0 00x$Ѝ  o'0@-4S 3/ S'@-Wq0 @( 0$lKq@\* '@-Eq@_ll;q@@-p PL`@@0 7/P0 S Ѝ _004'O- MM06@  @  @ 0p$000 (0-P(LL@ ܍Ѝp 03/0P0   #Pq @$0PS M(0SDUI>-`P 0 W U euX0YpY 0 `  W p[ 0S $P % 5 e@uUT \ 0@W0SU 000 !0+0S# 0S,aQW^00CS0";)@ T 00CS0!1) P @YT Y@DOoB 0Q  o @OoB\ 0 @0  0 0 SNTP'(%%(0@-M 03s0c00@S? o@PP* R!8PP<] 00@ ?  0PS PQ `Ѝ0S 0S 0S\0S\  0/@ \0Sp 0@0 @vp 0S0SZ @g0SO  @"  @0St= @D HP@ @0 @ `!0xP|"%#   T`    P @@``a/ z] x Zp h 0 @`P'\'T'@eq-G-0@  0P 0S< 0  Q*a  PPZ  2 0`P f ,pЍ!URQ PB l bm0 p H0 0W40p dP , 0Q0   040 04!$0 !0  0( 1 0, X0`P`  PD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pc00 QP    0P ?HP |y9HpP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0Fc00 QP  ig7  A 0Pp00S1<01@040  0"c40  QP  A 0PA0O A0  GP 4W ԡ 0R  N eY'%#X`V P0EMi 06#++R`HX8 $0S,0,  RT0C0iD0"P#10P  0QL \0   0P 00P00h00l0dd@TQl$).pRRaArrAaUQh4\@-p@u`P P00 P0rb 00QP  Ѝ 0P< !@ !0 P0Tb 00QP 4 U0PpQQ@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k ,zP000w# G-Xp` P@P W Ѝ0!0 0aXY DF X0 X0 P1O-@,M0p@l@$0`P PprP$P @,Ѝ $k0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q 8( $ 0L $ P 20 2 p(p,"  @ "  p@! P0@ S  2"!"0  0@pDd0P s s// /'#O-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \*P0p@P q x0 ` P 0 00  P 0 00 ` P s0 `P pP0 0 P`8P pN`s:VkR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0 O- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  3 0 TX  R 0 0 p pP YP  L BPTR2 Q PEPO-X`0pM@`PP`Ѝ h0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/KPw c o 0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0!  0^0 QP \ PG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0S"P  S`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0 p#B@-?`XP\@#@3P@T@TpW @@T`L`'O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ0 0 0^ Q P +P0 W:0 0 0] Q P PLR 0 P<0T 0qB`'mO-M@L0Sp<`@DH S!-P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:&`' A-@/pp0%B?[`0S b0ES PC )bp@@0T?  C0`'0 PKC %/`'O-p 1cMW, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#000<< 0,006]<00 QP cߍ0P@4p(0@pD0 0$00 C``02#  ,@PV002800aL0`FL08 SD00S   80< 2800,000\<00 QP  (1 0H 0  RR R0(104D0L0 `0L0C < *9P.  (10(11  J  , 4 0B0 D0P 0D S140S  ZI@(1  0I0@;+  P(10(10@4 40 0S_ 0@ H /o@0(0"s R$ 00P p, 0e0(00$0@0S@0! 0C@0 0@ 㓲"X 0X  PP  :X R: U$0p 00pP0 4n U/0 00pPd(@\Q UpW$     Pp PK/\e g0x!P0p00pq P$ b QQ#hQh  0 U P p$pp000 0000 ,p@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W w 04L |1r 8 <|1 0W4 8 <1t0U`0  0\|xQ1PP|!R \  P PPL0sPP|!70I|1@|Qx1U0P U* SR   1S \ldP@ 0I 0000@14hhbPP 1|!RJ PP 1@]300 0Q (0R| U$0p 00pPt, u@[000U\`0) 0$ (\T P0000T 0 00P0 00 ,E@W 0$ Se1Sb I_1 S0(0YRhbP0S 0Sl \d|RR P0S02S 0S0SV 0\2SJ\E|!2xQP >PPx 00I@ s 1 |1P 'P$P PPPPPPL0Is0PP@1@S!U @[ShaP=PU p|1WS P@ |qppL0Ispp@P !SP| t<PP 0 1|10|1#40L0s_?00010PP$ K/\^PP05 P 5P0h00h0Fd 0ES:\P P|!d1HrH"HP :0 @0|12PPp818 ,80PI 02S0P0 S0 U$0 P 0c000 000 000 ,@ D00S< 0,00Y<00 QP80,R0 PI Pd01S\+0!X&P %4QIP0%8%\0 P@i`'m-T[* e `';f7&Tv<SjG- p@r W pPW\aPP NPp $PK/bD08QP0Q:" 0PS00  Q pJxPh`P 80"8 R 00 05 !$x`'5ip@-@5%SQ%  5%QPR 5UU53QQp  0Q   0Q0  `'A-lP`5p{@ @ 0% Ņk@ŕ\`'O-POMp0P* b5S 5唢@TE  _P@ ET XT 5d 50 ! S$5"R$%P0SOߍdhP  RR @`0d B2" 0zX JQP d d0P Eh0K/0h0 a0 @!&,qr0d  01(\  j a  a,10,1#40L0sK?000/1001001#40>000310 00 000T0 C(X(%,5QP Hd *d0P `'.P'7@-@ P 50 5`'0/'0/'0/'-@-$@   Lؿ%G-P`pa@0S  0S X| >U &TY0S 0S@ '}P5m^-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @ PPݍ Ѝl!rp@P=0LLD@rOP,0: S0RP00 0PP P81: S  S U rPPP%PPPU rPP @P''@--0P  0 00$Ѝ  (0@-4S 3/ '@-`0 @( 0$"\`@* '@-`@O\\`@G-`MMP@p`ZPR0 `: SW/b0P  rR n`00A 0C @H#k @ V& 0S UP0P帐`0PPJ0: S,^0"K-@PTP&P r]P  PP @u3M`@ S @ S@PPZ PPn sUD e-p@+S R U>PXp!t0#OPU00`P00D! L@P2  P_0ST`X PPC0 PP W80% ܍ЍnPUz f Uv gTrU `ai FwF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440> $(0 $(DZ XX@Zddhhllppttp p@-"440 P"440 @ >>>DD>@@>HH>LLPPTTXX\|`\ `Yp` pY p@Yp@-`@"QUpf@p@-@Pu>r>o>l>pA-P@M4Q->C]>->CBX?X\<\99>L>9>:>CG>?n:>CFB> 0? AC>9>}C>G4>mF0>EnF,>E~G(> 0X J~XpW  $$((,S>,>}S>G>mF=HHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W tBvTrTpXnX\j\`g`dddhah`l]lpZptWtxTxh=0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P0 0 @Є"44003/)  0 0 0 "44 0^000C >0`* 0>l0-60S )U'0 0(|(((((((@-P@p`AMM(& 0 P@ 4U0:t0 R0*d %@1P 40  P,, %AލЍ4(N#37@-0 Ѝ0@-\M`PpX @ [Y0H0`0 `'!P0DP0S L P2 \ЍpLt7(O-P`M0M:YP3P#6 PP#Y0P#Up ލЍtX @@Y006否D08H00LpSPT`0  D6`Ɵ 0S  0PFSſ P 0 SU@`I 0 p;4,PZ pl뀕 P0 c0C CN1L1 T0Z 0100 0 8}600 $ 0000/( $4   0 0P  B b", $>̈X <00!Ч8 %8 !(0 40(0,0 R0(<0 (0Ṣг S 0 $ R S  000  S:0 0P00 C c9à30S00  S8%0@%0L  (0Sw <I z$20Sg Rr0 0 0 000$? 0 6@ptP 0 RU` p 01S0 $400(!(( x(o? khn4k( h(g,0 R0(40O8L @  H n<! 0bM0P000 ʏR0T A'' 0'2 P/,P)8 $t2 t0 _1( @(  Ph@h(8((|(,%%p( (O-M`@ ) P0I: 0 @0P40$? 0 ;62  BQ p{("(qsQ<042,0 S000#000 wD2pQ 04  0R  @PЍ( 0;  0 4 Y: |10S<000D0z`&2 `0 0; 020S 20S 0[` `$110010S ?p1p1000 . *d|(((,%%((O-@PFM M X `Vp: 0 5 R|"0hSD 0S00  000S Fލ Ѝ$p00 10000 0~4 H0pT00X0400!0S \`  " p$0 0[h~"`.P P4 p\t4y"0S$ L000 0s HP #0000S 6p0  0v.P0K 0 8 s@ o  0 0S Cr \  P1 "d.P Ѐᴢ L000O0 H I { 0-0X0|2 0J0  000r00S$c 2j0 0H 0Hh [ Z0# 030C  4 S 00403P!op1 0HP 0DP0  k000C0 0 S <   0 0001    t0000 0 !0vs  0 00S 3N#p(((((,%%hk7(A(`YԳ($f  G-P`M@HXpAZ 10S t10S 00 0N P<ЍG(@PEU> 1 RP1H W0  P!`0 Hl0S$00S U  0S n0S G 0@ЍGfX7-P H0 ЍUx(p((3((,%%3N#9G^t( 0`( "4`#/p@-LP@088200@ 00 !/0@0 dTp|(00S 4 /( 00S/( 00S/#4(P000R0SO-`02@ RPMgD R0R0`ď080S  C/ S ! R 0C00 0@ἰ? 0Np\5h!S 0 00Ϯ0 ?@U '  ϬR7 R  0 \5S0 0/070/0 0 Ѝ  [ T R  P0u0 0<00n/(|(t(T P0O-@P:1 R0* 0똑嘡0 `P3Qx 0 T B:\500 fN00,"1p R 0 0 !Ž p 0HN`0 C c00p0S   0 .0x 0-N T0 0x 0$N400,00S Ѝ(00(|(T((O-0p#M PQ P* D'PW0k:, `\5 00 M00O,"2@ R 0 0 !Ž @x 0M`0 C c00 d0@Hb CC cA30B$ 0NQ,040(0PÏP0 8@,10S 18P0XpC9 ȡPWEʸ0 8,80<01p!0<S0<0<0Ѝ U8  P\Eg2EEd2k`2 U00Y20 S0TP0S<0ذ(?0WTE4U  P 0R0SE ?Z0:P0EU 000Q0(P|(T((((((G-1P 0p` M   0<0@ 0S 0 0 80PS `P` 8UH0ZP000PS　N`4OQ$,$ (,`(PlP8|(s0((@-@8P 0800(G-衟0PSN 1p00 B?L PCP` 0@`80@Px1 ?L`10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ'dt0SP 1@0  XPP00Ϡ^P0d000 A(|((((( (P0p@- P?@CL800P 0 c!SRp((p@-X`0SpL0LP0@1CA0S000p(( ( 00 /(O-H0MSPp` M 003/ ލ Ѝ30 Pᴣ00 +0G00@0 tp0 ¯ S 0V  0K0W0H3p!0S& 83Q2Qe *"0  10 0 0[0 02M+ 2R2 t R:X;000TP  $$+P"1 Q    Qt Qʤ1 +!!0Q3 !03H0 0C?oR20SF <1B 8  +B$(P4 P R& P j P 0S 03/     0P  0`V b0:|(((((:H(0O-S0 00㨄RM`PV@#M( ( , : S \ \p$(5R<R ,P  RSV 0 0h0S  KV ,Jt0 PB?J0`p 00p0S 00W Z 8ő @5D0LT 0 a31 Q>PLP UP 0 R0:pp(@0@-P@80\U< S0 80< 00p@-P@ 0 8U0p81 R0p8@*0P0S 0SpP0Sp00S Y|0S  0\0S(8p@4g(p$((4xp(}@-p@`M|WP 1  P  {p`V( Qh 00S0H0S 0 0 P0L ,00Stt, )I3)00Ѝ@L&P0S 00`ЍN#3p(((0(0((0@-@PM \"! = )Q Q0 $0ASЍ000O-d5,Mp0@P @P(0S @P,Ѝ` T0): SR 0Ḱ0 qH$刡  !  Q01:` V `3 V `! P t(0`S @P0!20 0S:R 030  `(`!\Ő\  ? 娣 ? '0匳 gH0St30Z SZ d3 R #R Hu<3 R B( 3  R0\ 0㵯 G0 20 00C 04$0S4L3 2$ 夂 B *12W)p20S R~0 0 0: S S-  S5000000sS 1 00108q' 1p Z9 {*a 00 0ˏ E0X0 zM0T @ 0`; ? :!000R00S 0C600A*!P( 0ˏ d F 0T0 C c; 뫴 h((|((TP(((U (((((O-3P@ 0lMp!G`!\P  ? 嬢 ? &0 YG2儲0S0 S 0h"S 3S Pq@X  L820pY 2P0Ss \`X00X010S, G&'00X0S  0 0 `0\ *l!00ST06 0,!S0\P 0_PF0 20 00 04$04L3 2$ @  *a00 (0S P2X P& PlЍSu  zpp1\t.`d|((TP(((U Գ(0(0((((O-Pl20Pp0 @P"`V 00  Y0 Ѝ0k Ϡ?R g4G@ WULQ TUWV A0 %00100 @ H @TPTpF@TP T  0 @T  P T 0 $00V02 0 %` 0 E0 E[@P 0 000\000 %0`0S00000 |((<O-죟P4MX w3Xp0 naPp0 g3G0 GA3B3w T 5(8P  4ЍhN+a83 0p R IA 4000?02@200006T 1P' @ @TpT0y6@TpT 0 0 0 @T p & T 00  08n000XC` 1 0b(P 10010SZ 뉑  4000?0娱 0  'E0  EY@ $0>  10@(Pp 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $~hQ(|(Ww@- ؿ%s@-@P `S0S 0S 0 8 Ѝp&O-xEM` MP0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdv0SP.0S 0S0 08Sd s/2#' 00 " " 0D@?!? 00? 0D 0Dd!! 0D0 lpP0SS "04 0 R0  0"? 0 , R*( ,4ï0A8 ?S%78P0<P0Q R0" |0S lhbPUt G@0S HDb@PUn <,{0SP@PPDPpH0S  `吭Cn* lm-xl%|0S ll@0p00S0P0/% 0,0UA:Q000S 0S P H1 H0S 0S,0S P  'P   000(P 0S P PP Pp(=G`w4Uz 5\c x (-O-H0PSp`M W0R0: P p`0"E,"0 S n20SQ FbЍ@ 0Աԡ 0 000CSY?00 1> R. P!\!0  S P  P (  . 80< 0 @80< ` P0 W P 0 @$0 S@ `00 R 0SQ Q\ 0(p((((("(00S 4 /(00S0`( "4`#/( 00S/?'(O-M,M1@"@ pW0,$ :00`SHW ` p"P( "XP 0 00 0؍,Ѝ:00 (u"P  pXo"XPh0S  0D k@ P c0S, >B ; ; Z  W 054%00! ?0S S :00/0S 0 S :V00#03  R00S l:0S7  0X 2P: 0S R< kP0@S0z4`Ə5 K)Q9000 B?ApQP%90S  0 T 0 0 L 07P 090S, ATP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P fd80S (0 0x0` @ ((*70Sh0 0! 7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z@ 0PVP6CPy"h0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt A?7#Rp 10S0AL 0( j Z$0S 1000S 50S $0S 0#  Lt ?@$0S 1000S 50S $0S  <. 10S0ꊡ  0_000 04 0 S0 0 00 0 0h$0000 #600SH40S l4 PP @pt3000 00S1 LPX00 H00SS9 0S 30S2 \P&  0HJDP  2 prLtoPd62 0\00Q&&0: @000S828040/<0a0#PQ8`\@P 1P0H0800AAPa`ppPU0\(85  @5D0L 0T b32 R p'@ `글n|$\5Sc%Ϡ<# pD ?(0 >D40S<40W SW ,4,t`V0`@0x@S d0, k@ 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  !0S\000 T@T`V T0?  @`@T` 1 0X20qA000Pj0P0$W !B0 00 pS ;*00p0 VTX0 @ PX`` @W0`3V5 R 01<`7: R 0@ 0y 00   0K0 TR 1VS0` 0P   W@*  A 0B 00(|(T((((P(((((ؿ%p((U (A(W({O-` @ 0Mp̰̐ 0 0  BRЍ PP U QP |` @ pQ RP Q @p(( 0`( "4`#/O-dMX )B0PpP0P1P 0L1L H1 0,0SdЍ0S @d0,`>0 `E00@ట 0D RpT0 :H`P 0RA0 ST TX 0S @PptS|((((ؿ%(( 0000@/00S 4 /(00S0`( "4`#/( 00S/~!(O-LM`PV`@@M,:0S 0P *S *`0080< 010S y0  ?P0 X P ) P9`0S 0S T)D P00 ,9 #R0p0,0S010007(0 0!"4410< 000800$k0P@ ` \_W0@0C0N  A100S 0z >P 0tE0 S$ 0S '00P7~`| .0,0S0100@0h7@'0 0!"441('p` 0pp00ppP*0S  ZPa 0 1l%`YNPU @ ` Y% R%80< 0 80< 0@0C0Ɵ 0 00 0Q.*0S  P  0"pWWލЍ0S 80< 080x5 0< S dZ0 00$001 %_ P 0S 80< 0805 0< S uZ`0 00$`S! B("( p $ ⴑ$P@180< 0 80< V00C0 80R<.PSR$ .R  $PPP3P`080<4l3 R0 *3 006P2 0 0q$Xp0AS񟗴0ئ$$hhP0SS 3 00 20S40000MP t2 =#R0؀2 00 #R0tQ& l20S`20ST؀ 0 P  : S000 0 0 #R0 Q   0tFQF?d!d  @10 S& LY#R0 š!ɡ0S  0R ؠzP1  000p0P``0P00C0X?P8\  ((((;/(Hf(_kt($p((7_itO-WM M'0AS{`ܩ8ܩ- wP 7 `l hjP {P7 00T@ , 7 UP 70S 60V6 *X >0`06`00100V0:6 Rp0S:`@aVyPVWލ ЍT P@P   3o 60S b @ F Lq0 0%0@(0S S㘕u%p;XpG(pP, 5 2  B. !@ ]450SW 0$0(000]/0o 50S RX(0pAp;4pG0(pSD ZpQ(?R,p=40xpS@09Y(0G5 ?,0 S1 # (R& S000000Y!"!"5 dxhp5  (  ]/$   ,0 S1 #( R S),)-*-ؠ d ` p0S(0S , =2(p2W ,@R@ )' 0x AT!W"!"dh TR@ )' 0 AT dx@0 (0S 0$ QP 0  s00 ~ 0$ `010S x10!l10!00C0L10!tP0 Y00000C0!" {pI0Sz@0y 0 0C0t 00@o((( (,((ؿ%((@(Tp(t(t(zf00S0`( "4`#/(O-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D?0 ddp00@00C0 00 R2PU 2PU0p 0S0S)P@R1PPUPRPU P0:0000S 00"P D100C,(P X PC<0P0!!0` 00p0SL" dTaX}!Pe 0 0q X000pATt( ((ؿ%p(x(((((7lh(DiO-p3张P M`@?6 \P  ? 匣 ? d0  7d30S\30T ST 0H#S 3S 0"@ 00000CSFTYr P 80R000303L32   ?6` a2! Q,S Q0tB*J d2D20S P PB PЍS  ` !Pj?00 1>!  R1\ 10SK0T!  0d!S@1`0 ? 3600 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 幺Pp?|((TP(((U (((((00S0`( "4`#/(O-plMX :2嘒嘢00,0SlЍ0S @d0,P70 DDP000P0(@1 0 0 0DRpT0;:`1AQ \`X00X00@SRĹĹ̺p\t`d`V %P 10S  0&@P=P 00S  0_Q SR  00 Q  000 P  H 08DԳ|((Bؿ%((t(j(3O-oMM@P`00 :0|2H?0SX0S $5S$0SXPYX0S $XmX S Rܞf>`0Vd2 P\20+! `" d" B900!X d"B1h21$\Pl2LΟ\0C00p21`t2QB1l2>V 2l20CL0=SLq Q\20B  0S 0 $5$> *[>=0S ,0 0PS0 $5B111`R B- 100 S  $|0S%  0帀- 00$%BR0Ө`S<B11@%L0(PP H VD PN 0S  <Pt| *堀`<T<0S 0 00\0 bA?L04<5A?X0 =<0T0.H09t; 0VHRQX0h0@ @098 84<ϠQ b{ S Q,0 S[?^ @:P= ;0S @0 # "@0A!" !@0 ! @ @0| ! AᄼP: @ @30009|J*vp: d:0S G0 0؍ߍ0<00<`/  `!.0i0S pd,x5 0 PP ü000^00/\<$5St2 ` 0h pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0 P3 !D0 R  "0 0000 0 0]P1  "Xb2*R 2,20S #0 0T20S _H P 2p"S\?"0STT< P VbP2 H 0"bST 2"TS\?<  u0 0<30S 2@#S?d?0`#S\L P  -P 0#S\ 2#Sd2/?L cE0 0$ppS $S00 S0`@$Sd2?/0?`$0S0\0000p`X 2R`嵟\ 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7囡!"TpW`l嵏X7 0%S 0\000S7囡!pWO-P`@DDT(Lp G W @rwA-Q0 % C@*r`! 10" q0SU 1(0a&0  a*"1t10S 0 0T 0@# 03A0S4 N@ 5*< 5000S 0 0@TP`UA[t0Tp Pd0 0S L P<0 0S |(p(|%%(((|(0/(0/(0/(-@-$@  e 㦁ҵؿ%G-P`p*4@0S 劷 0S X|偷 ĿU ᬵTvY0S -0Sj@ f㜵(}P5m^-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  mC-@M Mq` @呻PPݍ Ѝl!rp@P=0LLD@rOwP,0: S0RP00 0lPP [P81: S  S U rPP!P%PPPU r)PP @P((@-~0P  0 00N$Ѝ  E (0@-4S 3/ )(@--30 @(v 0$.!3@* (@-3@!..3@P/00@-0@S m@ p(}0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT8 (((((T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/((T8 T 8(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3 h p@V p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4| 5 5d0d00000P5P5H5H5 @ A S>S>h p@ 0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(O-|4M X hDhhdhP@quP:$2 ?+:010S?,A!Ϡ<#\ Ÿ P  0B ? 0Se0S 0āh -0S |!\5St1\5P l10S(` XA. L!0 0@! 0 * 0S 0 0 00OoJ@hpİppHT* 0R A Գ (+ (((o(p(0(O(n(|(8 (T(x((t(((((*@ 9O- 0*MM08PpP30α 嗳80S ᗶ :P 0廱 p0: S X gPލЍ48H0,hSO 0)00S d00 78 7 $9   ` 8 8 [V``Z`P`L7VD -7P Q -P 8$H8P0 086 R>0 0p 0<&0&0P7p0p(60pw>0 P0p(2S# *,P *,P *.qVXZ hY 4[ 0SZ?관X V. 01*  + <0\:P$V, Q3C ?)|PPe 2S|3%8 S20#"20$#20PC 2SB4$040404j`02P&V20A2\02@2 0+0C`(, `Fb}+ 0| v)H  ?`0P4tT#0`P\`Q=S/0P 5` ( 2RV0 S0Skc 5*< 5 3 30S 0 0`20S 0#0 0R V 10S `2R\\0SD{2= C ,0"000 0t00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000P%X30,-q *, 10S 'S0 0(((Ag((((((Os((+4_T+oJT2Zt(q"k9\($p(((( (.((((( ((U(H (?(( (_{(|(((x(((((=SZ0SR  0\p<<00P%X30*0 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 5(1u 10S p0 000S(PP0q0*1U 10S P|0 00<cQ0,zP 0r<0*(25 20S 0\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*Y2 20S *0$# 0 00L40q"  400cL00SPs*1330S 0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*d4\40S 0$ 0 04t R,5S0%45S R! t004e0SP*$5v50S q0X% 0 00刅(0S xQ$ V0S< x 0(%0S8Pȅ*5I50S Dp0 & 0 08%<5HSR$ ( H00850<S_^P*q660S B0& 0 0܆@%D5LSR$  L00@50DS6/P<*BL7D70S 0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ȭPLX p R+@ Tʰ8 @/  @!. A@O@@᦭P 5  0+,@ᯩ$)P0 ( 8  Q DI ϠR 5l)p) x)吩)p助PW)pp \ 9 1 P, P'Qڨ0Q, D 0 0S }Pz*:: :0S 5a0H* 0 00S D0S0QQ 0 0S KPz*^::0S /0+ 0 0P D0Sh D0S D0S^Q  "Q  D0S&! D0SQL<Qk D0Svq D0S0 D0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*<<0S 0 - 0 08=0S 4=L=0SHm*T=jL=0S e0Mh =w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!@tN00 00L 00*n>>0S ?0. 0 0@P0 @DT@8 HLd Lc B 0b03"4@ `P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6:@ ᶫ|6PpE h0d& 5000T60S 1S <&P ,6 $6 @Q V @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 . ``0  0 04 8 !L5 R/ as0倀Sap &0S  U 00 X0S F  0S ; ?># $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍTt(((0 \P/Q/ Lœ0|   ,PŒPŃ ,*TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S 0P 0T`dSTSآPsҢPUU00Q AP 0S ??@峢ᱢP`"hR0"00S8 lr003Pb0S* xB0S* 0R0E>0*X4 2p610S 1]0 00S<XP10S < 1TQ `1*`X1` H10S 00 0H10S << (1P 0*>0`00S 0t 000S d0P` 0 0.G+(((((( (p(|(((((((P((5 ((L(r((t(|(O-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP t \P  ?H < ? }0 #2r0S0c Sc 0!S 3S 00R? 0!0! !0!S`0 0 0` Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*V0`0S `& ` `Ѝ0hS  j$  B$ $ R$  B  |(((T(P(((U (((A-Pph0``ATR 㴞@P<[0S @ F!1p0A(80 0 1S/ 0S/(`0 5 /H0P 3S P 3S P///|(^FPO-0(P,0@4p8`h P P0P` 0S 0 S   000 00 00S 0 S P0 v0       (|((Q 0`( "4`#/O-`@8 0P1 008Q ЍS@pd8Q Q 00$ 0pሀቐph+ - - 0` R ""!!P/! 0 P  C1  1 @-0+ 0` R"""t"o/ 10#/C!000P/@-<+ 0` RL#0###  /  /C! C!/! !/@-L+ 0` R####  /  /C! C!/! !/@-eY+ O-$5 SW@ lPphU00 `1X 0000$ p  @R ![ 10 <T+EP 1C0 2 @ @Dό R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RM@Xr .PP XP`H `tP P7   喧p 0S ߍ<08 H(00,0 000040!04 04$0D0(0P WZ  npT hhp* \X?` 8  4 u (;u 7u 3u /u 0,0)u0 %u  p 0`?`a8ShPb 0  0**0P0 g 0* d@edAzd@,=OcvA-PMPp`;@ p@P  P06P~U00 ## ݍG-`MMP@p`弦PR0 `: SW/S!0P  rR 00A 0C @H#͡m@ V& 0S UP0P帐`0偦PPJ0: S,^0"᭡@PTP&Pe P  ]PP @u3M`@ S @ S@PcPZ PPn ՝UD e-Ҥ@+S R U/PXp!t0#PU00`P00D!H ⮤@P2  *P40Sᶤ`X LPPᥤ0 PP W80% ܍ЍxnvPUz fnUv ɥTrU ¥ai FwF F@00S 4 /(00S0`( "4`#/(O-pX1`P10P0ʟ 0 c X 3#ˠ121@ R` 0UP萟A00!R00S! 7% 0%#s(0!ZXl000Z T00 pp8P,0(|((p( (( 00S/(O-,Mp0`P@ᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S X00 ?$000 0 P 8700ğ,^ 0P Q P )Q 1 $( 0004Yq tYPl 3 4ЍLOPlJPX30S, t? `$3P3Q,`Q0C,0(@,0h `PX,*0p ,0R0( 000V0A+ T2 Q,``!(@,0)P,`S00@ 0 `0B"30 ,0V(! 1 1S2? @10S f4, 0R00 $00?000P. <k4P1,00 0(0$0$ ئ0,00 00(0 R  000 0`@0` 0$00S ~{V|((p(D`(^FF^j(Y((- O-1APQ P1a`3$MS0_ 1P11r00`00 0p.000P0@T <ㄛPXpXT 000/ 0[P'0Ġ[@  0S 3  FP PD0$ЍV|(~{(((0p(.!(p@-P0 % .  @Q 0S pP# #3 l0# #:>0 @w0SpP p|(^Fp(4PeR/G-P `$ 0p@V` 0@`` V`@&!D( `G-P 4`pC0ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  -b0@`Spp `J 0 U 0 0n7Π ^ÌVQ 0V>  0P" G`p P b72 R0V1Q0V"0   P 0 P$ ` U P ``Ѝ{- J 0A-1àQ`P |0| ||a0@Sp࠱ P$` p@QL ࠁ PQ {- } p@-@PaSl0l lla0C800S   0h0080P4 PR*Sp0 - , 2 ,0S/`0@-0@  L1,F0,0080S 0  ta0@6( . ,0@-S ,0, ,,ba@TP "@ .  O-dMPpU`@@ U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00P U0#03?b[[U^㒔 `#0P00T5Q L՚O000 ՖDD 0XR @"!$"!L0<p(08p$0 0H(0 0 `,0`4  0 4$`HP 00 Ph40  (00l"P  0ᒚ,05S00SUSP3S` 040$0`UQ-V  0 00`FD040 CH004`380EPpT`D0H RS@0 8 ,P0Xp\`^@P,Px3Q 0Q- 0CQ%" 0PS THpPL`P@ FT@"P$" P0T`@V !3P` T@!00P0 p0403 0?L00T X oPT X\0RP P0w`04 S2<0%"<0S@p L0. 0 P  X Z 1!8"! P 9`㇓"!400 0Q 80080p0? 00T` 0RZ@p 0 0 P 80Sʼ0 0C800S   0圕`哙O@  > _0@0dЍ000(9LBAWs0. A. NBAW$T. f.  G-0,0S0 _P@ `00qW40S*WЍ!  0K@P   k@Pp!x. F A-`0@c,0Sh0h hj_PpQ H0< D 0P@DT@!. Da C-`0(Pc,0S0 ?_p@Q |0l x@PEU  0P !  0 P P Ѝ!. q Ds X0sC-Ђ0@ P@` 0 00 0ƘP 0Ѝp((ZX0sC-Ђ0@ P@` 0 00 0᫘P 0mЍp((A-0PQ B@`p0P R   T0! 燘@P 84iP㱖'(((@-,@P,0S 700(@-,P ,\  D Ѝ(p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp((|(27@-0S S+,Ü2 R0 ELi `Q |xPCGaQ* Q( PDP <4B 5*< 50d30a3 220S ᡵ0 00@ @7.Bp#x3 Ŝ ' 0P n`vXA 5*< 50d381q,10S l @0 d3S, CQ,aQ$ 0AS#AP F0@a3d3*0Ct00S >j D0@ S Ѝ04t((|(=sX(((( @- o= O-0` M"##0@p $@ 0$0 pPc0S@P@# 00"' qp=$8LtUhUaU$ bU |P?i0E S|VUU\VUUUUUU|VlV09p$S @: P80 ( 0 @+0S ,00(# `!$F P P0V xoЍVp FpnP` ,[ p_P `P0V:P0V PP p;0[0T$$0 !Q Pl  @0 00$ 0S Z(0,  $ 8v)p Op @ 0 00$ 0S Z(0,  $ 8Yp  @0P  l P0 Pq 0 ! P0= %. ,G[G-p@P` 0P V  00 000G 00`000O-0` mM$0P@t004080 0 p40S+ mߍbP AP LP `84cP iP0p8- 4@0 0H4: S@ @0(0D04,0008`0#P  P 0 0! xGTd @p 0Q= $ 0! $∑匱@P 0V$0 0/SN<<`V $;pPpኑ<刑0"<+P0<0~`P< \v ቘHp< 0 0 n?C0 n?< n/X0P < i<N!$ H 0#$0@0P!Sd `V|s 0S `0S  R$ R Z m0$H 8 HPp`G0$pR 0$ pK opBZ (,PQ(,PQ S R `T% %. / zd@M b   Uc  K  + O-P@p`,M,$P up)$0S0$020S($p P V 00 0P0P 0 0 "fP AP PP XbpP$p,Ѝ`P 0`P , ?o  00 00  0 `< p| 0PCqp p Up` %  . U G-@pP` ܚp`:D10S:E A p= o09 6X $$ Vpp+ P%W00S $$ F`p YPPU `fV rV GTP$$ * Dp$`% ) E b . ~  @- co= A-@P`pP hhF X}U  AD<;4  3 A]}ؿ%E@- R0Ѝp` P@\P 0 R SR  R $$20BR R P0 t, (P/00#01"$#/ O-@  @T \  `?p蠟 T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C- 0P @8a8q@^ \ ^0᳀ 0S@ 0S@ 0S0@@0\ ?\CT:^ *$@A0607;00@R0@Q 0BR 3C !O-0P$`^@P 0㘹z'0 0~Q P ᦎ@ Ѝ 圕PC-`$4 p咓P`品(@ 0^Q P Ѝ aP404-@-0  Ѝ Ѝ/-@-00@喐 0 Ѝ@ Ѝ/-@-P 4(Q 唚 Ѝ Ѝ/}O-MPp`@PЍ P P 4S  0l$T0P$ Q$VP 0S 4S $ X 4P S $SG30 0 !0!|p`0 0 0  @ 0P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڀ 0 `  tB @  "tPY 00pP0Sp      / 3 O-$M@ХpPP? 2R 4S  0d$Ѝ0 mQ Q0   RSRQ"  "S 0$000 00 P 0P24S 0S,  00 000 P0 0P0 <00SS PẐX   0 0`V4S 0$R V P0 RS 0  000P\ H0H 0000 0   H;pF U_ {      G-`p@MPu@P q@TC^t# E@0$4$ 0840 ;4p+]p |px H4$$: S! R B.T pD $4S8 (4,$0.B.  ߔp 0 0"dR04<,$$4(4$t0K>Ѐ 0 q    00E`d$t؀E0  ]P0`P 084S   0p 0gp 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"   # d@/ F d@] s    @-@P 4B BRP Fp 8L4  VЍ@ʒЍd@ )@-@Pp P P 4PS 4 oA- @P0TP p` X`p0 p$$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /O-`P@p M6"`P̀PP `00000ᗏ따 V:Ѝ 1 00 0P0ᆏ`P1 0 0|P UP *ؿ%(SC$$0A@-P@- x`R@dbЍpP "P 4U R 0 t,>ZjO-P_o!R0`@tMR(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 P m0 $8  P P  P zA-@pP`P 5/p 4 5/p 4 C-(00pS4P Ѝ$d@ 0 6  0d` 0(0  0 `WP O-0 0P=p@ጀ儠T Ѝ` P `V DDp 0 @t,33 A-P@$`$p0 @⟍T3 1O-Pp$M `@Ȁi뼰0     Q I Ex0 p `p X0 X p` 00P0 . *$Ѝ*3 j3 ?O-PQ@04p 00` ЍP P0S* E g`P0       04 p p#p p04pp  FUt0s@-SX`@ PRU0 ?o2R0S  Ѝpt,Z@- iR sR aR p` 4ep@-P@P (`Pp Fpt,p@-@T 40`PiP>ppt,iR@-- 0 aR bR LR( *sR% tR@P 0FP0S`00p`(j0 t, p@-M`@P`[P0 0͵0,R0S L Ѝp*15mG-Q@PM Q  ЍA~␀ p$`P phB~00 0 `PP 9lTsO-$M@`H&P ,`$ЍPP 0 0 "0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ ~P 000 00 pP ᡇ4  \$  0V,S( 0 `$4 80p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 00PM 4$$   4  !4 "4 $@xp7 6V00S 0@-@C^M E$E$$0N 0!1P!Ѝ0 @x("(!"`#XT 80 Z @P8%3 } .0$ 8O-`DMPp4 2<0 zp 0S8 ! R4!DЍLRd a0BS)S&TTttt(ttTtt<ttttttTTD10S  0lP 1@P   [剆@ -Pట  { T 0 哊0@  T @0  @P@pKo% t,݀O3 (%YA-p`(P@P0 p!`P @00 0$0@-@P$0S '@$O-20SK@0SD00J@ DP 0SD0SA \^<40$ 400#qpp, 804<0SP$ 0I,0 , P tbU@ qU PH04 8pPTЍ0$$ $(`VtJ0Y `0 XW0 0 0S$ (0 [ P*0W0 000$0 0(000qpp 0 QP Р 0Zp , 8p p  $ %= t: B"O-@PDMCnp F#p pX50S HDЍqP sP 80Up#  0qp PPp0#F0$$W`P P  0@x40P0  0 H0 0$0#P  P 4  0 (0$0,0  4 PSf 4,  (WUXpVP 0T 1 T00 S :0 U 00[ 0  40LP40 (, [0V [(Q,UX? U0U0Xp.P p (V,#X<! 01p8 0  U  0 0CP_ Q QXX 0 0  P4\ p 4 "$P0 0S 004  4  !4 "$0 S40H0L p $01S 0S P0`8#8&h$ r/0$0s?`mph4 4$$  |%: o<S= x5SC-P0 @p`$M!!ᜑ P ᇈp*0S00 P 0SP0SM \^H 0T' 10S#!Q` O.NP. a@ P P HxPPPPPPPPTdpT T  w,$ЍP`q%: <p@-M(@,`P6# ,X0^P0 0͵0,U0S O Ѝp*5m@-WM M`pn@T 4G0S @^< P, 0$$ 0$$0 x0 |xP x x x 0jlm0 $8PL#<{Wލ Ѝ-I@-0@ n00 0Y 0 9Ѝ@-MP@a qPwꨯD,4<ذ<Ѝ@蹀` 嵀 p孀Ѝ婀|奀 p!80pp\XT0 0 (吀8厀P  @08 0@TS Q2P  Ѝ@qo $m0 8 00  ` ppxV1S1SDPЍ@I )/>M[is** P `00CS`0p S00 P0S X0X /X0(%G-PMM`" " :2r@p嘂嘒TݍЍ    `Vj @   `0"F0 BABP 0S8 1B-BB$! @|<#⳩P%$ !P<# pm0 $8D($# b@B 0B    E0S 0CS 0 80m ꊾn (-(S*5{G-0p P`@M!ဂ P pd20S$^PD@6 lP`Pa@ PX<<<<`<h<<uP xP @ЍPP p*PPP0S00" P 0S0S \^ 0 Q  ~ ~]0p帠W ~ ~ Q ~  }   up ~%: n  @-LM@P`4  1qD0 8p T  P 00S 0 iR TR a0BLR :lR s0BST pLtLЍT }p= & 3 %; < 0@-$M` 0 0@P!!dq p$0S00S P 0SC0S@ \^; 0T 00S!  0*a@ P 긺TtpT T   4$Ѝ %; <-0,M$00 0 00 00 00 00 0 00000000 [},Ѝ 7@-@ P0020 0,0 0&000 P  S  Ѝ0C-@pM P`  0 00 00 0 000sS 0lSp@ P$0㓄( ?p l@ P 0㓔) )p Ѝ@T@Tp,; C-`P؀C$T2P WT Ѝ%P P WP9Pg0P0 LfP000$$[P]p7f`P |3fP (0;[PXIpD0 LP $0  pQ4 pMP 4Pa0P 4 &Pu  P00000[000000S 000(0eP de0P$0 nPP HHHkq`P kq$:tPP04 QMP 4`P `P @ KPn H KPh @0 SD00H0 RL0( 0l` 0 qpH  R$4,, 0qp 0`} {$4P `$${$4P` Vle`P heP i&yt^eP pnP+8,0 p`P p<&? ` 0qptnp $KPZ3po  .KP   'KP  KP   KP  $ KP  X KP q@ KP  ( JP q/   JP r JP 01S 0r/S㲰, s? Ѱ  JP s/ JPz$$H{$4P$mP裟z Rp`P Rp$$`0 &qpS, p0x< /LPj <pP < <(< LPZ <P  JPO  JPI L JPC 8< LP $ <8 XJP3 8 Y* 0c$ Bp z$ zPp$4`  0qpt$ zW$4 $0  8R8\008$00(0 0 00(0 40P0,` 0$00P00T0$0E XA`0$$~qp|$$z$4P0 00H00L0`#$4+` 0]qpc$$az$4P `݀d%%= t,h%Y%~%J$$%%%$%?$%D%:%D= &E%B&h&Z& $Uz& IV$a$n$}$$$$$$$&&&&'0@-@M P    bp< < 4{p$0Ѝ0> B''iN'@-SM@P, V0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p- )D Sߍi@^'ij'!iv'@-@    I0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01P A!~AvP8 0`0?oS c`2 06P. 0I0v0 0A. 00P0qP A OArv0 000␫gvލЍp``v0 0A. 00PH0GP A4 4%A@Hvv`((*''''''s@-6PP  P  )`@TYЍpP  00SQV  u@> '60 R !O-M@ Pxp*p"dz`P"    HbP- eAbP: B''W''F(O((3(e(A-p a@P@QaPPaba PkmaP l`Pl@- HP ЍA-MP pfG@P00p`ЍpP & ⼥0 \yp !0  H (i@-@p @A-P`"apPL00dP@C?0d & FA-P`apP.00dP@:%?0d  F@-( FP00 Ѝ!p@-8M@ PFP 1 ! :`P xd0 Q0s0S00dPP   a@ kDp `  c< P``jV8Ѝpl(e0> u((i0@-@BM M b 8p 0S 7  /  0(LP(@0S700$0/ 0h (=dP(@0S Bލ Ѝ0sQ@sI@i(( )p@-xM`>`PP cP@ VP0P P :c  E ,p呱Ѝp()=> u(i=)@-@M   pЍi@-M @EPC0 9| p  1Q0r R08C84 1p`Ѝl)e> s)iis@-`Pp@ @@EP0 9H@Ph- c P@ L$@`P 4 IoЍp)e? s)))')7@- P@=pT TL_ P@00 <<c90400_@ Ѝ0? (**s)'7@- P@p\ \ݰ0Hа@g_ P40 0069_@ Ѝ0!? (('*s)p@-M`N_Px0P0ЍpbP@Uxl@Pd㦰0 D+p<啰8 P@ PP nE2*.*G*i^*@-$Mp_PB00$Ѝb`Pl@Pp 0 XpLeP@ P`@ p$_n/k**i*@-Bur ЍÄ**0@-M00 0  Pvp ` l@P/ ` @vpp P0 `pR00bS rFnxpU q9rPxi ***s@-@`.PP  1p l0Sp +p@-` MP@|^P )b Ѝp P(    a  P^@hD.vi 0@-,M@ P#DP0 8 p,Ѝ0 0R0s0S 0 $0zaPP  (^@hD+e0? fs).p@-P-p@`@@^PH0H HH7aQ P lmpW*:? s))@-T @CP00Ѝ  p  R +D? @-)+@-M T@CPD0D DD708 0~ p$mRЍ4eR? s)i`+@-M T@CPD0D DD}708 0] p$LRЍe^? s)in+0-M $00G P  Ѝi^*@-@0~] P$0$ $$M7]@**g? s)'00@ P/a CRWC/A CR=C/@-00@- M@ 30( 0 p峮 Ѝi*@-PM  X@@͚Bx 80tP0 0 pЍ:*?Äy++j@-鱌@d\PP 倮mpPL``P00 00"qt0@`Vm`` PT0d0X @ @@@@qLgn03/`t? +@&%*+++ؿ%Y,////0 L0L0/@&%0 T0T0/@&%0 \0\0/@&%0 D0D0/@&%0 d00d0/@&%p@-@pkP 00p00D S 0A0CS0$P>P 0@p@&%@-p0`( 0`P/ R/@&%0 O-4M@@!2T0.  DP3tpďůƭ 0$ (`pVD@PT P p1cehT6l PP@ p 00JP`p R  P Q R/6 0TS $ P\(P  1/P r@0S  sp "SR(0S`^\ 2/P W0 [  m`(-ɚ;6-O-MMPp  X p`%6 pP$ 100$0 v-Lo - spWP  t sp Q X0o n8 p$0Q  o$_ X@T X00@0 0sPo@R 0 0 ,0@4@~sp 0h0Pl0q 0X 40,@ospDg 4<nj0H0S $P31nH0S=I0S:Z`@T 0 3/@: " 렒M0S:00 % p"pM0S  n@ n@03/@r JnI0J/ spNI 1ROa`"%J` 1 0 d1 T|p 1 d\!1 HSn`@#%Js!1 @ t1 x!|1  mP@Tf 03/@ 03/ݍЍz? B'-..i.~i...@&%ig/i{///`(> fn/.H/Z/ii4-//j//0 0O-@PpP  p īT Y@YPT!尫Y`P \孫PPU D1O0S mddkW P.Z  P' AP! K0S 0 L0S 0M0S 0 N0SO0`S PPV Em B +? 06`(%@-,MP@wpP YP`(  p0S h4 HO?P00< <(0 $,Ѝ'33(8i(=3H J3g3@-P@ᓚ0 Py3G-@YPP0 h3`@ Y㔀9]p+]ᶈPP  pp H H@@@ i@3HI 23(s@-@{^Y@P00Ѝp]P\ႈ@P <` Phu 3(s@-@Q4Y@P|0| |3\P\Y@P T` ޚPhu( iЍp4HI 3(A-@"YPP0 2`@\\(PPp ᓚp< >FJN@qHI 3(3@-@ \>PP0P PP2L 0 S@@00 >00Ѝ3e%I 3(ؿ%30@-M@XPXP XPpXP d0P P P Po 4PDp Ѝ0q433(7iB4s@-@~h l P LlHPH`ⱙ P! ,kЍpk@O4x3X4G-M`@PK `ppP"㮩(    ᵜ Upp% (( px" <@T t8Pkl2P\k UR T1Ѝ0 P*5if@Pl $@pp kt 0R kk)9k 7k` `psktQp R%P\ik %kmKP;ЍGcgQ\ 0Q    1 0PJkP0 RSᓘ :k8k # j0` R P U 0pD` P\\\'J B'8i(ie4u44I 44=34|LJ -*jx|I 444Pp@-P`@VP V  W`P a`a 00pVTpaA-@T v00`PpH\0 p @-MPP[00Ѝ`0 00p0@ 0 P gZ0PC 0 p 0 `P0G-@(P/00`( D P1r0Pp*0X!U0"R0 "00"SЍH0P 0 , \p 0 @0@-@P $a@ O-`@pP,(0V0S 8cP$P$P 40S 04S 0S(0p(`8P0S$0(PfO-M00 X$000Ѝ 0Q`?  0Q> 00 6<PP; X?᫅pP ,,p1,4@[T /@P00 D&0800X5Tl (vK( R R[`#"00eUx 000 ŴPo0"0CSi 0BSe 00Sa2^ 5!445XpcPPT  Ჰ$pP  YWeXB 0  Ap; 0STw /PPZ0!8!10#R0 0i8X/eP Z@ 0YPH@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB0@ 0#0  0@D@ TX@dTl p㰦 UP_< D_0 0 0`0!3)5K 15))A-X Pp@`PF00wC0P= 0 p 0 `P0O-P`$M@ HpX8 P W0  tPp` 0p0  0&8 p$̝Ѝ%=eqM N7i:A-@`P_K0`Sp`<_@XpF_PU 0F0S@<_W@d-_A>_O-`MM@ <0< l gK7KP{7['S(0`0 @$0 0 @`F( 0R|P~$0S0'V$0$:$ 0:0: 0:0 :0:0:_(@!!0 X r0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PE0`y\900IppcppCppPpp Spp@BppA`8$ 0PX0` ._!0X@"0,0,0S> ^0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ"!! CR   ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S=d>l>=>d>d>d>d>d>d>d>d>d> >d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>>>$>,>4><>D>L>T>\>SH887 9777<92S# Spt 0S R Sm &S|h 0R  |T |0L^0, 0 B, @W0S 0S `pt^pW>)^ 0R 0b^`0S Y^0S `p000 L^00C!xx娀XP0  @ :^p` 4^0S W  04 8 <$S Wf0S  +^0S 0 ^^ ` 0d|Y1 4  `pG0p00D(4@Y400 03c10S1և!u ]p 00 ]3I $( P  #P# ß P# ]p|P3Ip#S0S l]0S#  P]S8]0S $] s 夢 ` V0V"    0`]V4]0S 0Xw]gDr]` 0 d(Y1  0G p00Z100 `&"R 1 !o 0B0 L]1I $( !P  $P|! x Pt! T1]pLJ|  lhd`\XTPLHD@<P0i:5;:; ;>;:8o;<(C;( $:j::n;t;3:,:7H*};3;;;;;;P3<;;;;:W:@:;x@PM:P~]7;;;|M \: <8<a:o:t:::::::::::::p@-P M@` QP0 aPp@@= Ѝpi=<@-< @.P$0$ $" ЍH<eM 7@-< @j.P$0$ $" Ѝ9eM 70@-MP "M`@PۍЍ0@~= P+ ^_P@p=ۍЍ0@p_0S0S1iSQ<k<0@-M TPfp@@T=Ѝ01 k@iz<<@-T @U.P@0@ @@]"I \p Ѝ9eM A7<@-T @7.PM<0< <?"  >p͙ЍeM 7< 0 //%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  Z Z ЍЍ/@-@YC`K= 0S/@-(-@-  YY ЍЍ/-@-  YY ЍЍ/@-\00S 0  0000 0 YpЍ(\=@-@^Hy^s^p0_랈pQ ==p@-pMPP2 P0S 0@P 0 0 00 0XXp DlP@@ ((@,P0P4P8P+ >mpe>>8E/%>>?-7@-P0@00 0 S Ѝ0@Ѝ/0C>S00!031 0@-Mt 0W@P \B TLPP @ (@@ 0WP 020Ѝ0/%+(@-Pv@0P ,Z  ZzXؿ%??@P@-d0 !X !T@0 60\ (0000/Q Q Q Ph0h@-`  !TD0 60\ ,00 00/Q Q Q P-P040#^4<\$0000/Q Q Q PD0 40#\00Q 00/00Q Q Q PL- 0:# ^4 0Q$0000/Q Q Q PL- 09# ^4 0Q$0000/Q Q Q P 4 <# \,4Q00/00Q Q Q P@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00Q Q AAQ @- 0 00WP ЍI/%A-Php`@WЍ P 3MP@ p7@-P@U0  (⭊U Ѝ0BA-0@nS0oSp@ pP``SXPT0nS0oSFVPPAVPP'3@-t0 TYV!Bؿ%O-MM`<(0p0 0D@00 l0Wp0S SH `R 00,00 WRXhGyGGGp@-@PP (0/Spp@GG/G@-p T3RCGؿ%O-`@ Pp(,9000 唐唰00 Zp0@DTq oP0 P廂P<夑묂9 O4l,%t,$W aF@-M@A>0 0D@00 l0mWpA0S SH :Q 00,00 eQ닿hGyGGGp@-@PሦP ([0/Sp p@GG/G@-  2Qؿ%GO-`0@P(,p娐娠娰0 Zp00@DT oP0 :PP#+  ~QA+O$t,|Y %aF@-MM0An H 0P0 $@Vp WQu+Hp@-@PP (0/Spp@GG/G@-o S6QHؿ%O-P@M P0:`r"Yp)20 R. +x   &  x `!p 0 *00)0`Vp'Wpz 呐uPfPMP9 9P$ GP g@Phgggg\hhghgggPhhthUP|0 0|00|0|00|00|00pt`x0 YPBJ~-PyVp Z,0p0Y00t0V0;;0x0Ur3WN$00|00|000ЍY00t0t,H% Z aF-MMJNP0 @P300 |0Up0 `0 0N/0 4 <0@000 RCP@+{F[ H7@-@P 30Lo SϜ 0  Ѝ0F@-@ C0P@V@-@D0P@~{@-@ 30S 00S0?  喏ЍFp@-@PὤP (吏0/Sp@p@<GG/G@-xH@-m40 0,0,0(0(0$00 0$RO;ILI!IiIؿ%IH7@-P @i3P00S\ 0 K Ѝ0Ip@-@ PX0 0(p#mPP(;POp@`M(FO-@H pH HDDDf Wp,60pGWQu 2@FPonmmmmmmmmmmmmm,omtoommmmomm|mmmmrmrmsxsmmdsmmmmmmmm8oTohoommomommommprnrrspsm,sHs40S = 4 40S 4 0<007aE08:x$0000000D30@90;g)P04P 0I 0(80@008 0PPs0       +  @   '  & B ,# R#  # R" , @ ( "  )            ~20  x~0$000 T~0 000 0~0$800  ~0<:00 ~08:00 ~0@900 ~0,000 |~000000~0909Rb01r\0$0 000 0tO0,0wH0 0xA00007000}+040 A Ѝ/%.J/%t,%(((4\ aFq(IIJ JJ J&J/%A-RMMI>0PC@P@(0L =H`q匁( `L0NSp"0KSh0  R < (Lh0 (M0 G( h0N/@  0劄PP 00 0,P.0T0P JP T0NO0\ $00X 00@00\0|00x00t0 0p00l00d06ORݍЍ%(uJ{F^ VJJp@-@P#P (0/Spp@GG/G R R @-ٌ/vK0@-@MP`p 0R000 PSPPЍ0P0 0 0S0 Q0P js@-`/P0@00 QP0 OYЍp 0`( "4`#/s@-@P`L0 0Pd00SPPP @/@- 0NЍp(_ K(002P0/0@-@CMP( P41010 0000000 0P L< 8`NH00Cߍ0Cߍ0@o꠆_ PG-0@`p8Pp6 Ƞ,̠Č Ƞ,Ƞ D4$03 00n4<40 8h0e,b<0(000pE040p<0< Dp PH00ЍpHPD PG N(vw_ KO-$M@0 /`Pp0 @T V0y<00$Ѝ 03/ Z0p @' 0P0:@ 0 `  p00P LH0@3/pQP. 0P 0T@Pp 0  i.P P @0 ` 0  M꠆_ KC-MM`p/  P@1L#Pd8$#4d4# N41D0@@ 0@00 0|@pߍPHڀ@Td8$#Td%4(G-P[ 0M@@x0P` :P0P`P] { 00x 0 \P @ X0L 0pp000S0 W0S00S0 p |p`  hP 00P0S`!0!D0D00W 0 000  P0b"!4b4#P0P0Ѝ 000<0H(K% L(0@-M 00@08  P  厊>{bЍ0L=L@-h 4MJVLؿ%O-`@M$  00p 0@"@0"@0 ":Sp20Q0CS g@⨢P PȂ0p00@0ⷌp ,! 0 6{P'{P  PP⛽0S R   >P  t {[!! DPPu0S R   P   P Up b+žLPp p 0[4S08pS @p @Ѝl,%Mt,L_ aFLL M9M>MlMBMM@-MMCN@800 0@(00 0rOp 僉 0 K"K!K(w>0P( lK,<0P , TK0LKލЍ4K(K+MMMNN/NMN!N?N7@-@P S-0Lo SϜ 0 5 Ѝ0F@-@~<0P@V@-@>0P@~{@-@ %-0S 00S0?   ЍFp@-@P0P (0/Spp@GG/G 0`( "4`#/ p@-"440 @"440 P"440 "440% $(0 $(n XXjddhhllppttp p@-"440 P"440 @ ަDDئ@@ҦHH̦LLPPTTXX\|`\ `p` p p@p@-`@"QUpf@p@-@P៦ᜦᙦᖦpA-P@M4Q->Cᇦ->CBX?X\<\99>v9>:>Cq?n:>CFl 0? AC>c}C>G^mFZEnFVE~GR 0X J~XpW  $$((,S>,/}S>G*mF&HHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W ➪vTrTpXnX\j\`g`dddhah`l]lpZptWtxTxᒥ0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P#` 2R  0  ?<#΋ 0`x 0"`0報 C c00d0 `c C ca0b0 0 0P!\Qpx 0&0sS $$TGQT`P@Ul  00 ЍO +׼0tS hhȀὡ XȐPᶡUP, ((U Y5YTTt0p@-0`S[\@ L00S000000B0E0p (/%Px\@400/000/B10B1/101/ E_Yؿ%O-eM  dϠ 0@ `Ì0 1P50S  100 R(0S\PpЍ P` ` b5BL RW@QWR58؞PP/ RTD P D " PD1  2D1" " P 1 21TE0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd 0@ `?5ᱻ0 ST0T00  B 0P SX0000Y0,ڨ0d0? 0 0@ `5?፻ 0刻댠 ,1# 0w ! ?o0 00C000 \S T10S  2 dϠ 0@ `Ì0 10! 20XDT40A8 0 B0 080$ 0C $ @$  $ 40040 08 R R` /  `1> ``& ((U Y}YYؿ%Y/%YO-MM␵`,  l51^OR0\u@DSia@51OHG ?E 0S/nE? 0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0  0 SF0LSia,41 HG `&!""#0_ED@HL0? 0 040hl 0@DU0 L 0/4d;0 0 0@$ P` 04 <0#p R0C0p00sG`Px'x20S6t 2ܢ 0 000`0z  `  Z ~X ZPPQ ,* 0"\0Q>? ,0##90 P?( 0P@/  0@őD L 00 /4;0XGF 0d0@ 0_ 001r 0PV F`P 0"Ϡ #$$%90\X`d?(,0I P 0@Dő L0 0/4;$0 GF 0l dh 0@ `Ì0 1/%((A@1%P3%((TO-)MM,0=0?0(8$0F <pW:t< 0 ; p@뤡 0P@P`P  <, P@ 0  ; pF 0  ;Ep@ ;T@  @[Pp *G @P xK(=0S0,5 Sx0<0(500,; 0,%S00\:X:Q04D A\ 0Q( AT* 0 04 0A AF 040A A= 0 4Q A4 00 Q* A+ 00Q(| A" 004 Q\ AP9 p00W 0G\3SrD9\s_XX9X0SrA X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R0081DA p4 P 0P8 a 2! Q S,QdS18$Q<4R:&A @<8*\50? A00p#!3x00084$0<04D0t p@p0|00pXsL5P5 P4H   ?08@`D ?) p?̓`\tF01o&" A00&"n0  4%8$05<4R0@H 66 p84<00x 0 08SoPN @P@0 ? @P0ͷPP* ?̷@PP(5#R0:ùP@$0[`- 0000%" a`0 ?001>0[`0 c2# S,Z Q Z3?001> !00 ^  BB0uP`0/2"0$ 0  ?aV`1V`#T0`10F 0\I ?VB@TP 0ἐA똀  00B1  B[1 ` Y"B !!0 R0C!I0B ?,0 `똀 0  B![0Ӡ!`S1B 110S ?]r @P`x1 F084<ĔCP`0S84<Ą-0$5BPS,`QɑRB@L0 0 0000 20S|0` ?HL404P@0 @1ሠpr'FCqp00"R6  Q9}T1(\50? A00!#4t x0Y0(0#T a2!, A3 31 0  @P0(/%/%Z/Z((bZZZZ[;[(v[[[!\(L\[(/%((((^Fj\>\(\((\(b (](%ht@%>] (]/%((TT(U 04 ` T 0H$4  E$ ( B, @%LV.  R*h b <  X ! \ ! ?.@Xd@+@B@A.@B,-8 He `6 @40K `ಁ0 ,p B8d i A YZQ 0 嗁0 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S83 k ll 3n 00 d AQ\ a6Pa`(PXT> `4k뼐@ kll 3n0@0P 8! 0,9> 0  R0:1P000\P2#00@P`@` 0 0p00 R00L&X0 W0S:pD R> TP0 뤤@t j0JF 0YK 0`0S 40Sa 0 # $1 崀$0+V. K050S  O 0=S,0Sڤ>0S0$0! ,00C."\ ^  00 0?d B2 b<10 4&-=$@6@H p BPP04SP0 0R0 S00C0 S 0,0ᨶ0P0F 0,0S* p开8嘥ȿ+" < Q \%0R.  @(0 0 @DU`40 @4A`70 @R40 `0```0T0(w 0 n` p7$X0`0 I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01tQ0C00h0`0lR#00B1 d0R*q%pĈU0   (0 0C0(0( 0 R R` ` e 0$5S  l01` p0000S3d0)ST0T00! !0)SP5X0`0`P5S00d0 0o l   f00༵00080@ =X`Q T+H0!H (AP+Hⰸ DH000-ᴰR㰱 ,  BU 00X0000T0 10X0岑0= 8R\ ?0 P 0  B  R\ ?0   00C 0  080 C  C 4400CS T00C@ 0|`4  80QT:  $5SXL $`$`(0t|V0S ,4 ` d,04  0,4 $* 00`  VjW0S   0帀0 X#` x0@} X\h># P 0?d @ `0 < =\%R m0SP,m\`/ `ƌ$  $ l(0`S`  0$5S  l01` 0000S1dᠴ0.ST0T00! !0.SP5X  ``S 0d*먐 &    0v00080@%0C 400400T$*Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@PLl倐H(FP00@}8p`0x1ሤpY70IX!@@,l00@0T: 5@$\,Q 0@08(0  (0d0O@ 0NN nC 01p0Sڔ30S0 000S.L:08CLC P3 RH0ł."\5 S 00 0 d 0/ @ `.3,00 $ f:0000S0S 0,00C0S0 20S P:0S :T20S 0#} 900l:h*,8iP 20S#A C 10S303040404 0#pCVW*wV.咱PaV.GVV0S  d10 PST1\5=S,B41?^ E?)0 0S 04 W dLĒH 0@ `Ì014 ,$0S0S 04 ? d ,04 0*> 04%>)ݍЍSoh(T(*|]d(]/%]((8 (G-`RM@Xr wPP XfwP`H `= P P7   >p 0S ߍ<08 H(00,0 000040!04 04$0D0(0P 00WZ  =pT h=p* \)wX%` 8 ᖵ 4  (        0,0 0  s =p 0`?`a8SoPb 0  0**0P03k  0* d@edAzd@,=OcvA-PMPp`;@ np@P  P06P;U00 ## ݍp@-@PȋP (v0/SpKp@GGG/GR/ՔG-P `$ 0pׯ@V` 0Я@`` V`@&!D( `G-P 4`pCϴ0ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@O-4MX0p0\00``P吴0 0,G, 0S% P 0 umS;aSMSASB0C0b0C S,$$$$$$$$$SSU0@0 0DT dS$ 09R R"P T 0U8$UQUDT P 0 sS @ @ @U00@@@ X 00 l P]u0S00 0 000 00P4Ѝ[NzNNNN@-sS,@ (7*'5ؿ%]Ob 0@- @   ڮ O-@0p ᕳPp`G0 00000ZI00SB_: W `B?F ᴐ (&(P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p (0P  C @- t co`/he z^s@-@PH` 0083V @ tЍpX ( (ne ^s@-PX00S@H0`ă5#040<n3V @ tЍpT (X ( (se ^h10 PS/C-TQ@@MPM`6`@f$a ȯ1p P09 0 T:@6S0O@ Y DD6ۍЍC+ 0P \ 010 S a8!#4a4# 0^ P;0Tጯ 0+ۍЍT ( (X (p (\ (xe G-HB` p/PP$"$t 0F0( 40 ^06# R 0 !s0 60C 0 !s0006&0=06 0  B 00C0( 6V0:`! `Vp 0$&0? 0(0 6 C c0 0 &$&?0`L0V&S %E0: S 0d  &ЍG1< ((2 (e ^^!_?_`5%A-Ta00S FT:pJ/PP  0 0A1S0S1 P @D A01 S  As0S @2106&0c106   B ! ! 00C 00 (e c_O-@PGM@X9?P>U㰐Y  0@00D @/60d& 6F H w Td> R`$0r h2 XSQ 0@H0 } 0 R (cR 5-0$00ᓩ (00UC (0 , P(0,   @R 0 0֭ $ҭ0F˭ 崼0 0 60 6彭< 0(0,200UX,0000@| PD   D $`0P 0H\ d0(@4LP88 0T0;0Lh50L0So h0;PU ᪫Pc  0L VR0400$ & \`#  @ \ 110B0MF0DR0$APpepeC0CP!P`\` :0p0-P`0"  pD 0(0d0040\0@080< <0(02(,0 0C0)0C000 SJY 0Hj00 pS D!*&A 7 @ 3|) 0 ( "*3 6 !"0H& 0 09嫔PpD |IH&0SK9 R070Daq$0S 40S `PD@ 80S<000 Sg0C Zp,  00 001(0@`@ QHR'0 Xx0S7 0S00S00 0  C02#(027P p 7PPXP 0R SHS SQY`@pb Spm0 0Y 0:Y:tV3006X  0+(01 080 J2T  060 6&"(6Y:$0TSL0S d0 P V50SapW~@0S zD5L R d0 P# 0PDT%_oRU+E&0#H6 C 0 ᓔ)6 4ë0 눔p ʮ6`U0CT 00C0CSX: B൮ 5Y1 21[0!!!0 Sq# 0 ᓢ" 孀 0d0$&S: 060& 0vg0.1xGz 0W4#0003 *2pXk0SMf`F`VI l30SA 2W 1D3PUBL0S \0:`0l t PP1 P# zE3766|0X00006096 30;Pp`1ot` 1p` zX27h6X00005f &1 #?1#  0RP *d "x P0 |0PPP!f vD+`Pw!\ <+P  6p!dS!PU:< U*!:0U:|-0 s-0 xp$L0S\^UB: 5 (\ ({_` (_X (__%`O`d5%`5%`p (`h (h5%QNS` (x ( a ($aP (Faa\T (ae a(%ht@%|*]dASc]bYb~bbbe "c|c|7%l5%A8%e c&( (X (0Q:BS! \0 B 6Psd  0P0 S %%* 呐  0p1Pl 1 !7P 8 `U&`D1l6\0U/0 x xL0S `0  1#'$/%17U5\X0|0004090& 2|0P((  /0 `px2& 0x90Df?o2U+u&0#6` c2H埩 H0 HD4GߍW@G-`RM@Xr YnPP XnP`H `P P7   4p ˬ0S Gߍ<08 H(00,0 000040!04 04$0D0(0P &WZ  4pT h4p* \mXj` 8 G 44 (f b ^ Z 0,0T0 P $ <4p 0`?`a8SړfPb 0  0**0P0a ⒢ 0* d@edAzd@,=OcvA-PMPp`;@ Bep@P  P06P2U00 ## ݍ@-`p  @P 00S0?0\$ 0S 0 2mS\F\GL \ xgL0 SDKT ЍE%KUJ%FZO%A_0 cc@--KP L/DDP<@ /0P00, @R  T_C]0Sj 1Sg 1Sd 0 @D$1C0$S [  [ *0SR3#:\00<0S @!0S P@ T <0 0P U8 PDJp8KP@@ 1 $11(1d000\0`S`Sx0S4\0L 0H->0 $0Ip+ p`PxC0S)0p2 p1S?V?`#)$p& a1S)p Q$1S$Ae$1S X$0p@ k 2"OKK@0DP?`|KL0OK\0K@L0 0Z0T0Q0S<I[# [ [ ? [l0S -80S l0Sd0h 000@0D0 0#h0S  d0S   T*,800S0 [0S0S"  0C0T {0#SuѤ0S1`0S S Te,0S , 0C4,00`01l0S1|0 0S010S(1h0S01d0S4140S /㖕40P(0&:*:G0P(0 (Y.pp(/0P!* RbR vV 00S(dR0(1S01[X$1a 00PV`5U1000AO0pY ,g'HD뜵U p; 0 pSf:Yf(00p*p`(uU ?  0`SM:0!\R&0S 41 S$40(00p000 [ !0R5 R4*P 0!RP5P"S4U (R41SPP4Q41!SR U |`SRQ SP" 11S<1 £P3P%Q5 1CP0嶣Y [  0Dૣ1Q000pP$1+!`GT0b#02b! b&X 0S [() Y': [ᅣ00ŸS#."T0 S :0㈀ 0[p00DŸS#i00S#<0 01Y`T01 !000 30$q W5d:0+a! `  +!  G0  1 [dQ [XQRU10A+!2",Y0 0@b"0`(t0(0 +! 0@G00S1!YV*/fff gf g1R8gq03M?03)001x 01100 0T2 ?@1c4 04 v. 08#$0 #(#<l 0 0&:s't :>Q X0Q40S00|00o0 00 R  ST @X5H'?  $*pE TS x0!R R S 0 S7071011H0T RZ* JiQ\0 [0 0+ S  R   0S* 0H0< 0J?oR20S C(0 00 25 010 0P B24 0180Sz 0`( "4`#/A-0 0P@U @0MX0 `Tp9i 0WeA@00@- 44@4P\P 0B"" &)-@=B'2)@-C 'D%}lؿ%G-@P ` K!>0P V0 0  PP GpP`00 0Pd0S 4d0 QV &)x,"m;ms@-pP@ 0  8;X 0TTX&LЍp OP `(;0 G&&)&)Um@- 04#$$04GQ   & Ѝ]m@-$MPp   @1 00@ 0! 0t&))n&1 pi&:`d&:P_&`PDpATV@D:$ЍQ&emmmmm4p@-0A0MP`   0 0 010R  2   $0Ѝp@%&R  #   $R ┝0S1#$$ 0("( 18#! 0Ѝp@%0Ѝp&)mn%n:n @-(pc')KnL@-0 L@ R0* 0 #  2)P `00CS`0p S00 P0S X0X /X&(%p@-`O@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h_d]`0(Pp <10C <1$0 810S81&);%%ؿ%()O-@ ^"44”P dQ\4$M2=p2 040 '# 2**xؿ%@->@TP P# D# 8# , # # ؿ%y!zwzz*{p@-0@ R R 0 RS000p\RP 0SP0PP'R"R `0S S"P0ؿ%`}}@-@ P l00S\ 0@ !0R3 @00SP P9902*3*2*p@-P0@000`?0@@ Q-00B 0$10S !0 0C!0R3^0 P 0 0 0*00 R|+L+l+X+|+X+l+X+d+X++X+L+X+t+ R  C=00pPPY" 0#0%0&P/0@0%2*2*3*}ؿ%,A-@P`pp P0 SR 0S0B0Q3 00@ 0  ♂2*2*3*7*P 00CS0 S00 P0S 0 /"(%A-P@pGP  p5PdR ˘`Ș`V :<<0/S 0 R0S /Q C0p R@ `/RR FR .R @` FRP @D T0t/S `0 /R/\;_*ؿ%}f0O-cMM00@00<+0< 0<0<00} \CP 0S0,3,00,30S3S0<PdlhO \|\ `!T 噌 f00 3 S .@@ 0T S S00 0K#=PC@P0S+K K_30S3/S:+K &K @0 XQ@PT[K>P 0!t8  t,  t  >0S 0 8xS`S*?S DS . y000qQy*P0C K+ C 00CK+ ,00CS00TQa0CS10|22X3003000x40009 :0:00X::@: ⓗ  PK 0@P( 0@0 9 90S|9 00K  K W m < ˙PK 0 Y PK. | K  P  ⮙PoK P 0K. 80  6 t ┙@PU T80S 7    |P= 8 (<08808407007,07(07$07 0707070707 07070707    LP K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <PK ⽖t0@Pp[ K> 0 p屖t`@@hP0V"0T  HT\HX0Qx0pW pdR000QSL00D0QZDD0@a0 `X\ X0S 0PV)PP PP K 0P@0 K. ~K>x%x 0  `@씟D@pP @ VG|  0S$0 0C!0R3 0S0S 0`0喘P `0ᐘP c=0,C 0  R+ .t 2 j0  d0|d0`@ 4KR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  h  X   `H0 S   \0T0 S N`,@0SG @DUYC  ⛕  P0S|& x 0 ≕ ` PcݍЍ |4  v  ԗPPA0S, P b  P U  ⳗPt I x ⧗PPh@d0SXT000+ ⢐M]+$^)9*7* 3*}3*ؿ%}} ~}@c3*;%<>F~-~?[2*k~e~~~~~~/Nt3UuI~3*2*gfff=L;f+ـ߀!1[-@-<00iS03S !?[P2*7*fl0@-h@N   L @0 0 >*>*@-`0@Px0 B0PU1 S2P T0p0S @0R<< 0,$p Ѝ;%3*2*%C-PD1`0B8! Y!R!tM@p  10S  tЍ000iS00S 00S d `P W @ 0  P ( ᭖P000 p 0pf W@000;%3*2*%2*2*;%ρ`0@-@X0 B0@T1 S2@ 0P   0S ;%3*O-tQ0S hhTT @P 0S <@I*O-M 00B,%P 8q0Ws6 P p PpA @P ``G FRCtD\DFC8C8E [ R  R  R* T Y    ```_ @$ R 1  i V 00030S3Ѝ  R  R  `& "  V Q `Y W  0D X@00030S 4`60 X0000  000S 0dd 0  0@0020S `0 Ya  i 00  0X@g0000Sp X     Rd @ 0 0 <T R(q0S / @T  0@g  0 @$ 0 @Wl00S 0 xP} 0 h0Dv0 D$n3*2*(%*LYؿ%>*Ђ l1G-0S \\@`PqP T0 :@18a P8qU @T+$PuP@`0S 0D !0R3 PȐ尠U 0S 0S   8P0S0S \0S   @2*%E3*2*>*_3*}0A-0S "P `p @T V @\PT$@ 0S$p$00_`@2*%>*O-!1 RR0夑S @P|q| 0P0: ЍS DP`P 0 5] 000p PP@:SR  0| Q y`P 0pm0 000$n0002*2* 3*%σ(7*3*ؿ%.Oe2O-0S  x0b00 Eg1P0pȡP@ #0pP00Z: P0 *@@ @ W0: R0*0 S( 10 R S U0:W00#03RQ00S &P 0000 S Phr \ X000P@ Ѝ2*%}(7*3* 3*ؿ%C-MM@PQ 0S  0 k`000@T0S @p㼀 T0:ۍЍ`PP@p0 F Y >  /000PU2 2*%3*0A-0S P`||p U0(@TP`0  RF000S C@2*%3*ɄA-p`P@P ._p0S 0X0 0C?oR20S ,DoS 0߄ؿ% p@-/0@P᧏ 0Pp SRp>*@-80S$0$ 0 0"2*Fiؿ%A-@0`0/0000 SPڤ/0>+b T0 P<⟂P0? 4 7y00?>*^*;%0@-@0 00@0Ѝs@-@P`P @TZ TT?0 00?݊+"+R  + Ѝp跅ؿ%$0L<S/ @-SP^*?%O- 2@`VCM b@0DXCߍpTW B/ 0 S'44x'xp*/ j@t1P0S8Q 0SD{'{{g W:0000[9*0S \0 0S S0 000R*Q 0S `X0 c#.$cc4"0,4 4Q0 P 00000S  ` 2*X*%ۅ (f*2*@-<[p @,Pg0@0;% O-X3p0]MS DD@c@C 800#000RS #0ap"& LRPP "TW 0"00RS[ 0"x`ph"lLLPP"L  PpDDB@@r0PSY : SVH`P؀/0 10L<aS$ < 8H @ ( D `  P  `\  T  ؂X  8 P ,9 E8!88"hG/0>+b  P<P P b0?0H @P LP)PD  L P LPBP|]ߍ2*%13*2*2*P;%]5J^*?%q (7*ӆ>*TsRRdN*ؿ%C%#@-$@0 00: S(7*G-@ q `0S+4P 00S P0 S00P R HRڄ00S t Y `ߏP 0 Y00:$00S $3*2*ؿ%B[O-AMM`P@gpP8 0 840 AލЍO/0 009/P7 0p!p j 2`Q D D @P <┏PD z@P@ = 8 3|PD b@D t`Ġ崰TAލЍ0A. 4B   R ; 0 0 D E@D W`0 D{ 0 D WL^*;ɇؿ%fA-MMP00 /R @`㨀pPP 0S P@ۍЍ0 D &ᨌ`D @P 0V P`^*p@-0@ @P P @p@-@7@O-3tM0 S tt˼p00RS`3 T3T#0PLC4#S@<<tЍO貼0 (PL   q+mp0@`00`ܢܲL<` L\0@ 凼WI < h`VV#W f@Pp L<0@'pl0PxSiScP 0'0@$ 000 L<0@ JGdd>X;L JtЍ0 0C0`10S 0`S%0` S\Xh0SS   7870S d00X0\ 0`0G0P!bc0 <d2*%2*3*2*?%;%6ؿ%LO^*v2*2*ֈ3*)JcA-MpM`@PP 0pp*d!d @P TTL뎐)< 0}ۍЍ aD D< MpPU U`k p0P V` xO0S p T0TP 8 =G8 [Ex}ؿ%^*2*(7*͉@-P@-L@4#S 0 D 0#S 0 ;@;%0A-@P` 0 P0: 0tpp ?ᛊ0@$aH00S$`A-PM@T 0``p/VVP   完P @T@ۍVP @p@-/Pؑ@P@p00/00@P 0S XA-P/p\0@oC 0T@@Ds[U pDP@DxV*oG-pP`04PSp. @P`0PP0C0 T`4 $ZD@ꆊtR*2*G-頁`6pSP  @Pty0&(0C0T%Q&F( $06収00vPPEPP Xᖉ @$  (@/2僉 00 @ pP`20P `0@0 P $" tR*2*͊@-@X00$D tR*0@-S@ o0S 0S f 0S `0 PWT T` R 7eD0&F$ ЀP 0S00%B^otR*p@-@`PP%0S @ 0P0 @/ថP_U0P 0 08C80p~O-2lM0pS ||(x2YGhPP P LD|0`000@(Q /*` R 0?*A Qg0@80 %10 $18 %1 0<`00{0@ Z pEGlЍ 0`0V@ 0 0/j{ 0` @T`$ q000 0 0($00S0,00S0(0 0S000$0S0400={@0 1S0 001{2*%2*5Jvؿ%3*tR*2*3*2*׋C-20MS rYr 0ۇw P0 009000Ѝ PP (d ` X8 P 4 $ $@0@DC `P oP   |1RQ rQS $0!SP P0h 0 HP \1L ! "H D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t( R" 2*%3*tR*+;wؿ%Fhr͉2*2*ތ(7*3*2* 0`( "4`#/@-@MQ 0 3/00؍/N*1+h$))#l[0@-0@MT[0Q@X0T L0LP H  :Ѝ0@U@X*I(7*8ؿ%0@-P % (7*^ؿ%0@-Q 0@T0 R ||C 0AS@ kЍH0 DP ( ;% 3*X*ؿ%C%mA-D@p 0 0SP(| ` `Vp `X*L0@-  Q0 0P ,0t  ЍX*(7*ڍؿ%@-0xP 00S@%*S` * P@` 40P , $  0ЍpX*(7*ؿ%0@-0@S 0$P B5/x00SP`P ́qpH0P@`ᄋ  0((@p  Ѝ2*X*2*(7*Pؿ%p@-hPh@4S 0SP LLH0P00080 4Sp?1X*(7*3* ]*0s@-0@SP  40B3/p00S\0 pH0P`@0  0((` Ѝp2*X*2*(7*͎ؿ%p@-P,@P@p P @i p@-X0XP0SpH`@P n P   @p2*C%X*ؿ%A-P 1 a051q0S :p|x@P 00P'P't PPƊa  0ltPS T 0H000@A( 2*X*3*2*(%݀O?j)^*C-paM! W\ X 0 00@! W 0A0 y08 !Q 讟 0"Qk/gX. , W \ 0 00`  W N8#`Rp000F"Ct F?do00@ LKЍ6*S%=(3*dHuؿ%2*Rc`6*tO-鼣@0EMSP8a  0 @ሳ00T*0 ?o2Q03S P30S D3 T@#@ $ 0S pEߍ0S 00p0" 0S 0"p! 0 V- V V: p  B B B 0 0l"p0S0S P 0P 0- 8PZ 0SF ܴB  B B B 0 0!  B B B 0 0!V! V V     !\!|0A(0 "S $U+p0 (У0AC5/0(0#R00 #0Q0h2P00 (0S $0(C#5/0(0,0S3,0P0?0!#0,0@ ^)P Aۍ<ЍP(0S  +p0(У͡0AC5/0(0+p0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B80S 8#R00SQ 00S \0l 9P tlx3  P8P0S(3*T X*3*C%(7*w2*(%C 0 (7*Ts@-@0SS(3*0O-wM0""<080000@ 040P0 00  0H0@0@L P0D` PP:P S  S  S;  S 0 ``p SK  S"  S<60S  ,,(60S ~ 6v0S - P? 050S  Ѝ50S P 0 L50S  <<p 0,000%p,,Y0S40S  V40S '  P 0 0 8|(y( V0 00 `40S 0 H 30S  30S30S   ?= P 0> V 0 0 8"((P30S` P [L 0 0#p0 0020S  20S620S  rP\ 0 V 0 0 8''20S 0 $m"p0 00c j10S 403/ HH!PbV00 0?X10S00S 0 0 8 00S 0 4\  03/`V 4   00,` (7*ؿ%2*ז%2*2*X*;%tuluX*2**TsN_{2*\*lvwA-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-CP- !0 010000 QP 0PT 0$M &P ЍPB 0P;C0P|80S050 00,0 0 @ 00 0(3*(7*T X*3*ח@-|cM0S ll娫hChS0S Y^Pr 0#0,,`  R0 2r 0 0500K Pr5"0C590C990C9000Ph|n x_0S \2d"`2Q090 9Cߍ0Ɲ8n*@- @ R2008n*Ν!@-$M0h `  P @PPDp$ЍPU DF0P <ѝ}8n*p@- M0P@H   u4`    Ѝp֝8n*-\M0 P  \Ѝ۝dQ -CM0(  Cߍ/ 0`( "4`#/p@-`Pᶚ0 R  @  0!S \X; 'z!>T0 0 d DopPn*p@-P@U U  0<3 $p@yi ˞%ٞP 7P P / //-M M? 2Lۍ Ѝ䀿%4`00CS`0 XX0 X /(%O-pQDMDЍO7i@xn`lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U P   y  t0.    ty  t.0X   p8M p Wꀿ%&(j Pn*Xn*3<0S/@-@QPM PЍ@ p31Q``X00CSĿP"1PЍ@L !0S SL   d0AS&08HX@p`H 0S0PЍ@$$    0t1hS fS501 0400030020qj0CS PЍ@'=01 (0<00$0;0d 0:0090080070060 050040030020N1jS$ $FBQ Q ;81,(' xVPЍPn*3(j }^d*mL4 0Q 000/ d{*E%UA-|AJM1MSh=`py^0 `Pp c40`0 Yp0S JލЍ;X P0kpA7J.H0 0A1$HpL  $`0P0p0 Ppp9 Li0S8b1!0 d{*|G-xAp1 `S1SP V1S \$V1S VG 1,^V 0 \ }GV\\0  嘠EPe0SVGx1S Q 1S  0 GId{*%E%x}׫>kA-a0 MSP@ 0/000 0 0 0P    RQ  \ЍS @0  0P@}* n 7GA-HAaVpP! 0 0A=\ SQR$SQ SA 0"\S 0 1S rAtSpRU@E@PPVT <A W`d{*W%E%x}0@-P@0$M00PP0 p$Ѝ0 R  hA/d0 0 1S0b0 000 0Yꕬd{*}O-pq 0M08@ D @CT Ѝ0VЍO@R`" 1!0  @@0p Y PP  @@ 0 p R Z ttw00CS4f( d{*x{*>h0@-P@0,M 08PP 0 dpe,Ѝ0 P  .!! 0Q P0P: 08Q( ꕬd{*E%~p@-`@0M 0(`` 0 p!Ѝp R  _.|P10 01SL0 D~1S*KP !qꕬd{*E%xO-DMhZ2 0S 0 000 (bP (P (0%"P`(` P@PDЍ`(Ppv (   pp$0 $PpDЍO3(P 0u$  (0CS-  -SP`p㨡娱唑( r00R0S W 0G0 0,,`1!0< 0( (0(Ps p( @l (U((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! d{*ɭE%};}ѭC-M⬀p`` (%gW0P0 0000 aPPQ ЍP;@P PP  PP 0pЍC| 0R  ,?-0W400(00 P(q 0SQP m0 Pp0!00(VP0Sxpx1Sd:0`DS PpP 00PS 'ɭd{*E%};}j@-P@0,M0@PP0 p,Ѝ R  ,0 01Sx$@P 0` p 0 0 0ꕬd{*}O-bp0MSP@M 1T S z P4"4,J@ k X:0@8 0 %p2o%ٍЍ/k p &k "R xX, X R TX PR*1 21 0T 1S1!T0 0*sT 1!0 0*g]pe0 < WF M@e 0 < F5d{*p 3+<O-{JM M`@Pe3 u^P00 S5VP0 xxp0 `Xp8*_Q5M):Gzؿ%O-pMM`;p. p P@@ p p p0Wp㼱0Z:N0S bލЍ0 0W`@P\ @PLqLL?H^P  1pZV㟉 1Z SP Z.pZP Z.20Sa00 0Z0V9 Z-P \Z.@)0T:Z^P Z. |dxedAq%8*[@-0`0 0VPP u0@PT VP Ѝp@0"(PP DЍpp |O-tM< 8@406PPp&ztЍBD0PP(0  ($0P$0,_!$0U  T T T;P07W 0ZT6P07W 01P07W 00S\PTC7TP 004 0S0R0S00 00 (0$@` 00@TH*H7H'0D7 0<7<087P0T0<@(0@P,@$00Cs$0640S 0TS0[dDt   0` p~  ;X pv xX ` ( j0P0L6PV 0gZ0BnS010<0S 08 SJ ?@0?D000S5 0S>P ?Z T0 HPpo 0 Z? 0HZ0L 0`p 0 05FH L ,0 0,0 0@000D0@ B^op `4 0p0`X p $?4 $;` p H\$?4 ;$h p X0 08T0v0 08`p4 0y 3h `Pɏ 0Y` 0Y  0OB0SP0剤T400[S%  p8c0p`$X8 p $;`0 p 0@[ 04$;h$ p h0` XP 0MY `0GY 0@[00P  0;Y 000 X,0S0T4 00[S>  paX0 p`$ pH 4`P$; p> 0[ 04$;h p2  #`p # 0 <1Ih00H!T0@P #`p # 0 0.0[P ȯ 0X 0X 0 XT0| |Jep5/4CQ5<[5ZAȻ55*ѻY@ܻ4>(?lļ@-^ ؿ%A-@`4Sp  P_T0DPEE$UX [P00[P 0-80 P $3MDPE@D`*1R p@-P@Q0  0 pZP @0S \G$Pp HS0@ 0< 0p R$5$XF%ȯ*G\+4S+S+S+?@-3800S ,0 0$p  1*ȯ*$p*O-\M0 MS1 HpW-Q`@`((Q(0 =vL+ 0=P 0 0 ,ۍ Ѝ0 000nS ?S aS ppS qS x0  0 d00L050 8 **Zȯ*(%h*y%ĽA-X`0S L00S 08P8@p0Pp00** **@-@L0@=3@00SD',0, 0S00<'*̯**0\+t*C-RP`tM  ,,E P RQ ğE R`S lW0t`FQ ğR   TDR 7 4* CR ` 0S $ L)\ ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+R`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0帆00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ%%[+\+W+S+ȯ*PA-@@P@T .@ P`p0Slt d0 ;@ P ,0< 81(0@AXF%|ȯ*xTvZ9\+S+A-@P@pP0`S00|0 R dQ R 0L 0S @!P@`T !S+ **XF%ƾ@S+4?P@-- 0 C\+P@-- 0 7\+P@-- 0 +\+P@- }- 0 0 \+ȯ*dS+P@- k- 0 0 \+ȯ*S+P@- Y- 0 0 \+ȯ*S+3P0p@-AM 00@0 0@S<- P1 PS" 0S00!C;P 0S0>PP 0T00aS0` 00S0``0 C:PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0W'Aލp\+sc,\+^Yh \+\+G-1MMP, 84 1ݍЍP0$C:P @4@0 PZ30S Scs 5@PQ v0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, "Y 0 PQ0S0TS ,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2G&Q|00S  d0 0P000<0P\+*/ p*̯** \+*\+,\+Y^ **$\+PC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! r9P 0S0<PP T0  x1x t1 R0 0S0QY`# 81 0S ,1, ! B9PY$PX0S &@'00 R   R 0 '|0p00Qg5qp P0ST00@\+h$\+\+ \+S+ȯ*s@\+׿ 0 0 0 0Z@\+ܿɪ 0 0 0 0O@\+ܿ5JC-KM MP* |2 Kލ ЍP0`"C8P @@2@<2000,rUP 2 0S@ 2 N. P0 aQq0S 0S 00 3@P {.d1@0S t5PL1 `0P <18@P dPPPA @1 ЍG0SQ,1PP(qPpL6U@0 000g#T<6U@ pV(PPP 0RPN`S 6|0@0 J000 L0=# 806#*S+ȯ*\+݀5J+A- MPb& 2 ЍPO0S!74P 0 1CPP 00|S 7P .P 0tP@h1d@) PHP!@4Q-=+`>)P %6P00 0.-YS!0R> p@-@P G00PU C HPp800p@-`Pp@0P<$0 .0Sp 0h R00埕 Ѝ0 0S0C B RQ"  ꈴ*P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  B%G-`P(P @ CP  CPU0 00| P0 10S / 5Pe v*P@5P 0pS 02P pg*:P5P p_*P :5PQ p000 SPȓ0S 00S1 @RđU0 p `CP0 0 U **'*$* 0 011 ͔0Ѝ @p) P > 0S000*0S 0PS S St0 0S 0`S@)H0pW ),p 9x*X@H*** - BR0 R  P R O-0@!M M P<@8@4@@0D@@@ CPm4` 0p 0S 0S 40S 0S HG@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /ITpKX`V i=5PUp@ @l0S ;I@P dP TP DP8 (000@09)@P44P 4@P@.)4:44P 00%)<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU 0PPP @ @ PpW 0pPp3 Q  `3  +< =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0(P0 Z , d0%T00S9 llX% 0S1  + <=0 00 (00$@0S0S20}SRq+ @/3P00Y@VN 0SK U +HL<+ H7/+H3/H` +@><=0 00P$` Q(0 A `00+S*<=0  0`0@@DcT@@0P/OHP0,00(S  Zc@p9u*x***~F8S+\+ؿ%4* *0*O-iM Mh8dLlOpt͍40,xHD@|0 C0PH0.600K/p% ,A'@0'4QD'8aO?ⰐV=HLa少'TU01p 0S `"PP =d0sh0sl0sp0s0St0s tU 0S V|V?0S a'?0S0 /GPR'O'P?0S 00SV4  0 _ 0 .=0S ~P' Vi<, )0S ~O)P$.`>`N0 0 )00 ;QT /=0S-p= 8pR( p $p0p-0 RAP;0 00|S h40S;0t ILM H= $= `uX[,:H;P0S000  V$ ::+ 0S 00S -0Py 0Sv &p(?Ȫ sPPP 0S :FPR?X :H?PPW xPx0SV x0SZ +0 0$ Pk$P %1P  0`!U/1\1X1T100p `10T1S 0S \AT! 0S |=AP l UR0 0⯏0S 00S P PN &\K8KύU000,! 0!c4 8!0R PP000yC84010c/10WR`P VCP04 P夐PtPt0S4 0囐\'RU`P@xTv B 0k_0P0/GP80S IPPk/@ꐗ 9 900S Xk?/]@80S00?o 2($PP0 QP60S P 0S%P 0S~%6Fp嘆Vs@P@3x)tn9Ql60d6qP 00@T = BP 00@T = BP p00PO QM`mElP<Wt'8)NP<J060S(`x@T*4!@'K,' '5uPU<0S(0?'"( ,0".0S ?0.T0@.͡!͡!..R0n0"R0.͡0 7$PP#PP0S0S80S#PP 坣B(H000.R0@D0$. 0 pwx'xT PJpPT \ X>XP\ #P U x U R90S 90S9yP $.0S @DT90S pYF|1!0S   PZ0S= S E#H: H:` T00R0SC rPqJ  K$P  ;P Ub d:0Sd: P _*+ ϠP 0; R#- L;R.sr ZO.!0Q3/PPp;@Ž A; R0 ;Q;C.,0 0 S dh lp#0S,|< 0R.Kp n/-0S v000S o000S h000S a00|iލ Ѝ0S 03/0S O00s@- P@w9P  q9P0P #Ѝp宄`P  ^9P 0 FUpP Ѝp@1 0S S0S  @90PP @D9PQ0@-Mh 00WP P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :*P 0 S000Bp@ T d:P 0|S ᯼00 0S00 0000괴** ( x*x*0*݀@-`$MpP h30000000^@70P/S:S y@P@tQVyP u$ЍU7Pk!@ 93  $& 030/0e?PP":`?pPԉ@P/000 09@P00(`0@@DcT@@00@0CcS1S@\+uPP00/@-< (0@  000<@**@-< t0@ d00S X0 0Pp <0000S As<@**ȯ*$*@-j<@`00S T0 0Lp 8 10 10S O<@*ȯ*$* h0@- X00S L0 0Dp 00 101000**ȯ*$** -X0lM@ d @]280 0p _ *nȯ**@-0lM@h0 0 00 0rS sS l+d d12d X%P0 0p /,d $***8\+ȯ**@-`PP@ @0@s8#80U 0s8#8000@? qP VU 0A0T0Ѝp00CS0 S0 S 0 /O-pTM|0x0?X0 "? 0p 05|;0P`0V0X B@&0 @040SD H 8PZ0S= S DV0  @P*P;0S L;0#S H;|0pS l1 R XaR 0# a*0;tp uTЍ  ?$0000  dPP;0S ;0#S@DT|0S ph@"\)*$0 V `|#L"0 0 "@B8*ȯ*O-@BM MU@$@ APL?0a>0 @@@0`p5(`5夵P<($| PP)|50S5W h% 0\U )0X,U S00H00S 0S  0S 0 S  R 0 00U!$JPP$Cp 0㤴 q)@P$1p 0\u`8 4 ap0TS 00   00Bލ Ѝ@3@30S VW@@c3!2k)3 0  U@ L30S.;50G?oV20S4 30S0#3 RJrTN20 CRk2000/ U)U00e@ 0B>W0pXP44220S V: V `2HV"h2000; "00ET1#0 CR5@V-U 0S 1  00 0V #T V00T0ST dT(U@ 1 p1娽L10 CRVT$10S@d@0 @SP405+( /10S (3/1W 0    0QR\@\0 RZ P :/ 10 YS P 9/0G ꈉ* D \+** **ȯ**;* q 0\+%S+ĵ*d*-A-` @T 8 0 ЍAЍ/0p0$ P ^xSdY( h0h d6o:0@S mP 5/꼵*\+* *O-@sFM M`  @8 8 080$0`30(0$ 0,@G0P S8偺0 Յ 3 Fލ Ѝ[G0 @,Q(/2@@Ȳ@aGT  巅 2 LG 0 PD0P|2d =P `"`d. L.0S 00S , 0(d ⎼ ZPP d@0S00?o2 OP e30@6G6 D01@p  d 01 D0(66S0d00 0d0]AX0`PS 9P P 00S t0 |0%HP@ 0 @0Ŀ0,`@徿0?꘏*h*<\+S+ *~ȯ**UO*5J*0O- WJMMsn0pFXv600S00p r 9嬿PdX 6  60 9嚿PXRJލЍD60 0 0,0b97S 60Sa 6 b<0050S# 䵟0S5 Q S 5R "P 0S 500CS\5|b00l;0S P97S, 5D 58%8k0S 500CSX0$000(00000 PN 4޽0000S40܀C XSX @4000C 0h00d0$ 0`0 P@ CP 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""44008'P 2Xu0097S0000 0 0S  | 0upS8'iP820 00 0^ 0 m6 ]pP 087aP0* 97R` S㸁 0S [10S/ 0S+,0 00 0<0 1, :P8!81 R  t 0 ) 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00UX0 >0Su [X  Tꈉ**,***|**ȯ*T**\** *\+ĵ**Ls*=k@-2Bp`WLM LЍ@ ㆼpPk  pe 0001᰽1 0S<0 ?!tq(⣽(00 Q 00SZ=9Q ='/?@#b!"/p850S 50#S 0(60 8Opp 50S 50#S :< p.p 90S0 00 0 0BLЍP4参00*,**Mb*0A-H`D0 82Vp  R`RBR RB`2b  Q  ,+00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 <@ (0S 80(3/0f@*8\+!8*H\+׿$**̯**** Դ ݀ *ȯ*#\+,*;(\+eS+S+@\+O%**4\+5J 4XhD*v\ /0yXȯ*oQP@-X@ L0 Y iP 幑@ 0 *\+!@-@0 Ѝ0 Qp@-P,@P@pP @F%@-T@0SHP080 0R G *wqħ*@-T@4SHP04 0R * *{*ȫ*0P @- Pp@T Wp`W VL\ P  R/G%O-@p`M)T oTP ЍOCT <<@DT#Ѝa 1 !Q@ zQP ЍOu 8S 0S P pP 0 XP 0 X  " 03/0 00$=* VYG%{8($\!\R% R 8( -0 \ \ \; (R ( R 8( "\  \  0 ( ( !R0/\\\0^ (80\ "\0 0(88S08 S 0808*M%p@-H0H@8D0 (8080$8P Up$80 +**@-AaM(8S V0 S 壯0) P p p $8S 80pP\ UP 0S ,8S0V (8S 00CS0 0 0p 08! 8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝ㻯* +4(%&"<  ( P/@-@P$eP  ^}@-@@0s۱,00p 0CoM%ȯ*4$0 00/O-tMM ⶲB0 @T(0PPZ@T= P  4gU 0 0 \!`Z0 0MP P@ =!HP@0J04 3# 0 0#`ĭ`P #[3000 0f#嬭`  [ 0f 0H#园`< 000< 0f0 # 剭0` U  S  RS00 "1f 0;#;Z0S;#;0 d*"?;#;0 #5;0?;#;0@#5;DED"WX@d `U0` 0PZ 2QV"0 P NP! 0 !}PmM00`x!dYP 0e 04!P<V00@<4e0!  0$ @0S (P0S S 00d @00 dX 00p 0$MߍP@ %U[0DEL *$*X\+.A8**Ä8\+Qq H\+@\+($ȯ*@-)X0@ R0D00S 80 00p )@8**ȯ*$-$M ?0 0 ᡰ$Ѝ0-4M 00 000&P4ЍO-pQMxFxV(% "0p@&0 0P00000 PU08 RPU5"R e0*P\0 00$00S& (0s0S P l@~d50S` P%A&`D5X05 $5  { 0bdXd@0f$4`4Y-IP #IYڙ$@$壒I $f $2`0 lğ R#3SPS0@ 18$0@0fѫ00`p`V 80pPZ`V= p  30 0 0 "T3PT0@` 0P "M@`0$% T+&`#3SPXK1d$K 00#50@0  "j‫2 @@V0Nx2d R@0p0,  0P0V001*x"3\?\ 00P"P@VD2 0@p   (0S "%+0!P@`0U0!,@(0S@0d!#@t1 0@p _Qߍ 0 Vv ,r"} 0y"U 1`PB0P  P`<4@0p<@e0 @ ݪX\+@\+8**$*h\+( <\+H\+Y@jP\+Q*4q qq {.A4ȯ**$@~z@-'@6'@p@-Bd00` pd00CS01p ,P P00 @R0S"P8d`Qd00CS0+p "P \Pd00CS0p000S 8A0QPA p0 0 `VStp0 c`Pd00CS0gp 0@S P,P \Pd00CS0Vp `V0 0 j$Pp@\+M%\+A-pp@`P@ .PP @P PE "P@OoB@\+O-,U0mMS p EPd &0S imߍR0P.0͵1y4PPd'0P0S SUpG Ph4P PP P0CS0 4 p- P P P0 PsdL#P P #P d0p yP 0? hxsdvsdZp P 0S d0p YP0? Xsp P 0S0S d+f0 P P d00CS0[p\2\bQ P Q4280 0 dAQ 0<p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\0p 0 P`, ^0!S^0C0 drPXX i*O\+**S+"/aȯ*%Ĺ**̯**@-0 @0SfP  )!P  0 00@ x0 lNP T0 LEP 00 ,<P 0 %#S+(400CS0 S0 Sȩ0 /1A-0aS0P0P3U %P 00.S Ppd1l `L X1P@  H, P10T0!0!00 (1( RU 0 ! 0Aq000 00000P0 0 0pS000P0T h0h0 @U t0"P$0`Oꀴ* *9ȵ*ĵ*ȯ*>[̯*AS+S+S+S+S+d* `kp@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p輵**S+S+K+x*,*\*`*̯** L0@- <00S 00 0(p ɪE**ȯ*$*A-@p$Qp0S `0S p 900`Pڪ00000S t`0S p ߪ000080uT  h.$p**,*0\+O-P"2 AM MR0xB p" R S4 P 04 S` 4S4P  $Aލ Ѝ4Sg1+8;004P/S + + <PadpUp儑0倁 00g000000000S L1o981&$1 R100CcSppW100S 0o 000000媧i4SU00p$@pPPfTy $P00**\+*l* *4\+$*̯*5Jɪ\+ĵ*OA-Q0qS0`00@S Q`Ѝ0}NP P p0 R 0000@ Pl00}S0s00T 0S$@,PN ꀴ* *S+ȯ*&Oĵ*%\+O-쁟a0AS000qSP4M Q 1-N4ЍPF P0.0lP00XP" H@ P$,!0Ԧ20$A$000 0˦@, "P 0 彦@ [P 0$04qp00P0}S0s00U 0S(@<M Cꀴ* *S+\+ȯ*Wȵ*ĵ*@-,@02 YP`+A-`P8`p4 L @P  8@P $@ VYHb|@-@PO+ 0A- 0@0PS0p`0P㬀" P 0S 0"S0x R S  p`"R"^ 0 00 K+* *\+%mK+ĵ*0@-M M P L w@EPۍ Ѝ0aPhw4/S @ P;0@TP/P;O-@P`pW 1@@Pp3:mpFh`ܰ0X1 0T@1`0 10S 0 SY G0L Q0h0S*00 020 ЍP\+ȯ*@-!P0@0 @p npP0 0SP0 0r!@Ѝȯ*ht@P\+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0CL*D*H*P*@-0 000% {0S# R 0S0000S b0C("( R S Ѝ %%7@-@P0S 0t 0p0ᗨp\tX@0S 00@ 0,凨p( Ѝ0@b Ѝ0蔴**C-@\ᄐpA`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&*݀S+K+* K+K+/A-p`P @lP0  T  `00T  n0@ R   `FVp`00CS0 X PpTD000`000 T00*(%<C-pP`=@0尐TJ R 00@)ax0@P`0 \AqL00D P 0 Ѝ +?ȯ*So(%u**G-M@ `' 04P0 43`PT #P #T^ Z30S+ ` Q `V` 壦p0@00E.002 U#P El"l3E@Xlލ ap`0(T $] Tp TR0q10@S  } 0$ 0/ 0$ >pO0$S*F>C0S  bX4 `$Q(00SZ=9Q =(/?@#b!"/0 0p40S 0#S Z0AS  T0 0000 0p 0S m0j 0 pw0LT PZ<00~*7*Mb+p@-@PBp@٥갤p@-@`00CS0RpP0 @ .0S0`00&0#S V 00p0 PA-p@`pP0 @ 0S0`000#S V 00p@-@PP`/P 8*Pp0Spapx@-@P )@-fPP@-@fp yP@-ټP0@-PlMQ@00 00 T  40S P 00 P 0 0U 0 PACcpW' 30S F@C@@`  L P ˜` PJ P Ij0 S8 @0P 00P02 2 2 PP 00 @T   P 0 0@T  P lЍP 0S @P@E    P@ T T0S n@P@& 0S @P@ Tw 11@T  0P w0p`VPP)000N0 0 0PhQ XQP@x*"H*ȯ*(*zDP(%\+grzK+̯****hy +**K+ K+7@-P 1 Ѝ0Q0S 1 1ZP !0 CRhA R S0T!L1P 0S0,!S 5P 0S 10S 0 0&@ @n0 @0@f0 @`0 @Z0 @T 0 00S 0U\+*S+ȯ*-(**p*=* *ZS+S+S+S+S+dS+`S+S+S+@S+@0Ѝ0@4*-A- $a+;P%m+M% m+l+Op}j+0 m+@- 0 B m+@-/ 0`m+,b+P `00CS`0p S00 P0S X0X /Xל(%C-Pp@  l18C8S `l 尞0S  0夛`V   Ѝj+P%m+,,c+@-2 p( P@ @P 2ЍX0/LAP j00!C,6CCIP%ؿ% NZ0s@-@ 11`8C8S P0S  ! H@0 60nS .Ѝpl+P%l+$l+e@-PMP Tt P H00S@0\A PЍ @P 1wh+P%}K@-@80 T 1E +l+D0@-|AT 0S N 0 ŝP%j+@07@-LAP/0P00  Ѝ0P%5@ @-@0S S S 0\ \ \R@ R0 RG-P@ ?  圀? p ?x` @㋚ QT@D0 DЍG1s0 z@T*Qs00!N%IG-AMMP`PB  l2l h2 =\2 XV 0 0Tw   T lt  10D0 S B/o" R  0CV P%p5@-c+ؿ%},b+@-MwP Pppp pRl@PL\܍@A, HP 圚܍,0 < 9m+m+P%0@-MP MwP%@S0@SۍЍ0@,P551d dPPTۍЍ0@@ 5圕 , ۍЍ09m+,b+)p@-P hh=@PpTT僖Pp@8@ܕ<r> 0z4Ѝ0xh+P%@-`0S@ P3 0S 0000q20\ @qxh+%7@-0Pl000@h R R  l R  P4k03/ Ѝ0Q PP%,N%xh+p@-$A`1QS 0SP SA P00p00 0P  P0  P0 t P  dd子\0H@H  "  \ pP%xh+Z~l 3ؿ%O%j+00@-18C8S 0P l0P%m+@-(0(@ Ӓ0@ l+8m+l+p@-`BM P@0 S0`018C8ST01y0 k0Pn00x0 ⣒BߍpB/ BR 0ⶒ00P y0001l+P%ɪm+l+ 0?o2 0/P%@-AM R 0b0000@000  ᄒPڶ0 q wP 0SS WS BSr0 +dP  Ts 0S  1@0S0 pW %18C8S ؀0S R     |P W 0@^S00CS00  S00 P0Sl+r j+8m+|h+P%m+p@-PH@P@pP P P @P% 0/@-io/A-@PP" p00CS"|w w w w w w w x `V PPsP0 P00TA:% 0S P0000 !0S0R 00 A-AP00C!SaXp `0000CSPhy x y y y y y y `00CS`0p S X0 X 0 "S  y0S`00CS`0p SX0 X ! RX!^J0 0P0 P000 `60"S0L0A$0+0 0P0 m+(%k@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 $G-@P2 pqp =`P`PP2 00PF 0P * V @P @0S@0S5$00@{PP?P PPP P 0!SPဍ]/rm+P%A-@MPP\1   @P `p崀  VPu00u0ۍ0 P 0@ 0000S E  U P00 ZP%FOk+Pp@-`@.PP 0 )Hp$PB@prs@-@P` , 唑 R 卑 剑@T|Ѝp(R( d0P%P O< P K(P j+f@5xt yt 9m+0@-@M@0(@,0 0 6@P Ѝ00,x0 ⾏PPPP0S 00@SP m+P%j+@-坌 (,\m+@-@  孊lP 奊 _0P3P xttrh  XL削 zЍj+xt yt yf@0@-4MP4PX 1<18C8S DAU 0 9 0Z LDR<P8 ,0E R  ;P! 71PP 30(0S$4Ѝ0=R00ES ؂ th`\XT HLP%j+%m+Ya2@-0 導@3j+-@-n-@-n0 R   ЍЍ/$o+-@-U0 R   ЍЍ/$o+A-ARp`P@1T upP5`@DO-dM@P.0P0'0P0 0 8p800,@400(P@`@P p0p,0SX ,0S5TX L @@[ X  ( 0F 0 ( (c:psP T+o,00,00娂00T񟗾` D p Ї , L X h ؉ H ( Q 0S0$S 0S dЍE 3 P ( 0C,0~Q@ @( QQ , 0C@( ,0u( Qh 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @ @` 0V @,80L"(t6P6 <(60S!̈ ,  $ 4 H H 8 R0 X (b0R040880P(/=[8 8 (b0R  $0 P $0 P H8 Pß0000S(=@SX (  P0C S,0( X@S( Pl0C,00 S( L=`K{$o+'=UvO-lM($ 吃P㍃PU``8@ p0 P 0<02@02 @0` 00.N@P h ᾅἅ@` FP`@0S( P @ᢅ᠅ $0lЍH?@d e00 S @. @ C< F0ЍC趈0S%At%AA-Mp,P`ЍA衄0@: SPPT@@`P00S 0 00hQTP1 ~p P PU0DsLS<(    ؼ$o+O-0]M-SP MP @p<᱌P3 00S0W0S( 0S#` pPi40S ]ލ ЍO~v/;]ލ Ѝ  @plU0* RT < RP PP$Au ⁌P 30v: S+  P뤳 0P@`Pdž  ؊P pd ` 0 0L0 00 0S0S`- 彊P``ˊv `0S 0 ᳊P |V ᫊P `z{ R 8MRK ၊pP \ P x!1Z[  0 Ë.[ap`l< 0S'HQ0|!0v0 P: v?b  0S-v@pP vq墽W ]ލ ЍO-P-9? 0S:pXP P : R S00 R0S PPdVT}$o+S%:|0` >Six(%(0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ I!P X!IP00S D00S  40 /I #P@[΄8o++|+ i%@-Jߡ@-WPp@-P@jp 000/o+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@  "P@ЍpPU P h0P08S%o+7@-@P @"00S@o+p@-@PPp00Spp@o+A- `pP@P000 PP0 0c*@-@P P0P00S@o+@-`dMqPU> 0S; JIP2 @@?T/  C `00@ C 5@ H00 *S 0 000?0`?ZP10HG>P dЍG 0@-! P 00  0S0 0UhP xP +!h`6PTP !Ph0hh0SP0h0 Ѝ0ht@o+OJ8S%ZԚU@-,1P0P@P  , 8 D P \ h (P 0(  ЍxphP0PP0<l00l0o+behknqtwz}o+@-`M]yoPuHV0@EP<0P0$0P00:JP 4Ũ 40P4  TP00t<P00\ 0 -R  UR +R  >Q @c?|0:S [?t0cS .S bS S@ @0,S@pS wS ,IP ( AP 3kxPt@Pp@Pl@P0 0  Sxd>P_>P Z>PU>P hP ^*H}+}+}+}+/W|+#wU% ~+$~+% 0/|+@-  01SP R t0 T!WP R HH~y@08 ,(z@"P0 |+(~+ 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aR R S R0/0 R /!0 R0S //@- @PH ` 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0P@\@P, PP@@h~+A-P` @P lpP ` L@P  A< $@^tT Vfn{ep@-Pl@P TPpDPpp@U p@Pp݀O-MM`p 0@P |P0: SXxtX  AP  @P> wލЍ R R R00 P P@ P @P PP 0"SU T 0S0C0 6/ hAP 0mS POe%e%P P / ~h+s@-P@` "0 00 BЍpA-@Pp4` R 0S xp@@-P`( @p0` G Ѝh~+@-`@ (8R808Ѝ 8 0 CS  8 0C 8h~+p+p@-`Q@PRpP0S  w$0Sp wp@0S S D0V@ ` 0V, wU  p@we% $0 (((( 80( /h~+e% 0( (( 0( /h~+e%C-@i㼀`p0S Ѝ @oP0S 0S 0 ( ((08x9P 0 PP 0}+h~+7@-D@P@/@00S Ѝ0 7Ph~+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08c9 80 8 00S08U9h~+o+0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڧ 0`h~+o+@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00h~+o+s@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00Sʪ808h~+o+p@-p@XU N8PE`V` D0(  p8Soppph~+e%(080S @-/h~+p@-D@0S PX* 8P 0( pph~+e%p@-|P`@l0 R(0p0CR0R: $0( ip00h~+e%7@-@@P@P  AP Ѝ00P$ /h~+0S/0G-0PS`p@U @0 pP0@@@ X P00,q*q @ P00+P R/-@-4@$P(0,0P  $8 h~+e%7O-0PSG` 8(hS?Pp $8SDG(R008(h8! 0S0S ] Ѝ0S08R00(hjP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S  , P l < 8 8 8 eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VK"3P( 圓R( B( ( W(PV  PPl>@rH80S 48PS8P o088~480X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0BP0J``` P Q`*ZXP@oD}](<8RDP4@PP 048(PDPF 8S S0050R>$ 0P}+h~++e%h+0 A-@P `p M!00 0 B R   0.S u3 !` P*HP T 7 Ѝ0 P000C/0 !GP00h~+0(8R/h~+0$P00 /h~+00S/ Do+0 O-鴑MpW]$ 00! 0U R`PQ Pq@0PQSQ0Z000s@P9 p  wP 0: Sp u P)d0 R'0 X& r@X  K 0G0  x*ȨuUnSnЍP00pDo+e%+5J4 800S ,00S 00Co//o+o+o+p@-|PPF@T p@``nT0S S VS 7Sg@ @갆+p@-@0S00S 00SL7P p@0qp  ~00S Rpll0P@ XP0PL0@p88 SP@W@S%4+po+`o+|+H+|+@-*=@34G-@ eT00P  00`p|| 00ST V0 000S T28 갈+|++A-pP+ @`0000  "P0;0 A! , vA0PP     P  5X A$갆+p@-|@Pp$R0%S!S0C Sp S}P t P 0C Sn | 7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP m0S0pqp 0p@] 000Sp p@B0!S $P l$t00Sp$dP`p@&L00Sp7D00`Vp(V'p@4p谆+o+Do+* p@-`@P 0p@L갆+A-`P0@@@p0P/00,0S W HT T A,0* ~갆+ ݀t+@p@-AM0 70000\0  b0  ]0  X0 S0  N0  IP`0S1 0 o;PU0 D<<0 40 Ѝp谆+%1=GRX`~t+@-@0e%0PiP/ᰆ+< S /@-0 054 Ѝy%c@-@u0@ 谆+p@-x0@M@T 0S P0`P V@Ѝp`F0PS `|+@-@G0$ 00@S 0갆+@-@@P@-@0G-e`lOl0h?h0@M0?000S0 !0 S A?0S x0S 0S45B0P P T?iP뜞0S P ?YP\0SV80S! s0+2R80SeVHZ0PS0S' /S S S[ SY U Uz 8=P 2Y 0S E:1$ "17S< iS0S P0 P MP KP 00y`P FiV 0FcSd  8  0 0  x  $    d x t  t D D h ` `   L p  (  @ 4 l x   h    < (  t D  X 0`E.U V``dP ePOP= 0S`yc 0SP0@_U0 ,0Sl U U000#=U00S `J V 1P+U@  U !UQ0-UQ00  @0#0QP P 0 a0CS00 0`1/P   00P 0Sa0@S @/P000S tVUP8  G2,00 @0S 0|) -P 0S.P +,a0ES000+,P .,0 /6UPUU0ES񟗚$ d x *U( @U6 !U[ Pq 0S US'70S# P W`0SL970S%,` X70S0 97R0<Q  70S07S ;07S 00#&mw/10@S0 @0N07S9 :<#0CSP`  k=P 0 40S e`0 S &0!R0+?0}50S  0 S %0!R0*?0c !R0 0!ıWL50S!R0 !R0 0!ıD A 4; 4!R0 0!ı/40S!R0W!R0 0!ı !R0*?0440S 40S 6`0 S 030S$ y0 S 0  V r8L!cR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0<_P0P0<0S 0!ı2 .5(/:p20S0S @ p2 D 1 H 1 P s1000!R0 0!ı|100p10 00!R0 0!ıM 0< `0000!R0 0!ı8q ` `<0+++@+t++ e%݀To+9FUk*fy+o+@"vDo+e%|++o++|0+400S  qd00S`6ZPb )P /  0m 12+!?P@H!R0 0!ıP ,P P !R0110+?P&!R0 0!ıP !R0110!R0 0!ıs?`P, aP?qp T2 !R0 0!ıu?`P!R0 0!ıP ^2`PBP 0`0,`?P*)P 00,00  TH30S?LVp`# *0u  PPl U Ui ?V "0> PrPY U UV "0 PbPI U UF :"BP40S %dPNP5 U U.P!0P.$% (P0 !R04 0S40գ?0/0 $0 S00C0 $5 !R085 0SH50գ?0/0 `%00 x5 50iS 0 |050S080200S/}+p@-@P/!bpO-S`PpM`r`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0i80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;P0   80 fP f [0J0C}+0   /G-pȀWY+p S@05PPP @ ZPPE0S`0S P B0 0R R@0`p@-`R P@ d0P @@@ 0ppG-@P `pM@?00C  RT0Ѝ ` ?i>P ?0 ?>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8  0 꼫+o+|+A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 i輫+o+|+@- @ @+ @-P@,+ @-P@v,+G-(2pW pЍEkPP) P0`Pkpb@P 0pqp'd  k8k? SZ d0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP +Do++ p@-p@`PP<J,<0SV@` `<D IP +p+  0 + 0 +7@-dP@ PP 0S  P Ѝ0+Po/@- + ЍA-`QpP P P@P%U0P 0 P l @p@, 0@-M + srp@  ) PP  000Ѝ0o+P+400S/@-$@P P@x+o+@-@P  o+P/ @-p@''0@-M@'@hPRh00S@)PaP DP OP AP )dP oPi|0t00SЍ0 h0LP 00qph00@&)xo+] S%O-(M0S 0S H0@S R u P 4X ЍL G@j Pp 00n pPPP`TP DP  PPpP0S P``30STPQPN ((@(!P3`00aP0`0 pYP0`0 4P T ( v`0 bqgPf& 20SP `JP   @( YP hgY |2 pd T2 +D2p@20WF0b,2P 0S P (|hP# " 1P C/}&0S )/ 1X P DP Pd1 _L10S Q_ 010 (0 qp 000Sp 0 G'P + 0 R  [ R 0 0P: l X o+o+݀+8P+ `o+o+d+|+Lo+to+o++e%++h%]P@- 0@o+00@-~P '@P+b݀A-P`XpVVPU@JTWlP0+ 0 o+@-yP@ @0 o+ 0 o+ 0 o+p@-P@@P Pp@7pp@-@`P*PpVU p@] Pp PpA-@Q`Pp g_^U:G-@@` PР @PUЍp pP^7BP ^8p0SkЍGo+@-W0@0S @yo+0 R/%R %R0 sR0/@-(@0SP00d+G-`dd@p00CS0 "p PP 000 P U 0D IS  DaY^p@P@- 0PV:A-@0 0pR`@0S00 R0S@00`P0S U  P@00e%e%O-M@`rDPp!Q Zo`@pW*p%pP` P` X P UpV`DPL`00@0H0L 0`laЍ8P `@00e%e%@-@+pFPPP Ѝ@V@@@`H0H 0P07a] ?@] ЍyO5@5A-PPЍ0S `p@@@C\PP D00< 0` aW odPg]~d~@-@@ A-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0_w@o+o+C-EMPPEߍ@ 0@qp `,cPڬ嬐P ` P:T0S EP @  S0pSI`P  P@}+ +A-kX1@0SGk @1RpP? ,%@ 1P`` ``P0p000 0`001`\밀P@pW Bp\W Pމ0Sx\Ѝ Bo\@Do+݀e%e%0A-0S@`@P0L _@p`PH\@E\C\Do+@-@@P , P o݀@-M@P Pۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` hP JP D$@ ЍHP EPP L 0q_ [ ` [V @T P uX%XbP !T@@P@T 000d0(@t`<P#@0S[ܫ+Do+0݀!0A-`V8@PVpP0 PЍA#mPj`@@@@0 `_i[g[@b[T ЍA轈ЍDo+PZ-M cP  @oЍ0@-@P0MSP @!^^ cP+!@Ѝ0@T@0: S *@^+h%h%@-M@cP͡0 00Ѝ0@-Mp0P@u \cPh0 R\P0 R\ tu p0St00Ѝ0o+X+P+/5@@-@7P P0@/R@-@ &(0@0T>$@ꘫ+@- 40 R\00S@@h+T+h00S /pp@-qp $qpP@ QPpp|+@-P$P3#0 R/  h+O-q$M0S|10S%@AP`\\100CS0S#P`vu @@(P`0S00S($Ѝ|P`@n 0 R  0吠00刐 00 000 0 000000  0P0000`0E ꘫ++o+o+$x++O-M ЍO *O-P@4M(0X0 ,0ut@ P4Ѝ40SX400 ?Q)(@PPpLd00$0Jp P:P  ` V0/ C@p` P P@00Pἳ弃0v V `V@P,0S4 x3X4 @ P6L)X30pW0 0 `P20S Y Y` P P `V@Y*)P `@T_@ P0S x20S  P0 (0 S =  :&PI 20S 0  @ 1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``@P,1` !X$0r$0@P_ V Vj@Px P P Pr P^@Put$0U$0@P_{, 0S V V0$0$0S B@P O`0 h+,+|++++++,+4+7@-P@vP ,0 R  000 Ѝ0踈+O-`V =R+` =R-`8 n Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` 4P `` e0S} 0Ps {LPi%+y%݀(%Oz*<K$0 RP  /᠇+0 14/᠇+0 Q/P/l%@-04 ,    00Hx+@x+Px+ +=O ` <+H+T+`+l+P/0/᠇+0p@-@00P0 0R 0.PPPPPPPPPQQPQ'H'D'@'<'Pp P0 Q00ꠇ+<+H+T+`+l+C-阁P0@SpM`Ip`ll!0 0!0S~0@ 0  C@Pa00CS7 `PU7 0 Ѝ P -0!0S @P 0R 0rq0 U h Q H S  {PwP++++++0S%(S%,0P$0 00S000/++++p@-L@P`0S0000p01S 0p'Pꠇ+Pp@-`0 p@X10S P@@p(1@0PSP5P/u`P0@@S  1CP0 1C%@4P 0S-000|  0p  0d  0@@PO 1C[P }++Lx+Dx+Tx+8x+O-|C0M0dwvP1Sy0\P1 0S Z 0 S1C10q&QF 000 00PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S Fm 0C# R Y1S1S  ` 0kP  00KU1 0[0 `0S1& U F& 0R 0èQ0pP 0C001萄 S rI  0ꠇ+++ +o+<+ī+A-pP`tp00S HP `P 80@0@D@ 0@0TЍ ++o+p@-P@8 02PpA-`p@@PGE$1S 0P $@@꼈+7@-Y 0 0R  x00S U d00SX00S D00SX   ꠇ+o+ȫ+ī++$x+(x+ +<-0 R!  ^ !0ꠇ+04/᠇+0 R 00S P@0~0/0P 0/\!4 0 / B  0/᠇++ 0 /᠇+qp/G-p`@PpP 儐u U 0 0W 00V@00CS7P P 0P@Pꠇ++PG-P0P`PpЀ@ 0@D~ P tV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSBꠇ++G-p`P@0@@0W  S #R0C00C0Ѝ 3,P  j H 0 CpGA-0PP@q1k`EP q 0P 10ꠇ+G-1@`p`P0LL0 rS00TD`0PT@o+o++p@-@PPp P0S0CKp Pl%@-0P l%80P/ R/0 0S 0 /+00 0S/$0$ R O++y |+A-X@ 0S0dS 0p(0,`P` p U` m0+ X0QH0H 0.4 00/ 0 0(++(+A-@PU  ^"04P4p 04 R0PU R4`40 0 P ^PQ p0࠱`  0+O-1P0sUPP@PP0⸡p`@` V R0 SRA  0 V 0  W0PR 0*?PA `Y0 0 y W`@TP0 00  0` qp +@PPAp ` W0 0O0  0`qp @TP+++P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 0 00r  0@P`Pl`@W 00 0 00r  0@P`V@++G-`;P@pl0Vs 0SP@`(P@tu TUPo+G-\@P0p`Pxx80@ p 00  0`P 080qp7++800S/,00/PP//ᐫ++00CS0 S0 SVK0 /O-0P-SP m   8 hMp@MPM@P0S,@ 0R S%@T CJ F MiMM=X   g  0 ЍO`P I@F@ M@ 0A $ oIE$y + |+5G-@P $`P( brpP `y w u S [ @yz  0Z Pp@ ;p Tt p@r 3o 40 } p 5JB$|+C-`Gqp pqp@@PP.Y T0 0 Ѝqpp 0  0a0@S@-TA0@S<0'@ Ѝ'P( #P  R (+Ȫ++ .Pp@-9 $P" 'P= P !srp: p^P 0 &- &P E06 p1Ptd0`c@P\0 L0Af&P,@m006p o+(+o+Ȫ+G-@`pdP4T#0 5T Ta0'0000aP0 D@6T P'0(+@-o0@-MPh@P   srЍ08!P D0 00&o+(+@-HP!sr@ 0! 0&(+@- | sr @@@60P&6 fD0606Ѝ(+o+G-6@PP`j>T6k.sq 00P6 CD06PU p)`5DP0PPЁ  G.P (+o++@-P ,0 0R = o+ l0@-0`  ^ @^TSa04S '005S #o+(+0@- @P0QA 6R 00(+G-[pP@P P`PC`Cp6W @(+00S/G- M`pBH@吠吐qpp6W @ Ѝ 0 z PU!P tP P 0 H괫+(+݀ @-000mS Ѝ 0 Q0 >@P 0 S#  PPP0`0 S } Q0 R pV`PPp ]Cp00o+17@-PU0P( P@ P0 Ѝ000SB@PP (C^P!C Ѝ0@H00S< Ѝ0@: 0 0$04 Do+% to+G  S%[ v   0 xo+<07@- R P(0(@?@ 0 Ѝ0y%o+@B+@-P M# @0.S Z00S Ѝ ,0S 00 00S000 l LFP0@  0R 000@0,0 y%  +   <07@- R P(0(@?@0 Ѝ0y%o+@B+@-P M# @0.S 00S Ѝ 0S 00 00S000u l E⫽P0@  0R 000@0,0"vy% # +9  U @-@PP  @H Ѝy @-@PZP  @9 Ѝ 0Sp@- Sp00S p@t' tl0p`{P p@qpP@ 0p@ uDo+  ++P07@- S SKl0 Ѝ0XP@T0PP A@z Ѝ0@A0 00 y%y% P/L0@-0@S !00 $0$ @d+o+`+P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PwA Ѝ04@P,0  0 10 y%y%+y%D+0/0+P/RP @P/;@-@| p l ᢼ@0TxSPLHD@<8@ky% L  - g    1f@-V0dSK@S!1 CRJT" R&0CO  R갠 X X X X X X 0 X @P3 @.A C#R8 X П X X X X X X h X X P  X X X 8 X X X X X X X X X X X X k C \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~꤫+O-@<M`00PP*0 S 000C S 0  ? 0p00C/  0?ApU:X U :TЍ D0!R1@0P S 0,ST(0 @0D@D1!0C 0Ԉ+8m%000D ;0Ѝ,0P y;݀ȫ+ī+GP @P/ 0 /_Xo+P/00S꼫+0/@-@0S踫+0/@-,@0S0 0p00Ѝ谫+p0/@-,@0S0 0^00Ѝ謫+0/400S/(00S/@-4qp@꠫+o+P@- 00@ ^S00S00 Ѝ0X .y%p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ iB @ꘫ++oP@-P A7 ЍRS+DSSS 0e C RĨ ̨ ` ` ` ` Ԩ ` ` ܨ ` ` ` E C CS -S 1 CR 0CrS dSWS ^S0Sh0wS     0  E000 0 FK N R WR Q S-00 0  5+P800S ,00S 0P//+++$0P/0 0 0C/+o++@-PU  @A Ѝp`@wPppQ 00S0\Q0S 0S@V ,P 00$Q00c̫+@-0 S 0*( (~A Ѝ * vA~+@-#@ ,$:+P/0S/P 0  //~oP@-/G  0LP/+ 0@-L   Ѝ+c@-`MP@ᬺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`O-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P =␺=9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P!  aK[  0 p0 @ =RP   R R tq000SPP000p00CS ,     ` 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S +d+o+&@-@PM @PU@`p0@ mTPU   c,A R  | 000CSc D T D D D 0  RzV)00SS# P}U  U Ud0?o20RP 2/ 0RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES\ RU U U , 0 S0R 0  b R U2/U}00SS 00S000 S000:S U000 0 ~Ud|+s@-P`@፸000C S0 ` 0 B ^ ST00T00VЍp $`|S 00 000S/P/8+d+@-XP H0H@ 0S0S  0  03/$@d+@m% 80S/S/ 0CS/$@m%O-@pM4Q0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 <0@@Oop B0 R ` 0 0S Wp0p@m%@-%PtP07$y%/-4M@20S4P 2     A2 0S 104Ѝ0! R0< "$01 S 10S 10S1 `11S(  jA2 T!2 R (10P!000 0 o R  R?A0 000S P 10S 1s\ 1P 0S~ 0#Sz ,0 0S P  0!X+\+ ++ +ԫ+y%|+y%+@-^\+@- # Ѝ@-Pᐺ+<`]@Z@@ap0 `= ЍP@-@<P  9 G$h+G- @$p`P 0(S%0  P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 @ЍMb@B40@-0@@T c@P  0 y%|+|+@-@0@y%0$R/ $垼|+p@-`Ppo++0 0/!vo++`0 0 P0H0@-0^@P C0/ጱ+o+<001P/ R02:/ጱ+ 0Ao+0Q@-@q|0A \0L1!0sr 1!0sr  Q ꌱ+o+@-`P 0R@T 5.0@0rq 02C Ѝp 0 o++ 0P0PP@/o+0 :Q Q .Q 0?Q  \QQR/ R//A-Hp`߰0P; R@10C @C" 70000蔱+~p@-@DP0Ts 00CSp@g@qppo+@- 0 ? Ѝ@- 8 Ѝp@-0@PSP b0C0S| 23 0jS BS bS 00mS tS@p 0lD+p@-d儲`P`00XS;@@{xN t,PVpmp +d+ y%C-V0`S@p$M`$Ѝ:S/ %S .S 0 pX@0S0S x?S \S0S 00@ 0X 00|xX@KXBX DXV @LH,X@   d PP50S49P40S 40S eqpz P Pm P`4 iqp LPaz DP0V{< Pv3 XI 00BH@6X? L , H L L L L L L L L L L L L L L L L L L L L L L L L L P p L 8 \ L L L L L L L ( L L L Q0R 0 oqp 0 t2 P0h2h"0 \ P B B?gķqpG0 PP01P 101111 z3 P  T10 ꋷ 0R0:P0P Pv0 P \ 0 a 0R0:0P TmSA Pc ^ PHH_ 0Pꔱ+*++o+݀+o++o+Po+Y701y%H0@-@@00SOoBv(0(01 0 D+d++y%o+0y% 0@-P P0P0^  @$R \0 P$@R@0^ @R \ 0 @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P 200@p@-@PT `0S`00  p`0@0000 S`@@@A-PQ@` 1 P 1 PP7`ЍPƭp0W"0 S 0 @o0 0PP F200᦭㯯%5 ⯼2P 012P++A-`pV@0  ` \ Q(P  RPQ(SQ $0RQ? " $ \ (P Q S ^ U 0S P$RQ $2P 0S` 0 00`Q0S P \U 0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-aoP/ᨹ+C-pPM@@8`0C`F!稀/<  AYЍ I/o0"P R  ? 0 Q   Y0 ? @+O-pP@$M0P`D0L00SG RD L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 0`00 000L0 000CP$Ѝ@꨹+ 0   /ᨹ+0A-0@S :PT(`V0(0l00S@`p +(`.qp ڲM@00CS,넲p++||+o+$1O-`wvB 1!0РS ЍO00S P@̐00CS& ЍOZ 0qp   0Z qV Q ሲP㪲@ Ѝ0S%||+(S%p+o+p@-P@T 40@@@ @p `7050@꨹++p@-PH@U p@\Qp@E(0?o2(0꨹+$+p@-P@m p0 0P !U@p+O-M,070( @40pep780<0d7D @=L70S 870/S 0Ï0@{t , (0P0s007S(00(00 0,00 `$000060(0, rs   T000S 0S$Ѝ(0S,0 000000C000 L0H " 800 000zy+  0Sqp녳qp0S`M00 00S0 @ y50S PIUPe U 0Z 1P40S 4L Hb04P4U 'V4PR0 QR S P PS P400S0R0S44L0SP`P HL0#PPUP: 0 00`hP0p`PL0 P* G 000 0`0 L0$ `L0 `    h  D0PD0$ T 0P@TX\P. . P ` @ 80<T0s00040T0PU$00CS$0P20S g000 0`0 L0e408 CGPPI h0S8 Z5 ` p J!` 0C Q00_0p d0S0' 0P a 00o0 R0S0YPPYP(1Up1L. J.0S0$0`P0S 0S < @B X0C  BSp aofZ0Yp0pP0o+o++++++++t+l+@+ ++h++|+p@-P@_  04P !U0p P$@+p@-P@G  0LP 0 Up PS @P@+p@-`@V001P0S0 sr ^U00 s00 ' 0P p 0P tu !R0(P Vp00@00S 0Sp(0(0Sp p+0S%(S%+h++p@-P`dU 0S0P@T 0P@|0 pPh-@Ӫ0 00000@Pp@T-0P00꨹+|+@-驴0PP訹+O-ԳPc004M040@0P 0 X0S0  P4Ѝ0  $0 0$0$0X S38 <|r utE T %` p 200@_ 0 rs 0Z0 @ P0s00P 0S/d2 c0  4 P 0P0@ P(200@_X 02X0QX`pP 0@` p P 048<00 0(00X0 0 00 0P|#sr(, R0S0tP 0 +qp@P *F`ut q`pu80<V 0 s00 } V0zHPu 0 7qpm @P`p0X0꨹+,+0@-MIP @tu 0 kЍ0@- 0( 00S@꨹+h+p0p@-@忺SP PP0 P 800S(0Spppe%+h+@-$@$0S000R @꨹+++O-0 ,M"0Qp 0S?wPy tC 00#  `PL ,Ѝ4S0S (30S 0S(0S 0(0u0(0P+ X`@PJqp@PN뺯@PfR00 (PlBlb0 0 0(0a0S 0S D(20SX 2``FS iX1H1X`( 0 @Pᜁut0`V$@PxAut` }810S ,10S  g@PutXZ@P 00000 0 0)P@ 0S 00SJ YHSE qp QP 0S 00S1 ꨹+$$h++L+o++$@-($ 00000S@ +X+@-($ 00000S@ +X+@- 8, 000K00S@L +X+@-@P զx0x0SΦd˦ȦP@Ħ㾦㻦㸦L Do+ D 1A-@TPP 㥦뽭3;㝦㚦31㔦-i 0@  `Pp{0S0S 0X 0?00a ,0 ,00SA薧+ |+o+o+|o+ث+G-pl0P` ᨥ @ P 0S 0S S+A-` pP啧@ᆥ-0Up0P w,p@-HP@T 80   p 0 )))y%+O-,RAMM.`)V 0A 0Bp0 jP Ad0S0000AލЍ0!S  ∧PA>04S S S ˦0S  0 [Q0幦0S 0  C  Q? 0   ^R000 Q\ S$R 0C 0N0P0000\\   0C R 0 Cy%O+O-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T Vۍ ЍpPS@DT2P@ ሤᅤ @@ 0 qX )| U@ )T@"0S000cP ;04P ST@ 6 Pp 0Q 1T GVP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S M PI? T0p0000,+y%(%+%$X %O0@-@=P6P |1P l,P \'P S/Pe/y%%%&%,%݀@-@P @P P P(@R2%?%X%O-|1M0S" @`0 ЍObPp400 0 Ppxy@`00S 000S  0P Ѝ D0 000 { ' ' 0S @`++i%+ +0@- LLPR^0S @T 0 B+y%0@- LLPR^0S @T 0L B+y%0/+0/+00S /+@-NP n.Pi.P?j@-0 +//@-L@ p0 P㌤S0PЍ +\ QR0* /QS QQ*/0000/@-@P '000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P KO`Q  V&` PЍpA-`pP@T@  A-P`"F$@p ݡQP ,0 0(000dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0P00`a0C@S     PЍp  000@@0 0 0 0 0 0\/\\A-1!0 g \[Pa@1!0 g[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 4tgp\00H+@+w%o%%p@-0Pt @R RP D D < @D@ p@} @%H+@+&C-1`pMQp@P0᠁ `0Y 0 1PR l1@d1`0 Lg\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ +@+H+&+00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 f0IS@P R00ۍ Ѝ00@00 S00@H+@+]&4&O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `Cfb`0V AP0 0g$P++H+@+&O-`M@@_.0 0\0.> 0e S \|.t>0 xe QX  t   H       0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ P  P 0S| @,Sv p0S 00@P 0S  00@[VXS B x1 x1 x1 x1 x1 x1 d5 x1 x1 5 6 x1 x1 x1 x1 x1 9 x1 D: x1 x1 x1 x1 x1 x1 x1 x1 x1 x1 x1 x1 x1 x1 x1 x1 l4 @? 4 5 x1 x1 5 5 $6 x1 x1 86 x1 d9 x1 : : $; l; ,? x1 x1 H? ? ,@ x1 @? SS4 0 PS0@o0P0  Q Q* S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0 j0 P^S0@oPL0 R: L `0pߖ00)0800400S<&;8 00 [04 0忉<0S aH0SSP80S4PU 0`  E/P0800A E4 >0T P 0  004 0 0  0:00z040 0H:HR <00s, 囍0P 0S ǻ0S 0( #P2S 0 H9` 0S0`V: $ 00@ t9@l0S g 0H\ H0$KP x0 0H$0$0 S8`0V:l$ `000 00C 00P0 `8 0R:PM`8 0 `S p 岈7 P0   R:0 ` 7B7` '1 01S:` 007 |0 S0`(78 00 tg04 0奈<0S G_Pm0800 OP80Sf04 0<0S  !80S0p4  H`P <000F400<0`04 `<0S V 0400<058 00 V04 0H<0S `L0 R: L ! `0pP00pY R  Q $5 0[4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ 04 0 t  PQ8 p0V `XDcH0p0<Hp<(0000S s04 0嬇<0S Np PB"000Q0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s "p0 Z04 040P0 |P 0S 00Pn80S0sp!pp 4 040P Po P R00`pL<0p<R80SO4XL  0`Rl0&004 0V@*000@++++0+$+%L{%Zht@x+Ph ,-,H+,+ *0%++t+90pW(p0 1(W0 P0H !  R 0sP 0 pW* 0$ (1 0X`pH0`0h<Hh`<x0h041 8<0 0R0((vQ 0{Q  +*+p@-@P`Tp0wS {S sS 0p P 0 DY0`@p P `G-`7PPU00Yp01@ R  pḁPVCGXpp0!S < CQR2 D \D HD D \D 0  gY0 0 00 00 00:S 0S0S W00 000 0V 0S`: ᣅP 000BS *ꪗ +-!-p@-P0@T P +P1 0S-E E E E F F E 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@ +, 0@-MMP@P  PX p4X+  PۍЍ0>-H0  BR R R /(%ؿ%@00CS0 S0 / (%@-,A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@Pd+1@-01\ @T P#OoB\@T P P P QQ R P\ \ P P Q R  ,+0@-  `Ğ\ @ T\    %R    +,A-pA0 5S$\! R  (P 8!z0  ,P !q0  4PP6 寅A<0S 00 <WP`p夀0U00S 000\P !P D =000 7PuS,l+F ؿ%p+p@-@0` T  't`d l-P`PT p P000ST? @(%ؿ%N-+c-s@-@P P<@P @0?SP@P` {p Ѝp/iP@LP 0S S @ԕ0SЕ00 W--s-@-.5 a-ؿ%@-0@<TQ T00 0001S R0Slp@TX` T@0$ @H4T(8  @,}+M--ؿ%,...+.5.@-4 l.ؿ%7@-@Po  0S 0@T a00 Ѝ0[0"S p`@-@ P  p yVЍ+/<0p@-XPP%0ATp0 "R   DS " @DyAp`{% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,W0P01p>,P1,01//00/00/00/00/00/ 0  /",@+ 0  /",00/p00//00//00/1200//00//@-@⪑(,00/@-@✑8, 0  /7,p 0  /7,/ 0  /7,//00/00/00//00//00//00//00//00//00//00/000/000/000/000/$000/Z00/00/00/00/ዿ00/.0*(O%/g"b @-0  0Ѝ@-@ +@-  h?,s 5@-0S04c  +@-h?, @- 0;,8, @-.,( 5@-0S04c8,  @-70 @- 0+,(, M@-', @-  *, ( 5@-0S04cz(, < @-  q7,< @-  h%, < C@-_&,< @-  W#,  @-  N#,  q@-E7, e@-=X1, e@-5&1, e@--1, @-  %",  @-  7,  @-  $, @- 0u4,x1, @-  7, @-  %,  C@-&, @-  v3, $0Qa @-x1, @-@D؏P d 0  ꍡ* 0@-0 |1Ή>, p@-,0@->,p@-d`)1S P8p@P |A垉0 c Op>,Op@-P@$`0|Qv 光p>,@-㑌@-㋌u@-p@-P܎p @V pp@-P͎p @Gp@-@ @?%PcЍ @@-j@-I506,@-@0@] +@-@0@T +@- 崌 p6 ЍK0@- 娌 o|6 ЍK0@- 圌 fp6 ЍK0@-U@0c d6K0@- 册 hg6 ЍK0@-@@0@-@@0@-@@0@-@@02@-@Xp0P L導?o2\ "R S   Sx@-@2@-@1@-@1@-@@-@@-@@-@@-@700@-,!UR>, 00@-,!@JR>,00@-,!@R>,00@-,!6R>,@-K3@-E3@-?3@-93@-P0@-^0@-}l0@-B 0@- T1,@-~3@-S@-k@-@-p@-P AN @H4S84p g^  c^Q[ @-PPL04S@<  L^ H^=,8,Q[ @-PPL04S@<  /^ +^,,(,Q[ @-PPL04S@<  ^ ^5,x1,Q[@-<<{P d(i0  ꍡ;,<,*@-<<dP d(R0  ꍡ+,+,*@-<<MP d(;0  ꍡu4,4,*@-$@床P @>,A-\`)qW HG6@P |A,0 ׅ>,O00/00/00//A-P@`100# 1pS021(S%04tx10#1Ux  Ua wRbJW80S  3/1SAxL0t( S0I`o s1|0|zO-Q@`XMXP% N S`PP R 0  0|pW 0S  t1 Pz1 `Vp@pGqS100C1ġ`F10Q@aQA\00Q0S< 10 \`(0 p0 0S1S1S  0s! M10 CsЍO G  s0S 0V01`Foa 20S2 0 0` 0p@-@` P  0p@LI0@-@Q7j ,OA-@PP 0S l` 0P  g/`1S0ZP /P 0p RM N/`@-@PI P f| l0 0l000p@-P` A Q 2@D D"o<0c#Ap RP*U<0p`{%@-@@R@-@@S@-@@-   ؿ%0p@-@0S*YGP) `bP  ㄑEPn|Puu G@  P < 0@ S< 00pppx+L,`{%O-,M@0P0 T; R0AT 011!0 S01  R01;bP V,0S  R3/00S 3/[1P  SP d0P 0 0S^`: p` 0 011S`@S0` $0wP$0p$0P``Pp1U00$0PeUP0!S$0蹟000CAP PCڰDPA_A$ Q!@ Q\b 1  pP$PP 0 `p0C0CS0V`0Z `1Z0Z7b 0 000 0  0 "P P V`x 0CÀ  S CUPPEPE_P0 zP b 0 0@0 PE뵎P NLm1 0 z c Q 7z&됷Pg\PPt7000HDቈ! "1 "0S SP 1S b !ġ1S 0C" !8C8R11$PUPLfPtpQt0 -zP (vWz{e(`P 0PSY *G 5m0 m 劒넥[ Pʀ500xPG qPD >P' dP% <P m SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C`al1SS !0C B/!?1hG^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@P 4 0@Sꨃ ~  ~ ~ ~ ~  ~ ~ ~ ~ ~ 4 ~ ~ ~ ~ P3P$0CP?P* <P >P P10!1 NSPNQ0^ B 88C8 P P?@ "0C S񟗉  @  ZvPq P1aF P Ty~1S'ʰ1 F P Ey~P 00P1 RE40S 3/Pi PP i P,ЍPR0h C` 0Sp0W 0[ 3/pU P `F P y Yi `}Ti00x00A<0 b02P 300P000d}4ix+0ؿ%Q11P,RS%L,1% 001/x+P0 R0//x+O-p`*@PP [ ! 0P @ Ѝ0/00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @x+1P/D0 R/0@-A1 P h@< x+O-Bp0  W jk0p 000" Ѝ`440S 0S rP 6[000 @  S" S0 050S qP [ [ 0 0 0! R @ S0 0 qP Z0S Z00000 00` S P0PS PH0SPPq0 00q0S qt ?C S ZPU  n0X!0C0S;3PP0 PEZ+% @VUUUO-$MHZS  R0P 0L`DpB :0Y0 0S 0g |j)PRqSq`q@`0p@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0j8qX 2 j0  BX P0{ P>  PN P P!VUA`E Dlj@DP`4>j ;j 8j@`"PD P AP;  JR !   ` D0Dj0@0!P`1 V0p00@  `0`^}|`F`FV0p00@  DPEj@DU`E¨` Y @ {j@T`— R    BY00000S 000 0 0{$ЍO0Y S +@2 %ؿ%A-pP`Pp `np@gp@0T i`P@ P P0000+@-P@p 0 0T0*  p@Ѝp0 00h{ 0l` 0@ i @t 0TP ; %+2h0p@-P@XP0Ps H` R :$P 0S@@Q@pv%+@-@C0000+0m+0m+-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  } ЍЍ/@-@@@-@@-pP@`M,0 0( 0 00`Ѝ@- Ѝ*O- M P`@po@|oUkT0 0`P 0WD0PSZ 0SW L00SSD%PPL00PTP^y@DO@W :p qPRWpV`KЦo`0 S`K0 ut@PD@0 >PT0 0P<00L0D 0H0T BZ  0u eyeeЍ00D R00S 0S ~L0X#3pztP 0 u똰LIHqgtg Bӂ0 EG t`P`3IH`WgZg+2P,@-,, ($ *Ѝ*@-P@`$0 0  0 00`Ѝp@- Ѝ*@-pP@`M,0 0x( 0 00`Ѝ@- Ѝ*-@-00a  2Ѝ Ѝ/*p@-PUn@Znp+@-7@- @Eu B$[PU % /hr=00h@PU %T Xr=00000S$$E Ѝ0",1,+ؿ%ФO-DAM@PP4q@ '@ l @pPࠟ   P<Aߍ`V } ]`PX Y   =R@@0y `yOؿ% p 1@-p0O-MM 0p@y`P2 }PP* P ]P 0S0 0  K H HPPP 0 Q0 0 PvۍЍ0P 0 !0  0! ,00S/ 0P H@-1,6,@-TGtP P < Aq"P@A-@M @߁0S0{%P.  ҁ0S%5}P  X0Sn Y0] )PgB@Pc$]&E(,E*B^&V(ЍP@R~@.1PE((P<(20S AP1(.Ap 0$!PT@ X$ &%P 0)AT iPP AP p`PP 0q+Q Sp 06&V`T(p`AT-@p0T-:W@Q  R@4Q p0Q  R@AP`003/P 00  h0S  R l 10!84@lAPT1,S>,.,@-MM+@(mw+(XjB+(dwB+Nj(@PލЍB@P 0 T @@@@@ @@@@+b'B(?~-MM+ 0w+L j+ (w+0j u@P  f?ۍЍ0@-@M ⃀1@@4$P @(P APL4m0kc&V)*00T1,>,b P,L,S@-@M 0@@?#P* 6@  P 00*!R00$Q j*@P  k0S 0` 'P&)m*ЍT1,>,O-`M  0 0X#*0S ` 0 SS 0zp0 S00C `@z0 S:}PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ B T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 mu%7@-@ PU ! In800 Ѝ0llP X !L  1n~( 0$["1,5J#3>WxQp@-P @<00S   0 p@a9 0@1,P",7@-@ ]PU G! m800 Ѝ0PP 1!| md00S ~DL 0H[~;0 ,:",ɪct/,y xؿ%s@-8Q`@0=nmZ}y bPgrbkgn bEg8`gb9}bi 0 An@Pxx8VP CsCaa ṇH}ЍpL,Qؿ%O-}MpP`o 0!p ԕE  0S  P R V 0S  `\P &mLP !m`p@T Pdqo V4(Ve0B? 0Kr.P "7@P "700lzP\zP; P  8; ;0S ;vP ; 00|3"0}ߍ3Z 3 44}0"!03140`0  400 ,T40    T(0P,00P>"!!0 #  PL  YP U $ t#xP2P t'th>-}0S TPU $}8 P0 iT0  SR 1P 6l 1 W0I2g>0YC>0P0SP @ 0V0 R0SQ k0S8 P a{u  PS 21,%ptbtf@",1,F $, ٩6,}D)0 00@-,M 0000P00 000 0 00\PPP@P DD囧@0Q ,啧 ,Ѝ0@8 %ؿ%h", -O-piMs?!0LW P 00iߍOЍ/lxN@PX1P L!L0.0J(@P jZ` BPPW0FSV030#Z0S 00W"5!` P P p0W05U80P , 00(P(O",б -O-p0MT@X   p$p埕 `V X @M'U` iiPPvPO@P <H E0ᓕPU 0'SP0U*S/ ~P q [ iv0@ 0 0H0 tvP11Z o0坔p`PUQVV ( l2S022SP0220C2   S`` لhz$00 00( 0p| W  @0   (PU CfDf(c0U 4 _W 0X0C?o20S f_c$c_dfiz@0UkY_V_^z00CS0000+5V0U \$0S  r9KWiAzi 0%S @SJ B* BzD0 0Jq/00L 0.RP 0 0xPH00Zpc@P 0A0 0X੔3 4Qj9iWz00X ('Se@0U fyz  0UX ~sc^cyiU PPW  'WK0ЍO Ѝ/ᱪͪk|ht@L,(%$0@-CMlPP 0S .Qh@P 4pCߍ0 Pp ++G-p@ 堀堐PB`AT:00Z W ,/Z 000 gP EQ 0 ,@%A-`Pp p@ y ,pOp P@+A-Pt@topl 7p0S DQ0Q.SP @$ $c c+;+@-M 00PDP   p 0PDP  o zp@ ( cy o P*Ux@x*  o```p @*PPЍ b b`!i+%i++8i(+43O-8MXd0 @ToT400s0 ,:vP40,   -8 4d0 w=C$ C`^TrOP, 0.̟ Q(<P 00 ( 0 0uPPPPP6@<,`0tD0D, Dq,t &`<XJ /  0p>0a Xvn  uPP\  uPP;U 1sS 1lS;"000 ]WP p@ v /x! H+xhH Qp0TKT[T{1D+0~, uP uP uP uP uP uP uP0:4: @p A*A0p 0HAmp H0St:t*10ll QP 0H0 H0Amp 0 APuPH , z$U 5g VPPP@;;uP@- ,5n)0x[)0wV%uP\8 0\8UXLy0 yDT. 0)0z= ; u@PEPSePN X0 '\6SE p0 ;@P: 5 ^[X|UtR hN[7S'  PGHD@Ac10<7@ P 0(AAP\XP@Ps :4S 0 zP 0'APxP 6P'`0b@Pal\80<'8\8P,W 8xm8 dP0&08P 8fm8 dP0060&S\880\8P 8 Nm8w0S d&8P 8?m8h dP000S\80\8]P0S\80\8P@sT %0}H\8%0|@5T$A Q0:$R$ Q9ğP \8şWt^ H4   8Җ4SP  0@?S @P l4{ 0Q0:$R##\ğR#$R#W%HR($ 3 ( Ts0S1 m`P 2@T SအO HH#00S "0S <#|ee03S3 TE 8"DC?00N?C0C ,>$wP0  0@F0@PbXP$A?ep@Px080Ca@,0,$P pbS0S ,p !X >0S@0 <:X+4AS< ". 0 0S DpD W5S !&o0 0S $p XdXz+",#ؿ%FV^p%% u+6,i+y/7Z|ر +x-r%++++ɪ8FINc9(֬"FR+ŭ>>,MϮ ++~Q\g+~5Jگ+1IYѰ~P 01/ر *C-鿏P@,MprP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍ荡C-pCMP@*rP`#0R``T  Y00T0  tp0X@ \2TCߍ@2~P (;3ꍡ*&,7, 0 8,@-@30 @x1,@-0  0 P @0@ 28 0/P $  Ѝ7,@ $,0,c0@-0@XMP0  0@ P x x0 t0Ep@X2P0/Q   LL cL2 0/R@, ,@YЍ0+T 7,x1,$,6,c-,-MMSP|qP  xj tj0 0s0SލЍ\0\ \9P L0 (0< 0, &,%6,%,-,",7,"7,U@-RCMX6S _P \8l PXT20S Hl2\6S 8g2020"(2`Pr\8. ^10 :4S !yv\@10 m:4!SO *00 0 Bbp_ttg2@P) 1d UTRLO<L0S ,!,E$!$A0S  9 5W-0P3\6S .+V A-bCߍ 0 B+^>>,+k5J+"|+I+ɪ+ڱ+4 +9M@-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'hЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0\ P0//!01000/ 00#0//O-ap$MPA@T cm oP00 ` 0S 0S0S$ЍP P00 S oS, R ,0S R : 8 80R:P#3///@-@MP Mp! *0 `hp Wd5\\ SS=S 8 d3R 0 ,H0 Cڍ ЍTT @-`QM p@ P PP |PЍHoPTP0 pP@$U@@bT @ @0 @QP+9O-Pp 0@0M'"pPP "`ĐĠ0 R 0 PЍ 0L03/P 0 Rl놁0 Ll  @n$0S P @Z @Z`P1,Ep@-P`o0@0S 0p@,P@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 l 0l 0@b$0S @Z$0 @ZT `@zZ @vZ@l0S0C@ ,$@ +ЍP1,Z|e0S/p@-P@H 0000p@O-p@P|M YK0P,0+`{,yP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U00 0P1 00 0<00000/pP ,0<<0@Dt@0S BP 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 8 @-Y P 0P 0Pp PQ` QT^PQH "P <080P/,/(// +Op@-8@Q0@P@DPp .Pp@%p@-P@P  of ZY00ppɪ@-  T%@- y `%G-@PMP N/o Ff0 0 0S1 0S X0P aR-P ލo0S o0S1S P mP @l0 1h0$1d0(1`0,1% 1S nP >4%0`>@`pԠ( p$   $0Y 4 P 3SG ht .o *o00? 0Ԁp䐍0eP 0S0)#0C?o27 #3RR  0R6p7P 'SH0pA(\ C~ QJ Nh P XP HP ,0! 4@ <#pi2P  @000@0"<0N?P0'SpH0AR 0 B Q  > 00B,0! 4@吀<#B0!pJ n |nKR wn00K?(0811~$10 100 d@0Eo`YG_FPEjP 0000!9PP 00S 3/pO003/No9-P4jP (S("+"V b+bV`UhP@``VBl!aV>+"V+bV3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   dV qc0 0o`PxqxxU" b ,`P  PAP"f+"=Vb_+ "`P ,q3l_00A-p$0p@` PAP0 @ p> C 01/@P00pЍpP@00003/003/$AmO-PUMM.`h(@4P/l.z+lQ_ xHk5yW`V`$Z^  UݍЍT  n? 0.07 00P00@P#Ppύz`40,Z^4S =,7h400C27\4=1 V =V?h400C26\4=1 0 000000000 00jpp`d ( !0440;40s -1yv0 00 00000 0zBp` 044040s -1ଔV4 `v00/ nlE "a\5@[^ =2,XL=1pP0Nόfph \  Kv00$?00,Z000Ӧ?%N?@/&"`H`T( Z4@0S N?/$"@44pW(4 0}10  A a "a a4!0p  1$,01(L!!,H48> C7$ 1^(1)04 $,10 (q,1 48qHL$!R  p} \ z^x #@p#t0"$1H00 4;$ fx2P p> C  T$100$10H00: 0 0G80<80Sp< Pr $003/$`hPM `qQ!> ,! 6$H(@GS  GPn<PK I<ISG 0$10! A04!8C0(1}1S0}1$1S `4@@T1,L,(% Zh%>,6,&,X1,*",_PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0 :  P  Pp ,>*=(0$0 |$(pP d4\,n ܍Ѝp 84U0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕, l l l l l l l l l l D Sn "Se S P0~  R{ <pWv  &P d0S P"8H8 a8Rd0S $"8~\0S  "w8&`0S !m8X0S! S! 807L0@ \Q\0S ` R !8Mx8 "lQlh`Q`\TQTPHQHX @1R<0Q0}P00P0)0YP0 U @)' 'pPv 0Q  c>,fe ƴ̴_۴hxn {"@+4@HTL4XT1,O-UM0M*a8V"e&'@& tetv pW &0 X0T Q 0ӓ ލЍ Y )qWd ^P FP' P C @P @p`H唴 XBT0SYh+ `( X% 0S 4$@ 0P0000P F^P14s10#5:$ o&m&k&0S f&d& "nW zeP0Z@DP&@ ' p `V  L `p80  P 0 0 ,0ST0 S00 P0p800SS0 4 0  0x; 8:/P00400ST0(ll S S         L  Sc  SV 0 <0 eP<0PL!@  PP ,0$  40x( PQ ,1PP dP 0005S0+4^] 14 4 t0 S r0) i%а 0İ 0>,5J",۵*@[&1, %?Xz"vɷзIWYnk:bgov^uݶ@@+O-@AMT MXp P`L @P`T $P```JPP@Aލ Ѝԃ*̓C̳ @ 3 (4@$80DP@<@T@X P \430$3 00 2 $02(408@Y P 딢娂  vt208@d2@DDAT P2P"PPB/$P <2 8"&PI,2 $ *20)ATp !0 UP.'!r%0 Z@0S #P 0St H0@4 000@0x;8 8/P6  %P !%@P 0  _ @%%0 @pW:p@ꐲ ٷ@q  $8 m۶L r",>,*Nb0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB++ $0@-@"!P(@+@-$@2S 02+O- @P@B`P@   PP@ m`@p0Ec#రPU* ЍI @P  @P @BI    R0S kp%q@-@00 |P Q P 00QЍ C-PJMM pbd 8d@4PTbH*PhnP8b Yo`GFWI kbP 0 000!00P < 8<1 P <08 <@XNo<0S0 0< 8`PX 40,0"1@ 0101@00 0A00000@ @@U,2@U0S8 0S(8MJݍЍAT P0 8`$!QQ@0RT<0P 0 003/@<08 S0 S(0S 0S8(0S003/@<08 S@6, %< 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> Coꦸ 0@o/b0 !!/+10/Lap@-@4P0 `DZ1111p+O-P@p`ԐԠ԰0/ C !  !0  Pc00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ+)   ! 0@-P@M/.dc1, 00 0d0@00 0T0@@@@1 0 000@P,Hߍ0P +O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+   Q 0S  Y0 0P  P  $04@H0080pS,000TT0 0X0$0\0(0`0,0d0A- 0R 0  DQHa@1QRpB   !LAPAP0 \A0Q     TTAU @@+-ָO-`BpX1MSL2X\1S,2\X1S \QUЍ0C`1?`1S*Y`]1PS \1 XX1! 0`1V$ 1x C H0C 0]P 0 S 0.S  Xnp `Z!X%P V0X`0 0dNX"7b\P \!-b000: SX1x 2 \1` 0 0 X1 ` SX10 2 $ eK+ % + 1  p@-MMPETPoۍЍp_P@`+uX P*+p^K P*+XK P*P:Pmp@-MbUhQd@L(;=L`P9 mk<0 0\ P (>9(> Tk` @G@P UލpaQb߸c/, p@-@l`01SPPP@pP0S0@1S "P 00 ! !@+O-@MQP! c0  ^ 0Zp`嬢Y pP 0 0rP0SߍP W%]P0^P0 a0CS0S p P`Vp08Sڠ0S' R$ S\0  0 a00  p 0h1U0ſ0 0s0Z+ 8Pp `p $<0P![h!R( 00@P(O  00O0 0S* ?0!C  0 00t00 00S 0xVa0 4; d@edA+"+?Um T01SP@/0S0 1S0   +C-h1`\1 R0``DAh908 0 &S Ph9!P h900 ! !PV0<1LPDTPapHU[LP Q[U `1DP1 K[U `1TP1 E[UP1 `1@[Up!00, pn@ ЍC, 곲 +ٲ *ָ@-M@ &P @oЍ@-| 0S l^P \0 T0T 0PP0?L004 80<8( Ѝ Ѝ&1,(7,&,c6,[%,-,@-p@Mp9t)0 0 0T00.00 0p $0t !Ѝ+ p@-LYW*7@0P ?p@TQs?M-?@-P @ y R ,!0$@:Ѝ0@ Ѝ/a@-0  0 P L0L L@ 0< <@0 $@Ѝ7,3 $,c6,-,-3M M Tt>P0  4\P \o3ݍ Ѝ[+F-3M M V>P3ݍ Ѝ00@-M  0 0S@Ѝ0d0d d~@P T0TP P00H H0PD]@00( (0P,UX1,7,7,#,&,ù[6,%,-,@-0  0 P <08 04409000 0 2Ѝ&,Ź6,#,%,-,0$ 0!S/ /$+0$ 0 S/ /$+ 0( 0S0 10 1/%++11<0@ Q !@-0 " !/+0 10 1/+@-M.w/.^, 0l0d 060 P000@ 0#@,nߍ$%P +0D D /Q/QQ Q/+$%@-@0@ 0 0HTPЍ̹@- @0S007,0@-pAMhPN @T  P<04Px9L/L0Aߍ0+d?,@-P@ 0P  zЍ1,-@-   Ѝ Ѝ/-@-\0X0@P %D  Ѝ@Ѝ/ɪI-@-\0X0@P D  Ѝ@Ѝ/ɪ8IIi@-4P P P萺@-@XP@ 8o#@-4@[P 0 P }&,%,.,@-4@[P 0 P }6,-,0,QA-@@1@#PP1P#T|p|` bP (B(AAd""4A1A99\A\L,/,7@-@*P @|] 0i Ѝ0ƺؿ%0@-EMP@ S JP00p00U ($$0x:@Eߍ0d?,~+~@-xM[pA S XP1^X P0x 4!5  *X<!0 01P00 0H0 0 00 00 000PPw`Ps!Xߍp\bH0\2c!|Xx:X JP (.S((J+d?,xUh2 0 %)@-@P !0`RxzZP PP 5xZP`h 1  T *01G@0\P@T 8[ Ѝ+U %@-@<!0@- 0 Ѝ0@- 0 Ѝ@-0@M{0w0 0000 0Ѝp@-P<@0/SpQ YPp@$%@- 0P7,&,O-$M@p`P 0z P( 0 NPP0P00P p @08PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ@1*",x1,C7,$,a;vO-,M@V$PIapYPi $Ip`V30S` 6VppGWT X1X!XX}$ 0 `   #$ 0VRR  S  R V 0B0EPB$SI0! 0$000 0  $0 VSS00P0#02S `F }V Ap]V @p$ %I`,Ѝ茻 E A-`pP@P![Vg hPP 6/AG- M$HAP`pP Ѝ0 0 @`0 VSSXP$ H-@- 00Ѝ Ѝ/P -@- 00Ѝ Ѝ/x A-pp3`PMMP` pp@uD FV 0a,,S((cpZ& I 0Su 0CS2PJ'I;S0)  00 0S8 0S r0S 0S QN@|+P$ 0 \0 L@nD2PC 00b0C?o2|70 &0(G0SލЍ!Y|7SWP{1Q! F?p@Foh!H1P0 H 0L('  0S q0Sv 0Sr 0So QN@;P  0$0 @pPYF? iQ. dQiFHoqֻrh?, 4X1,7,Xc + %nQ*?m7,",lH-MM P  P  /ۍЍ䠼-MM P  P  ۍЍ䭼s@-_P' P[P %P70S = \= d= l= P4 @D`AP ^H5@TTЍp;żx0|+R/ @-d|+p\0XlT0PhL0HdD0@`<08\40+@?,lC,D?,"hC,`?,/+pC,P@-@ @0X/,p@-@M L(@H@9Y0 #,0H ,0@@0f8hFPp0: S HVP O O܍p,Y 8 YQ @P@Pڨa <PT8#|1|!|x8<DQi P1 0880v8PP oQwP00S ny < R t00 00000 00l0bp@ mH(8t(0Q!&,V6,%,-,+  h &1,7,+ O- 0CMSP0q `@i0!`/0`SPW!000 @ @3/@P CߍW! 000Z 0SX 0 @T W  00 0  0S l00S \ | P0W0 ! !  0007,$,H?, 5^6,+7@-PQ@0 SS 8^0 000] Ѝ02S  ꈽO-0UMp(0 4Q H W#ß0/SCP3c0ԃC0P/UE_# 0SPTFWC1 h d  PPP$ 0RP gP _^ 0 10S 0S7 0 1S30S kP`F %p2pF3VT 00a 40 0 0R RP 10 1000`yRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 {P1 bPKP WTQ1 5TH1 +P [1,H?,$%+P,L,7,ؽHtżp@-Ph`@TU`pUP`eP  p蠥%O-`MMp\` `P pPP0P ? .@ڍЍ pP pP $P7PP $Pt@PIx!@ < o0_Q SP0=S`  6 {PRPV PP  Phx@ *( D$P@3)ܿ5J20p@-4 P@U0 Pp@@-G-`P4 U@T$ `V! p0F&04 p0RSP pGPp Pp40Su p PPp@T/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ PmUP  p@%@-@ (@A-P@p`p0S 0pp RA05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8pЍPs@q` 匳p }~~p tu no 0o`gVw [t@ lVRP\P LP @FT Xƭҭ}D*OAp@-PMM`; p  @p TPtTPۍЍplA-@P TpP` P  0Q\P5|d zd@@-PM Mp;P ` p  @0P@RP0UTPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPWO00/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0( 1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X ( 40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4  B(B(Rt01 408 00803/P,000403/,, H0 , 4 T 8 X ( 000/O-0@p 4MPPp`/04ЍO%%0 L03/P! Ѐ0 P p* D@ Z[H * R T R , [p DN8``pp 0S0P 004Ѝ06,O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R ,e i R f R R  O-0c(0M<00PSp@p`00 $ 80s!3r 0NMh0@l0 S@3` 0X@  H3R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D002 p0 0MHL048  L0(0,(, 00 0LP23V 4<0p0P<0SQP0 N T00SJ0Sj(000q p0 0 0 000000  \0 0 00000PX 00808/L0 PpQXQ Q(00,0p 04 80t [`\sp a X0S l^ 0$0p0 0(00,0  04 800pQ 80+P1,+E*]C-F`0pSPlM^xL0S }L0 S<uL0S$nL0SkgL0SG`L0SHYL0SI{RL0SJtKL0SmDL0Saf=L0SL_6L0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0K0E( 'K0SP4 PQQ008Q00S (4Q (4 $lЍC W3W0` a \a _ 48P Q Q0 L3003 0K0 m lЍX300P3 0K0 0HS(0p`@ 0 N SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8", P0   R>0  H0L0  H0L0  H0L0  H0L0  H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC !SH000050PpG0  d 9/ 000(00+,e i  .,P1,*R R R u u g f C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/@-M0@ 03/P 0 004000 003/ލ@-`,MHP E@0 0 0PP@00 RS THP pW LP00P00P0,Ѝ @T@0/W/0  0EH P00P0%݀0@-$M@D0X O 0P 00 00,0PH0Dd$Ѝ0G-%p(Mc@PW  \a `T`HP0< ,`SS0 Q "S `P  P !X$U0$U ` 0 啘0 00% 00 0 0000M0CPP?(Ѝ,T ( ̳ lS C-40PS,M80S,ЍS S S !S S @P `p䐟`&`X 0 e000 00t 000 0 00 0 0M`P' U 0h TU O-P@0p (AMP U  ! `<#0!(p<#UP <0P vD00 P &P [700P0X@! 0 0 p `@ABA0  0! C @0  X!- P0  0!D` pHP@!@3Q@HT -`MT@D@`0@@< 0 0K-M0 0@`0P .㨠嬰l 00@p `HSAߍ!0P0RPN*.,Um+,gQO-t5AM0DpP$DPQ @04`PF X, @0D ,`0S40  ,0 ñXT,  0$ p0pC 0$<0@0 0R80D <0 80 0S d42@@00,4 0$4@00 0A000 00@@@{0S8H`P ;0P40 0H03/0S,0@ p p0C @@0D @000`pH0SOP p1x'x0(1@P ! B B2@"A$,0Q1 ,0R BF1"L, L  P8p@p 30 Rp#p0x1Gx10q000iAߍD0` ⇁0L03/ 00`0, uY O-RUMP , X:X>:x  Q * Bq Bq BQ B` B  0K 0@ X@@p0 0,(0 @@@@@ p@@0b`P<Uߍ pv'0 pD`∀R 00*8b0A-0<0@SH04 `pPhHV09`H?V090VP:0A!r0S/A-@P0\03/0 0    `0V R!  B B" /10C+Rp 0!" P! 0 `PPp !@` B"/00080000$0 01P0100A,~ qO-P@OM H(Ja1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,bpP5Oߍş[@P `şT0@0C0p0NC2 VH0 0$ 0 Rش V 80L0TX 3/P1E0 00H03/0 T00!!  003/P#%#& 00t80x 3/0lPp E̍X 0 030300 07000F00, @˿ 801 SH0 V p .4t` PP00P00X00 3/088q0X 0L03/%$& l00,0t0T0x0X0h0H0 0T`X 006/P `0d Q 10  0!s"D  V p0 B.D!2 B".1ᴡ0C100C0 D `V`s`V T00 03/P0 0D 2#4`0Z7 P0a 0` 0dD p  0 B p BJ.D!2 B B"?.10C10 0?o2100C00 !V 6, 0 ,e ] W A-Pp`@a!:0P  p0Q p .p JI `P !@ B"- 5IT0 01`0(`10q0000#w 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0f 8< b @_0`4 V  V  R U  U  RE ,A0  ( C( P0 Cp $, ( ( ,0P 0 pP`p0  C 0P@Cp`LPeP\ p `P@0` O-0@AMP1,.,O-@`4M0P\03/0 X ĀX p ppP(W 0 Y2 2 Z "00 " 0  C" 1 " X "0  !" " 0 " 0 "  C" 0CCW 2"0E0 0l20d2 0\2\ 0J00000P<1,pp@12((4Ѝ嗓)08q P ,0|EP,0ZH D00&0" 0P P`%0,00a0P8 @ 0S[00S[ ZP uP00S`(c0,(00V,000 0i3/`w +q,~ f xn uV  lY hk r+@-@P0EP/9JP0S0O-pMCO TUtd4{ 00 rs= 8b0  * 0 P  0@0 B )R R"PQ0R r Q0CFS0TR000US00Ѝ@0  ||j"PT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(B@ P:"P 0R 0R [X T00U00} [XxT00U 000/SS< +W++*T8 T",+ 8T+O-0MS@pأЍ`  W0 @00PS8 cSG MS  0 mS  sS. gSR  0mA 0S cS !MS @MSCS GS +0C?oW20S 000 00SSSR mS @ R O-OM M<00(00 P08 @0 (0PP0@D00P,0 P 0H03/800<0 00!6 0R 0  0,3/ 0P`` S04 D&408&XYU\a`0$04000000$0%I8p`0,`LpH0WX0h05R0lp0(h ) `pV Sh `U Th PUh VU 00 0$PT_tr씟om0P`080dPS<00O>0=C0H0 08<@$xU 0S  T0P_0 000H0P0 F0PT0S ;x CP 0S40Q00`Q0S 0L0 aA3/P 0P P  2/``dF  X!ZpBP0?8@UP(0 Z [ Q PD @0    SD0 R8X' a`0"$0y$000,000$0%$0t H* 0?x 0 \ 0  0? 0( 0?Ȑ 0  0l010h Lt0hp2+Hb.+ ^.  Z`*pV 0 T^U 00 0\T^0 4T^T0P0($00 Q030#Q0S $0A,0"PH$ep 0 &(PA00`P3/ A0``PQ1VԿP(0 [ J Z C8,,@- 0P",*@-0 /PR ЍP/R0 R/R  0cx,@-@@@-@@ !@-@'PQaPp50S  {0A00 ЍApP#0S  h0W E㞼 X @PP  45 0",1,2ؿ%9@-@ @0C@-@P@@-M@  7  7 <{܍Q0@-MP@q  7k  7 0TsP PP@ 0 0PP$0R04H,A-TP4SAp`4@ 4 07 7 D,A-@4S0tp4TU TU T`040 0 4 ,p@-@P0 p@,p@-@P)@ 8op   @-o@-o@-o 0P/,0@-PM  0xPPA i@  0PPP7@0P,*P0Ѝ0@覿 $,@-)@JA-A0J?`V=p$X"0 ]PPЍ p> C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a>,Y$0pQ@-43# #"T R0//s@-(@T@ЍpH建0P巺0 0{003/@P/@-tM`P @P0 p@@!P  10@Tp@tЍT0 @T|0t dl0l pw L`P L @庺㪴7, $,".",;I/@-O @ p///@-0@Q T叺@o?0 \ 0P00P0P//$,@-@0M0 >\00S; 0     0*0Ѝ; 0$,//G-`@p|WT0S0S #<PP$1@00S{; 0!X0u;0pp@$,0SR00/p@-@Pc9<0P4`" 6D0# A@$!pP1,.,A-<`P@;Pp( 4 A(,@-=^0@-p@-@M @=>0 h0S Y`L0LP0V 44 0 ܍pc/7,z1G-1`PM@1P1!!  xxaxahtX@Pl7TaPF>P0 [iߍ BOWB?9 b;pP0=SB8?q@ B?`%@P / BPt@t P 0 T,-D &-:9vzOx",1A-1P@5dp1P1X X T`T`  P  @, 00c",:9 %8P@-0M02000`00Pp0@P `@T 1\ 1TO/11 PO/11 Ѝ}cR; 0@- P ~ +G-@BM `P @+=P l/@P @ܠܐ܀0 p0p姲0SO/11 Bߍ  gPl ppbh^0S  PWHT N1, 1ꏯ',(,sD,M;yJp@-P@1 1  pd?,1p@-P`@P0 p@p@-P@U`P PN/1 1 pVp@-P@1/1(1 P1 1 pV@-*@C-@aM.p|<T[BP`ᤂrU U.?20P$0 "JPZ d"L0(@80@PW D",BPU , o7 0,P@f7PK1PL0P P110PU)!,3`pApP0S7 S1  @$< 0` 0P@Pd1`[P&P aߍ@G0 !@P>0!,겻N?P0@B; E:; 0 0 & F 0  000 p ሴ@dӴ %",P,d?,;y=9:',(,sD,T1,51P,L, K` A-P$p@P a-@T   kP( 0 ‿P  0̿+ P 9@;oЍW\\f P嵿< 0 U5J", z+]h//O-0p4@T Ѝ@T@T' ^% @` PT[Z [СQ UZ@P@ @T@D @B@PB0"/tE,O-4Mp(tfZ,@P @ P$ %R000 000V0 05  0V @P 05@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 05@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0J5@TPT0@P 0T00@PT Q Q0   ,0@-4MP!! 0  P P P@4Ѝ0@/@-@ ㊾@ڹp@-P@/<P `@ H70P P `Ra BQQ pQQ 0@S:p @-H0RH #@-w00@-P@04MS!1PP Q*   P +U 0@S Q 0S4Ѝ0|E,0p@-@ ^T00PUPU' \$ST ݴp 2@Q.^U@P@@ $ $ 0 00C 0p0 ~p@-,@Pm90P ;pA-@p```P匀0S.T 0@P"Rp@P( X, 00S@- /X,,C-麋X@(p,P0`$ 0АYĐY T  T: X0WaU U VP P 0dU Ѝ /V0  :?@-@P 0  嫸@訸ѵ Dp@-P@0S|T0p 0 Tp0"S @0<00Rp( T4p0 X,tE,xE,G-lP0`Sp@;S S 2@1+1:X p  QBp\T.@T&RQ0000(Q $p5 Q 0S T v/ 0@1 00 0TRT0R"1|E,{p@-P@q@op1O-0@Sp`P 0 PRQQT SL0UȰС0r 0 $^0 0"90(Q $ 50, 1QX#  E vQ 0.0   R pR `0` ` R [ R# Ѝ 0W1Q:P X,| Dp@-P@P0Ss!U 0E p(0"PE0U055403 0(2#pX,tE,xE,40@-0@SYDP0@0ӕX,( A-AP0`SG!U 0E p0耟@SV Ѝ 4 U(@0n`P `4p00 0@07Pp0P ѺH p忲 `00 PǺ0'p(0,0`X,xE,tE,s1A-0PSp@` 0 PQQL SD0 K7 2r 0 !Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` X,E@- @00S T ]4Ѝ2O-X0MSM2"р\0@S2"`0Sb2"d0S2l"h0St2P"pH I-0SHW80S 80 SRN80S 廸, 70pHPASTPPEP @⨜@`P. @ \00`0d  00|h |X lxh;S \qL!L@0˺P@_oyRݍЍ 0:S 000a 1 00 0 G0 0C0 ;;0CS||4Pp D4N%W5Jix( I$p@-XP@0SC!R+)r00 S @ 0N Dp|E,O-BM MpPTo@P 0`^ ;`( =pᓵBލ ЍH0 Pስ ៼ Q 0 0 \0 -`pp0 $0!X4X00 (00Cv$0;S wP PZ +RQ 0P \P SG0Rpʪ0S S 00S 00 0`S0S00000000 0 P 0S  + 0 R$ ?! 0$ S 0"0S 0$ hedAO-DMhPl`PDЍ㲳@P >$6#Sp 0 0P` ;#S0/p0 d00\ `0h0x00Xq P$`P`t0 (04H 000 00 00p; N@-`X0Sg0 ~\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S &0O Ѝ D4O-0TM00 0$ 400 ,00(0 0800P! 0` @@xP$0SUppФ Q 0U U H0!<01PRPpZ/PUp<0L @P PUDp p0S H0L HLPp00D S400@00P4p S 0  S PS p0Sz ;S S 21+1:$0S Ls$0,  QB\X<X4RQ2ȠP,$0($0(Q $0(0 S ! 0S H (v*80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRX0B"1|E,{O-`0M@<TЍPpİ@D0S X08  0 0 p`1/Z  S     yQ yR  080Q0 0p`1/P E, A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-ð@P`p1S 3/P @`VTd0@@ᬰT0P0S@000S4000S(0000A E,E, 0 p@-@4`4P0Sp@޲10S 3/@E,E,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 00//00/00/00/10/Q@-@@L 0A0003/P@(˭ @R C-B`0SPEM;0峭-0pS㫭-0 S|壭 z-0S 㜭s-0SH啭l-0S0厭e-0Sk㇭^-0S00$ R!000V F 3 G1 &>0!C> f`'0 010@0`*,P1,,O-PMm0@i0` P(" b `b0  #00 0+p![0@0 0+!O0g0p@: ;@ݭᨰtt厳l,@d+ 0 L!3H" @p0 $!)$!p 0 `쀟P0 R > P:姭Ѝ 0p!0i ` `&OT 0-00@p NR S3#:@`0*.,P1,? ,`ga ,yQA-@0`\03/ pPW@@P@P< 0쀟DW  \-W0 U  0  !   0 00$ 1     t   Ch  0SJCT T0T TT/z0B@@ r ,q$ H u ~0 ys@-P,`@د01Ѝp,p@-0(M0P,03/`፮0@ S:000 00 0 0 0 娨p` Ⴅ0A0ᡯ(Ѝp0 l O-PM4,@PЍ ᨮpP 0p @r @< / PZ0H03/0S@`H@`A0 0(`P p" 0 Q"d2d" 2I0C 0 0 000 0A 0 0 0=刨:0S5'"0 L0P 3/P X0P@T`@\0`0 S8P 80S ,3 0, S001|40P ∡0L0 3/00 P0,P1, 0@-@80q  003/P1 04ЍP2 @-0GM0@00@3/PP$0SP #`p0 000 `p0屩0S 00@03/PPPGߍ/A-@xM`D 4,0Pl00$pp0Phs@P3 P p!(0d$0\ \,T „P 0X*0L08 3/1 01 0100 060 000tpPsxЍ 0Fᵥgp0S 0h 0Q*08 @,04/P,qP 0q00 0?o201ꈧ% % O-@0lM0$3/0H03/2P0`PqTW0pZU 0!0 0 ` pP00 (3/P`\ LV,"##$0 40R ! H 3/0L8 03/pA 0L08 3/PP: 0 R7 `#1/1L"P#0X 80T3/L0 083/p 0倰$0Y 0㙮.8 0!$p  P `(;/P PlЍ>,O-5P0MS J?0SYU 0SX5X%XXu`VL H%@T dS0u0% (%> % 0 F   0  0d 0qwp`v@0,0p` 㐤80$4@`W!0 `P40 000 f0,0 p50$10ɦ0\$10æ\0d00h00`@ pl0t+00S< p0 PÁt ,l3 000000 000 0 080pp` 3d,0ԠCl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0姦P2Q oVЍ)P00SZ 3/@@OoBS i@0&00v10@!Rx!@!x@|@pPpt@at0S|0X*@GP PQ 0!@x 0T:x0S@ ᧣Yt@OoBS@|0xT:M@>,J T1,, R*08Q, < E,L uw ", >O-S[?UM< 00<48@`D P pP Uߍ٨0P40 P,Q3, 080S 0R@ <0S6(1SL 0K ,HLAP4#0B 4 4#H@; $da 0@P+P @T "2B 40P 0S 3/P,00,0|2, 0SU@`PD`D@s v0yS-V Y0N &#,H! L@H@<#`P`T@P ` $@ $,$,00 0000 @W $   , L $, CX$00P1:1!sפ @0 000000 0000 007p` DD0U4 Q[T Y &$"4 v h`E,E,*<\ noG[ O-/0@JM M`0PP+{P) x0S% t0l"`儬!`\r\/+0P T  0CT *0C/Q 00庰Pa)@m+ P:V)?0  ,P+0: S `VG)>00ꨰ  ᨯPJ>0@0/S' 07+ m S {P+ a P*OP 0/S`0oo`bS #p#0&000 SV+t/ P*+) P*vP(@t(@]oJލ Ѝ;cx@-?{*@-M @ᣰP(0  =@P 2 P IЍE0S:$c(#"c  8#8S O-M` PPp X`p㴠崰#PЍ0S @ %P0  iBpLP Xp0  @呬 cQZG-|M `P`P PP<s+/@P@g 0 d@  @P4+Jw-J.0G%+JhJ.0T8TX 1PP~D 4 (PPu$"+JH0J.PPe+J8 J?` PPN+J!tpll40 0J>تP 0 .P UT #ލ≯P@Y+JJ∯PPp0J.Ὣ@+ ⲫP h lJ>⫫PR ir}j(%c+x&/00/00/00/00/0@-0@4M#|0$P 0!P\ WP0T0670 P@ A@P ᫦4Ѝ0P1,.,!,O-AMAd2 (000PB(0 0000= 80s#0(0`p[05 0!%500%`0$0 0$0S000`5_` @@`?@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0 SW`vp 0 h T$`⳩0$00  0 0 0#㔡4P00 0`0000 0$0Sr DM 3D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0`Sp, H0LC +0V   0  X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0 H0$0L010,!<1H0$00, `@#P,  0Q00000S p, .#P0, ,0 [wR0,4  #P4  Yp00p,0Y08pB,  YP P 0,00000;0(\cQ  k,00ZP1,@*.,Wx%>,C-pQ|MW0PSSp`0 00 P  "   "v 0@T0 S>T2x@&T"@(e@@,0S:0O(0$"PY@P  00+0@080s=0 0( T 妤W|Ѝ#)!@&(100\1 0`!00 XT埴@!0(P R P@@ 0! 0 h0 @0 400t0S00XTv00P0 ޟP@0(l @hԟ @8q 3/PP1,[_gUm0@-)M@0p \*3 +㩟@,㦟P0 ௧*㜟P p-㕟 0 F  圧.㋟0 0哧Ѝ0!0P8q0 S+P ,pP $Q.,Ump X!,A-@  "(0M$( 0PlQ2d2 5  L! D!@` , uO-p@㠁堡,M0 S000 /00 !0S,Ѝ/S  8/00`pPU1(M`P p嘁!FPP PP%0(` 1`^" Z"0 400,00`T00X08`b0100& P 0_0} ~P#`T1,WO-pP@\M4 `儰!"0 SpU 0 Q$0S   $ p僠P9\ЍO*.t+  P:0pQ  ,`VT` V 09 00`0000Y3(0S` ` 0 Rp`H03/0`0[   80s pȟ0PP000<  BR0S0SP 0[p08 r  *   * U0'0U " [P R 0S  0V p0 .0PP  P 0$ PU$p0p[0 ^[np0 PUp[h0[( ^!P$:p0 0 00$0 0$0 0S 0X XZ 0 0P pZ$0 0 S)10 0S 0 00#0 P.S 0UPpСZ 03@ D Z0)  Z$ RRp 0S  S0 0Q0000 00000000 \Ѝp0  ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S ]P 0 0 , 0R0S00`R  P` P 0 Q ``T R T  R X `( 0Sl0L0( 3/P <00S D0SS000(( sT L0( 3/P 80<00S (0, S004 Q 0 `( P20PP0Z0[ U0s P 0$p$ PUp0 80sd0 : 0  U0 W[p㐁! 0 QQ 80s 0  00UPpp0  R 0S  0 p0.  0@ 6, >,H1,P O-`M,p@0 40PVY ppPT Pp0Z:`PU`Jp?ERUA `?`/``^i00#h R 0  80s0`F`pHU p h0S 00  80spHY pPp xh0l0 0L03/, 00Y:pPpp0媝0P80D>ЍOp0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (0PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`]p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0k`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0   V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (0A W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , w ,0St P0 P  R0P0l 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s_ 00\ Q W 0 ST 0 SL0  3/P@D0 RP RP0{ $ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sb 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQBPp`,0 0UA:8  0 0S$ p0p0$  S[pᵚ`P p0Pj"0RZp YZ Yk:PpW00 U0#S ̛p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0P00  8 rp08Hp0!8p 40X 00 0S 0P*p ` 80s0 L0 3/P 08400H0, 00,0+$0T00X0pPrm۶^ ]46, 00 80sh p Pcp@-@P(Mn(0S(`,`M0 00P0F0 P P`0(PP,((P(Ѝp000,P(0,`(PL,R!,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1\!S<1@100> C @t70Sp(0 ,L,0#0@ 0'8 0' 0 W &%, 080000, 0 Ͽ0080000  0'ɿXW00HH0P00T00LP (X0W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000pp 85P,0[XpW( 0GSC(> $P A$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0L0 3/P 00S 0SpW+ WP0pH03/ 0! P7/P%$%$)@0 Q1XYK @1003/Q  01/ 0S 2"c$Є  0:P  0 Hp0  @D@0 ᄀX80X> &Pn;3l,0S pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000>,T1,*p408Q <LE,\,uw oo 4k 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-Yp@P` 0< # 80s#   002  0 S R( 0S%  吁( R Q0 2T 0 < {+800 r"000S   `}$ 1 SR08C81/X",!0 /X",$1p@-S@ x1SP $003/p@x1P$1 0SO-@0`PKMM0((0DpH0S >I @>0 0<0o- %"{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,͐ppK܍Ѝ(⣍(0S*< o !8 ;c&@@ u.O-`0@PMM,0d1d0p 0S (0 S> 9 H 00 0 <0.%"@~40kP`0V,p0U 0000000 0 0000000 00tp`ލЍ,JṐ,0S*< !, 00B"X R00C0C0000S0 0,0A$PX", u@-@-0  !<$10(10,1P001.@-@}0 0! 0O-,MTTpPP`0 R,Ѝ "P9 @@5/וP`K L` V`G2 B 0" 00 0(0 0 0`ᾌ-ߖ0,ЍO/@[;p@-@Q-GGGGG HPR 0 PK40 PlE <0`p@PP<80 P6,0 P$000 p)*+-p@-PBMH`@ e  VHHH(I@ItIIII J4J\JJP 0P Bߍp`P00S0`40Pl`80PS<80  0X0S,!@ ϑ 0 PǑ\0 `0S ˙@`嶑d0Ph0S ⻙@l0S ⱙ@p0SD ⧙@TP`咑t0P^:;=>?ABCEF@-PAMH`@w  V(,KKKKL0D`qK0 @0S    8`V#@T 0 PL 0Aߍ(0S l M@d,0S D C@@00S ( 9@^|1230@-AMP@0Q*L4MMMMNN4NLN  Q  <q0`N 0S (0S  /  +,`V HwAߍ8  -  q0`N 0S (0S    ,`VPǐ $0NP㾐 0 P帐0 Pt岐0 P`嬐0 P㦐0 P4堐 0 |    60S O-@MV M:Pn 00x R# R0`^嬵嬅adDp80  @Q D0 P゙  }PD  H  `V8p00(0S%P$Bv00,0S$C$Bi0000S$6$B\0+ 0 p0B/;Ppὠ C"U0S1 `F` y딣0p⇞ 0S d ``,pYV o$ @x8` 0`0"  ߍ@ 0  0S  x `pV  0  1 PS ` 0  0N 0S @0S@΍  ߍGT<0040!00Ε@0Fo$ 0DL03/00 Eppqr0S !0ⴕPD` 0S  p8` V0$a x Q0W 8 < RFO   ᄕ 0@ /,@k 0  d R0Vt 0k  ݀LC|'w/@-x @+0 @0p0弙dj @w@-D @000(0,0000姙dU @wꐯp@-XQ`0@sJM@!   0q1S:]]L]]]]BJߍp0 00@ @@08P(@0 (0 0(0000 0%(2P(28P,@_0@00\%u5670p@-QPM,0$0`s@|!   0($1 SI^^^^^\_h_t___ 1$ چPЍp 0 ,ц,0S$0!^@0 0⁔0 000000 0廍01P01PP@HP@@P@_ @00\%uX",O-P`0,IJKMN0@-1@EM S<cccccddddd0 00 P0 PP忌 0/S  !0n6 @ 0/S0 0Eߍ01?o211SX!NP,!@< 1?o211S 1?o2 1 1S 1SPIO0 60 00000 0pP0PL0 1S 1S_JO 1S 1SPPKO 1S 1S0PN 00!Z>,"#%&O-,MbPp@BX  㔲݊ XZY eeflfff,glggPpƊ0 @Pe@ J,Ѝ Pp帊1`SPe 1S !N R !᳒@p@d⟊ 0PPp嗊1`SPe 㐊01S  1S0I1P/S X(00(0 00XR0SvU (9 60S `Pp q00!15:% p eP q Q 0, ($!p p $ QP^ 00 8a4Q101T/lC,U,6,c*NQ/0S@0@-S@00 0S/U,m0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X ю@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 ǎpPP2@0S- $P* 0 x0D 0,",ZU,E]o\LU,pEbt e|U,$\?|\JU,`@H[H@@-P@ML d`P <2P0S%  (wP2 00 BP P< "0 4 P 0!3 YЍH0S10S-  MPP'a000C R  R41"$0  000xpP0` 87/0P0 00 !`0] U00S-  P'000AC, ^ ^ 0!P^ X^ ,0SP\ $0̋ ">SD?,mV,nlC,U,@?,U"U,{A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 D?,V,@?,U,hC,xU,\0p@-T00P ODPPp0AS@  1SA@&,>,6,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S"E,l0\ Q0/\P ^U Q0000@-E,0O-`GMM40X2@TL2V 00 0 0000000@@@@ 0hp@c<  ( G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 x0@W 47 `4Z|4 VL0 <0G, ,"B6,u X",0@-PDM@S P08 @\ 0@  Dd  0 0DЍ00SX",0@-@DMP. P0, P\ 0P  0T   R X  0S0000000 0DЍ000SX",p@-@Q`P@M<㯃@P   T0 0SP@Ѝp@0 @00 D0U@ЍpX",17@-@SW\tLd| Ѝ0!{P4PP<<0P0<0P0<0P0<04P~P<0 S, 0<0sP<0 S@  0"p{080#j{0,0$d{00000////@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp///@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P n0 $t< f <U\ 0$?P 0|! |Ѝ0>,a@-80@SP`4Mc00 0┈P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0ら !0p@-PQ0M0@$ 0x`0 6/8 c`Px1籄x1a1S0C€10Ѝpp@-@P 0hP  HPp0S@}p UP 5Pp0S 4! B! @P   Pp0S h0P R 0L  4PppmU"O-uM Mp8 Z-H0 cS_ C0SSyC0S PB0SyвB0Sy2 P     P 2@    PX2 HL     P:00002x @@K @P@ PHPP< , h@ ,D@/? 0101P01P0R0 0K000 0d|p@  Py| 0S 10S $1S 10 0Suݍ ЍdP^H]PhVPg1S |!R hsP \%X",@?,U,lC,U,D?,V,hC,xU,U,U,U,|U,U,BUA>,6,@-@(00S @PpC,@-@PЍp$QU0 `P PP> C  01/P ,00 H$L Q>>,80S @-0 ]M/ m #O-`@Pᐐ吠吰X0r2 S80S00 00 S80S0|1 P S$1S00 0WVQp@-8M`@8  ,T P $Q$00S U 0 |1 08ЍpP _P P Q  ሺ P K ᔭ P X",A-MzP8 U`ЍDP $A003/0 R   01/`P 003/@P$a0H03/0 `pXDD2 08 8/PD> 0!! 7#`  0 3/P"#"#00 03/p p0` L03/g⏬  ` 0SWp`?`B414!44cL0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv  0 |1 0@ꄺ   #X",G-`RM@Xr PP XP`H `kWP P7   >p H0S fߍ<08 H(00,0 000040!04 04$0D0(0P ^|WZ  pT hp* \WXq` 8  4W (W W W W 0,0W0 W  ⹉p 0`?`a8SPb 0  0**0P0a  0* d@edAzd@,=OcvA-PMPp`;@ Ὼp@P  P06P&U00 ## ݍ /O-P<ЍH/~@P 00X0S08080#1 0PPU@0``PU0`<  P$`D0! g0 @-00\S00$P (00S` DO-AP0Xp :S 0<003~0P0<` (  嵞Pᰞp　< Ph0 2! !14 80 00 PpW00040080h",e  @-00@T ^3#%:/o" ^Q0  0\ Q    $ ( ,   @( O-EM8AT& `p~P儰0 P @0S J FT P ,p0$oEߍ4 3A-0P@pUP3#:/o"P RP`0SDyW@000000Ph",O-]MM`0@ p6ŝ06TP 3 # :/o"P Rh\   Z DQbQ_Rw 03#QH@JQ R Z0h3h#pR00S; 0 0PA !R431TQ  @#-#-@0S D0S<# #@ 0"r;.vPP 0 QpJ[0S) ݄]ލЍR00SD0S0 @2.\0C@Qg"C00 D@u@0Sа $ p (,0QE $0X |Pp0 Pᖄ 0N0Z00g Z ZP 0㛓#000X    4,( [: U}T  P ؀ \Q 0R\    0R8 8  g yd%94|d{dЀ0$\ (00t S S  S00/Q 0P//0S 0S P/!R@-404 44'GR )r0@/ g 80R*@-0M@"P0 0! 0! P0Ѝ/00S/4h",$p@-,P@0S0S< 04 ph",@-@0Sh",A-pP@0ST 0S` @ _P<0@P`V@h",@-S@P ' dIP  Ѝ<>P 4`P (PP )P` !P P(  P` Dx PppGPP 0SP` P P @0`0@0  j4 0@-M  >Pڔn P p@tPcP{{Ѝ0G0S 0 (f,$ O-@M M@P;B/$@z`P!$ Up 00@QD0S.8 R( (b0( bP0D0 ܍ Ѝ y P P    0xP 4@bT4@0@T0@آbrT{0  00#$pt{@0T  00# `#0000D (`(00#?P X\ 040RP`d 8<0RP,+~0( S 0`0#PDplP `p#tPu@ph W #WH`Ph@$pP_ pp#hPV0%# D0S(0 D (Va#\  ( @0 0#C@#000@V( d@OVgy9{0@-M 0Fz 0@S|( zPXP8 P 4{P2P {P, 0 #Pg{P%Hu@P PPz00$00,(00@00D00800H0zPT Pw$0S(00wVލ Ѝ5 0廖 0!$00(0 0@0Z/ 0D0`$0500D0;啰p0PUX XP\PkP 0``tPX\`,v}0S 4 R 000 0#ᣯ0P 0S uቯ뼀8 0<$ 0S P 0$ 080S0`X .P`d0S0P 040 Q\8<0 Q\   ^P`h",I g`?,M|[>\ $|d@-8 0P 0P`?,pC,-0,M$00 0 00 00 00 00 0 00000000 y,Ѝ 7@-@ P000 00 0000 P  S  Ѝ0C-@pM P` 0 00 00 0 000sS 0lSp@ P$0㓄( p l@ zP 0㓔) p Ѝ@T@Tp꘾ C-`P,/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    PЍO-,O-`4@P*/P% U \ P\ PV q?rπp0sx2p0`P  P0P PUB TV00p000 ЍO-Pp `D@  40zt0 0_0@00s#@@0Y0 0@P (V,|",0p@-0PS@U U U pX0XUpT T<0pD0, p @pp|",,RX(V,x, ,@-@0S|",C-DP4@0 | tt l pp0(\ @t p0@000@Q%@@ Ѝ(V,s|",80@-0@SiD 04  R@|",(V,A-@p`P0  0 0 0`B 04 8 <00 00S00  SR000O-0@Poo`#0S Zp`0BT ЍZ  R  SR S0"P0S R00Y0 0 0 [YA-Pp`(@$@0" 0 $ 0( 0,2Q 2R0 002S R02S0(2: 00S= SSS- 0CS03Ѝ #"S S0&B0C0!S S0 SS S S0 S , R  0S S00PXR8@P    @- 0  9 p@-0@P@0S0j00S00ӵ0Ĵ00p|",p@-@`PQ Q pP  q 00 C0, r0Q  07@-0PS@( g;PP 00S T 8j Ѝ0D 00# Rm|",(V,S@- 0Ѝ4  ( vRP/ ‚!S Q /  ( 0 vR S 0 0SR00//p@-@Pp_onUp@nQ!XR@-@0@ @8R;)r00@02€> @-P Q@0,p@-@^P8Q @ 2"p282x@- p@-tP@0S0S 0DHSTPSD  p# @0p|",(V,08S^0/(f, o, p@-@ 0( 0vS0PS 00S1i wppC-@`PNMM< Ѐu0 ` P `P q000 ;#@PD uptNލЍt AydG-xM` @pᜐ堠PP! |!0@P 0S PU 0 R<D1D!DD700S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   YZ( ( p\ O-`p@BMMP/0+;@ ⃦0P0p X@;$  m P) sz BލЍijP (0  h   im0/SX l0H,! l!14"So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q 0 STS "0SO[@0kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 000 " "mo@ iU01U01VMKURXA- 0MHL`Pp t1t!ttE6Pj@PP0ЍT00屋 0R`0 !?020 2002p204 pk 0PS" $0Q00 L03/P Q P0Q    R D0QR003/ >(V,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @P^U PP0 8^ @T ,fP ` ` `b` ` p Sp`" 2 `q`!~``Pa Ik00`U08uRP08}/ ^Q 0S`P82S011111111108 m2~/P/<`0Xh40S0St  P p2S222?040WP 2SX1O-bM M 00 QP $00/;}0P0`bލ Ѝ$ Rsp y?`x00@  ,(:Z 2S 1S,2,",,40@0 Ḁἰ        0S@!? U㪋p ኤ< (AkP^bVqT&PRQ 0 Sp O W p!p'q ?p? @@p < W p!p'q??p0g@P%  0eJ  pj?WU E ,( pj0j?W U `d@ Us@-RU0 U4@K`d0T `Š"; P0H0:`04 oЍpK _@-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0@.800 0",<< . 0(V,6,O-P@dM0p4005Q 0 }Q Xg QP08B^  RW* ,50'D0Q   R0RS 0}υ^ @^TX 0SQQY WpdЍb004@F@  0@TT0@ 0@4P SI 0`P P\ X 0`VBT`@00T04^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?0(2 02S01 (0 , PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W>?h "QR 0S2"202#38^0WN ?dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0h ?0L0S 1P0S`10T 80<q?r0 8Z o 0^Q  Rl0 ~/O ` 0( R 0C0#80(V,f T  lO-@|MHX0(S S|ЍS S7 ( [8(K2D S0@ }(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"~, 4š $(( (00) 0P00U00( 000$00 00 U00040 080408 0,000, S 0 08B4X>wu? v?( $R BT@2r/00q?`0sh00`0 ( R   T R,0S0u0<03fpP<0=X50~;\0o_P0"Ha``V PV Og0( 8 y@0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0 L,0S00@P0PT000S@ P0h P0a0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝ>,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/>,>0@-@0M u410810!&`0 P0 0P0L*`0 H0PU ! 5/ᛸЍ0>,@- \Il@ Hk@-7@ 0  hef*ؿ%@-@@0szk,00p 3f0Co訨%D,-$M ?0 0 k$Ѝ0-4M 00 000P4ЍO-pQMEU$8l "0p/l%0 0`000 `V0(08 0R(0`V0(0"R 0*`Pş$0(` 0  <P  0 !   fp0 S 09S 0Ѝp0 S   000 00P0 PS @ d0  pDL  Ѝp@ p  "p@-@$`Pe]Pp0 @ `P0 002 0pp@-SP@`xM  j0 0fp@) fp'  fp! fp  fp  P  L0 6 p,4CxЍp? <~f  "0 0 s@->@P`Mp @ p0 p`` P0:p @ 40 pЍp<% ,%p@-@PqP 0 5f01pP`qpJ "f0#1pp@-pM0 p @Y fpf@pЍG-QMv700ۍ @  Y R @`V e@pP`@-`RT00 Ѝ@PTp ]@P  Q*@ 0S0S0 S   0 0S0 S*]P ` ^^0ST   00000`0 @@P0  5 "@-@L@ L1p@-S@T1S#d1S.RU9lRUppbV:lQ^lbp1CL^L10CL1L1PSD^0P11C>^T10CT1T1XS6^0X11C0^d10Cd1d1hS(^0h12,P0C2bV^bp2,P0Cp27@-@0 PP" H1 0D18<80@ 8@   (   )     C A Ѝ0@_ Ѝ0Q@-@    bdP p c00` Ѝ@ Q @ 00 pЍ@ Ѝ +Q@-@    dP p 300r Ѝ@ 1S&70|]7[P| 01@ 40F pЍ@Q Ѝ .@-t0M0@Q0$%+p= Ѝ   081/@-@d'P0S  P 0800L0S S@ ' @-p!@RM Qt0 p Ѝap1S0@-800@@lA P@-@p t10cSt14 Ѝ@M @d 0 Ѝ%\.Q7@-@  ,, _ Bcp  Pd Ѝ0@( P 11P,|1@ R  |'AQP |`00CS`0 Xa@ T0wp 0< Ѝ0@ X0 X Ѝ0 %(%+p@-PDcp44p@S @vdpK p@cUs;p@-P@ `3 08 l, >U\& 0 0 008 , 81pp@ K Cp@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P#.H0$:0@0   10 &000 0sH00,PQ 0a(!"4a4# 00 >Q & WPp iW  g-080`P040 Ѝ 0b"!4b4#@- @T0800* HP  : HP%p@-8A R>  **3X K 0S 3@0 S   000x1  @  0SP P0 0 ,0 S   0 0C-MM000@"0_p@00FP؁+ ^^P`5pQ v07S 0 S W h0 0\!`1 1 `Px1 (ލЍ PpP  R쀟쐟PU "Wxx x  0 S   x0 pP 0 Px1p  P  0S 0v0 P U=<Q@-@  ll|+po07S@Yh0 S d0VS`0S@' A-`R@p@M PP UI70l0h @ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *"P 0S( <0 *3 2 <0) |) 0S 0d !r 0S>0 P 0SV>P  *@ЍA9 PjO-p@`,$MPP   P 00A $ЍOpPy P000 pp XSP  w   0pG 0pG0 ZppIU3#pp pp F^p#3s 8118100x1Z* \Px1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 ~P  YY p 000 0SZ81181$Ѝ \P  YY p 00`` 00T0 :0G [W 000x1 Z R& ` @"P `[` @H0` 0 00  WB W W 0S 0`0 7 0S [ xx0P 0S [{0 xr%l # @->@T( "44p P`0g"@"44 0^W 9L L0 b"!4b4# 0O@> *J>0@D Ѝ耼p@-p1PSM"`! M%@P T 0p1!V T >0S X\{MRP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ P 0  @  B.(0$p ,*l1S  D. 0 R/ 1/ᄚ,/A-@P 1 !  nSXpR0 qP 0`0S000S \ \QP0 S   00S000@00P10 paU0k Gy0P@-p0p pp q s00P Rh0 U  k yp@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P[ p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@k yʚ;@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p,p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ k yP)@-0 0PT0/k yP@-0 0T0/k y//P@-(0( ((@008< D0k y@-,MP` 1U0@0$00 0p@000 0<0S FYp,Ѝ8010C>S00@( ( 03(00@000 0<0S80 p @Qk" Yy@-XP@P ]Zp!R@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0QPU `0 P  S   p0 X00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pbĂT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S*  P% HLH R 0|S0       @@U 0 HQ0SPp0S} `Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/ꄚ,k4 y@-8 0h(@ p@ t@Ѝؿ%A-`M4PspM gY0 PTp@ W@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   R갨%ؿ%-@-   Ѝ Ѝ/@-MMP`@p0  TR 0 pۍЍP-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/ᰨ% 0p/QR갨%p@-MM p Wp P@;00 dSV 00@ۍЍp P0 4Od%0/ᰨ%@-$@@!R4 @R갨%p@-dP@O; P"4 P P  o RT PV00pp谨%ؿ%Q@-@P:a@%@O@-q@ V01p V01@!Xp@-PM@`   Y0 TXp 1@ R! 0 p`Ѝpii$0 /L0s P/0 #:60#//A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> z!PP> *@-@T?@Q/D@-@T?@0P/ R R /0G-`P M0(0S @ P P P: `P 0!00 0   F08S0 V00 Ѝ080 00S # `pP `P0P 0iS.S  `P04S 040:S%0@-@PDM QP@T 00p@DЍ0U  >P @0S@-`Pp@MTЍ 0S P 0S Q 0  pM>@P @-000Q/Px1P/$0/@-@M  d  0 VpЍ~iO-YM `F/@HL9X0KpP pYߍ0pM 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 PAT1S@\1S`1 ֌P5\1 S S R@L1SP1 ŌP&L1PC_oSRPU@g P0HS 0s0QP 0*y81 T48#88 S R p S 0 S T X @@?@0?H0p 0P0H0}>H0 @k000L0PPP@ 6@iqA-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ S @T@-@sp !p !p`SȀ %0R% -@  % A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pk@P─@Ѝ ⾚P\LLP0 qP kpP jL A-PRp@ M 0S0T00 Ѝ/P P&`0 00 0  @0S TT E8PP/00T S8O-P@0"S0Z"SJP Y pgpP w70p0 ЍT WUYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8upvpvpvupvvpvpvpvvT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: 0 U*`XJ:0\S 0}   0P0N[ SP0Sl  0PTPp@]p%P /0 S S /S/P0/S 0 S S/0/O-PDj@P ЍO^=㸸`P hha ЍO}J U qWpJ#j@P  P 1 A Ѝ=፸0@S- P'[ j`PFJ ``[IP 0 0  0 0S p@-@P !J` 0SPJ$` PP(0S $J0(0$0p,` P,` PO-4M10C`p@XPS0D\8PdH\pЈ} }d}}}}}~~}}~,h,}|ā}؁Ԃ(8}|4̓}0HT|Ȓh\}ԔLL\phț(4(<t$XpHU- `Pp $uP@ P7 7  '$ !P`0@T\0S @U0 @7 0H050U- H0?0P 2I0 @PA t01x4ЍFP 0 pp 0S 0P I01#@%U  ChUH070 0 JpP! .R 0R77@0U h 0/pPL H RU H0@1Szh@H000{U P0H0q ,0 00 0 O,0S ` {U ,0!00 0 ,0 S< K Uz <1E80w40b儒000 0 PPP00 0 P  p@0  @P  UL <180w40b儒0p00 0 PP00 0 P  0@H0:0H >P 0<0UH& 0S# /QPp؀  &P00<0/?`P 00 /0P0 000H060U ,0 00 0 N,0HS  >h 0A  a/ph  P 4@AK0  U 0 U ,P 0S U 0 p H0 50d h050,0 % 00 0 ,00,pYT 7$ UPPeU700 5 0 $ 5(@p 0 (  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 N,0HS 9U H0P SPH0;00H090U ` di`,9pPh D`P 0$'J C_FH0Q7;0UlQ P0l1 P0l1 P0l1 P pE0P p1tH000|U10H 2vP0H 2n P 0H 2f xP sPH X H000RH020MU  0pPl] H0 S;70:H0205H0600H0;0+H080&UV <1!8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =>P dp PWH0p000 SP0<00 P WH p P  PWHp   P  P  xP  dP=WH#  BjP S  ($p 00t ,p 00qpPh $ ( H,8   P< B7 \<PWH B& $rp= BpP9 ((u (r H$8n  P  B%_   =Kj R1M[aZ_chp   %4Aa} 3DS9l 6f+@6ipv~IWb_ #Wqڨ  $P  8PW ,0 00 0D K,0HSu  yP /o"Be ($P|/ϲP0H (0FPl 7$ ! (0'0G ($P^/ᱲP0H  (0(PN 7$ ! (0 '0)UY H0#X U@XH020H0 0002,H000 H000H0 00H0 00(07600R 2 y *t350S00T01=5 =50H0U <10@0P@(470'P 0S@bU H$DcP$U 81 800 (0 00 0 J(0`S, 4`( "4`4# ,,0RH0800 "PP0 0 P 0 0XH010vH010qH000lH050gH050bH000]H,';,WUUH090OAK3O0\ U0` 0w ZPhbX@ D3&7 D000 0000 0P70P7}' G000 0:00 30000% Op F +8 0 D 0p0 D+ 0 P#Z 1H0E,w>P0047{(8wP,:|؍<Ѝ80Ԕ$080,CP(/p,078247024<7囗 SJp,8|?@D7囗 SD@u?0H'87l"L'<7@7D7p"H7L7808 p,20!3 ( (P ((pW 400000(0 00N᧺@(0S 0 S S0P\S @ p p8000SS ,38 P,,00  CP 0?o20804P0P$0pB( (P f((0S0' & Ӽ PN(PI Z$d h⥍PP78=0P0@(0S 0 S S0P\S 00@ :0P  }pPpP80,C P(0)S YL 9O00(hQdqk^Ppdq P DP0S (P u qP 0S (P gpPP| 0)R00S XP W400000(0 0  0}0S D:$ D000XL ,@ [ [ PesFw70Q//Q *///G-p0@0P `3P Y 0 0 `R:S@C@3@D"X HGmU( HG蜹A-TpW0 LT`@V0 L0LS @sP X X| |00 S HH0P 0RS h p@-P @Pp=@-p@-@Pp PᕲPpT0 p@1@-0@T 0@0T0S@-0   A-@QX2X"XXT0p  Q081800` ጱPPW Spbʼ0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . p0S  p0S@hPT0$0x x0R lD@ t0 p[0S ( ;>/ A-`P Pc_῱@T ḱT0pSԱ@p@-Q Mz0 T0S0 PU|0h xPc_`ǰ@P ᮱0 @ ?  Ѝp MeG-Pp0M 堰❰ ⚰  DP &@81A0 81(P  0Ѝ |B H@T{   AT0 R0 0800+ P T8p0SS90SSVPT0c N`P| 7 |0   P @T T0R88tPY0Sx x0R  yT l00XXSP  P T T0R88BP\;pG0VS tc_ Ằ@TG Ჰ0`SS-90SS)ɰگPT00S8 00 H*: S R   p  0S 0S G@❰T 00,6 j@P | t QA-PP@pQ_` ዺ 0t0cR0a100FS  A!/wP@-;000 0c0S /000 P@-Q000 0N0S /00> P@-}H0H H90S So膺/00I P@-D0D D0S Spj/00[ P@-H0H H0S S,0@oO/00i  bp@-@Q0 RP_0 0`S0 SQ 0` /=p@p0 p@9W0 p@x {0P@-x0x xxQih0X  P R !P BR #@@ p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S ǹ0@0 Ѝp/0h`Q l0000P 0  ,'A-0S00@Pd` pW 苹/0000Pp 0 $먚,' nP@-808 88Qv(0 !>000 Ap@-@PQp< NC-`TM@ P `dp) 0 d ````d1pWp0`V& d. 0 0 @@ ldT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0 x -3@- P Pp@Ѝ0@ Ѝ/@WpA-@RP0p`@0S pVA-0Pp`@S:0SS 0  RS* R0 Y`V1S* †P a 0@DpR: Q  \pO-ATP` M zyC@PAD@081 Z  wp 00娵PȀ 墵P 坵P 嘵P 哵P 厵P 創P 儵pPpZ l Dp \61@ R H:p 081#?Q0800 00 & &(p L0S% S% p H p P p $  p E pw P0S t0$0Q0p P pe x0SA 8111↬0x1[:;p M GP> 5p@ hPH 00 \d\$k宩P|$| p* ?d p-"p]@x p 0S P Q [ T  r;p  #i;p寴PO 媴PJ 奴PE 場P@ 围P 喴P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq2!၆p@0-j   pb 0!`pZp  < pP 08!pGpPA 1 RZ  P4 ЍZ p pk  [C -0!.:HS\ qmf|p@-P@pp p@RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U p Q p@-P0U@Sd` 700p dP@@T:Sp/%@-P`1pSMAT  p@lLЍ T7PЍ@!R 0$ 0 0 p@ *@aV 0 !p@`P Gp˵0S lt00#40  LLD SP [7 0 ( " P#?- p@-PP 0S @0`0S @@p菵00p SU   \@ .S0.Sw0_S-S.00  @Rc"0T0 0D0p% @- @0P PET00Q  ဲDP `00CS`0p S00 P0S X0X /X9(%p@-h1@SPTPPE @p G0.SSPP X<P H7P 4%P 0  .ᇢPP:OVp@-@P'Uc 0 @80 t;80 d680  T180H/@,8)0& (#@        70  70  70 70 7 Np@t婣 IPa 6hou}HWf8% 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pPmZp000 57QލЍA. !. d0h (7p`0SPE@E p 0S:0@0DO-,MTPpP+ S`  @P_30S  P@ P@,P$ X P$0X4B3ӳ00,Ѝ P,P, R P,PE0S X R0 6#3봳0 0 0 :$ R, R ߰P 0 0 9$ R R ,PX!@P !!!j  P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-P@`MpUQ:T 0T00D0S00V`F@@$V00ЍPW"0$?S 0[ PW RPPUT  P70 0 .0 I@0 0IU:D X0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"  & Z/Z#sT [\*00 0000K@P\\ZT [T [ KP|%; C-RM MPLp`Hp; @&?pE #6p V=p >4 6pTG    0 tIp P; IeP 8I/    VRލ Ѝ   20V002 0@I p  @pP0P@T*Ap0S4 7p`@T*T 0 5p @ p   ≬0#$$("( 5pm @  v0d#$$(B(   i04!c#!$c$" j5pM @@  V 0b"!4b$#  I?I   .0I/$ P* I/A5p$ 0S @00SP%@25p900c  xMA- PpU@M eЍR` R 00P0S 0 -0 0t0#0Q0 .V 0 00 04P0S 0 +O-4MX@p 0S\`d` (0S:0 p20"4ЍO 0  ,   xp0,0 ,0SPCD ,<Yp 0"00,04ЍP V0 000!0  ѭ 0,pBp000P!d `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  09,PL FPVXp@-P@`P 0S P$`(0Sp,` P,` P  070@-MMP+ pp P0@ۍЍ0;0 C,@P ,P $@- PΠ R֯00\L  ^@-Q00P`PV0 V=`V xЍp@@T   ᑪ0x@ `DPЍp`Vx1@P 0>0S *⏊P PU@P PPy`v/0P@-000 00Q$0  @N @-` ,MV00<0@SP  '0x Bfp 0pt0 0 01 0 0S0S|0@0|0 0  X00Qx0 xIPT ,Ѝ0 8 0@0S 0xPTA-`@VPPFP|P2Xpx`Es-P x倂|"x20 éV0  |20|2@-`@MpP! t (p (X( 8p6PU@ T700@Ѝ ⋩i///0@-M @ |+PPЍ0 3"Qtp 000)006p0000@ 0 6plp 00 " 06p< Gp ; 'p@-QUp@p 4-0x1p@-p@->`FMV 30P0Fߍp@PF/ ܭ9  0dt01 0 `0 HF?6P 0> *0 F?5 ii@-@MtP4@ $4P P@Ѝ Q@-<0< <<0SSP`///E$ $0 /Lp/@-Q @ p000t0@0Q00@-P@,M(  f   P5p 0 00S p,Ѝ08i(p@-@MP B ` = ǣ  (Pr5PЍp:iC-PQSM M3#T0S3"`V2"@p@"0B01801T0t0 H00C@L0@T3H @0H0L00L0 P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0p 0`00t0H0 L00$L0T@120@ 2T@@D@@0@L0 X:   @L0  ҧXH@L0   @L0  XP ầUPPEPP@ D$("(3p`Sލ Ѝ C ➧XH@/ M C-`p"0M` 0$`  0{-pP @T+Ѝ`+PPA   0c-ps0 S +@ ``T*x0V*c00+T00V:0 (P|P@ (0 LY 0@P8 @-`@DM pP@    m!> U 134  R2$ $@0 DЍUi@i@-|@QM  ⺫00 p |2 0"x23Ѝp@-]MP#Z2p PP -R 000S0S S SS wR0S HipīVPS CQRS@ 0`  x@P -$0 Bp 0S$ HP HڡhH 3p 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0 H⩡!>50H \0Q3p[[0S W01S dd0Sc0 0 000 0 0`TRY>S SM  ]ލpRIxZ@P= p@9 i3P0 0- H)3P[%0S" HM P N000Sii@B U@-40 000 0+ЍL 2S/2S00/@-@@֪V002@-S0@0 @@ȪV0002S 必/T G-PM`p (PcP(@P0 0TT`01p<00 - 1pP0S p z2p PU0S p 1)@! (ⴠ( `2p | PY2p 7/PP N2p m'P Ѝ@qB@lBpBfB@G-@p`0M00P U 00S1P    P崡 00S V 1!X0P00 0P0 PPP0PU:000000x Ѝ@-  1 ЍgBp@-0M2S`P@x (ФVP@0 \(1Щ00ލp@ \ B@-P`2@Sp0$M  0*00ᓤ%440 0 0p`/$Ѝ@-@0 )@(@-@pp s1p`~B 0`( "4`#/p@-^@P Tj00p``0@D^Z"000œ\p@Tp0,R0-0 \ 0 # R0 0QRO-M@@0'0`1Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 f'P 0 B0 嶣 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S ႣЍ@-@ 000YP  R n Ѝ@-@\0S \0\0@-@`q0`.0`0@-@08$@L0p@-800@P% >Q" &T10x1 RpR 0S TT0Q  >0S , p@|0800yTA-p`KPU&P@00<000S@ (0? @0K0cScO-@IM`ḠȐDp0 7Iߍ0RS*R? ,0000K C&PP d0S  FRV ( Q  R L)Qh 0 0000200> 0BS0 *➢0 360s RpS00n T) $0K0p C80$0Q  DPV VdP h  Q 4($/ h 8pHQ@`$Q DQV R <0S @HT60 0 <G @V20HS80 0 t:@(1S p0 H0S=00(  )(100@ S . F P81#<141816%#810p0F07spVg 5Sp 0 HS+00 %A C 5V0@B WeV M 5S8Vp0p 50ST 0HSt300r ӡ 0HSe 7000  0 @ ", 02 S3 07 ,04' Rl Ip0  0HSA20 0 ⤡W@(1SgVp 000DKP*0W(1SW(, 030 PV:0BST  ,,S P R:(, "  PV: ART  ,0 00D0C0W00HS90 00 0C!411@ 4S Y 0 HSM00 $A  40@(1SWEVuW08 2Sk  8 "R0 PHt  [:Q0 2 0000 00 @V5 VpWH h 6SD 0HSr^00 &A Ԡ 60@4W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t000@0D0D0 HS3<0 0 " ╠ 2V0@ WV}[Q0000 00@0 0P0"9 _0H R 0   k @~0, $cSc2597@-P\ R&@P\c0S x0x08  Ѝ0PP @ 40yp %R$ PLA-PR1!@ `P0 pC R0 0R0 06 30 0 0}P0 0:0 00sP00;0 00iP0060 00JP00ЍP 0000000 00.p0 00"p0 00_1 mC-P@UM"P, 0P`00P 01iH00P0 0v븀x0`  ($0(10< cV `!P (@B  ) 0ta!P( ``(1 ( Z0(t!pT0+"70 (P 0y c>```h!P( `"(1* (> >Qߍ 0*Y  ; 0@-p0i0 MSP`$M1 1 !p *p@0S i Up ۍ$Ѝi@ 0 Pp I8QQ050 004pP!P() ͞(%$PE @- 0080PP `V@Ѝp0S  @P  ᭞00O-IM PpPHLL `PR } @P0IߍO #0,0#600 0400` 0 p00,0 PS2 V30a2@0 0 ,0TP;`0 9P C;B@PIߍO@9;0 Px !VT` 0X`0T%;0 4`;P P .@r1O-@pP`QP,b尠,`2S$P㘀U`,@ ,}&-Pv&, Q 0S ,9 h& P,`0\ >FRO-00!`p@PT:Up T  X ⢱00U *Ѣ"0 @p Ѝ0R0  ⪝ @:0 &p  :  &p@A-RMM00@` PRp0F R㼀 00 ApۍЍt p p @ ZP: ^&p 00CS@- 81S Q S0 00 0PЍ R )0# DPD3O-04MS@ h@@ `0P0_0 o0 00 0 pP 3 00 y0 pP3 0 0S0@0`00T0 @P0i 00 0 `P` 0 $ ( ZXXppP  ,͜$h(e,8b P`@ [0!P*ơ"0 0HP 0 S$)( ,➜p $8(5,82  P@0Sh0` 0h0  0304Ѝ$ u0 k p( ,hwtp 00 !0 ApPp @ kZj $P ,L,0pS P@,0$S  S St0P !R "R hp( $(,8 'P@N*RO-P0M040@p0` `2##pRp#ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S 8 0h pߍ00 `2$p $  0 p 00 `2(p$ 8 0 p $z8 0 p(n8 0t p#0}0,L04l0 440}po#0n@0"04,0 40kp`8p`5pg2pn,0 !P ,@ 0,00lS  R, `" pP 00H1,0,0H0 p 0 7Y00, }R0S 0 00P 0I p p  0,,0 !P !, `"P ,0 0H0p0  0,pv@$p@-PUp@bn0L0pp@- P# Mp 0` 0 ` 0@g'pJ&@ Ѝp ` 0Y'p )X` 0Q'p  `00; U100='p@-p@`P8!(0-080000&0S  0R  dp`H Ѝ@@ ,0p Ѝ@ Ѝt LOO-`@p 0帀SP$H` 000 0 0 `00`0 0 Р0 `  $7" 0T0003H081y H ЍO<0 $6 :000x3@0Sl3H000s$80406 D'S ,6000800S#FP 3R840S'07e{*1A-@PT` 0S0A hp` |  S 0i0P 0S <0S $5   .p0 s pP ppL0H00p 00p0   =00 0$0 F#5 FAd0h0O-0R\M@pȀP 0#P X0 #3P 0 RT0` pp hPP/ eL`V` `@V@`#?L`}ooF`P X0 R2 R 0PU|NO O T0pd0S  $ P $[ <Y y' l2 0d208#<410,00000<00@0,0D00 <$P(P Q48pLPPPTPH0#pa mpZ 00YPPP  0x 0'x1 08#<48#8 10 E00@Ho@0p08#<4 0P10 0\01pXw (04S#1S0810 ` \ЍO<t  7 0S @  06\Ѝ7S  zDCDC$1  <2@-`@pP`K0 +h0X $7S R @`00 < ` h4 0 Ѝ@$0  t6bp@-P@ $ 0 00L0p@| p3p@-PUp00CSp@0@ $/4  (T000L0p@3 {4p@-P `@pi800  B\7000D 0<0L00p@8 % p3 Q4A-P`@ v0h 0R0(P3 081HAp` P08!(0 A-P     Ph0h hhq 0d 0 Pd0 $|A$-T m h00h0 C-p@ PR0  R $ RP508Ȁ `s3  i@0S PP  P0  lHP810p@-800@P  Dh00h00L0p@ Jig'O\/0S/08. / 3d R  0R/O-0M0000PS`@pTQ 0 ЍO> R*0tP 0S 07S Ǜ ǛY  S0  !!  Q 0 S:500 0Dp00 0 0 ЍO Y 0 0Cs0&o0S0 S0L0  p    0P 0 0 `0SY0A060@ 600 0p0 0  `P  0 S 081di@6P P0S0 0<S<0P0Ѝ 0    05P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050`%>0 pY 4i%0 5 @0S0 Q 2 P   ? rZ0S Y Y 0  Br.  Br*0 @- $P0 0 0 Y & 0 Y 3@ $ 0P 0  S 0S0@00 $0D♒Y<0<0818 ?  ; 0 P0kP4 000а 00 0 0P00 S*P *   pe @ 0ЍO600 0<P0 0S * oP  p6`81 000H 0 000 `0`0\0S   0L!YP 0 8 R @ 1ЍO3Y Y' Rr   0 P0Pd0 Yk 0 4. t ЍO#f L2 6I`qA <203A-h0PR@. 0 DA0BS`pbp m0 Ad$O-` /Pp 0䐠x1@T ЍT 0S R T0S> R *qP  0 4@6O-,M@`P Q0 ,ЍO`F zVWP0@SS 0SP0#ttx'xVI:PQUE0VB:  6""448#8S50V2:1 S/ 0 0P!' 0S 0`00a0<10  &  !P -  0\,Ѝ G 0  B4 Yx@-` MQP\@M  C0p000 p 0S TH # ۍЍ 0W`V \@T $PA- p`@PpAPU- 0 HA0S 0A\0S 0A A-0 ;M0M`pp@P @ p0K0<000C$00(00$0C,00@pV004p8  XXU0`$0 0p ݍ0Ѝ   p@-@PzT  (@x1S0pSq 02p 02022p R Rp07@-PX0D @P 0S6 >0P 7P7;00@0S02700000 0#0 Ѝ0@};gPF@OGF 00 @ 0[ Ѝ0zD9p@-@P0( cUph0Spp@9O-P`@T Q Pd0S  0 0pd0 ЍP0AQ 0S 0P ,  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 b0800<0  P`00 0 0.0S $0 pWp:#<0 2 0 0 R0H0@S4 00ppW\0H0/Ht   p00,0`( "4`4#S /0 @Rp@-00p0`PQPE@ `㧓 @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1 @PMT. 0S pW$ P Ç ᎈPP@0Sh0S d0S4$⩇d0 0S }PPPЍ|0d 0|00 00od0 00i090 RP] J PU9$0 00 HPP 00C@d8p 0S#0 0 0p8`@[ +  %0P R 080SJ @멎@ 0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S   00,  @ ` P D,0rr  nr,0@PEg P0S y$ D0A00T*y PPR 0P갚,%@-0  0 Ѝ@-(@ P G0 0谚,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ u0Pv Ps @ uG Q0P ލЍ }u0P P 0@PZG0 PP U L|P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  갚,%šp@-@PDp@NA-`= @P@ d# PPd f 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ 0@0LT1 0L\0TSpASBC\ rLr qDr4r q q q q q q q,r q q q<0@D(404 4/,00S f0TЍĬ%$ D,A-`@ 0s P0-0p0pGWp0P$P @P @pT 0@@PP @D,p@-@P?@0 ?@0R:@@pP pD,p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/ЍpD,Ĭ%* $   qɪ  '      % 4 E %R W O-Q<08@0(00IpPV @|x`,@480T:(x(P80< (0T:(x((< 80(0@ 0T : f|030H*@`(4 X|008  D!0 `@4 G|< 8000c4 0300 `@80@&000 4/0SD0p D,x Ĭ%*v p@-@0`,0DPSp1S{@D,0D0P/D,O-EAMHP MU>W0`0000, 0P0P6p0,0j0@00`o`L+ pp A>0t@lTllH0SpW W D yP P 00PpXA C9R񟗈ꠉЊЊЊЊЊЊЊȉЊЊЊЊ0ЊdЊЊЊȊЊЊЊЊЊЊЊЊЊЊЊЊЊЉЊЊЊЊЊLЊЊЊ0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0% 0  ;/Q~$0`S $ 0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00 z `| ze,`PPDAލ Ѝ, !ԅ/P 0H0D, Ĭ%   ,Ȧ,0H0S/D,0Pd /D,A-HAP|0`S@M*0S'^ 0S S fV 0P 0P@ @Ѝ i pW*P 0 000z0p p@ `0p#%X0 T7/0S F0SP 0 P0@ЍAzD,Ȧ,Ĭ%$ G-\qPL @0P12C001b5R 0 0&0S   h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R{00ez0S0PS z&0S,P N,@GHD,-!\  0L0#0D,@-p0M  L0@31 ^AP 0C! 0ЍlyD, @-L 0 0@11D ^Q       D,A-Db@0Mu L0 @2# p PW%cP_  Bc p\  ZჄ$0 HD@,X#10000 2R01   0 0S0" V00 S Hz ЍA X 1(4/00~X1威0 3SV Q`ЍQ0S yЍAy`\c  Z& ly@lz%0S Z  a0@0D,x C-Q`0MS 00S` L@P: 0s%@Ѝ ypᄐW   @y y0p0|0S0S %@Pp p00FV@@ P 00T p@xp\`W 0S:S* uy y0p0ppD,Ȧ,O-`LqL1P0SU$,@T,P@P6 h0d 0B1 `P 1xh L0C R P!050%Pd @T: Py x0 p[L0CY1T*Q@@D,G-QT0Sj:\0`S& 2 c@Oop @d(0d$00@X1 0S. L0 P B I %Q * RB  0=408@S 1:X 0p@D7C 0p03 c0?o< @@D@  xP  xNP ` @!0 a`2!! 0 00p10PD,Ĭ%A-p0@@ `P PP0`0P P@l x%Q *0S  ᫂D,$00S:@-@@WD,@-PP` U(0SP@P )@T \0@;"T0T 4/â 00'0S 0 (( @S ЍpD,Ĭ%* O-$M@PpD00T0SdS )@TPY P3@ "H3H 4//Y(0S p0dpY`WT0W @p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  0@P1'0S 0 0@$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@q!0 f`[x [`K``fpP @P0p0 KF K0`F@  L @v%Q *0S  @D,Ĭ%* W ,@-M@pP,aD(0SWTP )@T: 0@!0 4/?0#880 F~P0U6@P  K'0S 0 |( @Ѝm@P %Q|0S0S Pw 00D,Ĭ%* O-@QpL$M(0S@ P u`(W +0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*$|J'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  Dเ`P 00P`P0 0#  0|0S0S @ @pu,v`0<0 0 cp`  u`P% 0   u%T#2QZ J*0T00S  DeVv꬀ 00FP )0S 00@ ,0, 4//`PD,Ĭ%,* @-L0@'0S 0 00 0T Ѝ@ЍD,G////Ԭ%/Ԭ%000/%000/%000 /%000/%000/%000/%000/%000 /%000 /%000@/%000/%000 /%Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/0% 90 0CS0 S P20 /p@-P@,`|Pp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0000 /%P/ 0S S//@-@!Sz000/%000/%7@-@PD@P 40R0PPM0 : Ѝ0*  ؿ%PQ 0S/// % 03P/*0 ACP 0AB0P CoSPS//O-MX@ @ЍOSQ`p rT} 04S`\xP0@`,S@T~L_Uᚔ!` y@T`0`PErCT 04SX:`\V0㨱0 ~~T  Q X ( Q  tyP@PZ P  yT0`0S0?oT20S@W-Ѝ @&0R @T`0-@~@`00P  0S S @0V @ X 1\y@0@V X*f~ 000 00S00/ᨣ!%z 00S00/!% ///@-@Ht@*P >~( - @bmؿ%=5m-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A }00ЍQ@P }@p@-0P `| @P  \*. Q  Rp R  (  p 0 B %ܦ,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00(r Ѝ0S/1>3 !/0S 000/ܦ,0S*p@- @PKK P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!-a0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍܦ,A-PRp `@P 0!v000A-@Pp`0 SW' WV00S񟗋`hhhV VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (*I0PA , (0 ,P0%%%A-Pp0 R*S\ ]\ t`@BX T  xPuP`,% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00ܦ,< 08 C800/`Q'Q!//%p@-P@0`wP@@p Tp Q 010// $1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0P`0%%%O-P 0R@M =w P&  6w P 000Ѝ 0@  HPP ЍO 0 PS@ y 0 00<00S*^Q000800R ]R00-R Ԗv0S* ]R -RQ\U0]Si-Rk0 Sz:0S00T6000S8\ 00000 68^C8e SeR ,0Sl40Si$0Sf<0Sc(0x_ j 0(` pc0@`F p@ yUh 00C0c-R [RQ :R =R 0`S:  0Q00pS0p000-S]S0pS0p04 R*000`BV R:0pS0p00 S>*R; :R8 ]R500A  s0` `BxP⠳ 0(S0<B(R$ GP    rP  `$0  0$ 峠0S00pp0Q00pS0p000-S]S0pS0p0= m R:0pS0p00 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 0p00S ,Z00V0S Z4 0FP   `hFh400!0`Რ40 P0S 00000 P  P (B( [i 0]S S `Q\  (B( 0  EB#ЍO  0%ܦ,%p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@%%%C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  mHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB It i @ 0D OX &(  RPSxPA4#X  z 0   000`020$U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S Y^0<0S 00$000*Xe .X< 0eܦ,)>{^ ]%@-0@``P?Q $0A  R Sl0^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )p V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( =$,Pu 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   `0 S*}Q00 0RX}QR  Q +S ( 0  BF  B   B0:  B~?S {Sz   B0(  B 0  B  B  B " A 0000S 00000ܦ,%^ ]0S C- `M pQpG opL@P 6W:( ЍPPP P $PPxP @UtP0 uPP 6   00|0  $ ( , 0P4 8 < @ D t_000G R:0S005000 S3:  H 0A0BP  00Q p0 P>3S! 1St Sq S <0RpQ00< 0o )  sSW S<0RuQp< 000p000Q S S SS8 S S4 +Sg >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  H0S aCPR, 0E10S*P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUUܰ(ܦ,Ee$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0XP`0%%%0p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@0%%%O-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T +P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  !LP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00C%1 O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0( 0(0 000p 002   0 X = Q  0 R)  R # `Z X !,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(r P  @@ $ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _X_V Q ( X ,0 _X @itg v xx ,    R (ZS $X  $ 0` (ZS  P 00004Ѝ0S0 0x| @P %O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 `800@ 0 WZR  D>sp 0 I800@ 0 @ZH  D>3 1> Q p0p-800@ 0 p$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T rP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  hGP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00C%1 O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  !P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  @P:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00C%1 O-lM`-PQ0r @-Qm   i        Q 0$R`S, 0pp WK,[ 4\ 8Y| <HZ01S0s x[RPR 0C1!S 04_0p[Z 0000 ,@4H80 0 S I0 0CR 0%2 L 'D0 HY0S100u 0 S 0SHPPP PPP8`"`!P03 pP0  .p, 0 Yp@ Xp@  p@@@d\0 PY\P\0 P\P`Ѝ\00@O-1MM @PDP  8 "( p C. `}pX @D;@8 (0Sl pp  ` ᰑ 00㨱$ %0!`p@ t0!0P 5P3P 0S RM\001ݍЍF\0S 0K0S R Pp 08D<4! @ P0 0x0Z  0Q)0h,R <1ݍЍp ԓ FtH   gt0@-P@M 0  PNp >p@ Pr Ѝ00 0iЍ0@Ѝ0A-@@0s/ PP0P  0.p` ``I0`0[0pp=X`p [``10`0[ 00zrpC-@PCM2 /6IP4 $pPC ` @[000 t3 0C.@ F P4D@ @F\M0S VS00 SCލpt@@0S@\0\ 0P@0 _ P@1:S[?00@M[00@p p@-QMP4@SMY TE /HPB QP0s+ lXP 0QaP 0`pG @ 0@WQqp> D 4p7 ۍЍp+0si/r1p0 +8Q\@0 P@0  P@1:Z?00 p 04Z0#S @Z@Z@-p@ Z00Hp0xowo %@Xw$oL T @-qP`O-$(X,P0p-S`@/U'W1 ? 6UZ0 00UP : [#P?5# yq 42x2 zPWi@rUZ0[% 0@-DM@ P, P 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#(0`@S  R $ R &R  :6$4&60!$ 0/!!> 5 Ã111Nş P ą?(ᴕ咉 ?( /( R  " R,咜  )/,< 0( 08# L.:6,$4&60($ 0(΃ 5#111L4 ^ 9) 0()0"!/#0 0 ,僂 ͌0, 0 0^P0(0 0T 0T$0'P/`@ #)0`@00%$0S`@P# R"  " R,"2!x"$0St"x`@ `@x3p0P a:($^0\<P0W 0=R( Q( %0h00c @D0 0O"):60 0($0Ϡ! "(>0!!!0C 0 \ ( "Yx? ,`Ÿ 0/  "1? A  , , 0Y (Q0040 `@10P :P0 0<R$0h00c 0 0gOX!):60 0($0Ϡ! 4!(>0!!!0C 0 \ ( Y? , 0/  "1? A  , , 0Y(  R0#/`@ #)d`qXdDl'"""".%Q(\)\²`@  0 Q0z*0^s*rs!DP&T8<`@ 0dR$  \[ XQO&PT8<`@  \0C000 Q00S7PT8< `@0  0C0,000 @ 0S# 0 h00$%`@0 @0D 0 0h$% 0S 000000$0`@2p rp t t `@  0 R  0 & D%w`@D000 P 0S %i 0`@ D!b 0`@ ![0S(0S `@(300P :c 0 ;NX#):60 0($0Ϡ! |#(>0!!!0C  0  " R Ό "!( #Y?#"0/  `@ D#`@ D `@000 P 0Ss D%`@Q0i 000 \0S_q< 8 D`%d`@D000 P 0SL!D% & PA#RLP; R8  \Q,%8< &0dP(00 00% :60 0!$Ϡ0! !>%0!!!0C % P5!" ?.Q!Q( 00 #0BL00 h00%Hw 0C000 00S ^0 0  s 0L0^ }  C00 00S ^ 0 0@P \' R" !O-Mp`$R0lL0R0W@0 V3 0 2c1  ?80PP/ 0v> 0`0?d000P0?T0 080?4 <0 00$$%"˟$` 0000  000V @;0d0P] 0TPP dPN$`P0Sʼ Rʨ R ʰ R  0 0f 0S0`@dp?O$@T'pET0}Np0`@dp00Q v^D@D 0H080HXP0 00 PESQSp PQJ| 40 dhltxP^@S[R R00d@px0Ut0Zp0 Rl0Xh0 Rd0Ywt [,[8P0>C 0C 0p00@t0p` VP x0S Q0pt0 00@p d00 Pg xT( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?Pv.C BAQSx  \tp Pp'Q 0 0qp 0qpQ0S@T`p VPy0 ?oR20SQ00ߍ 0 Pd@/qp@p 0Q   Q+10!pR@"NSp \TPd0 P0,Pd000 0  ZR 0S 00@ P0d@ `P0S0 !0X0ZS 0#0dd`` `޵0dP0? T0յ0d80? <0̵0d@0? D0õ0dH0? L0庵X$\BZP ;@p^P0S= C-ßԓ"bY2&:##c2S Pm8PP 0 hß0dT09L30@p45P 00P ` d0@pP ?/( R ß&0Q| 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0`qp: @p(pJ=O#00O0S@@㴰p 0d0@p괰[0"c01 2c1@T 0 O Q 0  s!P OT00O0S10(` #ΌQvO00@popOT00VlOT00<DTl)\P(\ ףvɻ %I$@-@_ LFpTat X00 R 0 R 0Q/  /  lHb b  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/Hxa ha H  Q j.0 0#  Q/LG00Ɠ\ 0@-pPo> 0@" \ 0 /FA-@P `p@P@0% P PPA-\@`@P pjNP@0& gP PPEA-\@`@DP pH@P@0& LP PPEO-P M pP9 谟P n/`P P @@ % "P P0S  Ѝz T W I  20p0SDZ A-pPQ `@Q P 0@DDB(000S  <?ܗ@- M`pPPp) M 0 ;0@0S M0"S" 0p000S0 7/ ЍM0"S1Ds\0pT000S @ Ѝ1Ds$ $>pg 8>f @-@ @O-P`U M PP2SpPK P@N P K <10`0[@P6 0nS# =;PP00Q Q GP R  \0  KB" 0 0Q@00oS@d000S p Ѝ4 V <O-BMM@p4M@0  0HP::PP  HPn00G0P PC @@`Kw 0 PPp 0P0 0 PPp \@P! H 0dSPkPU0 Pp` p} a 0JP @PP0 PpS M૓Q P' %L 00BލЍP/U ` P p@L0SQ  BPBލЍ B0H0PP0 rp=  5}L00 P 0Bd! 0 u0 0iL0<0  0B]L!0 \6N00'DL00 P 0}B}8L00  P 0qBq,L0\0 P 0fBfd d 4 zd@c db PM 0 A PЍ00@-@?PM 0 A PЍ00-,M 0 APЍ_ --a0$ S   0/ 00DB8Bp@-PAU@pK?( ( 0P 5/pA<_ p@-P4U@pK?( ( 0P 5/p|A _ @-@P 0003/,A^ @-r@P 0003/@^ p@-Pr?oU20S@ 0 0 03/p@x^ p@-P`|UV00P00S@p$ P05/p,@ ^ p@-P?oU20S@ 0 0 03/p?] p@-P`[C@PpK(@0 p@/?] p@-P@P p 0 0 03/p,?] -@- M  dp@(0(003/ Ѝ@ Ѝ/>P] @-dp@0003/>] O-`$M ؄P @<0Sp $ЍJ0,P@@  4/ $Ѝ=x\ O-`$M ؄P @0Sp $ЍJ0,P@@  4/ $Ѝ<=\ !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////[ [ \ \ d\ [ 8\ (\ \ 0\ [ [ [ [ [ [ x[ [ P[ 8[ ([ [ [ Z Z Z Z Z Z Z lZ XZ HZ Z $0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0%P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, Hp0@ U p 0@T UO UK 1I,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0@V@B 0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV5?Q20S/ 031 a< A0100@w  0 00P, \0Ç0,0,0P @ YfV ?R0@SQ  b9@S B88 C c3<21FV 0, 00 R Q05 705,5 0,0 5RQ= 305 7,5 0,O| f@ 1$01$0@@@0TS`VE.0Z0 Q X Q=V, R05`7, 505 ,   R,0 Q ,0 0,0 R ; @Zp 0Sm @R@ 0Pb % @ ?RY0@SV b9 B88b00 F@00b%#jo%#jx%ju00@-MB0@Ѝ0p@-P`M0@ 0T 4/ЍpG-PRM[  `Tp~PC/a@4P @1000< pp. Ѝ80S&  1 000< pp#G0S0000< @ ppG0Sx G0S X 0 < @F00F00PT 4 L Xm P L O @-$$@M Ѝ،O-EM M`X@P+p `E= oI0P@'T 0 cI0P@T| 0 0EAP / /UEލ ЍF00F00< dN @-@` pMPCP& /I 0RP$  rR$   P @0Cz rR  Ph 0 @mЍ0 Ѝ@}0rS WF 0 M M Hj A-`@ p 0P/S /HP @0 Sp 0 S * Ap@-IMM@`PP p 0: S X0 0up IލЍpFO00@IލЍpE00H p@-IMM@`PP p 0: S X0 0Jp IލЍpEO00@IލЍpE00 0@-@PM 0 A PЍ00P 8 Q  8 //p@-@P PP` < PP u 4P  p@r*PPp--00 M (0  ЍЍ/PHP --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/̆H0-@- M@NP  Ѝ@Ѝ/O- q`Pp,M< PR% Ppp0 0CS%n  P[ P@ 0 @[P N ,Ѝ000:Q!0P00,Ѝ4Xp@-(M `@PQ& (Ѝp0 00 ؄Hp@-`@PSNpp p@p@-(M @P,0, 0 `)& (ЍptHp@-@@ @  `  @P*Npp p@i(Hp@-(M@PNp `%8 X(Ѝp@-@PT T  ,M` @Np p% =,Ѝ脃HC-PP,M/ p@``FV`R V @`0 @T M ,Ѝ00 0:2 0,ЍXp@-(M `@P% (Ѝp0 00 Hp@-`@PMpp p@p@-(M @P,0, 0 `p% (Ѝp萁Hp@-@@ @  `  @PqMpp p@vDHp@-(M@PcMp `E%8 e(Ѝp@-@PT T  ,M` @HMp p*% J,Ѝ蠀H P $ Q80 @-880@M08 Ѝ880/LL0000 0<Q 80880Ѝ/<pP/0@-@0@0 M0S 0000 X0 x0PP d00{B/P00 Ѝ0@f5P, h0,,HhA XA O-3M0PP 0 @0 `D0p@ P P00U pp0 0C Y 2ATT00  RF LD@D T\:[ 2 0000~`K L0 V0 W7 X2ATT 0`Fs 0Ry qL 0  0 B 0SH ]L0Ѝ V0  0  LL 0 0pHX<0S3 0 5Lw 0 B@ 0 B  B"L`FtZ  0 B  BL 0 z L 0 0S 0 B 0 b00~ 00 zHp@-@PKppp@ 0RS00 /p@-@<0<00P  @Kppp@ hzH808 00 Q0R00 /zHp@-@`PKpT T   p@pp@-@P\ \  ` @~KpTT  p@ptyHO-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap2  W R ? \ QQ Wt ,0 000IC11j00Q0 0, Ѝ000-y0 00wwH@-@0@ 000 @T @P80@080v@-@P @P80@0800-M  Ѝ0-M  ЍO-ϟiM P̑Ёqa QP@ PP? `K͌U P ? K͌T zP> F͌(1S gP|> F͌(Y UPx4> C͌ X CPk= JB͌8W 1P^= ̌V PQ\= ^B͌`,=@ 0S078 H0P `P P  P P` P< P P PP( QP PP (Px PDX PxP'( 8Q780H0x100C40S000C,0h0LP 0P( z(0Q0Pd , P `P X hU1q @a0T0 @IT, 0X  p @dQYh`@0`@ ܼP`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`ƾV ,PY 000 `,0匰 0[p$0p1`㐀0@@p`SPp  W 0@0@S  P8<`@P(04 0R(0LPP1@0啿0S@@X!(@L 匿0S00!$0P 儿[T~0S0 0 v, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  P5U,0V00@ Pܰ封[ P@0ɻPP  U `X0pP @Y 0@X RzY0,0P0  0, H V 少[0D|A>`Fp1 ( `Z9Y( U9e( P9r( K9 (  F9( JA9( <9( ^79,  `,  B 08P< T$,  p , 0 H T0封1D|a*>p@8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  PHU,0 V00@ P封Y P@0ۺPP&  U `X0p8@ 0<X\P@U)[P,0 CT", 40p! ,0 H0X 0q1D|a=p@P 00 0R6 (0SJ ,00p W! 0g1(0pS8 1@ a! @0T0P0 @T,00 ` @uX4!(0R1@pPBN0P@ T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @gT,000 @,0,0Q@@ఱ>P`p PPA U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @T,0 0P @Ta$0V1@V T  0 㪹0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a PһU,000 P,0|!0RP 0P1` @b0P` T  0 @  040 0R80000S O-pYM|C0cS@` Q 00L3?K͌ 0 00S?H`3K͌ 0H00S?pp2F͌( 0p00S|?Pl2F͌( 000Sp? 2C͌  000 Sd萍 1?B͌8 000 SX 1?̌ 0110SLN 1?41@BM@0810 POYߍ 000Sk H`0Sv pp0S P0S 0 S 萍 0 S  10S N aX0@-P@L0MH( 00 ,0 40Ѝ00^H0@-P@L0MH( 00 ,0 40Ѝ0]H\0\ 0 R/D@Q 0Q(00?H/l]H$P0P0/ D <  R ,  R$ 00?H/\$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@Ul@U(  R 00/\$0 00[Hl P  `0H?30\ -@@  D\,00D//`[$O-PP 4M 0pS4Ѝ׺PH D0 0 0L|!0T:|@ĺP` `0D0ZP`@0PZ0 TJP V@``@|l:L ?3Q 4Q<  H0 00DpL |"(0:9`P0S R@,PR @0P .: R0`S4ЍT `@004  0`Pu @|`Z$0 00]lXHp@-\0\ 00PU 0@S 3PHsppDXHp@-@P 0PS P1\pp0P0% H -? \0| DR0  0R0 S000 0\$( /W$0 00VH 00 /O-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n >1Q0'0 0 0 0 oЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000V l@40(HG-阂pP@M |Ѷ`P @@d2Z0 @#0 ͆BBB"`@C @@ࣅCC匵PV C? pQ pL 0p R] @B0 @@@(P: 0 @@@(P/ Np+ #p' p0 @@p(P  'e 000S :3S ЍP [B2T @Tyw`Ѝh0S )pP_S4 A-Z`pPp [Be2S @T3(KI000 R AA A <^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0 El0T0ЍtppGl`( r1(@ T (0Ѝ>ぶrp<|^yvv8#s:p0'm#jz #fH#cp-`-]`_Z|WoTpQrNyKzH{E@|Bh}?`aNlI  ,!+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|@Dp@-,@'^@k( @0T(Pp0O-`ܶ6 6M000ƟJҭp6 0000SVF E p :p PP[ k p?P4S S S|V0S$pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0N $Q B q 0 ;0 ?pP.4 S S040S$ 004 0r0  cR$`S 404#` pse0  ;0 p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0ShpP 0@  ^ $@ `00 4S  20 zS 202#`N py p 0$ $P0 s 00bR40 ; 0⫴p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100 ?c p5 p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 0"ԵPHQA, p@-P@,0 0 P3 TT TpO-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 pK0@ $30S0:3S `00X00Z! 0*`00 <00lA @A40 000=Hp@-@Pj<ppp@p@-@80800P  @V<ppp@<H@- MP-pP 0@T $T` @@TP  Ѝ<V>0V P0@P@P@X@-@/P @/P q-P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" O-00fS`PpMvpJP U0 pr(ʍ"(0J"Rp 3S(0$00 0($PK nT$P e 0XSX%$ LT 0@50 85 2P4S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P xP C@oL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D p$l h $ <%$(lX .P Y .P Z .Pp2?;~0p220P_0 r("(0II"Rp7XD  .PZ2Zx2X  .Px2?;~0x2V  .Px278x2Y .P<2|2Z .P|2?;~0|2V x.P|278|2v1S05 4S1zL%R.pZVY  _.PTx2!78x2|"ZYZ8PP!x|"t2OZV*  D.P%x278x21|29p2ZP`p:pp8 :@H@-<@<0@00:3S 00  @-8@80@00:3S00 @-0 0@:#R&#R) -̌“ ƒ$@ $ "p" #ƒP`d:#RPp@-@0@P:#R(#R+ P- ","" "- $ $X R p #P`p':#Rpdlp@-PPP/ 0@` :QQ" “Tƒld l p #_P`p :Qppll0 0 H0 0 dH@-@ MZ.qQp* c0 0 `0000}5 0000u508003 Ѝ 0< e503 ЍL L0 0`0` Vj#cؤP`$@4 0 000:P/@-0 000nX0X 00:3S 0@-p   P`/\0\ 00 :3S 0-p @- P`/@$0$ 000:#Rs/$0$ 000:#Ru/000 000:#R s30/l(0( 000:#Ru30/,0 000:/ p@-P0P`@0M0 0s p 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp ht@4A-$R$BP0@SMz RP 0S `d 1 P00p ĮpQ 10Q61 1`p0V0S  100V0S  034p & 03, p /,%ЍP  QÁP 0: 0 `x   000 00#0 0@!00|X <ht@4H4@-,@@0S!00@-$@@0S!00@-X@M@ 0S Ѝ< 000 00I#0 0Ѝ舶@-h@M@ 0SЍ 6# 0R  (00 Ѝ (# ܵ@-LBL2@P$MQ :cVW0r3p pf0Scqp 0SQ1p0SB 0  B0`*1`00|PN 1@ 300 R 8 D 30 0X300 l :3,p 4 P`$Ѝ0`00|P @ " 0R` 00 `!00T @8 V300 " T<pA- M0 P`p   `ᨫR`hp `L@垫㼫<0@00:3S O ㎫ Ѝ D 0 000:3S/<X0X 00:3S 03@-p P`/@-@0@ 00 03, p 5P`\@-<0< 00034p jP`0@-PPP M* 0Q0@00xP 00 02000*C Ѝ0|P H00 020000* Ѝ0p/0@- 0 @P0:R M P% P P Ѝ0P 000 l20 Ѝ0PtP 4000 Pp0 000:!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0\@Tp-#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@TЍA-PPM Q@`Q00?`FV`V` ,p(L 0@nTЍP/\ 0,  B0/\//A-`MVP@,p(L 0@BTЍA-`MVP@,p(L 0@(TЍ@-PP M Q@7`pV00Ӣ?0`FV`V` W,(  L0p@T Ѝ(1@ RR( RR T 0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0V- Pp4S-` @PP3@ 0 00p) ,4, [ 0  9 0   lЍB0  :lЍO 0O-:$M$pdZ0  r$ @T^ P 0p p 娢 VH&:0PSF  0 @Pp$Ѝ @ P0S S7 SpUV'0004S$ЍODp @0S F0V  B2Rp  `Fp!U 0`F Vp  p!@p FPPQO-PM 4 3`S,[*Y= @00! 0@ @00@ TP/ { @p ` pPPE @0S  0 ጡ`PЍ` D  P 4A " 29Ѝ @0 l P0  0 /4404 000S :P /<0<0 0 0S :P /404 000S :P /T<0<0 0 0S :P /404 000S :P /-DD 0\ ʌP 0 s|@-|0| 00@T 0J#4R B0pQ 8@.P h @$808 000S :P P/D0D 000SP:P4@//P000 000S :P /L0L 000S :P @-xp @W/A-0 00pW* Z3$SP! #R`@4Sp`3@Tv AlB0tQ 8A.\-0    pt000 000S :P /HO-00 0 MX% p `P 0 Fp @3P  0 P:p@ 0 5@ x Ѝ@P  P /p@-JP p3S P`4`Y30PVS  0s3 S 0P 2 $R 0X0S 0D3 20X #$04p03ppp@-jP ,3S @P4P30@Sp@A-`PY JSU#X p @R 3S$ S(XڒL0AQ0, X0p ,01B0010χL10|10\ b0 0XP 3PSSpP4Spp3PUpp@-@P PX0:"C0T0XppG- ؀\/P@p  `᤟P LTL VW PT WV  P000S;0 Ꮯ0 0 O-($Z Ap`PLP@8P ( T2PP* T FP 0 y @00 q0WXT P  RX8 @(  !@0d @-?C0 @   @ (( t  XA- Q@PP% pW# 0 0S0ߝ,ݝ000 R   R   R  P 8ȝƝ4`T `TX *P Q Sp  QW028p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S hP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pnpH0H 000S P@ ?# Q@ 080//lH(0( 00Q0/H(0( 00Q0t/Hp@-P0P0 0@R`  p@p@-P   ` @$ppT0 T ^ @ p@@Hp@-@`P$ppT T  R @ p@@Rp@-P@00S ^ p@ p@O-ȟ0(00P 0P 0 00@000480H000\1 P``P ` @ 㵗P@  T  @`` P0CZ``(``@ P 00 0(0 0帡K?3$0 2[00Z2K 0STP- 0C (\00C:000T ,S  !(0   00C0<Ѝ1Su[` RP7  0 Z  (0000 0P0Q00 0 0X0 X`@00 AT0`F[ V@pV p@<ЍZUZ00qP 0   0T S00 , 1 @01AT0[80  0 0000  1 AB ?[0@p`` @`HLP,D |帠p@D 0 Q H0T0Q (00^00Sq H0@0 L0 0DἰD 0R`D0|0vpjP  S,01@ 1A`pD00|`^p0R H @ L Q Dn1S J0 (00P0 080 5 l10 0S0L0 80 & D0=0 p@``(00P01  (C\00C00 T0,R001 @0#80 000 S 0C`C00080   J HO-PM? P ,0H1`  0|U 0/p @T% PE$ `p0(@ U 0咘P0 0@  0@K0 Ѝ-,0 (0 M0 Ѝ\H- M0 ЍC-@P M(p, P00S 0G`SLhPJ0 O@0H"Hb ``8 ̘ 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00%0   0T S00% , W10X0pXP$ T0`ER VڜpPpV 0 pP Ѝ80  080 000 S0C`Csp@-`@P5!pp 0p@- M Ѝp@-@T T  M` @P!p 0 ЍpHl l0 00S X  8Q Q @ ,@ /&R//pHH H0 00S 4  !R@ ,@ //H`0P0 T 0008!R !R @0<@0/6S//<0P0 0 0001S@0<@0//$l0l 000S X *" (Q Q @ ,@ /&R//H$0$ 000S @ /\HP X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` PF  ? D000T $000S0H0H 0 ?o20QQP T//H000 00 0RPT00/HA-`@P` 80  QP p PeU @00PU _000S0`0 00H?o20SRPT //0PPT00/,0, 0000P/P/(,0, 0000P/P/O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!pW`YHp0Sa>0 S;,0 0D | 0 00P0qpI PX 00C P0HSP 1TX[00CS``[TY0IS`YPY0 0CP&Y0 00,Hp@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0S 1H`?c`` AD Ap0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CT0 00HT0 ?o2R0S P (1  //$po-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  Ѝ\o o4\n(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P' (0@SpP0@-0^ @ 0 Q@R0,mO-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dpፓ0 `| 0pP Ѝ 0 S RR Ѝ,P e,00P 00X p  ``F , B,(`aaA0  U p0E`4ɑP  Fp`,004@ 0U` p0EtPT   PB  0SQ 0 0PC 0$ 0\R <PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP ؼH4PQ8 0 /$ $\/ P/DPQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ESpM D10 0 QT$ D 0R U EAp; 0D00  Q P@$ R U E*p$ 0$@ P0*@0B0TP @T 80@Tp` 0QH4PQA-`0`p0*Â@$ PP q@D00T 0QP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0i0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4~ڌ`ẍ@Pw 0㈰(᲍Pp,o ̎PP0b Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 0!\08 `0d0h0l0p0 ЍP4/ tP) 0*Q! Q80 SpG V P  PʪP Ѝ ᝏᛏᙏᗏ@ᓏ A-0QM@PP(C p`QAR   B P1 \.X) P$,PBPP H0 DH00R00D p0$`P!b@0SЍPЍ谱@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI 㐏L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @د$40@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0H@-44@M00 MЍTQP-D00M  ( @05ЍP8 /00@-MN 0N00 P@ 0 0E DЍ0QPO-r( P0@|0, 0!0 8C8PT* H00E  @HDHT,0Q0 00S H00S_   R ,  H D S400,01$00Q$0 0P 00AQ 0%, S00,0,1$0000 S 40p0L|@0H00D00jp 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Yp$ 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 T8( 0`V 00P0 0CS 80 @8@ NN Œ Č Ȍ N LL\80ɟ`Vpl<8( 00S>0X *1h"0( 880 0 @ `40 , 0W Pp$t00Sz000 @0#pc 1`11qWP7P'PP0 P<00 00S 0X *1h"0f40V @ 60S J6( 0p|Q:0A0 0C0/ꄆ 10 0 S' PP 1 11RY@ RRQ 0   V %( R R !%`FPA p0p`P@ !?3 pGWaFeP `/0 < p  L  `P 0P0P00 PP0׌P0D0T H00S {080  400 h H(,40 vp`\Ѝ8 L0j bT<00D RY 0 R PP!Y n [R  g[ $R\  0E0 p0T  0E  <000$R ( 3 H000S2( 0<000h0S0F  0 0}O@t 4000Vk0 0C B 040H00 R d1S\Ѝ4080 @0 80.P00C\H00^<0SC P\1( 0, QA@`0`4! ,\@XP ppX@P EP0@, Q J   4p@,@ APWp@PT ``@?4$:P ؀P th9|8.D.-,<,p`TPp P @0`, AVXDP q@DH P! R @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \- `@00400   0z8 0!00@ 0C40`0 pWPx p p  P  , BQ 0` W G 4 DP @P | 40@ PL0Y0I D| p~0TpP:W W@ P o@DT GpGGD@a0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0 PU U R0a R  W R RR.0 S0@^ 0 RAA$8 LD@ ,　H@X LD 0B0 B$8 B!!t 00Cb 0U40P0 P,0a0 0R0h400,@P d1S ( ,7 G <0@00!R 7Q R dP  ,@ ``E 0E0p0~ 0E  <000P' 88(  <0@ ?0,0 0000Ss 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  P9( @` 0 `b( <@0 0L0 00 /<000[( l>@ v0 `C0`  <000tW B `0 U<`? 0 0LPP6Pj <00 pAU \ʕeH5Sp@TL 0$`P@@U= 8P8P `$=` 'tƒ /A\  B\  ^tƒ    /V01P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/U@-@P@M&\\ Y #3t P P 00 O000 0jЍSp`P -P\P Y͌# / S@-00  |00S d d0 8=0!D00 R R0  @-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\   Q0 0 000:h/Pp@-@0@`P0M*l"R R`   P H00 040@ 0 @ &ЍplPp|02C-00$RSP@ M "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20+L10 0F0剑Q:20t1=00Q!0S0`20l 00 0&0剑Q:20h00 00`0`Y0!Q 00`M0!Q ,Op0 000/pMp@-x0x 000@00CS0 S 0 S P00pd{P0HM0p@-0CS@0 S 0 S P00pF{P0p@-,0, 000Pv@pLLp@-Pv@p0 000S  @-@J Q P\,Q    @/KH0P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0pPP`@ V vP 00CS/*+*00+T0 S80  ,3 0@60 @D BT p`$ЍIɟ,0 1A!R 1A0 CPg(pW01H1qH1P[W:PP  pGTPE  P0 00?3[0pPPp`rPP+  U   PQ(0@ SCIP@C00 (0C\00C _2b$Ѝ {q X@ @ D0|0lp H0@D002 T `V `tV ``  @x=J0 00LFHp@-@Pppp@p@-@80800P  @ppp@EHO-,6dM0@P$0 Z Qx 0pu`PuQ P!r0P0K W 040P0[000P0@SE:I.A@`0XP0P00PEPUK000 00PS0404 00 0`P0p @R@+40T R80 % 4000C?00,uP`F'uPH` u$ L400Pp ˓pG`0 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!! B qH" R~U` pG7UH04 S0 0 P` 4,8p 04,0@,@ 0<8"PU 0 4Q00C 00 Sb 0( 0C0, Q0 00PSl 0006 t$ 10 P 00  0+ 0 K00000p0_000C?00dtP pGR0H`FOYtP 0I pE!q X{ 0H 00 0ᰡH X!D0|0p)sdЍ004 p` 040T pR0`40 00 0P} 0KP sPdЍ`rE0 00 f`?Hp@-`@Ppp p@X V00 N?Hp@-@Pppp@ Ap@-@@ @  `  @Ppp p@+>Hp@-@<0<00P  @ppp@ @>Hp@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``=O-MS D@HP 0Y 0p`@ 0 0[  F4/ 0 R = $R0<SX10000#10#.Q00S0> TP 0 0@0 0x00 P  0H8#8 S R0 0?P4/[WЍZ  0H8#8 S R@0刀0ĸpP4/pW</h/Q" @-@ RM !R "R pPĜ\  00@[Ѝ/0Q " @-  MS S PpP$R (@2Ѝ/D:-4M0 Ѝ@-@000M, @Ѝ09p@- 0B\\@S ^\1  @ % e ,\'\ { d"LB!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\ "0  {  \ @ o% d  + {o\\:\ { c8QO-M  Cn0PP 0  &  0 S  s `\@u,\    @ \ .  QS%\+ L GRSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8   Rp 00PЍ%@ i\@ @ `f` 00#1.Q0*Q 0S k@  RP %p0@ %dd\  @ @   RP% p0 @%@c  RP p% 0 C@ @%+@c     R} 0   @  Rj 0   @TY @ꄑ 0 0   0 00< 0   0D @@ @  T0 S\R [$ J00 S $0<  q0>/ 0 0S0\S 0 S0 0005&%|%p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0/`A-@0MS0D0@!0@p0S? ` 0u1Ã!1P!1"b2cP@AL0L  00210BgP0 pW$P@WP 0fSTPЍЍP 0Ѝ.N|"gA-@0MS0D0@!0@p0S> ` 01à ‚P P@0!0A1 0120B P0 pW$P@TP 0nSPЍЍP"0Ѝ-kL!>C-@0MS00! 0p0S2 P` 0 `1H $@0   0 K 1$  0H $$N04!b1cD$!b1c  H0N 0 00ࣀ((!h!b∀C 2P㈁ 0tS0cS0S㸠 0 @00 h@PT0< X 00k 0lNg݈kL>-?L*S A-@`p0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV` 1D!00O-餮pQ qM PP- 00S0406 `$  0l@H 00S1  RS G@T l P p 4 @@T %T@%T400 R,:PjP 400P,%0p,08=0,P0(-(͟00:T T) `DV%?#"< / XT c`D`Vfz t``` 0`DHlQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbewV.`^`0^@ C @00! D 2d* R:0\'TOP ͍R'R ͍T0   R'R'Rp@@pI@[UhP 00040LhP, 000p^ Q1`!RZ 0BS11`W PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#{1S 0C-11@ Q 34 00`Q,]*P 0 mp 40P040`OU< 01 1`0@1O1S  0C-11@ST 400 Q,%*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RM  pR 0%R 0@a0D RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU6 =1 =10@1@10D R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@pr!R =1X@ BT! w4 Q`!`10` Q,0*S 0 lp 40040@L, 40,qߍ! 1I00@QU PE=1@Q@1OU =0@01P@ Q#-1 1OS\00PgP 400P,V 2gP 4 0,`V l``&``VP``P``Ê`@oobP``V} d`y`@vs`pQ AQ AQU PE=1!T@QOo1BV 2g0PO 4 0,0R@p00@ 0 m00 @00$# ' V8`000&@DQ0VT$"! y p]K5#g0@0B!@D`Oo0B00Y0@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/$A-pQ@PM 0S! XB QfP `V! 0v0* V U~ ``ЍpP0U0f ``U &8 0 0 R U Ul<P0S U8  op 0S R 8(C8B((0 000SU00P L0 8C8(0P L0 8C80TƨU@4༨ t | @ ht@H | 0R @-ME0@S  ЍA-pPP U) +@`TV 0PS |@P0DV  AP 9oO-PR M `Q %00 Ѝ@ pPb % Pb Pc d%0 ES  eP  P  0PP P0 S    P`0 S  `  0Sn  0`S  0PS  `V$ `P )f$`%dP !dPdP 봰 0$[PP "J [ `$@ v (B8BBXnS0 sS fSU/o0"S R00000P`h&h V 0@:  O0S  C("(  ` P0ጲ <P 0 U W PpU 00d #P`Vl Q`Fh&hVPb    0 SPW  P`U= o᫲ 0p @  0 ` PEX%XU !  X * `0 @ p0 00  PR0W00Pc0X0  0P/W  R000Q/e  cP$% P0(C-Pa@!`pM0 h P 000S@ PЍ`P ` P0 Rp  R 0S 0IPP   PP004PЍ M 0 P  @``+ P*`Pl |O-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDiP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI P5{P 0 ۍЍC0P p! gP20 ۍЍCl0P 0S/S pP +dX y0"dX IP 70 ۍЍC0 PۍЍ p 0^cYW L0L 0 $ۍЍ404 0 $8 $  | Ⱥd 8 G-p`@P  X0@cT  NP @\PPP P @T  @0G-@-@ M100 Ѝ@ Ѝ/~1 Ѝ@ Ѝ/@-@ccc@cc c0c@|cp@- 0@SM 0  ЍpP0`0 0 0 0` 0 Ѝp 0p@-PS@:pS dbP!p`C- `@V M pPᤐ0fU@@`V   0W nU sU  `V  0@00 Ѝ R@@@G- PMU# `pfSPU @ q P0 0nS sS `PUn 0 Ѝ 0S00("(ЍPA-P# P U00`pp0,SS00 0\,\@CV`P  % !p`p@ , C-p M@`PbP(>pWX*nUO sUF fUH0D Y)RA @aPK H0D@ pH0@0 H0H0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D08 400 _ 0S0008  @H0R# ,0 0H00H0H0@ HH0@ 40 0H0@04 H00~H04 0H040, R0 0qH00H0ꌲ  O-0@M0H`[  AZ p :p(080H0r_P; P0  `0:0 `4 ἀ/[`   `' p`!Z `   ` ` 0@ 0@Ѝ@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\A-`p PPU@M"R& Y`P !0P ᴀ0V00  p   0 0 0ЍPЍ^ p  O-`0@ 4M 0 1P p`pZ6 P !PN`0P  0Z`pP|@P P3@@_P` 4Ѝ :` `0, Y 0(0$0,0& PP@,p %, PAR   0S00SPu Y  T㼂  P" ` L@PXH @ D L F ,p P$fU8   0 P+ X9  BHDXDnUDH sU  "0 S   ,@  P4` 4Ѝ  B P$$`$3E/E@R Թ A-Pp ``V@M(R, (_P$ A0` ඀y000 Pp00 0h 0 0 0ЍPЍ]@-0P pW@` MR ^P 0 `> 00P 00 0 ЍP ЍV]0O-LM< <*, 0 $0`P |@P0|0PP* 00|zPzT P)P:PyPH^P  P- U $0+T $0, PPG $0 P10#0 p(000K{e 0s 0P^ , P) 0S& ( .S  ROSF =k`P#f@PZ `XEXu 0n P DDD0 0SP PC$0 ? 0S u0 @$000  00 n0 gPp^ j LЍ0TS$0   N0 400 S,0'Z8 ,\8 0S!:@0@SI hFhvP00$0 0f0 $PnWq ,pP@U 0 Up`e '\UQWW%P^UPg P@U 0 &0FS;{  0tP ,p80 EQE E/RVTSRQPONMLKJIHGFEDCBA@?>=<;:yl76ce3210/S-Q+*)_d` pPU@ U\%00P  @ P00@ %00    P`P pP`,>]8 <04 $nP@0f  P +P p P`       04 $9 ?U  #u 0 S00P{p0pP@`80 L0@\0 00 $04 W80S0P@ `UPPpP`O 0$0 000000 0s0P ,p:@hFhvnXEXu= @0n  8P% 0S00 #PhqPQTP P0 $Z0$ ,p|P00E vPXEXu0k 0@s 0 P0P'0 $zP] LЍ0$ m $g0`n0 $\p$< V p `K L \  t Э l P/N$P00//0@-M@40 0!1l!1"b2cNL 0@@0$@B!A@C0PЍ赁Ng P0`0K?//H@-M@0 Q0 ClB N0"0L 2<@0$AB@C1dKEPЍkL>$0P00?//\@-M@0 0C@N $@L0B!b!bN?AA4 1c1cL0P0@$$C!d!b8A@C1PЍ-?L.*Sp@-0P0M`2*@P 0Ѝpj^, 0 0S Q20Ѝpd$G-1!0  aP P@4 04 S0p0p2,0PP0  |Qp`  WPeȄpEQ  W| 0 ȇ0H00t@-@P [[[ [$[,[[,00!R  !蜝 001/d001P//L @- M`p P0P0@0Ps P 0tP Ѝ 0@P Ѝ|tC-@P,MA!n`Hp@\ yf"RDK8d$7$rQ>*:eRZ>t [~|iUD1Pot{Yo"SRQPOLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!   X" ;T<"!00,ЍPM P :0 00X0BP P. ~P d* 0X 0 0"P 0cP0z:0 004X P 0cP090X 0 0"P(:<:"}Pi 0cP0Zh90X 0 0H"kP^ 0cP0K$ 0X"  YP@ cPc  (:`X`pF"(9" 0ЅPf9P* e0cP0d 0X" v DV0cP0080X 0"8"P D0cP070X 0"`8"P 20cP0 ʨ70X 0"8"P  cPpdX  0"P% 0cP0 70 00g P88<8X"h P 0cP060 00RX@ P 0cP03p60 00=XW P 0cP0 60X 0"|6"P. 0cP050X 0"6"{P{ 0cP0ʘ50X 0"5"iP| 0cP0yT50X 0j"5"WP\ 0cP050 00X" EP q0cP040 00X" 3P _0cP0Sʈ40X 0A"4"!P M0cP0DD40xXB 0 P <0cP040X 0"(4"P *0cP030X 0"3"P' 0cP0|30X 0"3"P 0cP0830X 0t"P3"P 0cP0$20 00X"_ P 0cP0ʰ20 00X"H P] 0cP0Pl20U 0 01X"= P 0cP020X 0"<2"}P 0cP010X 0"1"kPD 0cP0Dʔ10X 05"1"YP 0cP0P10X 0"L1"GP` s0cP0 10 00X" 5P a0cP0R00 00X" #P Ot \ , (  ?̡ 0  @ ̠ h < h < H < D ̙ G  x 8 L t x Ȕ ` \ ( D В \ t 4 x , L L 0  ! @-DT | ?0cP010 0 0JX P] 0cP0T10X 0"h1"P cP!AʜX  PW 0cP010X 0"1"tP 0cP0$ 0X"  bPq 0cP0h20 00X" PPk |0cP0ʬ20X 0"2">P j0cP020 00X" ,PW X d2X"A!00NH30P30 2X"$1!00>30 2X")$"00130 3X"i"00$30[ H3X" "0040 0xX!00L40T40e P33X"I"004044040 4X"8"0040*40]40 d4X"5!0050'50 4X"!00H50P50J 4X"9"0050+50 05X"!005050) x5X"_~!0050Q 5X"q"00~(60z0608 0يX"[!00ht60 06X"'N"00[6060ỊX=!00J60 0ᨊXJ*!007ᝊXS!00, 7" 0㉁PX"00 0~X!00 7070 7X"["0080M 7X"(!00080880a@80HIP" @8X"k!0080]"00!00"00{PԘԈ1!( !00"0090"00!00!00"00"00{"00v"00q"00~l"00yg!00tډ^!00k@(Z B`{P  L:C@P 0\sP p:"0S:=!00J0SX 5!00B0Sz -!00:0S{ %!0020S| !00*0S} !00"0SD !000S !000S= "00 0S !000S "000S !000SN !000S !00PS 0S !000S "000S !000Sb !000Sl !000S "000S !000S# !000S !000S !000SW w!000S o!00|0S g!00t0S _"00l0SW W"00d0S  O!00\0S G!00T0Sk ?!00LH& c@60N4"00A/"00<*"007%"002 "00-"00("00#"00 "00"00"00x 0rP <5"m 0rP"5" 5 0 04 @@0 140 040 0l4 @@h0 84L0 0w{4,0 0nz3 0 0ey30 0\x30 0S3 @@0 FP3|00 =p!00}3L0 002 @@0 #g20 020 0|20 0X20 042|0 022\0 0g1<0 0!00#10 0210 0gl1 @@"0 81 @@0 %1h0 0\0H0 00(0 000 0t00 0PP00 0}',00 0t^ , Ċ \ H P ȉ ` X Ԉ , X | Ԇ Ї Ԇ ȅ H  T 4 L Ȅ x A-t ANL\0@Po>\DQ; 00P \QHTL a`0 : 0D46 0b0#6(7(0a`  0) A03\ \ ANN1 0QU^ P /|2G-0@P Q0>A L `@/ƌ@0pG/p0PϠ B`@T 0 P\^\4 0C@PU 0. ^\!B\A ! QK%RL:     b3Ό2@XX 0啅 06}P t` 0{ 0}P tP`P@P056Q 0~ 0a 0j 0Yn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! /V @D 8(,0400G!0, 0 40@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0000CS 0S H=006c@ Q,=00 C0 0,0pS P<`@@e0S 0,SV [ 0PC0000 00 0 0 0 0#1^@0Q 38R0 4 RR  4,00 PUSY,, < 0 40 30O <Ѝ(0 S0(0@I; 03C`;0U 0PEd@T0S` ;0  R S R PQ0 P 0BS  0 0C R 10Uk 0PEd@T00  BR00S  7P 0 S0f8&#4<f4#R  \:00P:0 00 80B4 R,5@0 000 000 DQ1  P !ADL B \000D0S909 UR000 0pP <`@@n0*pS0 ʈ  P<`@@ ;TUS 0PEd@00 S  SL S5 8a@D00@T6c0PEd@T ULQl80 R H0A S00 CR*ʈ+R~ D800$80LQcD0ʈ;80\0T U 0PEd@00SQʈ@6c@D 700 $ R40,0000 700gUw  PEd@T  [ !RX 70Uf 0PEd@T:ʈH ;0 H @D;6aUR 0PEd@T:0ʈD+1 0D0@D6a+D`60[{ U1 0[![4 0 0C 00  00D0 PE 0CD0 p0Dld0h \ X 0!PU 0PEd@0S^6c@D0l0\ 04 R! / Rf<500 Q 0SU 0PEd@T6 0V3 400400 C`l P[T U 0PEd@00Rl @Da0C T R=0 U 0PEd@T40F?o20$0S0h $3$&$B0#22cR]0S 30T0PEd@TU|Tj0PEd@TdUp  0t$ R R& D U1![ $Q P LQ0Q 0 ! B00  0D PE B pD R=0 D l" 0$ R D D" C$ R$," 0+0;6cD@D10 R   B0 D  010$0S  &$   0K` `@U 0PEd@T$0D`S` 0-0`@+U G$ 0R $P (D R2D507S U     0d 0S PE p000{ =?>?N?P?5?x M?x Q?H?A?L?v J?u 0@\,( @Dʈ+6nM2a@D0 D0B$0S`0  0`(3@0W43&8#[ D30L3HL0  h300@S|3D0z `o0aS 0X00\03@D0P0;T0300 C3a@D06c0D@C c P8l01r0ರ^l[PEd@[UsR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0toP 40s0 (CL @n 850c@ 0`0P50G 00`_t50R|5l 0Y[qPEd@[kU 0C00Sq 0 000 (1 T*U $((U_ PEd1岐@^ $( 6cQ0D6kD @C6c0D@CaC6L0$ R&400  0s@ 7`0> 0cV`0@+KP6c@D\ 0ಷ@D&a@`7l000p 0 0P0<`@@0 $(C 0X0S>0p0P0 Xtp0(0$P$(0/ @80( &b0R0S(0l8@D0hSR: @3 0@l0$8@0@80t 0c \ p T d \ h WP ,90B0 `C40SP90*p@-@LPP80S ($03/$0(3/00pPA-@`4PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0DP,040p0 x0 0 0 30 Ѝ0l0S  pl0@@@ gDS???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8  ( 0(3/pPH 8 4$!0P S>0R:oRS B P T  B T p W0Bp$  (08#8p@p  BS>00p08 ` P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @Pᬰ(X 0C0 0$SQ $Cp0`0 sRpW-0 p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 08#8^0X 0 C∀0S 0SCXP! P( 0 ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 240%R00S020,0@0000,004@0D?o280(000 0 0 0C$0PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0fPPENAxtP N0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B0l0\000S mMP`-0S P(p00F S$0`0!h0S:l R1#P0 6SM \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 BWl0\000SЍ|O-pj P,MXt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ@30 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptP` l H 06#0H0Xl \0P8 B l0\000S,Ѝ80&6&6 &!9096tl L Qtl \e 8t0 S` R S9 Sl@sX 2`o 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 Gl0\0w0P,Ѝ\P80 B0 4l0\0d00S,ЍXwO- ,0PK[ M@!0 ДP0pUp/oX" Xp zpHor 030 #4 B %B B  0BVU2W0>&* Q!M:l`\A `Fp W P!P1UP! U:XUppU`10\ 8  \ 0PE0 000C00U00\   W 0 B0 0 PpU` ,8^v0 6Aú,0 l0&\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 03 0  0#400  0 \0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000* R0f9S /0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH {0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 @ R}0ES IS= [S8 gS8 00S0CkWi D8 RC0SS@ S   00#  #800#"0    ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0q0S 000#40m0q00Y0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=p#  #800#"0 00]eQB 00c*W6F &R< \ R80l0 C;0,0|h 0 00 0000 B 0L0DC0C ᡸt0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC 060@! Rpp@@p@-@/PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ ‚2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&Q-M 0 0 AЍA-P?PUPb8 `D 0t!(3/@PU \!@9 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/8 O-Q M R x 0 R 0#01,#0Pp4` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%| 0S,!R4T0S@S QS,T%@$@N%, AS,D$ S$, AS,D$ S$, AS,D$ ^$,00B00 R  0 0#01Y,# ЍP0#20CS!B1Ppu 4 p D  C-PRp ` P  0!\0 0#@B .P@18R0  C @$'8 C-PRp ` P  0!\0 0#@B .P@18R0  C @$'\ @-@Plp`hPp@` 0!đQ0 0#B  ꄒ @-@Plp`hPp@` 0!đQ0 0#B   p@-P04`^00# @L P%!p G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#7&c2pG0N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/ U/0S0`0//d.< 0T36@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-0 0@ 00 0p哲0 S[Q 0嵟  !  W X SA  ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00Q00S@\ R 802^02N00 R0@\<ЍW@  yP 01LX 1R 6 G2#6pP^p N  p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MV00R@ʀkf W !.⼠ᾐ5 i8R#8% P000P#406IP0cZ38#8V嫞⼠50aS)0P⸐0P%TPVAPeZ5) B("(Q1P8#8000P#406cR!0C 6V V0T@R p` PF_oRRPU RV0W RB+pᰐgZ5P8#8000P#406pGp0cY38#8 WvAP78p#8k.00P0p#406VPcQ 0C6C0T@ Ѝ+}ⶐpi58Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0g0bQ^`徠἖0`j9Y8`J#8 0 00#4 0编0iQ8#8  R0἖`2006.01 P V+ B("(5VPk.0V0o B("(7k V0&0`8p#8;O-ʀ6knS㼖0M $P  #  # #  #  "A @b98 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>8X#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ b98 ^#8 @Pk`0`00@#4PP0 B0`Q8#8 k0&Ѝ0἖10἖- ܑ Б 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&A-Pk΁@`&8#8 R   pp "$ &bS0  Bk>& 0  8#̠  4##<V0 0 ಩000*60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@PP@ @"$PP Ɓ0O-0 QR@ M, R 0p&]P+(+0N  q/ ! RH@P j   Q&Q3 "[r&k R0D 2 8#8000 #40&0bP8#8 Bk0&N.V }0G. 0S0 0xS0   0LSI>X&&&&0 Ѝ(  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦Y@ Ƞ,Ƞ!k>0#40缦0j\3! J`M⼦k> / ! Z! ! 缦jR!! J^ἦ    s Q3 "[6@!:!18#8x!28#8 H L Є :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  ܂ 0S A-P p@0 C`0@.4TUT @<'P &/@- MP`p*@P @ P *4p + @P  Ѝ) 0@0 Ѝ"@ Ѝ0@+T  Ѝp@-P*@P @ߦ@p 00p@-@t*0P 0Φ000 00p@-MP``*@P @ @幦00 03p J+@Ѝp׫0@A+T Ы@Ѝp0p@-S P@0 C`X0@3T 0 p&0P@p%yara0p@-S P@0 C`30@i3T 0 pw&0P@p%tcid0S p@-`@0 CP0@D3T @mpp/0S p@-P@0 C`0@)3Tp;&(0P@Kp/z%yara0S p@-P@0 C`0@3Tp&(0P@'p/V%tcid0@- M P@ 3p  @P Ѝ0 @ Ѝ0@ Ѝ00@- M P@ 2p < @P Ѝ0@ Ѝ0@ Ѝ0yara0@- M P@ 2p < n@P Ѝ0֪@ Ѝ0Ѫ@ Ѝ0tcid- M} Ѝ- Mv Ѝtcidp@-@P%0PPptcidp@-@P%$0P p00ploobp@-P`w@P  0@$p@-@_@ @-@Y@& @-@S@> @-@M@Z @-@G@v @-@A@ @-@;@ @-@5@ @-@/@ @-@)@ @-@#@ @-@@ @-@@@-@@.@-@ @C@-@@S@-@@h@-@@v@-@@@-@@p@-P` @P  =0@<$pp@-P` @P  +0@*$pp@-P` @P  0@$pp@-P` @P  0@$pp@-P0`P @P  0@#pp@-P` @P  0@#pp@-P`n @P  0@#pp@-P`\ @P  0@#pp@-P`J @P  0@#pp@-P0`P6 @P  0@#pp@-P`< @P  0@#pp@-P`* @P  s0@r#pp@-P` @P  a0@`#pp@-P` @P  O0@N#pp@-P0`P @P  ;0@:#pp@-P` @P  )0@(#pp@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-Pw@#(0P p<0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`PB@X#<P pP U patadp@-P`v@P  0@"pp@-P`@P  o0@n"pA-P@#X0P p?%`P  P `'gntsp@-P@"(0P p0P 0pgntsp@-P`9@P  .0@-"pp@-P`-@P  0@"p@-@R 0@"p@-@ P"$0P p00ploobp@-P`@P   0@!pp@-P@P 1!0@!p@-@ @) @-@ @A @-@ @Y @-@ @u @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@} @ @-@w @ @-@q @% @-@k @4 @-@e @I @-@_ @^ @-@Y @n @-@S @ @-@M @ @-@G @ @-@A @ p@-P`@P  \ 0@W!pp@-P@P  0@G!pp@-P`@P  : 0@5!pp@-P@P u 0@%!pp@-P`@P   0@!pp@-P@P S 0@!pp@-P`@P  0@ pp@-P@P 1 0@ pp@-P0`Pm@P  0@ pp@-P0PZ@P  0@ pp@-P`I@P  0@ pp@-P8@P 0@ pp@-P`'@P  0@ pp@-P@P 0@w pp@-P`@P  j0@e pp@-P@P 0@U pp@-P`@P  H0@C pp@-P@P 0@3 pp@-P0`P@P  $0@ pp@-P0P@P ]0@ pp@-P`@P  0@p p@-P@P :0@pp@-P`@P  0@p p@-P~@P 0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@pp@-P0`P%@P  r0@mpp@-P0P@P 0@[pp@-P`@P  N0@Ip p@-P@P 0@8pp@-P`@P  +0@&p p@-P@P e0@pp@-P`@P  0@p p@-P@P B0@pp@-P`@P  0@p p@-P@P 0@pp@-P0`Ps@P  0@pp@-P0P`@P 0@pp@-P{@X(0P p0P 0pgntsp@-P`@P  0@pp@-P@P 0@wpp@-P`w@P  k0@fpp@-Pg@P 0@Wpp@-`P(@<P pP U patadp@-P`#@P  20@-pp@-P`3@P   0@pp@-P@P [0@ pp@-P@P K0@pA-P@X0P Np `P  eP `#gntsp@-P@(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R |0@wp@-@0 P ""p@PPs#0S n#pØg#0ꈺ@-$@@N#—4XP 0R @-P Q Co//L@P /0 t@-0 f @-P Q @@ @0@ f0 y( (0( g0 phf Df | 0S p@-\@`@@ PPpP p@ = A-P`p# @P  `P `pp"⍗P` " !" `!!Pp@-P @`sPpP p@@- g@P $ k0 0 0 4A-pP T@P"  X0 0 0 PC`P  ` P0 000 ,0< M@c H/@-@P ߜ@ e 0 0X $c \}-A-M `V $P0 P$@PpP  0P$ ;ЍAЍ/ЍAЍ/ 0 0t uXb $U\@-@P @  0 0X Za $}p@-@P x0 0 0R0 P0P Q # p@ppp@-@P `0 0 0R P0P Q # p@p P/0 0 0R /P/<0 0 0R0/P///h0P @-od  QP  QQ #/P/ 0 0 0R/@-@P \0 0 0R  %0P Q ^#00TdP/00 0 0RP///$A-PPM /o00 0"P R Ѝ R0 p 0 p`P 0 S  R H  # pP` %   004(A-@PM 0 0 0R ЍQP 0 h 0p`P 0S d P # pP` 000( (0( $0 X\ (; P -/o<0"0 0^ R  R/P/D0 0 0R /@-P o@hP/D0 0 0R /@-P oo P /ol00 0"\ R RP Q Q QI /fP 40 0 0RP 74/8fA-(0`SM.P@U Ѝ P0P pP 00  0rP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( ZP  ̯P 00#0 0 P 0S S R/P/ R0/@- @ ht꤫@-0,MS-a @ S  P `^"` `cP |P ,ЍX  ,ЍD P ` ?"(0( (0 넼xX ($@-@脪@-(@@K⾓T@- M`p@P0 P0P!s*0 00 Ѝ0"S@- M@pP`0 `$qp 0 00 ЍϞ0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`J@P (pP  1@P {W@, ,0, (0 p `XU 0M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ xЍ00@- @PM  @ jЍ00@- @PM  @ \Ѝ0@-@P ,0 0 0R, /P/0 0 0R / 00 !S R!* R0:/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //P $0 0 0R //P $0 0 0R //PP/d0 0 0R / 0   \*S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RsP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 5 S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0(> G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮qvhg"R /R@S00S@Ѝ!1 0 H   0NPp 0 +("( RB*0 Re \Rb  uR^ 7PY +  PS6I %"". 0)" " <,  0   ,0     SPY$ Y  ͕)  )# < 0,!  Y*-"-  }  )&  u: TG-@`pp W W00 GR0SWL 0&<0W0PPF <W0@@j\r\\p 00 S S   CQ R<S+  "P)   P#  P-0@S@S -S 0@@-S0>S @ 02@0S>S 0 @>SSS @@ @bP (0SP  R @ W' W0S@@k@qPV` 8P @P D -P0SPT`ؼDBO-PMups@PZ ,pPQ ApQ 0G g``S`IP0!  z0P0u4  Y  p `PЍ z0P0u  600 @0tzpm`gAo/A-PP #P`p @@PO@@@P p40,p0P4080<0 D@-@  j@-(@@ \D@-@f@cO-4@T p`, ҒP @@D¤@`T P礀Qㅑ@0@ @@0 $PZ PZ P舖2  @-R 0P< P 4Q ,  D D0D )0 , ,0, (0 d1 ܕ@1 <p@-@M4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% I`ЍpS' RxtЍp 0 Z0D p p0p l0D \ \0\ c0D D D0D @0D 0 8/ py/ L/ (iA-@`,pPP W 0 !᫏,P0`*,P0`C-`0@SPpMF  ]P00Ѝ!0 @P ,0SV !0 5P ,0S(0S00  0 P 0S?0S0"S 0:S 0 }R00 "R  0"S P  P @` 0 @P , ,0, (0\  , Ēh0p@-S `  Q P@0@p 0  0 X, А0S 40 00$ $0$ @-0 x, x 4 @-R 0, B4 P @@ @0@ <0 , ,0, (0 v+  p+ 0O-80M@ Ѝ@p`| PP @ ` @mЍȒ  LPP0 004QY  4 R] ,剱1Qw   P 0YIW  B B!w,0 P 04 `<0 04 <0 3P,UN<U8U+oY& 嘡 @p P  PP) f 0,S<SS> bPc @ ,0P`<04 0<0x<8 !w,0P YP V{,$x x0x t0F/d d0d W0,L L0L 0 |8b̬\{D( 2 ( p' tp@-@PP0S L  Q <0 0 p@ 0  0K/lتH' p@-@P 0`0VPP p p0 0  0@S0<  0pPp( (0( $0K/=d ,& 8O-0@SP MR z`G40SM x `P@9 ЍnP pP 00S 0q 2 00PX 0S. @0R* P# [` 4P 0P 0S 9P' X D` ЍORP 0  03/P  40R 1#PP 0 0U/d 00C 0P `O@zh h0h d0U/T T0T 0]/pxli0<$ ,T# 4P# (,d@-@f0,S<SS+ 0  0 [Hu# |PG-U p`0VRV@P7 404 S ` ^ \S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0S P`P : ) '404 SS`  `D D0D @0c/0 000 ,0c/``! ؅!Yt>XnoA-PP P`p @@P @@@P p<```( 0,p0P4080<0D@-@+ @(  @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 ̉m nQ(n mVPG-< Pp0`W=W@ 404 S P SP /000P,0 10,0$ 10P : 404 S P PSP@ @0@ 0( ( (0( 0( | LjlX lplp@-@M400 S+RP, R7S 1CaV( P` 0 00P 400C40`ЍpR S j  Ѝpd d0d k0< =L L0L |0< 44 404 l0< +P khk, hDk k kA-@`,pPP W 0 !U,P0`,P0`p@-00P4Q8 @Q u4 <0,04Q<0pPp 0 0P  \jio@-P MU3 0`Sp@$  PU00 Ѝ 0 P ,0S @t 0 @P  Ѝ0]S$ $0$ 0` d ihRp@-@P 0`0VPP p p0 0 0@S0<  0pPp( (0( $0 jD ghw0G-S@PK Tpu 40SF   P@g P P 00S 0>|P7 0 03/P0  40R 1#P' `P 00C 0_P  @ꀐ ) pG \ \0\ 0 8 808 0 @BP |`hf c8f40S 0C40/ 0  @-0 fe0p@-S `  Q P@0@p 0  0 4 eLeip@-@P 0`0VP0S R <0 0 p@D D0D @0 0 000 ,0 d dddp @ddwG-S *X@` V 0P 0R `00p |T` vV 0S  Gp@ @0@ <0F/D80,Sxl dcA-PP 0 0RF4pP 40S @,0a, 40a@T:8 408 /px~@-P80080p@-@P 80 0R@ pP0@p}p@-@P 80 0R@ pP4@pl}p@-@P \0 0R@ pP`00S@#:p@}p@-@P$@pp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/w|8 ]P`aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@h@<@D D0D @0S/90 000 ,0S/0l{@ `X_ `4_p@-@P H0 0R@ pP`5 @/pDzA-@P1 0RP` 4P%80,0!qW&  P  1P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/y ^]| dZ]0P -?o82 ^0S 0 Sd/xp@-`P pP@bP (0S p@ x > yw0 //@-/LP0 p0 v] ]O-IMP ; @T p `0 R 2/0#L\ P Y  9/0  p\PV @T!1 0 A003/Y@ 9/T KT T @T@" 000Q 1/0K' P70S+ 03/P. Y 9/K@T 0 0( 0 0 Iߍ 0 0( 0 0( Y 9/Z 0 03/X X0X 0( ]\ \[ [[x [[T [h[ h[[P0/O-@MM(p ~T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0=P 0 $ \00 Mߍ0 000 ,0H Q R00 xY$Y# 0/0/@-@@A-PPp`M2 0S/ Z@0U  UP 0/P B 0CU/PU  U0 0 B/Q T!0C@T@!  I;@04D.0 0& 0 S* 7Qp@  V A0P  @9Pۍ4?00@ۍS0 p ! ` H p  p 0P@ (X p@-R 0@S PR :   Pp0P  , 0`0` `90 L0L L:0 808 8;0 pVp VVP VV0 Vp@-@Q PPpQp@-0 MSP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPU pp 0 5QQ Px, ,0, 0 ,UTTXT8 KS 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ Op IQ#0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Qp@>c 0 Q0` | HP0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P p@>  0 0|  pGdOcA-PP4 Qpp0` XpW*@P&  P <V`p p0 8/PWPT`<``Q# PCP P 0S #P P PP@ @ P P 0 H gxN`gp@-P@PP n| Pᖁ0@둁@p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 $0$ $B0 M\ 8MLM< M@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0 H LLG-@R00QP(M P 0 ` p Pt p `͚0T?o20S00(Ѝp`0 Lp@- @PM`00{0 0{0 0{0   Q Ѝp 0@-@P M0{ { {0     P  Ѝ0p@-@ P0Ml,`.4l4#0n{ "44 0f{ "44 0^{0   \ Ѝp 0@-P M0@G{0 |b" b! <{ "440 5{0 ,   S Ѝ0p@-@PP`(M/ 0S, R00z$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0N P0V00(Ѝp@ R 0S V00H@-@ T00@-@up00T000i@-@T @-@T000 000S/@-{Tpx000 000S/@-x{px000 000S/@-h{ox000 000S/@-X{ox000 000S/@-H{Tox000 000S/@-8{ox000 000S/@-({nx000 000S/@-{nx000 000S/@-{Tnx000 000S/@-znx @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#+*l* 0 01/ *001/*0 01/)0S@-@1/00/p@-P0P0 0@0PS` Pp~pz`lx/000 000S-/@-pz-kx@-@000 000S/@-]zkxAo//0- M 0t Ѝvt- M( lPp Ѝwt@-Q0 M Q Q e~ 0 Ѝ 0N Ѝt H^t 0($/0(/0$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@i} P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Px80 0 @  0""048# /UUUU3333  &: S@-x R Sd0 X Sb0?0 r-w - 0!= S W 9SL @Sx00 r@-@w- 0h@  RD R9 Rx 0 r-w-! P6 P0 P& P x  00Rs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-XP 00R B  P1Y O-8H0@p(,M@P R  ( @`Q t( h(hh  @0 D jPT0+0CP $@ p@ z 0  0 0J D@@Q0 Q?0 0X0-SQV|0 iP0-S`0!000 ,Ѝ,7,0 70Pt v` 70  `,Ѝ 0 @ @D@B@@0带 :Q` 0+@P 6eP 0 WV :\ 0S0008Ɵ@ 0~ ~ -Q & % $ QL `=0eP0 AZ pP` P p 0PpU  ytPrP 2 y  Q Q 0PRUpZ p0Py  B` VwQ| $ R :R t X00 RP$ `0`0+ C% :S& V;\j R  ~X $ # R :R #0 0W 0 0+ C0:S0:` R :P  X 10H3H0   R   # R :R  "0?` FRQA 00 `S``P0S  ,Ѝ p0Ph 0Wq 0#0" R :R 0 <0h0 0 ! R :R 0T0V ! R$  p! R :R x09 0B 000 0 R  W0!0  R :R 0 00+ C@00@tW ` p 0 0D0G0L! RLD(tpL)($|K  JT \(H `Gļ 4 0E dO-2夒0 \p`" P@T60ll R01-[@@P-T@PA T" RPP UcP? -@Nc0P  :R7 10 0S! 000PP@:T0S! 000|100S 0:S \ T0s?@0S01 0 0@P 0:S  W $ 00:R@ 0S  0EP00P0 0 Qh0h 0 HtL LCXD,d@BA4|A PA f@-@-Q Q Q  Q010! 0 0 0 0 ाS r0! S L^ 0r0!# ^t00404 40 ytT00̶  G-P @p0#03w0q0W`@DT@!  o 0 0R ! 0 2P   GOt0@ pQPC-pp M P@P `P$ 0 @p0 PP V Ѝit00Pdt0`P\t`Yt0P`StPtl0 0 Xu `B,-0   X ,B,0/o" B0 B/o"; B0@-M 0@APЍ0 \Qp@-@ Ae00QUPQBep 4e00QUP-e00Q1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PCT 0p@/pA-`Qp@P RqP 0开D00p 00$`,@(P0Rs00A-P`p@PB 0U0" V W- p`Pp`PqP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`Pes00|dXp@-0`@1PSM ,0S /n$0S (n pЍp0@-S @]d0 P @0P 0 0001 1 00Pds 0 p@-0`@1PS ,0S m$0S m@Bppp@-@d00CS00 Pdp,P--M  sAЍ Ѝ/ -- M0 0A ЍЍ/0@-0P$M R P0@S&  S$m0  B!  0$Ѝ00mm L000 0 PS@$  LX+ HP 4000S$/00//A-dd 8MP4`P. <<  Q S  @2 hmpU 0 0 40 30.8Ѝ @ mUp  uh@p@ pW goPX 0 L  @2"lp(@p@ :*X:X)(- Mi ЍC-p`D!D1 !M0M40<80$1 pP4Iv@P 0 0 <8 303!ݍЍ0 q  0 @pjPP@T Cnt` 0 P8TvPnP @T@@=$98 C-!1 0!MM0<800 Q P00400 x1@`uP@p4 D1pu P4000 $ ( ,  0 0 pp PP"@T Cnؐ` 0 P8TuPnP @T@0S  d L0 0 <8 30 !ݍЍ800(.7@ T6p\O-ğFM M 瘤dčĝZp@TX (` 0F0;d 0P0S  0FPU 0 P(00S`P y$BPu=Pp$mUg ,4Pg(d,bxSP $ZU ,V DZ "2 0 d4 30Fލ Ѝl 0P1`LmP mP9 / $sP @@U  f>`W< WH 0!0 0  `G1 }0 tPtti0$0SP / rDP#5i00*tx\LtO-!1 0IM010pchd"PPN @`H }0 `8@P; 0+S+0S(P  0 P  Y0ST" x0 0 1 30Iߍ P fP"h000/0@- 0 0M@Q000P 0 P " 0S0 0L @0 0 0 30Ѝ0!@P @-@ 0FM M 0 `0d40pr PPd@"w+ P bh0@]h @R@ 40 0 d4 30Fލ ЍA0@-p`Pp p0dM 0@0\001 =s0 (0 0 \0 30dЍ(55@-<@<M@ U^0 ߿ЍL,0`( "4`3Z1S //0@- 0 0MPQ000@  @0  @" 0S0(0L @0 0 0 30Ѝ0)PPĂ G- M砐 p@ U$e!P'0G W09pPUo0 ;u0+ @P   U0 U g0PgTP g0@}g@  ~x p0 0 4 30܍ 0]QQp xP|`U8 0- M Ѝ@-dM @p`Ph h0 00\00 ?0 (0 0 \0 30dЍ(X0O-@ϟM @ TbTpa! P+?`H@@a+)\D@@M!@P@lX,%T\lT%4pgpX b"  b f!) ` " nH.$DLnD$ fa,` ga&-`a,d8pgqp .`x h't|`t'h(  h pmvmzNS <@ @&`(aKi @$@dIcKL%fc .al0$e;a 0#0c=f;h.d f,``l̠j`荠fpeˌa{'D #n e 8` m3df` piHpp,c{d p' p8@}n{ @n+)Pl .nc+g fi`k@$X Pm$&-3 `+k[%P@ +.B #Bj'Bc+00@m46K=lKY30i[i;d 0h!+@k@0@lˀ. `PD *`ˌ ꭠg )n @ mČƌ͌3kˌf+" d,mČƌh+͌03hˌe;# 0͠T0fˌ+>C3C7Cg;p隠3gPa"j{ a(f `H hkekb,b(e P]@a[l&al( h4bf%bf! lLe+( e+"+I 啓I 嫗Ib< l`` +LLd pL dˌp' p g|nˇ\pb)f+ *h! pf{h,Ld8p`K`nkpꩠgi `lɠleˌa{" pea{'p0P @g}h{ $bK,@Ph[bK$@f `dID`aKl['P`akl[%P`e]b[gk$`bgk&`8 klkd% l+d!ad ge&  g+e)雠` di+( X%p Tg+pf+! gzk{df+" gh@+NDCD4GDkK,+J͠ᕣJ`ˌ᫧J` . n`b*Le+aK)@e aK$ @P(MXfKi "fi h`0a a;Xld@P`kb$b!ai4(0ad )l0ibb+D0l[i;(06P0n`! +뽠daK) @$@L dJ`Ki+d+(, < R0 00//@-M Pp @5U`P`W0D>S 0!3100 0UЍ>SD 0!3100W00W00h/-p@-MAP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( D @-=Q@B 8XA^^14/.-,+*)('&%$#" R@"    +S@ -S =S  +AR@@@-R@  ++   @      0RuS/WS^0@-X0CSMF <0 à 0R ^ @@PSPQP@^  0  0 uS0WS+S -S00T0 0 +S -S/0 0 I@O-0wSpLM 08@ (P(0,00040 0 0V @ NV@TnL7 `0p00000  0a0GS^) $00+W@ 0-S4=W000 0P @X B R f ^XS  "=W  R!   P:0$`=V @ N5V R$ "@`0   ~ Y 0 S:$`Vp@ `NV0S$ 0"0C`ኡ0X  X   pW ,WwpPXS  Z0$`U P $4NU R$ "@`0   1 =Wr +0G?oY20S ZlX 00 00X00 Z$`UP NU0Sl$0 ""@` 傡 0T 000 ) HR;%I?#I0!0 HR<IU0 @Ѻ0@0S:U0"SW  T4* 0 SA*"-+ @ LЍ'pC=W   00$`\UP $MTU0S  $0""@ `Ⴁ|GU00DU0@?U@`LЍ舁$`6U P ${M/U0S" B`01Ds"U00 0pXp+P-@ +B XR R  +B0 -R +R XR 0 -R  X@PPQpx  00@-@ PM  @p`Ѝ0P 0 @-pT/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`BP+ BU PU  0  bP sPYT0@RT@PPrVP ,000fp 00$Ёrp@-0P@`T @T0rS Pptp@P0+Spp@ecؔp@-@PrQ`  0  P<0P0 `@p 0  Ps0@-\A M@0 @f0P0A 0100StG4p@& P G 00 00S00 Ѝ0 0 @1S@bG`0 00S %#S@ Ѝ4(x0cb|b@-0A M@0@  0P00 000S.p P 0Y0 00S&0 Ѝ!MSSt0 @00SES@ Ѝ0$|<x4a$aa@-414!0pP0 MS'1@T0 `0`S$ @0S V+ 000S"P S0S%  ~<p o Ѝ|At0@T0S \7R00@/40 0 Ox(``_G-HM`0 Pp p@ HЍ@ pP 0  |p p@ HЍpR0S @W220P R@O-!!!0C!0T!"@0$AO#`0/0(0 0,002#Ă0! 0wP!T! 0!T$/ !.P !P A00410`00Pd000@tPd00 $L  R$@8ਁ4(0AP`0 0A,0儀H P0x 0 %P0P0P.- |- GzGTQ(\)\P(+ + `SQ O-p 0࡟MW:Pn @T) QT/ T P" 0 ^_ S^ЍP@T T T@@TBp^ pQTp0 p0@`PV@@@@ @& @V @Pp0 VpP@0`V 0 SV0Sp#P0W p 0`@(pV*?[!]-YE@-0M0M040K00S0 0@ $03/L D0 0 4 30ۍЍ0@THG-`@``a V00 "5FPP6 pP@ 0S? 0p R0CÐ@=P0 T  00S0 0  0  ! Y*o`@TrpP Y  !OO00O-ddş MMMčHş尰 TDp`$0OT%*0U@@ R R 40B?o2 00⃰0S U0 S0E0 &0Sw0000Sfd0+0E 0@ 03/0S| 0@4$ 0000,00F$0(@03/P   0S00*  0.S @ T0S0V:0S 0S  ,P8 * R YP $0DQ/ 310 D1 0 (0P00 0S  0P80: S 0" $2 MލЍ0S} 0   000S0z P@T  00S0gO04/P 0 0cEf00m0   0C x 0.Su0S` 0.So\ Ru  @$ 03/0  00.SI X P 0 D;P8 @)  2/0C 0@ 03/N0Sw 0 eCQN0/ 0 @0 03/0BB0İ*nPO-pXXŸ KMMčؔܤ\0 /\@ @`P\/\P  `W!1 0 4 30cKލЍV4/\ W/  0/\W@P P`P 0   R  = T/R  * R& R 0 0 0  0, R @  (03/0S0: SW/0 0ā āQ0M/0 `0`T̪O-@ş5M$M 00000~S`P <   pH 0/SS;R 0B0 4ZS 0H*0; P4S 0 0CPR IR*0S0;R 0X @H p S    ᬓ嬣嬳*S1 00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QT Რ@  P+@PW |"h2 0 0 30ۍ$Ѝ@\0 D Sn 0]S2!^0100]S  000-S]Q 0]S  0@< 0|10s  0BW 0R S0BW 0R S@b 0 Qy  001A0 8Y0  p:>0P0H*0 ;P 0[0!^0  @'Q@f@dب?**H[!-]iO-QM@`pM  @ {G^ @P}\ @\ [\ {\PU PE0]\\ \8(|PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(# 0}^S0CV  F B   G  @ ]RR ]RR zA- 0` PpM 0 S #0{S @ 0\ @{\0 pLP Ѝ0}S0S ЍAK 0 @-`M Mp0 00000  , 0 @;S \0 0 ލ Ѝ@\ ; \\@\ɌTD P\ލ Ѝ\@p@-`Pp@0T1@D 0CP@DP t000p0 S. *S8 ?0C\#S 0 P/0S /Q 0S 0 0/0 S/@-@"S,$ \5 CP   @0S# 00 CR S 00\S 00@0#000"S0 @T0p@-$!$Q$1 P0 QMMR050 X 0 0 5 30.QލЍp , @ ` 0 p x @EO0 \PD04 P 0xHo4 ({}}@n5C-0$eP`M 500S xE@ p#S"fJ0 卤P$ 0S %P @ 0SKJ0SЍt `p  0@S0 0 40  0Sx t倄倔p 0fS0fS 000#3R0 4$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 %GP 000#3R0 p# 000 GP 000#3R0 # 000 FP( 000#3R05 " 000 0#S 20@ R@@G7P00Ѝ0 S S\ FP 000#3R0 " 0@00q  FP  FP2 000#3R0) ! 0 00T 000#3R0 ! 000ElP Xѭ0@S0 @  tFP =Q6 0P0 0 bFP =Q6 0P0 0 0 @00 nmmmlpytyxyhlkkHkjjj$#"M = -LHDRp㴀Y WꘀqvK　SБp'0X{FH 0hhZZfff$}iTfe$f0O-,,% BMM $ %u  %p 000 0000+ 0ڑP 40 4O.P P@\ iP 0S l400#S \ ZP 0S 444d0``\ KP 0S 4d0``\ <P 0S 30   \ -0P 0S d30\  0P 0S d`30X3PE0 +:@3@0 0P`\ @P 0S I?PP[[ AP200xS0xS0Se "P2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S ,dH10\ ~0P 0S d10 ! 10P 0 $Ӑ0000 0000 APxeX |XWW hW ,WVVV&2V U@U UTBT hT4T`aT0p@-\PP 4P p<`<`P@pP^_=@-@@P00PO-,S$M M @p60P`U 0C   500 0?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[ @[[ \[0S @@0S /Sy .Syw 0W r 0W/So.Z^ Q /Q  0pP  /P P$ЍQ /QU 300000  ^[![00 0 00 @ pp /S \S? S -RF P0 U@ ᱠ0]S^0 p Sv tj p, 0Wl  0W/Sfdp @^U/X2000 /WU0@  0U ᾠ]QQ \Q  @P PӥU@  Q$ @@  0\ @ 8!  p[Q @ P0 @0 C0 0p`@0U0  Z 0 P/ZY  //Q /Qk 0000 }T@0lP@-@ P _A 0 Q 4Qq?o2cPWP X|>P T00pT 00p-A 0 pWVO-0p M @Zp` P {y10230Y ߍPT 0 ;pI  P: [ ; 0` 0P qP) @@ 0  %p@ 0  P0P S P ; ">0 "C 0 p@@ -Ru\uO-0p M @p` P 10230Y ߍ落PT 0 pI  ㄽP: [ ; 0` 0P P) @@ 0  p@ 0 P0P S P (; ">0 "C 0 }p@-@ -RsHsO-0p M @Jp` P qo10230Y ߍ PT 0 +pI  P: [ ; 0` 0P gP) @@ 0  p@ 0 P0P S P : ">0 "C 0 p@? -Rq4qp@-T@0`P@ e0P0S SsP p< p@-T@0`P@ 0P0S SZP p p@-T@0`P@ =0P0S SAP pt 0 00 `n-H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/,nm-H- M 0 S 0  00\100M 0 R0    R  R8 00 0 0 30KH Ѝ/@ml -- M0 0(--M  --M  A-`hpQpP @Q 5PD@(0 0000A^l0P R   0//O-ǟ7 0  0 A0S0* R0 :R|R\F\@ D  4 P P;PmX00X0ᨽ: P % X00X0P  sp<E0 @ (0hp0 00`pl5 0, ` VpL5 04 @E @ NP!$A 50 b :p0$ ,00 D@ 80*p8404 0< p40  ph40\  pD408  p 40  p30P  p30T  p30 p*`3C00 2#8"0t3@00 2#(\3& 00a#(2D3* 00@#(2,3. 00p#(332 0 00 `,  R D< 0q[@C   1-)%!p     p  ( }p    R   $qp 9D0  dp  D  _PSDw0@1q00p`I2#8ẘ"0\p  !@Bp0@0@5T0dAd1@ 00VL!x0 0 40 30<Ѝ  #p  1!0 :PX00X0TkxBXBA`KLK0KKdAF$AH?J@`J@@JhYx@IH@0@t?I?dI?H>lHTH>8H HHGV|F<P<WEVd;TEp@-@P> 0S0 Z70@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT ;708@@0/S(@@ @@;;t!|;H!4!A-M@P7Pq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,`<0 ň0pS@ 0S 0S;0"S $7# Ѝ T1r0:;00ЍbT X@-@P1 0S* 6@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 06  T <@0@0@/S=00@-@PDM  @000p 800S DЍ0p@-`Pp' P@ lzp V U phUX p` V@HtA00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc2680E270G2&1H01./ "(0C0 /0: Q?o?o 0@ c5RA-?c"6R2 7R Pcp0E7`G 0E1C f<68<70< 01>?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo C-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0///0Q0@-#/A BR?R0463R64b0A3QBA b3B ,00/A BR?RCA A2" #@A4#a01,000P-; S J?R$R b02!0 SJ?R  C" C0c0,PP `)@-900 p@-P@` 5Ppp@-P@ 5Ppp@-P@`D 5Ppp@-@PP pIP DPppC-PMP`V ➷@T |00I4Ѝp :  p@`$ <77 00 R  <7,@-m900 0S@7A-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `3@ 4PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @·0(@$0 TTSO-PϟC 0C,0  d /"b!!A0,0 W0z 0000 0YWrP 0  80( SP4 0 00HWa 0'P(0PW%S(PR\6 ,0 P6,,0 v>C 0CWP0(A 000"0W085 0 0P( 0, ,0!/A!b!b0C P0(  0 B0 SlP(PWp 50 ,P(W00 00W =0 P( WWpr ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0,$0?2c1, 11,0 020 0000 0 ,, l,0 0CP0(J 00000 h3 ,, V,0 0CWP0(000c c0 ,EP([(P000`Wm0 00. 0 -P(1 \  Rh 0s:  p0b0v  6@p@00dRBnnA1AA@0@10c@Dnn0C@0c0N`K`l0C 000C0000$ PUS ZSP  @ 0T!P ( 0$0| R0Y R0P ,PC  /#b!!0"A K/"|bQ:t0bS0#03   1 01 B00,0DSd0,0dS)\P(\ ףL ( h $IQl',++n)t8 QH140 00N(00 S!0L @pAX_Q"pG@Dx  W@q 0 40N Q @(0Pa 0(P00X(PP @ ACLC  \^JS S 00#3P0z z H/o"(]PzX<JTQ(P7 pp@*CP(!)0p\10 B0,Pp% ( ' PH!/"b!C;R, a2ba12MP P(P @ @0C2c2c2P$00( (0p 00 @ 0 @ ,0@0S} 00@y0S 0@r s,p0 0P P(00, 0C$0(,3000c^\0M0cP$`QP$`p   0P  P(00 , 0Cq$00(0  p  p0P( ,  $P ( (0 b$ 00 0M0Ѝ>A-x1@0QHPP P MM Q%L10 P1$8,p P@@ . R! v Pp `5U  Ѝ0 P0  P La@p ` U 3T 0 ЍH -200 *`!   gfff   @-0M@ V0P 00Ѝ@-0M@e0P x00Ѝ@-BP@lp@-0 00M0,00`P @  P00Q Q Q 2 0 l d0 0 ,0 300Ѝp <冺 ,偺 |H<;t,t,t,0@P/ P @/G-X# `p@-V@P0PES  R  D0PEV R  SS0@0D@R@- 0BAs @Q 0CR 1@O-` M$VP ? @%P>  %pP9 ,0p01S Y% Ѝ0$0P@$P 0 0P $0 0 ,=00 ,100%9RQ@-M "*@PЍTT 1@[Ѝ1 00O-xx ]MMō\\ P Kp `.pB @P;@`0 80xA|Aֱ8O80PTA>C_/ sa$P 400@@P Ph T0 0 5 30 ]ލЍm100@h100^@88<70   M Ѝ6--M  kЍ Ѝ/ -- M0 0 ЍЍ/O-R @p` M R00?oY"+ 00P @ P 00 P! !  3d1XP5   VP W9 V[XP0Ppp`0 0`f`0` 0 00&" Ѝ`pP% PK0XP C0PP00 " Ѝ߭pP V حpP `6\@-@ M!(0S2 0 `0( `1/qpPp0)  0 0 PUR <0PU! ЍPPTp 0S  0CP!v000Pp!@-P M!(0S: h0 "p0( p1/qp@`0/  0 0 @ToR <0@To!1`V ЍP@T` 0S  0C@o.0T00b!&000[!0 R/p@- @Tp0 Rp0 0R0 y P 0S P0o 0c0(j 0P0 e0 S`,P \4P X8P Tp@QeEp@-@$PP!Jp@ @- @@J@ p@-,PP K@p@-M 1!00P00S p  0 XRp p 0S= `@@ W8 CR81!0A0 S0Q\.*L\*\ ( L0 0QW   "Q @\ #R.SA a  00C "\ #R Ѝ`0@/4  R  *4 8/` 0X\S 040:8 R РS /\xB@-@`PLpL0ppD尀 T  ; ||ᨰ-, @-P`@.0 Gp@-h ` \\\%p \!00p@P\ ckVmmsTICt70000E00pH00 Z00p#T00 0`0;T cQƟF @dQ 1^01 0SS100S0dQ U60100 T =Tr T 0@0060000  i 7@DLDL000B@00DQ00100C0y T T 00n 50000  J70D0 0]\ 0 0   ? 00D 009 004 00/00*cQPcdQ{B0@DLDL00D00<00D  0W0C3hh4< p@=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@"00@10 03/P(!p0 $@ ೮0V0 p00 R (㴨P00 0P3/P" Up   R  SVp 0S㰩P00 0U L d G-@P P0&`P (rp^u  0F0\c<!"#b!0CaqV; Y |(PpY` $00100S p j!`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000( P`0003/P 0 p 0000SXP00}00D/>3L8tp=G-@P P%`P $rp ^t  0F0\c<!#b!b0CaqV; Y 'PpY` $00100S p  `1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(nP`0003/P 0 p 000$0SuP0 $0~00$Ծt@SR: G-P0`00Sp 3/0Y @IOP } T 00 00 Y @IOP j T P00 D0D 0 p`P/88SR; G-P0`00Sp 3/00 Y @IP 5 T 00 00  Y @IP " T P00 D0D 0 p` P$/`O-PPM M Q@ \ /\C PyU$P8p/\ @ @. D\m `P /RR.\' B Rm/0  F0M$ P 0E P6pE 0: S 9S0/\0Sy@/\` FQ .PQX 0t/S0W0OʨP !啯P uO # \B  $+/\p@` @}ލ Ѝ.00X0/ލ Ѝ @( X 0/ ?   P@X(00 @(>00 @(?00 @(00 @(00(00p@-@P Q 1Pp`\PI0@P "P`V (0"S p(00p@p@-La P`M=  k#00QP0媥P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P Ƨ 800  Q( 0 @XpXP/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/(0@-@A R R:\|\00\0S Q0A|R  :RRO-ǟM MtDčpĝ!^ $ 0 ^ |G@PU 0P0  pP 00S D  R&' Ὺ0 00 N PK00P000x` @ Z0P@0 S [K :S`\ \S S S`0UD*Z0+ P 0@0 S[BV`P0#SS  [P500PS0O0SE0AU0:$0p%x5 0 D4 30Aݍ Ѝ:SV P0U:HΥPPE" pP`PEV  00 0S gᓦ00@ 6pP  r4@00PS0 00p4 p0040(0,= Pv :SL 0@S t40@0 0(<P<`4 pD pbPX pI  :S2 0S 0IK 00S:S:0 0pK0HW# 0 E 0:   6 2 0PCNPp`'& 00C:R0@0B HPEJ@D3P P @ :00`0000 00,S p' 0pS p%0 SRF w&0@r&@00` `3@̥ 0<40+!04P80 0 `6/p P 0S00S\S00 RAP, 0S7\S5 00S1 :S000 0 S4S[ A 00S :S|S@0@ A@B0S'h!81 0 8 30E ލ Ѝ   @P 00 C 10 Y P [@P @@PP P @ 00   0P 50 0Pp @ml$(,,hDp@-L`@` 0PS 0 0 00p@   A-P= fpP d@P 0:SS  `d \S p+ Q0 @ 0:SS ^S0S:S 0Q0p @Ld@P{ 0`:SSd@0QLpA0]`0S:S 0C^7B Cp2RIFB?5/A)&"!0p 0 BW1 0 BR0 0 0 0~0|:0z0x@ᠢ`Pz 0np pop# 00A-`= PP6 d @P8 0S:S  pd%0:SS   Q0@@@diP pd@0 QCPAp@WpP1P P(P# 00p@-@# iP 00S 00XS  @<,00A ^aPAUA0AW0AS70ARppO- AM Mß3 00(0 00SJ @`pK0/44 PPN P40D 8T  0h#00CS3%10/.-x+*)(&%$#"! 㓩 ㏩| 0:S 84Sr5#0S1#008"$2 0 (0 30| K P* 0B.KS:S00 B0$ 8T S%ȡ 440<4 0 S BKJ ; /0$ I 4$4I <4$0C 0$CPPB>K0C 04 8 0S:S X< H R0 0  Q!000M P@04@@0 H0:S " 00UOPAK0 S:S008$ 0S:S000 L X0 00 -H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 @ 00 0 0 30KH Ѝ/N\D4@-@0 @ @04O-@`,M$xxPQd20 R\ 00@`pR 0 @P Z p P p J ^ J PP0 S#: % U10 r 1$4S1$ !@00P P0S "<100S (!0 0 $0 306 ,Ѝ U r pP Р jP 5SX0(, VT00#    PP P0S|\Xn ˠ@-(@M@@0?PЍ @-Q@0M 0    ",  0$0(0T P0 0# 00Ѝ |0Ѝ0-$M  00 0垧P$Ѝ0-$M  00 0厧P$Ѝ0 -M 00 0 }Ѝ 㢨 㩨0㡨/C-@P sMX`0^ppAtA@0O| 0 00PP0PTA A\0 $ @4 (0 0 1 30sߍۿL0   M ЍO-ϟ MÍ000PQpZ P   P0%%Z * 0S0 R ,/$? 0 3 30< ߍP0 P 0C PS !000C 0 `0zSN~|{oyxwvus1jh?*c_^\ `ZEU000 `0CP0!PE 0SF0 0C0000 000Sw0  IY 񏐕r<P0 P 0P0CS0000 @ 0D SB*Er? (0R0 (0 , 0C$00 40A@QPVo`^ 0 S0 00 Y8 @@0 P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0 =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SdP P000, 0@C0 <9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0_000@T@09S XRZ    0 ( 0        00 0@0( 0CP000&     ( S@ @x& YʱY  P rP @0vP" MP 0 S0 0C0  S P @00CS0D 0 S0  @$ 00S sP40SZ 40AQ0G 0Yc $ @00ESZ FP 0@0CS0O 0 S0 G @0ES$ PS|Z| R0/ 0@0CS0 0 S000K @+ D  @AQ X+ @ P 0@0CS0R000 0XO $ +D @@P 0 R0 @NT9 0Tb@@P9 0 R0 $ @XQ[@@P   R @0 00K? 0r?(00Y D  c 00S0P0SY 00 0(0C@0@00<000jS0,` `01D0(0H@V< l P 0  B0=>J(  r0  p P p p =>3PSq $0S0000PS`F2P Z,`XT $0S0 00 00;0j0<00000:0^09000h,b a ] $R L  0    0 P P  +P  P0^Z``,40VZ`I` @0&0,(0( =>0#C0,`-QR ]QP @0J Q  ,` 000 0 yP 0 0C P0 SP 000;000;0000900000000l000090 00a0:0[00WqIT  ,@  BR 0 R0 @$P 0 R0k @X;"  R "  R1XX  P BR@ $2P$L 0 SI 0iT nT  , BR@ 0Z0K @ R񏐸D" AR>  @ BR  0X0@ NR-  @ BR  0X0\ $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0 S$@5*YY0$ 0(0@T 0V040 (@) Mb00`500S @0S/ 00 0;Zd P 0@0CS0| 0Y0  @d0SNP 0Z 0axP 0 S 0 p00 00W 0*@ =. #RR @R  B   @ 009 @0=>03SS2 0@T0C0000@000& 0S9P @X A 00 000*P[ 0XX 0@*P? 0 S< 0@@Q=P1 0Y. 0@ 1PF 0 SC 0 0 (o ?o_T20S  00CS@0 0 S000 ߚ Pi 0 0H0 B=>  @Jr0 厚pP P p ՚P 0Y0C P 00S50@00CS0400 0S0  @0\,p `0$  , BR@ t 0 R0m&00 (@a00vP Z 0@00N,  ]R$ `Z Pp80$0 0 P80,  4`, rO<`T P$0 0P(0080<$p4PR 0 SO 0N+P 0X 0$@4P= 0X: 0@PE 0 SA$P P<P 0 S4$4I2P 0Y 0$ @0P0 0S- 0 @0I$P P P 0 S 0@X,` @ tTP 0 ST' @tZ ( S C@ SP 0 S 0 @000< 4P $VP @-P 0 S 0$@   ,$P*, [F 0S@!0@3ZO 0俜P@ P 00 0 {Z  ` `>0$0H00 J PE A=>0 $ C 0rp/ P ZP@D7 0ST `Z   @DP0 T0C 0 p0SP Y ` 0@000 @(XZP@D`A-@P`p 0 0@ @-@`P MDp @0p0 000@  Ѝ 2p0A-} !P0@0S5  0`1S010f C000PP! pW@0P@ `PR 0 I00 @ C PC000 09  Q  Q*RQ( <00@8 BP0n 4P00`0 <P + B ?#A 0#@ # B0 L H Pp@p@-@P5  's0@6 p@- $ M0@4/@PЍ@Ѝ@-X0 T0M0$@ 4/@PЍ@Ѝ@-0M$̓0 $@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, $@4/@P Ѝ@ Ѝ@-0M$̓0 (@ 4/@P Ѝ|@ Ѝ@-@0\ \  M $, (@4/@P Ѝ_@ Ѝ@-0M$̓0 4@ 4/@P ЍE@ Ѝ@-@0\ \  M $, 4@4/@P Ѝ(@ Ѝ$O-M@DX@`pP# 0SP 0$,  ;/0$ 0H@ 4/@PЍ@Ѝ$ @-$$@M Ѝ@- $ M08@4/@PЍ@Ѝ@-X0 T0M0$8@ 4/@PЍ@ЍT@-@`pPtt0l尀 ᕚT  ʭ@0 `/$ ₚ-,P$0՜O-şM `@0  N 0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b 婕P  00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00 kP-  R^^? @ 0 `0  hP 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`i<qA- Q@Pp`! P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 Ax  A-P@`ᐔPp .T Tp!0D1(0D,TS0 pAd_T %(0$"0@ !1 I6 O-ǟ UMLǟS @`|  sP0P0 rp0P0 [00 x190 H@ YU1 p00PU`p! X U0 1 #P00? PP P5%0 $^PU`p0pGGq WP1 P! D?`⡒pP- Ƞ  0S V D0 G0CSax1  * 50 0  Rx1  ' 40 0  Rx1 00x1 00x1 00x1 "00x1@\00x100Ox1 I` U $`xPUO 0p 9/P00`xvtr#3 0 L1 30Uߍ 0S IP/3#0 ]P 1p3p#pz0 ]\ T 0 Dߓpk 1ar$00* 0S 0S 0 kY `0$0C04@@PP! 00괡@-A!!!!p@-@P噏0P0 @p$0A-S`P@:T0 @@T (0 0U  @0S@! 00(p # 0S$ @-`Q@M Ṙpp.  8<0RP@D0RP 0P0V Ѝpp ᘘpP0@'@ЍPPЍA-`pP `⢍@P0\X0  n 0 0P `$050%⋍@P \0 00X0@@-5@M0SXPI6PY0: S S]  SЍS P :P E0p`PA=0 `\0`.S0@D`H08< 0L R%0L R!8< \P@D V^0 0U :0Ѝ]0S \040. SЍp $p Ѝ O-,0Up!0T  ݆P1p0 pPp P̆p 0 @Pa0 00ⲆPLon/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R ,` , `! B  // R 0  B-  ` .$`$"  /0S :p@-@P0C0 % 00 0p/0p@-S@ :P0C0  00 0pp0S Pb"! b, @-@M0C0 u 00 0Ѝ/0S/ p@- PM0C@`0\ 0b"!4Pb4#0 PЍp0 $000  / 00$0^]p@-P@([P 0S S pp@[ZP p@ Zp@-P@[Pp> \[P  [P 0S SYP p@Yp0p@/p@-P@ZPp >p@4[ Z0@- MP@YP Ѝ0ZP 0S00 x[\0 00 S /p@-P@YPpZP YP  YP p@Y0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-P/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030< TPE YPA Y0S !1 0 3 30<ߍ(#@- R R  R pP& R p   0S  % 0 0 4 p  0śexePPPO-ddğIM,M IM$J͍$@@Pp P0`S S  $3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " "  J=00hc +4p# 4I8#8   KJ- 0S 0S> S" UV J=00 v J=00Xe O<  'TP #0Sx 0SG0S  0S0s S0S UVJ= 0  2b"!4b4#"R #< v<0I8 0J=00 0 P J- 0S.J=  0CS) S LJ͍0 @:01 00000G0 ,0jPP @(& 00SaLP P P J=00X0  SPjJ͍zPa ꤚ0pC P,0 0TP0  03/P 0P&< 00SS   &< 00< S Rd  0S 0Dp8pՔ&Vdh&hL QI$4@@H 0$0 C0TpP0  03/P PU U UX pt<0Se [( &< 00 Sf&< 00SDywPP0K?o2X  RXKo᪢SH00S0D@@Z@0(C,0D\8 [^4 @0 C40P1 0P4000000"S? @%5 04 0 30nݍ<ЍT00H0Sn&< 00 Sp 0K'[SPV 0`FUd:00S4@N Xw HuP0px`0X0pP 0$0ptX; `p ``p0, 055U 0$ ( `  .P 0;0@#$$(0"(@0S S000 0StX[P ,0LE0S. /T00z[P [[[, ![ [DvPP'Ko᪢X00 S0K?o2'|30 00 RktT00ND8Q (0D 0 ,0 sRCp.@%D0@.vR0@@T@S@@)0D 20 0=SPPC0  03/P; Z 00 S3 PD@ @%,0$RC.@&< 0 P !80%P |v  {,(5$%0 5s 00S Sp SSP10 0LRPP0  ; PP {qP  L0R4 t 4S Z 4S 00RP00S 0R $RZ $R 0(!|KK <GXMн ܼ /O-Pğ SMD`0'qpP #qP  $0  08Y0p00S0  P{ 000 SPw @@PY 0  BPEsCs@l#d3 0 D1 30Sߍ0000R @T^ 0 .T0@T RDSS d! Sz*0 D DD@Q00 00000000 ;Pʖ0=S} R0SN SB SC 0S 0 %P0s[0Sb R00rr @S @Rd! S1*.T 0 Pk< D K0P9dC   DD@Q0000000  Q000S000.@DOoB0  P84R0T0 0 0s )R00  P#0S R000 PR000 DD@Q`krR00A@O-@X`PM @#  R[ pP 08X0\0`0d0h0l0p08000 00000XS< S5 S Q00QP( P& PЍ 0& 0$8<`\` 0 0x Px000 0000 d1SbЍ 0<`$ 0<`$ ppP X8 x4  0x!x T00(000  00R @# 0  P  0 `$; P!$08<080 (0P $q[0 RV딀bXid1 @SYtX@C 0@0S . &O-`PH"H2M 0D000 0 p@P0S A@\ ST P>  HP @@`!1 0 0 30\Ѝ0 SRJ @PF  0 o`P 000S P`P@P $q"qT  P X0 SR @P  0 8`P000S`` ᨐPz|9,8($P001\//*l#p@-@P@P ppTpO-P@Md  X/ x " 8 0 `P  0p X 0S0S " p 0 . "2 ߍ0S0SP;0S pW\>37 p p Q P  >00W  R  A/o"\  P  R R  . p P 0P R   L" l1,P0S$n0 RS S0 00 ZpP  <p00@(0$pW g972 G520W0 0S   S  R  R Q ^  ^  \/oQ" SS RT0S  0 PxQu x+0 0Sn QRj 0pS\ %0P,0V gP , 0 B  0P0pW ,00 X,@4A <uP1x00x0 lp@pPPP @ `0V 00`nlT0`ilO-ttqLM @ p PP0 0I0PE ``0S S S T@9P `0S `(0( (`]P00 U `V X 00 ͋X``VU$@LЍTtpG-XM`@~P pP @;00  Q0 P 40S0- XЍ qP k7 0 kP k8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ0-   00#EgܺvT2A-`0!ᣁ000?0"@@h>VP0p: Q0hV@Hp` G0S@@:p`F Ap@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@Hꌆ0p G-X"X2 0M000@2@"00P005  `p0\ @ 0 XS@@ ,B,R0C# T/ .0N ,B,R0.\'^V*00D!41 0 0 30DЍT  Aa  B8 LR\P 0FS0 S S X0n(."4n4#0RP0@^*0^0 8< 4^*0 8<dD@- M\P Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp k(0!@$R0@0T$0B0S \@0S ( !0$ R0Dꌅ D Ԇ A-@8`4 rMX0P^ppAtAf0Of0 000TAΌ LcP" 0 mppP 0@dP d X0 0 1 30 rߍP e00@ 0P05X B| 0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ p@- M@ Pt00h` 0`0 `P@@X@%0@'T  ЍpD( ,@-TT1 0M` !000mp @P    mp Il@ 0 0 0 30*Ѝ;lPpW @@T PU 0SP@>T00@500ꆄi4 0p@-P@0 0p0d(0Pd(P,Pd 0\0PP 0P 00,,niP 00p 0@-@ 0 0r 0 0 0 0 00@- 0 MP @0d 00P 0 Y??o20c Ѝ02 00 0p@-@P 0U0 0pp@-@Pzd0PPvd(0Psd(P,PpG-P0Pm `^Pf 0@00 S S0 S S tMPU 008#<p48#8W 08 (p8@P 0q0p0S S S@ 0A S  A @P0 ! 0Sp q00006cP  p bPp0@~@ O-@ 0Pp M,0(S{: d(T_  \0 T0V 00SR 0 RL@D@T0`G 00SC000@D@D0`0S, T0X  0!0J@0`I 00S$0AS0020  v*0S000   e0S& 0p@|c0ppxc(0puc(p,p@ ЍbP  (,@(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0oP Ѝ0;p 0$  $ 0 . Ѝ0O-@XULMP$`0 @@dPF$`pPB 0 @@dP7$PPW* 0`Q QD QR Q& 0S:00Sz `Pb  `00"0 @p R  R/ RY R 0 @T:p b 0J[0H 0 LЍ   @QA@ 0S`:   (⼐p 0  ,  p0p 4`0W G`@ @T: 0mb00hb `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QARU  R  PP@T( Q  A X " X. X4 p X@  P@T+:>X X X 0` `9p  ` g  Q@` `` X `p`Oaz a*jO-'Q Mqp POPh<__ @00`0* $   $$Z0 X(0,3(``-P p`Z # 3X(00, "(`` -0P p`TQK`a!Q0#03U0S` Q:PQ Y7X ЍX030#1! 0 Sa@ Ѝ000X; S`3 `#61S41`F2s2`Fs1`FPS0`Fh _0`F`4:0;`0Y S`3 `#61S41`F2s2`Fs1`FPS0`Fi @0`F`0809````u pC-`Mhp' @~ip* P0u00 @0@ht \0 0P Ѝp0H G8ƌ<Π GpB71B- 0R  R  0000890L>1 0 00LЍ 00 !00 0 0@-S@ 3/@>`O-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `  O PJ 0 pD 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z Z Z 0 0 0 0 0  p 0`Z$Z7 Z3 Z5 0  p 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy7n @l l Ep@-1!00 P@0 00D@1011.T 0@\0 S@ G P p0  00C1000L   00LDL` j ʚ;dj A-`MPpM&laapGQQNHH0   @ N 0Ѝj Q@-T4T$00 0`P@P @0C0APP@@ 0P@PP PpP p0C0qPPp@ 0P@PP  0PC0.S P000@000@ 0@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0Bdn`QeEBdnnQph0000P R 0NQ00 H 0NP0000N00 P 9 O-``!80@@R@@ ǟ MM|čǟT ਴L<,4065[0P80 0 06,P0H0p000&6 0 @ P< 0hD0 0 ,vP?o4 2R0S <0`1  AD0PU 0P 0U V HaV/h0S ̥ 00U?p$5P00P 0UH W00刅?p|50= 0X& WP0 a@V00? )R 08p UpP  , rP* 8  +4 p0 4@ p04 p0xp4 p0Pj0S\P vZ0P80[ 0 "#3 0 |4 30ݍЍ_3P `0_?0S 40ST<0`1   #/^`  aP#2 0 |4 308ݍЍO\p$P00!?0"( aU]" P "\` `T X@` `@F`DV?xT 04  S)D#$$ D(H"($H1 Y P` pI  I` T 0 T2L p 0I00  .I5* T@F 0 `DVX@P꘡ 0   wYx 0 o 0 iL1d`0`0 ppG  pG`T  0 d`P0L p 0J00  .J) Tʳr ^  ``Ac{  ԓ p  0БtPH$ x dDO-tM@@ `nVPPh0 P p 0' 0  0$`14 %S, %ἴ0 徤   (6< 0 V 1P80^6< 0B>PU  0R40008 _`1S   ;`1S0 0  0PJ0  0P7P  PP$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0a_pW 0pW  0Rx 0N_pWf 0pWa  0R0 ,0;_pWGpWD 0 PS00 )_`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0~001p 0s001p 0h001p 0]xt1p 0S[h\L ^tЍ tЍ 0 10 ~0 w 0 p0 i 0b0 [x0 T HD  Hp \0<tT4@-@`00AMM0 400p00 8PP0S xD 80 0 4 30AލЍ.39y l 0,@-@ M pp P8`PP 0S@   Ѝ00S.S 0S Ѝ蠘p@-|0|AMPt 0 ` $ 0 @P %8 00 0 4 30Aލpxd $ p@-P@Q`  @Q j[PV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `3W00 Ѝ@p@-@MP`0S 0 @S 0S@V00ЍpO00@0 P V00Ѝp0@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0  (p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@ $< 0@- MPr0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0Py Ѝ0 lP0@-@ M< T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@$T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP@  48,tPlH$p0@- MP@O@ P Ѝ0 0( 0P Ѝ0贽0@- MPvh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0 Mp@-@ML 0 Q0P0<00P@ ` 0. 0nT @D Y000T H0 0 <0 30 @Ѝp@Ѝ/.0 T/v( 8 O-PM@PP pd``0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @  P  S#3@  P 0R \  S # 3 # 0T0 0N 0L0 000J 00  0; O-Q0 dM R Č  $Ȍ (̌ 0 00pp< pp_p  XPc$Ѝ脹C-@P@ `p MPOP @U WP@W  Ѝ @Pt0 0000 j0 P%!@b0S0Toᨂ# ` C-@P@ `p MPx@P @U VP@W  Ѝ @Pt0 0000 $0 P @0S0Toᨂ#ܻ Ⱦp p@-@P800CS0 S  P `0 P/piY`0 0CS0S P 0 /QY@-M@0  0000 !R !0@Ѝ@-0 S 0@Q0 R  004S f0@l@Q0R Q    R Q  Lp@-DPD0P`@0pp 00p@,X0  L,p@-@ @ `@0Ppp0p@, LA-DD p@0P`p0 Ad LC-P0 `0pMpp@ H 0D @ <8 }@Ѝ!3 LC-tPp0 `0p MFp@ ( 0  @ Ѝ2` L0 00/ L0 00/ L 0 00M0Ѝ$ LA-TT p@P`Mp 0 Ѝl L0 00M0Ѝ LC-tPp0 `0p Mp@ ( 0  @ Ѝ2Կ LC-|Px0 `0pMp@ 4 00  @Ѝx2L L0@-P@000 00M 0 0iЍ0谾 Lp@-D0D 0@0pP p@TWN2pl L((  M  0 Ѝ L R) p@-P`@V rP 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M,`(@Pp 0a1PF0 R # P R8@  0  B0 00 ЍW Q ^.Q  Q. 0  .Q P P 00p@-P0@S` }0 0C0p 0 pO-Mp8`P@P*W2*00V-:Y `* 00 p pZ+ `P 0 P0 P 0F000000Ѝ`<0 PFЍ ` pꘑA-PR@`p0ASAA0 0SA0q0@ <0 eP00`p(O-ΟMM M $0>0l>͍0 @@8,0=͍p 000\0`@8<L@H 0 P, 0PS P0⯭40H0P 0 0A Pt0(0-0 H< 0.PPe00H= K$0 p0 D 00 00x0=<;:9876543210/.-,+*)('&%$#"!  P3 R 0S .S 0S 0S00S.SP080W$( 8d 0 P 0 P 0D 0 ScD0C7$.800440PI0000 0@ 0CS(00w0p` 5Z@$`p @D0  xP(0Ss,0 mP0 0`P6000#806, 000.0   .00Q $0 ADP0 0Y0D:0@ H;CH&6 0  0 30d ݍЍ6XW{6P0h5WP0e % dP0⯭40H00 0 PPo0 v0P(0e5000#80P0d寭40H0 0 0PO04 0<08 BPD0HK@0DW.P4@DKd 0 @ 0 P)4 0<8 B_P HK40PP_S0Pd 0 0p 0 P00d 0D  0 wP*.0d   0 hPp@WDK L Pc`0d 0 0y 0  RP0SD[ 3Xk  0 DPD{PUD  bp`0WE!@GQi ;"W@- P$ -0 PD8$ 2d 0 P3 0 PpP: -p PD[ad `0  0 PV-PD[0d   0 PD-1@d DK0 0 P`14 @0<8 BgP( 0D @PC 0 P`P0 0 и `t0| nl0D' ԧ` *̣8`X l   ======< VUUU<tP4ԙșLؗ||W2-0@00Td 00DK0 0v 0 OPPG@ $1 `PV8qVp# P@ 0 4P0U0 0 D+P00e0S0PEVڴ 0 P1d 0 5 0  P-q` 0 PPh 04@DK 0P\XT  0  PR 2PG0/ @0YD: T 0  P= 0 PC20+X W:B0@d 0 0 P 0 P" 0 d 0 P 0@T0DK*S `pPTDK 0d 0 0 0  P=+L0W 10"3$ 0;L0000;L020 20;L00030;L0#100;L0L100;L 0  aP0D 0Sztp@`Tl P0倐d$@U`_  R @ Y$ [0d  Z 0 3P@T=+L0W 10"3% 0;L0000;L020 20;L0L000%;L>L C+A0W 10"3& 0;A0000;A0200;A06;+A0WP&1 00`&;A>A Cl6;}W |6P0&@H 0 P6 0 4 <8 BjP+0DK 0T*Pwp\ `$P倐P 0(Vr  R @0 Y$ 0d  0 P@T0P`D+0@DK1'0X 0 {P@ # (8!?C0 S@ 0 eP 0 4 <8 BP0Dk 0PCUQqڨ@p@Th1 W2 ^0d  ] 0 6PW 9P0u40P<8`@C 0PPh  0 P| 0  Pt  0 Pl0DK 0PCU 90EW 0d 090  0 PR`ViPD[# 1R0@ `P0000^=pHK0 0<#:-@0GV D[HK0 0S@  0 P0Wce*`;@d DK0 P 0 P40<8p@C 0 4P  0 P 0  $PHKW[0*0`@+*;Dk @@2 0  0 cP 0  wPP] \L 0@ PD[ PP ` 0bPc P 0 D[ =P 0 Q0P@S 0D;  0*P4 0<8 BP@p4 0<8p BPyl  0  PqmDK`)PD[0d   0 P[)PD[0d  0 PI)` )P )D>@d `0DKP 0 P/HK@4 0<8@ BaP" 0 P@D[g) 0Pc)HK`)  0@W0S  W T_0Pd 0 0 ` 0 P0p0d 0D 0 tP 0 d 0 fP0`DkS 0 pPs\?P0WH?P0(P(0`00( DkP ?4P0W @ 0 /P>PG!?C0 S  0 P>Wp=H[` 00!~0 P0 `FL>͍d 0` H[! 0 P^ 0@TDK1*pP 0@ D`Y W 0  P? p0d  P 0 P1pGP` 0 Y8 0 P$0d 0 =0  0 P](0D< 0 P2x0H[=0 0yw@(2"PG0 K2P0C2"PG0 A 0"PC2 0: 0 PLrp20( 0x"PCt2 0%@ P+`PVV 4 ,?p0S @P000d0`-Q-+*)('&%$ 7>000Q00o 00A S: P @1T00PCT Љ0A d @00A S0P  ER  00A d0d00+S -S ( 0(00d000C \0Sd 0 d 00S 1CP' $ ZB 2^iS7 IS4 NSd@jP2 d00(Si <010[nS  0S Ѝ00XS `d`0Q Q00 Rd000S 1ЍT @Z o 0'$0 Z0C0;01$CXr 0 "o 05rZ0ST 0SL %0jS 0JR0S 0R0000 @+1 0 +r0 00iPU 0 $S B ? @ $0(SY0SX[ u@P h2vP 0  0v0S P i X:`pgiP)9aiP0S t :0jSk&Bp 0q[ 0 tPpqf qhttt t(`sPPV   ! ⤸0| yvPhI t@P; |0S $ B $R 0C 00CSp`6 bAQ`ppx BpGaw0 [ 0 0S0SIHK 0Set@P hpt0P00 hs00Yh0W hAuPhQp(@0S   88Y'\ hsss s sQ 0JR0S8 0R000X h0 P'1 0 qH X+j0vp8p q0㨀pSY  t6!:k cR R4R p 76K0ct0tj 0[P 0 'Q0p0"00yQt \ QNdT0# 0 C Rࠃ R0d;0d000 C Rࠃ d$ 000d0Q0 `000SZ  d 00S `1 CRd` 00C QPsW0 S 1$ 0^0C$d 10 q0Cd00C [ d00L0C [@PxT$$ ( R$  b$ d@hPCtPPYp(@$sPPNPt9  Nh 1gPk [t` 3# 3#s\3X 00S0jX0S c0#3gP P3m[1HL0$#40k60C40pc+ 0p'o`2 0SRF؃ ho>m 0 opdf p`D"@2rgP/ h(@MrKrIr Gr Er4o  1o[_1@D0$t`#0#m 0`pYP0[00m`p0 P @0(0$0 @00 0h0 dl d0@ S 0S  p0S46S  0gPO 0 o0 #1X\0%#4#$Xn e` A a5? ||N?55|WP9? ?MXkX(-0@  p㨀 Co0XpSt剑5At 5o0 0SI&BS5t 0'́5fFp't`%2 0o'o(1pW{56Qp 1'G  .00C?o200!\ $ 10 S' 0^dn[ p  2ZfP "2UfP SV 0p'(h@t pfh |PR 5fhq0l pp0jS'0 ` A V@dn 0#$v5ft`Q  N$ZPZ Љ Z$\  Z ㉐Цd00Cd0fPd00d00p(000C?o200)0pS `(@0S0SL Vhppp p pXK 4 4% 4# bP0 46'4t0[p(@ k R \p0 p 0mVp0@SxULt 46SG50jS  X Rk&PBp 0mp0p0(@t 46S60kS0S0S qPa qPvt0T&Xh A kR?7Rcppp p pn@VX t 60jSR4p R \,O p1 0m 0@PWPh7Gh>p02p0Xp@q3 \ q.6B#: :p t0(g$!\p0p(@ 7h' ;qP vqP@Xէ 0' 8h'((S   0&ht p0X( jRqlS@" k`Q0 00M 0ЍV  Q":?C0CS S $4c&&0C0c2///A-PU@`0pS  9P 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 ~$0$ $f0 vP Q Q PA-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l C0 3T T0T D0 *< <0< E0 ! 8POh 4POD 4PO0 0C@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0շ 00з000S wS -S rS  0S /xS  /  p@-^ PB2 p裷 0 pP P//0S/ S S/0S/0S/@-@Y0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /K K ??SQ $0$ $p@-0 /K KP P P`/AQ/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/J KQP0 ?0/@- 0  A-4P 0`0H@p P:0S0@R6@pp@-P0@ ES`M aЍp Ͷ 0PŶ0S 0 p@-@PpP Q 0S P60PS6p@6A-X Pp@PEX `ճP@``O-` MV " p@IV PṳP @0SV F!ؚ0 `F`1 Ѝ Ѝ 5` - BMMRč `` T @P ᷱ P<  J G G8E0@- @-ßs M Mp$ȍP|`@M TF "  r" @$@`p ~0 "l2 0 $8 30ލ ЍXUB^T"P0 @ap .<0 B^P.!0 7100A@  0 徧 P0 \ AL+\ -L+*)B'&%$#"   \P  i\\\\\ZTI  F0 F I <& T CF 0 %\    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0U P@ 0 (Ѝ  T00 5CS /0cS#:3 3Q31:0CS! 2#0@-@P S 0\\0 0NO-P`M p Ữ@P-Y[ +Y @0G S`p"@ 0I \ aIQW IAIQ7 IUTPRQ @ 0T  R S` 0J0 0 ЍS T0 Ѝ0Y U Pp`Ppb0 0XQ AA0@ \QUPpbPpbꙙ0@-BR"^H M <000 Ѝ0@f@P-00TP Ѝ0B p@-BR"^p@S@P0T0PpO-p`M@P-TP0 +Tp S0T W  p S  0㐮j  0 ?0 0~ 0  v P p P=Q PS \4 !Ȏ\ @00D ^a0DSW0DA0DS.70D S+| Y[Q PS \!S@` ꉳ"00ꂳ"00 0S \0F0 0 ЍS@ `?0t0T0i XR A B0A PR W  p\ ppX @p` QWKppK0@-BR"^L M @000 Ѝ0@@P100TP Ѝ0(> p@-BR"^p@ @P0T0Pp | 0 Q?0S @-R-- M[ ЍЍ/G-`P(00 !PER !U6@  >PG0 ʭPU pWU@mPp X" 00  @@pG  pᨭ00 赲 0@00A-P@ RH`H0``@p 6T  I A; ,p@-@Pᶣ00CS0 S  P `0 P㭣p6`@-@ᖣ 0`00@蕣- M ? $ Ѝ0@- M P@0 0 000. 0 0 0 #0 (0 0 0 30 Ѝ0&Qh: : 0O-`MQ 0 Q0 `ߍ0( 0*/PP 3p000 00` P i@P 0 "0 0P @ R R R#Z0P`0S 0@ ET :@D0SZ@DPg @ ᵬ P[P@DV R+1 0 0 帱00 R R0 S S 4 P@  @DOo  @BP ۮP !V_*0`TY ᴱ p  R R R RO V2* ښP @ R p~  7 R @DH0PS C  > @DZ PT* (/P `F p ` 000(/ P`F m p` p70pa p_5@-DD @1LM0D`QpP- @.0 P) U) pp0 0ͫ0  PP Z0  0 x0 0 D0 30LЍOPLpp  @ ;0TO5 F3E4 d2A-``@PTpM) W ``00偫 0 OP 0  0 ЍX`` k@0T ЍyOP @D 0 0S/ 0S/p@-0` P@ Q 0p0 00 Rp` FQ`00pO-ttß OM4`XQ `Pp@dh Q 00B/00 Z.` ֝P 20 00 [ !!.PQP\.Q Q :0 尝P 0H [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O P00 0J ` `媪0 0C S:: Ẫ0  `  A:[ 000(0,$@0勪0 0(0 `0 $~P00 0 0 41 30Oߍ Z[00啯00<4 }PPS U.R  : P vN2 x2 * |@/ -/ O-ʟ@ M MDtŝ00 P:% Q0`px$ Q Q 0 0 *: 0 D5 30dݍ Ѝ)0 0(V,0P(0 0@ T S#PX (.|5 00 P0  03/P  T:0 C/o"T S R`  P$0 XH%t$(0txᤐU0'x T@0 0 ` `<|L0=D804 ,PXP0 C0 R P0  03/P Y  ` ZV `W VpG:(0,0@0(0<Q 0 d0D P0ST Q  RM p Ph < `BZO[P0 0 0PS ! RȠ LȠoQ \ V\pp0XP &0 02W <0S B@Gq 0PS!P" SPSP@Qp$`0S 0 0X@@ @PC0@P0CSX@:@p$` @)-D0 C0 0CSX: 04 R  Rw Q9 0B'RS] P `00%H `/J0 SRP5 080 v `PC0 | `Z%8ʨX00 S5 8 0X0P($0q/P0$ R R < R0$0P奨0P `VX *P D Q* 䪨<0X`0 `D<00S S F00H030 0  `P0 9 `ZL @0(1Q:*(PfP PXP_0 CR00 SX@0(0,8w P~HpJ0XP@ CR00S:@ணPX@ 03/P $X (0@(C 0L0+0P ( @00(0(,K 0$ 0% /z  0 0!40 T8!rQi(k$0 PXa0.P 0  `PY0 + 0Z0:<0S$0(P@0(0ק`V D`(=0%H .3,;L @0(1Q *(@0P(0s P& K(0@(`C 0L0j+0P  ( @0@0(0@0(0. . p.  | A-0S`@M05 S Ѝ0p 0)PP4 ŬP/ 80 0P P  0 "0P,ỬU 00S S 0p+ᩬ+ 0 G-20BM0400 00`S0. S @ᄒA~ P p0u #0G[/P @T *X8 4"y,2P 0 "1 0 4 30vBލ 0    ! 0/=)@PI :PPD 8 0 0@طPAP 0 00 00000 00@u+T7 0 p pIP  00S 0  0pW&   0 0 0 H+ 0 B+ 0  00S S J#   0" G-Mp0`ƫ@P0P0 0   0 p`BPǫЍ 0 6PP A-M`pPᠫ@P , 0 (   P 0@ᤫЍ0, 0ЍRQ0@-$MP8@'0S9 0S0S9   0 40 0 0P@P 00$Ѝ0R R" </ 0 0$Ѝ00S 1 0 00S000s S 04   0t  O-DDğ DM<h@P 0 ((0P P`spf*0 `!PP TP ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0.$0@P`  s p0S S S@ 1Y g*@@P 000S 0 R0 ?@B 0I  R06@DQ1 y  @DX T!:  @Dpi0 Sq CF P`0  [@D q [p>`8PT* P`))\ 0  0d!P1 0 <0 30HDЍ((PI `  P@Q P1 0 0 0Z0 J P`00)) 0 )0 000 00 `H`P|  p@-M`P@),0,0   0uЍph))@-M@$$ 9 Ѝ)()@-M`P@pP0P0 ɠ@0@ 0   @0ZPߩЍ((0@-P MP@T 0t  P00 000P 9 @ Ѝ0@T00\(D(,(@-1!00M@0 ! p`P0^! 00 0 N RJ0100 N.^Q 00 Ѝ R0XS 00 9^0 ^ @ A Q QV ( ,$04 c#!$c4" 00D O-Ÿ2 0,MP0$00@p P / 0 "x2 0 $0 30,ЍX"L2 0 $0 30,ЍOh0P:U000 0> U@ 0p`pP @؁0 tP01 `V, @ pWVp F P$`U 8#< 400SO U0E S0 s\b ᔣP:U@  ;P 0:WV 0S  $0R 8#< 40@ P`0S P@P$`@P.Up P$`UPeGU P $ T 0p@-@P  (M $  `0 R+P* ᇞL @0 0 $0 30(Ѝp7 0 +G < O-ß lMPd 0 P / 0 #3 0 d0 30lЍd#X3 0 d0 30 lЍO 040 $(,00h1T@ RT@P0 q0S P q u XP 0SP q, u00 X0S PX$Up#P40@ 0b:0@Tp0*PUY 0 SY*  0CR00R:@ٝ{uPp40@` 0b\!J 0 *PY9@Tp. U00 S` V,*:0UT0X X- X@P0( R0  JP +P RU @Tpu0 S:E 0 ': 00@SP /F  d O-`` M@QpPL P(Z? U U U  0 JЍ0` R|  @0Z' + PP 0:/qp  00P @ P S&00 0 00 Ѝp  .P0  * R + L U[ p  0.P 00 0SN  00 0:/qp 00 `P¿^ 0? <`V<X0`u R0Z0}ᇕ0 jP0 :/qp`0 a 00 0`VÿR <0`VÿpX0PXJS 00 0^O <?` 800C`V 0Y!QD`L0k?  `:/qp< 00 `P  @ P %00 0 Y 00 S`P%0 S": 0C P;P`T 0S  0C`ÿ00C`V0  Y 0CI 0^ @0^ Z%00 00 0 ۥ 0  @ S\0O-@ $M  H`p 00#p 0 0@H`# 0 B0S0 Q6  R00S 0B QR `  .$PP რ00[U X0 00@PL  RWRY 00S ` R00S R Tu*0D0 Sm P^ TP`p^[  C0 P ATq ^a S 0 ` H`@r3 QY/ ΒP+ 0S "  P00S U0S S" S' S- PP000S 0 0ԟT $Ѝ`dP`V=W WS SSS H$p@-@0P0FG p 00p0 0@p¤0TS00 -M0 3/Ѝ/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ R R R //00/00/ R R R //00/00/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P 0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P @- @RM R R Ѝ003/P 00S00Ѝ 0R0 02/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/ЍR0 p@-@PPeP P0 03/P U 0| p@ 0/003/P U 0@ p@0/@oppp/z DMA-P@Qp`M Q Q Ѝ0 03/P V*PX "000  0003/P P P PЍAR X P` }0SP!y  ;A-pP`@P  R 0 R 0\A/W 0A/0A-M 00@SpP` SV   P RPU U U Ѝ!000SP Ѝ VP 0SPUw! < P` {w  (#0@-0@SP M S S Ѝ00 03/P 003/P  0 Ѝ00 00 0 3/P 003/ Ѝ00@-0@SP M S S Ѝ00 03/P 003/P  0 Ѝ00 00 0 3/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 / L0 00/ P0 4# /0 48 RP @Qa GP @Q`P <P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b" R` V` `A ` @R^ .R @@  0D0C  X1 (00$Ѝ00P  ` < V    \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00`\ n k 0G-AQ@<*p0S% R3 @R`P00 0X* 000瘠    P 0 Sp00 NAS 0SPQP!00P0X`(00 TRO-P3P#RP3 M0U p\` @0I @R: R R& :(000 ЍQ*@ ĠS? A @ G0RPR@\ 4 R @4 S0A  Y*@T*0P 0A\ R!ɑ" 40S0 4 0- M ЍO-S@,M `0S0g 0S 0S0^P @^Y \S0pS0 0P00C0$PU P0S @Sf  [@U pPU00 S V*0 B>\ A XP00L X 0 Ġ? 0 0P R SAS^01"0!0\WPa(00P0S 0 Q*00G S 0S 0 p  0AUn0S"  ! [*@%X0 `v(  ABQ AA\ Q`E  `  0B>S500A S00P0 S 00 (00,Ѝ R `0S P\0[ $?0 ,4B0`0000ZDPޜ00{$H p@- M P0 `00jp @ !p < 40 0 1 30ލp@;  A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ}; l Q:/R/0S/S:00/@-\@3#* 0^ @R R R `(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R*00C#(00/C/A-@P`TP% UVT ᦗP @TP 0?Sp 00(00QSp@-`P@ zPP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP讛(00詛00꥛?00Q @-A?SSRB 0@S A芛00腛(00/-- M  ЍЍ/@-M@ $#p TЍR/0S0 \ S 0S0000/O-@P M ` <P-Yh +Ya Q0Yj T@ @Q [:psa`PpgP:pha`P" [)SQ" K0I P0aIQW0IAIQ70IS| V[SQ;+0S \0J0 0 ЍQ `Q0YXP  A@0L ^P @T@@0@-BR"^H M <000 Ѝ0@]@Pᥚ00TP Ѝ0 p@-BR"^p@J@Pᒚ0T0PpA-@p`P rMX0^pAtA0O0p`0 TA΀\`L PPp$08 @(0 0 1 30rߍM9L  0   M Ѝd  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ QPO-M@ \ 0S000!pR !01 `PP E`#3`7P*Q30A 0#1#2#4#8 P 0   Д U 0C  pS TP0 0@pQ 0S  ЍșT 0 @00Ѝ这 0 0A-@`Pp0 0@$0$ 0 M Ѝp TP(p@-0 000St@@@pdPddP@P@P 0000 0 x('0 p@-P@h p@A-@`P8ppp0php IT  ~0<0   A5 , @-@P0S  3/000S@Nx A-pP@`  @ }000@P p@-@PAPpp@@-@!1BMM 0`PF040@@@ @@ 8xqPpU h10S \!p0@  P8A0@ P< 1 0ࡄ!0 0 4 300BލЍP ߘ@P  4/P Q Q 0 0yp0 00P Ø0 0 徘 @V7  4%(@ p\H O-qQpMP B Ap@f a@0` RD 00])j1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00xQQx00p@@PЍPJЍ<0 0؃l  #ش"`"4"~ ~ 0@-0@P$M P P0L0 0 P $Ѝ0l! G-RPL 8104*0SA a q@`p #)/0@S-00儑 000S 0 000 00 x0 00 \0 00 @ G(00įD8(@A-耟p0S@P$0S!0`PP @0S PU @@P 0U00 {4@ 0@ P O-dM∀`XSRßQ 0 3000SYC@0S00 h0X#00T3 0  0 00P ZP3s003@0p0VQ QN  QI nP0S_ 3/0 0P U@@|RP00SJ`" 00C0T@dЍ8B,@@@$20\r 0,0SO  R10$   @$(00 L00LP 0S 0 <00@00<00sP 0 S@$0<S(  ( @0P 1S@iPQ 00C0@@00$   @$(0P< @$0S(  ( @0$  $(0| x<z 0y dy | y Tx Hw w w C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0P4 Q \O-ϟ |Mtϟp `0S㠐夀m  Yt 00 0S` %SP %0BUS[;)"@kK/(1 |y]F?a-= 0 t0 30|Ѝ  !O#d"@(,0 P$; - #"0-cR:-c2S=  PP 0 0C@aa0C0C Cr  \\@-N2?#c!!"N , hh ! `bQ,5:TbQL, !,#c!!2N 0  \0 S 0!Y%0`0S00 S `0  p`0 S00C  B1p;Q/0A!b0\P  }Y0`0S00 S 0  B1:Q/0A!b0\P  ]Y0`0S00 Y0 p`0Q0X: 00\P 9Y0`0S00 Y0 p` 0Q09 00\P Y0`0S00 Sah /0 b !Q P9Q00\P  Yi0`0S00b YB0Q08 00\P YQ0`0S00J Y*0 p`7`p0 v`,48 Q0 0\P  Y0`0S00 YQ / b !Q  '0 \P0  Y0`0S00 Y Q L'0 \P0  lY0`0S00 S Q &(0 \P0  RY0`0S00 SU+P#U'P Q h&0 \P0  1Y0`0S00 S 0Q06 00\P Y0`0S00 Sj0 400080 0<00\P@00D0000 0P0l% Yl0 `0S00d YD 0E0 S0ڜ0YT I` R  K S`GYD0$ `0S00; S00$2?2c 1 R11Aãd0Sâd0CS0c04\P 0Y0`0S00 Y 00  0  p00 S0R`050\P0p3 0qY0`0S00 Y(0 p`0\PS002 0MY0`0S00 YY0" `0S00 Yh0 p` 0S 0 @ 4qp  eqp  @Q 0! S! -Rm Sk|! x1Q > = 4= < L< ̩\<d7 l(nؔĔ$IQ|h2 < 0Sc0  Pf0P Y I S ` R  KP0`p `0 SF 1h Y0`0S00 Y0S6 1 Y0`0S00 S0S& !Y0`0S00 S 0  0UP !  Q"" " " 0' " S0 P$  VRN 0gS 0` p`gx0L!?$A1c P0 "?dN2c1 1 @1N0/"b!!Q1C  ã/ d0 S  á/d0CS0c003\P 0Y.0`0S00' S0|3Q00\P Y0`0S00 So }0P% `" `#a b/ \A-MP@`[0p40@00000 @pT `pGpFЍA"00Ѝ@-$$@M Ѝ C-pP`X@X@ M t@0@0  0 @  ЍԱ 4C-P`p@XX M S@0( 0  0p@  ЍP 4@-0N \0N@ T \ۏT00\ҏ00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-0a((Ÿ,Nl^3f*Sj Sq @R 0ϠTlQ@Ҍ 1C0o 1fcf Qq P@\ q00CⓇ?G1c0 0@100C L``S0B0S0BPDKHQ``@P QS@ 0S l lTà%A@002c2cPÌS S L l là l^#3S l là;\L l là^ʌ͌)\P*Qgfff$I, d, ף 0P /0S/ 0 S/0S/0S0@//O-M 00 S X$\P 8 J$/@"b0"b!Q8 UJp#.""O ` T*b!"b @A0SO0 0* b?/& R  " R00G#1? @?@Z R<@0p"#<@I`_`APP R?#"d ?&Q!Q00 37>0R'Z0S()@n \Z R SH*ȟX`` ԨԸ  v@@PPȟ$ȟ夘 ,J(q[.|xtȟ5 :lX\@`X$ ^, PΌ3# `_ 0RS@ xWEXPP  @E`E`ǟ)ǟG $ttH|t(ao[.`gl 11 :Hg8@ ß0D0pϠ'l ‚ b l C /B/`0`01>aG` 120S"&.2db`3ch@G@. c 0܄4#+:60 0($0(>! 0#‚!!!0C0"+a[oÏ(" ?00 #2>[?@G'PE@GPD2#"*" H2H0@r,W#10 ?015: 2 0 #"".2Q  3 #101`0T!2? B4sppp0/SX0 p c 0t!+:60 0($0(>! 0+Qd!_P!!!0C0@![Ï(" ?00 #2>PVXi`v c 0D &: 600*$0 *>!!!0C0V& )!"2 >n:E.€Q_uk9"mn< Sc$IųQ\(\ףp= ף\  Q(\)\( sc 0 8 +:60 0($0T (>!!!0Cl 0[+Q_("Y0%R^PP0 0 cQ @R0!V BqgqgXpC)1? c 00Ń0,!):60 0($0!(>X! 0‚!!!0C0x!YÏ1(" ?00 #2>r/D B 1?A1c 1c0R0B0$2@ 502c8"2c2A" "b1C S/  P008T2T!:#0 όR! UZ: 0"#2>"Q0030#0000T  @D0 S0  @ @$ 0ЍDv)1?c 0 020x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@]T 0 @-M0@P T 00t0(0Ѝ 00p0  O-`@PM 0S9  V 04? [P̂$PQ%  .   !0 P  0% R0 R !P  j00Ѝ0 S, 01P0% V 0? VP⇂R5. P P !.Q P V0% R0R!Y0h&P l6m&NS`@@0FSHkpP [ 0S10ƒ!0 hh "0Y001 OX10\1 001Y" <Y50 S0S >S@p3S*S0S -S0 C R0`@0F0H0N<)`h0hlpt ~|Ѝ*YY -Y00I S@0IS0   S ,S;SQHAL d ;S,Sc SiH^&- Q 019mPhj`019mo\` @KO@h6Pc^`L 9k bhp&tulg>@0 0N\hP\~00 @U~ @  P 1 0 0@1 00\P00P 0,Sd0,0P 0S   HILu& ah& `p&g.tl60 4`0 @ `ᴄğ@$(00p$cR0#030 1`002c2c# b?0ppcWZ  X  R `H 4$cR* $L%P 0 S 2J @`p 30@0 @0 `cQ0#031`002c2c3?0cQcs P`Q   Q0(38#AcQ*3301c00 `X00@00"0` 8p @@p`@D 40g 0Bl Sh0Ű1p` @ D~}8 ף)\(\{ 3P$A-PQ@F 0S00 01ɀN  phh6l6|`r`P 0:S jP `VpFPW N h|0PPT`V_pHPNLg@P`BoPpVA`P \wA-A`P@pP a|PPPW~PqpATX  P>UI QQ |1|!`0 t0 V00 m``@ v P =D0C0CS\@0d/@D  n@D0P0T0S00#  1PWPࣶ LN  h|U,h<P@P0P P0p0 000XH$ HquSt# t0@-@ 0 0!R !" " @-\F=<;:97310/.+,+)('%#" uqpo  #8qnR V@6VJ 0V & 0 aQ S  T c4ЍPPPP010 00C0B Q$RPMP00> x3 0S 0V`1!(  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S  pD 0V`1!ex$ 0S 0V`1!X V  x 0S] 0V`1!G +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py p p xp& qp jp cp"s R 0Vp0y  V@ `1 | x 0S 0V`1! | xm 0S 0pT  0V`1!u ; x 0S4 0V`1!f ; xX 0S  p/ T- Z* p# p$ p7 p#l x 0S 0V`1!(P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S ppx! 0S dp@ x 0S Vpz  0V`1!  x  0S Ape  0V`1! PZ X PU S PP ~N $pG PD rB P? m= P: h8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P @ p  P 4 p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S p  0V`1@! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S ,pP  0V`1!q PE sC P@ n> P; i9 P6 d4 P1 _/O-ϟ oMMƍH0@00\ !TR !0Ts0e0 ` 0S   R  00 \ D /ܐ  @(匐d 000@0h0X00PU @%U0T  ` J 0 R 00S0(U` P0`r$P0 0FZS~;:Ly]_ p%nWWN,VbsPdP    RZ00sV p=*X1rrOXOX.>TqCtˠn@qPF0D,\ TDTl(80<@P@dP@@0@ 0@00'@00Fp`A@00F S$V $@GPU"0T$0S( @0S @80倀0@0S0000XX **: 0 6 30 oލЍb0P00 P:0 0g  x S 0S0q-0r00S0 ` 0 00 @TS@@R00SB r0@ y, P L 8 4  V  0a P }r0, @P0L08040!$R    P R<  儠 `@VS 0000S0r00Q(1S 0010000S0G?0Q(Zx ,0@DT 0L,0p000S0bQD bP@@6 0 ($0 PCUz<0Q0(吰?0400S@@0S 0!00040S  x|0t00. p7| pR1|0P @x0P0CD0 :0P@0 $t0S-0r0|0s80 `0(0 01 + @)Pp DQ`h>0(00000S0p;000Qy( 0 00 `000000S0Q(|@T0D 00@00\ \0P00 D0pC(00 S R00@D,0,0@@0,0#@00NS `Vr0ڸ|p @ @ P@ , L@8@Q(r0^\0P00p  `s0\40 0<0K R  mRdp 00! , 0g 0@!000  0g @0SQ000GpBV*}p(Pp@ 0`FV \p Q 0 Q\0P00 }Y@1 Q 00 0 XC@ ? Q 00P? 0P0c@! Q 00 0 :LPPU\00/s` L ,0 4` 0(`PUSp4UPEI0CP QW ,LXX ڐP? X@@@TT80 0ጀ@JZ P@QJZ  @80L^@( [P㔰吰 Q 80[ P80 80[ P  80Qu sRh,V)ڌ@ `0/( P@PIY   R@ Q T[ P K[0P00b w8 10R+ S0bB- C S!!/΍L!CcS00 a000AB0LQ*npL0 h00Ch0h T r0, @@, @p , / P@L@8@~80 [ P 7 80H00 00 0 H0Q 00PQ  H0000H00@0Sr@#SH001HS-0`r0͵00 S30` 0QH0000  0H0Z0P00(r0g0 `, \ ` Q(00X @p@P L 4 , / s0\40<0 P0  \0=mPy_XL`P`,8<P#" . A S J$\ ,\0\`pEE ,\ S 00\00S0 080SP `0@w`00F S/@A@00A S$Q0S 10`aS0H01 000 H0S0\ 05p( 0SH0  H0 @c@-@`P MDpY@0p0 000@Y ЍP A-@P`pY0 0@YO- M4@P`p08Pjrc T ЍO@3 v0:ɳ` 0@|  0PL0ST 0S000p0t 9 P )Jpo  46OD5@DT 6 4>N0.0>X,.,>;`p.>N 0/`p 0P t 0XPJ@H0DZ0K=1 PgTD@80( 000D00@COo0B SP@ES0C00@0CS% =010x<, 0  0|ЍO;t@@C>0 SA. @0c 0c6"B0@DT06A0@00DS0d0800800Z80( 0C800jD00P 0P|Ѝ00C?o200P0J@00 40X <0$ H0t0S( Rʘ;$04 S00Ӣ?(01 ?` @Р $0X  \;`p 0P 0 0t 0`pP  0[`pPE0 0P P @Y0<040( 0X00S$00P 0 $0S00R  \ Q  RH  Skt0S(0Sʌ0<040SX0$00<00<0 ,00 |ЍOg< R T RpPC^0P6Pe0080P @PD 8 RQR00 BPE0A8 0DQ <0Sl X@P- `P) R`P" Z  <0R0P   0`S80`0800P00<0( R$8 01"B`C 80@"ET 7 `p@ 00 0 @0S d 7P$t7 ~$0`S uAo $0`0(0h0<0S7`01C 0  0r؄ p 0 f @0p`pp 0PhlHؠ`P X%  t6Z h6Sp`P 0<0P 0P`pP  0. 0P H PT8SY\0H0vb$( 5 ` uA 5 0P  1P! \0H0V 5(0@c01  0$B  0$` 0@`S 0 = 008 P 8  00UL0SS@0S$0S<0SZP p$ tPP  -00S0SU0S S P P W 0W9SpG 0P0 @}X$48 DP gP! ]`P '@P X0S|$080SSZPa 0$ 0C0$00040  ypP0 0S 0kPQP 40S0 RIWQQH R  R R S p PS <P9X 1tU TU m p@ P pg e 0U (0000C0-$0S ` P P 00 0(00(0100CT <`P <0R0P 001 ` ?aCoc?`(?yPD?'@ 8??@$@@0 ` 0<CP`00  0 0`p0P@ ( < 0{ 0P } 0PC! t0( 0R?0S\0H008P@<0_X  L1jP`p!$$0S 1[ P   P0 0  0 , Q0|Ѝ<0`d \ 0t0S h0 P(0 +Wp$0Z5 P\ U  @PT  PPM@PGl0W0SpG P @PP8   ! ]PP, P 0@DTk t9Y h0(0 0 040 P0(00d80@ P(0 0C (0P <0SPX0S$0000+0Q$0S X0S`0(00C h044  0 `4 0` uAW0S0Sz 9Xw p90 @0` P@h010(0H0S 0S SL  0Z `p PA P 9 P @X PP @W>0S 0007 Qڶ0Sd46S01::S0P000ZbQlHP#h0 PH(0 @$ P !(0 Ph0/&$zT P p0SB0T(0 0(010P0 @&$`00C0X07X0$0h0 P(0 @ p@B00C0 X0|9X[ W1  00S `1 CR0pC08000 1バ0C00C Zx 00L0C Z@Pl"H ^H  bH `@Px 0t0C0P0( 0000000 0-P 000s0PC@0P0P0Pe0 $!1 0 9P U%bk$ 1p0X@@"ᐡ\`#P#Z 0 _EpGPEPW@ 0#X@`0!:?C0CP465640V| 0 $p x0`pl P $#iP \ 1`pP` Z 0 x0@0 #$\* V瞯<48A??NX7P  B\,$0SI ,0 0R0 $060P0 "P z P@P`m@PP X0 0C BX0 ^\0$05 @1Z `pd!d1dxdP D\ 0# 0T$\R \ 1gPRaT`P  0>P  0($5P `p0x ,00$0S&0KS$0! $Pj $ 00C 0$ ( 0h0 R# 00S S SP 000 (0000 "AQ!*(Z000  0c230$0 S D0S 0P 0 _Z"0 00Q0000 @00NZ"0 0 `BpP 0p0C0I0$00 00 1Z"000( 0000 @a!00 0 x04#$\`m 00T0 00cT0  [0( 0 000KPF0 S0``IX00X0k  97Y `p,($#\0$0T0 000000 0(0~P0P00PCU0Ez,`Vq 7`FPz`p, X0吰0C0 DPi !| x| | r|Qʛ p8  &\ H 0[ 0P \0x0\00cx0 #H7R @ 0a0P04060P`$#@Y 5\ 0T#0 0 (0P [t 000(0 0Q00 N@S 0⊐SQЅP S@80\0800SQЅP8$ H 80 0C10 T 0#0 0 (0P= S`p,H$0#`Pa @00C1 P0 CnPe5P`y Ad90P00(0PoS!00`p,0Z` p P,b $0Sy 0 |{Q0r !P0 00C  0Z `p,V!0Y0$0X PR0oPZ P000  0C吰0$PI 0SK@ 0( 00 0S; 0`p, $000P00P00Y!08 0$00# [00S 0 UY 00P0`p, 3S 000 P  @1 @d@P000!00rX0P Sጐ !000Sg0SD00D0a0吰 0C0f@-00tSO-@ 0Q@P MPP`PV  0Lp@P  "(%(!( Z"8J@ Z3pIq WG N@ "8!8P0LL#8S 0Y 0  0 Ѝ @P   ! R ``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   V0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0pBO)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 O-M<0 2XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 0c 0Vp@ ! VT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0S& PX 0Sa P0 0UX 0p 0 Q U P  U UE^ PLU 0CC10B P0DSy`0 S0 S C U 0S S S 0 UP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S 000 0 b@0xU"00@C `P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf 0 S_ | &U@"00Ѝ@P0M@E  PL `K"V`pKW  J` 21p 7 ` PE~@QP!80Sj80S 000i U U E%P 80S800c8080S `XT0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5 ` 0 A-P@p`* P  0 P  0 PA-P@p`@ P  0 P  0 P0 00/ DA-@< RP`pn3 ^@ P 0 W@0 p0U0`PEPU 0 B P @` pV  0 B Pp0U`98C- M` p @P 0  B 0C2S P 0l Ѝ6cz@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ qS0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/L ĿA-@T0000Pb1 !0^2, l!p(  ^2,0D10C#10RA! @^ ^@DA0DC1T0R @@-P@M: Q @ 0 R Q @ЍQ0@-@ @^3#1^HP1.P2 L+@L+l0n0?O-1!0 M000000 !1 0 0 30WЍ`pD00@0P(@0  `a  O0< @( R  00     O| rR@P0TD00D0 0D00D00D0 0  000  H  <`1A-0@`T@p Tp P1 Tpp8#8S$Q-* q2 q: R 0X00SP ^T@X@@@  000COPX@ TppPZ@W@00?2  0aDA-P0 Q@`%; S V45S pV R00S D S0 Sp V pSp?0+ A-paPAU CQ R& BU50e0345@@ 0 QARAL^ R Q(0P&Q Q/.PU  sp A T/TA A Bu03>10^020B 0A-ˠ a LRCS0\8 \TO:|10@o\0 ^# QR=0b035PPA@DT3!#1^ !1. !2 A"LA^U /B R s၃p AT\ A Nr4̠ @@QPUP@E 0  @T@? 8G-@  \PP`p!! \Q 0S6C 0*4>70 0S6C * Q 3 "\  \Q4>7 0$>' 0G- PXl X` PC Xa`  P)2Q>8 qD ?qV   0@)pY00 S X Y  0  $Šˌ '5  ?@pY 0 X``@pWuVVA Ϡ? pAAG pa2GA n2.! N3! 3>a D O-T M0! # Htd{Ġk[ @R) X# ZHM R?[` k? 2 B0 `b>6> 2 0k 0K55[@Œ P 0S 0 ЍOE = Ѝ Z* XJB0  ?{D? ; K2 k404(; 0h# 0H<#@<Ƞ@ X X+0P QP 0`Ġb ЍOP  Œ  0ŒJ Q0 002 0O-r M0!J# DŠUe [Š"kX LTW T@ ^ 0$:[ 0x:820Ao ЍTL Y= ?Xb h? 2 B1 b>0>2 0h 0H<<Ƞ[ 0S   RP3P#(1R$1 ",!P2PP E!E2D5 ЍOY 0A ЍT PŠQ. ЍO% T! @I?x'?8 H2 h;1;$8 0d# 0D:#: @  @ ^ " 0 0@  40P/P / /BR30!#11S041 #<120A#ac/8/ P/R30!#11SP41#<120A#aK$00 0A#aA..P Ϡ`P03 !0##1RH$1",!020 C  0c0C>b0//P.P P03 !0##1RD$1",!020 C cA.c00 //-p@-K@T0TUoJP& V @DOoUB@T p~T03@d0 D  000V`p@  000ppl@-@;0SM S^ #  0$", !0 C0c. =Ѝ^ h <$;S 4#6>Ѝ(R03:045S h,?S/ | ?S/  s;p@-!0@S. ) T SP\M M P03K:00a `00Cà0cT'R: QP3:PR 0* p\0D?oR20S p@P!PPE%Peà$!P0  Ap@CBCR @pp 0+X*;!0A-ˠ_S  _% \ \ RP0V _R^\RF AGA!@L,lS^ Q03:00!00C0c @C0$aqW` }@~@G? 7\S00 AQ3:,)(;0S ;0S P /45S 0 ;S l0l !;S /45SP/P @-Q ;0S ;0S ?S/P 3# /R /45S @-45S /;0S ;0S ?S/P 3# /R /45S @-45S /p@- !!:S$&O3S%C>c0&0T @c PC22 Q pQ{pa1^ Qp|  000pPS X  000p0C?oP20SVT0@-0!*P M!: %+ %U  C!A Ѝ0@ O Ѝ09P :#:S % Ѝ04>70 -Ϡ M\Ϡ Z Ѝ Ѝ-Ϡ M\Ϡ ЍJ ЍC-M! P D$&F#z o \ @po& W \" Ѝ@U  Go R \B  ЍC0 W 0 0 p@ E%J +ህA!p p0#0 0P# 0S 0AAAЍCPOP 0ЍO-D!j,MF#_Vp `@$_% Y Y  0pOp \83  ,Ѝ@Yt ,ЍO1  0 #V 0 0 `@E%(K$ @0刅ᤊ E `F 0R0O:p0?/000嫰 0 E` 0 *) r\ Qc0S0QY0 P^ 3#P0 Y`F PP0 #0#* 0E 0Q0`,ЍO(1,Ѝ R0 #000!*R0p#!`!*iÎ!)`#Z Q p#pQpQ[ ` R0 \3#`   ! # QP!   00 / ɠ@- ʠ,ʠ\ l!Q  QP/> X4>70@-! # Ϡ\Q^ ^0030# P  00  + @-! # Ϡ\QP P03# ^   00   A-$a$1`pP0MS3 U10AT !0S 000& @T 0 0S00 0Ѝ@0!0D1S<000S 000 xldF 0p@-@P0p R pPQ`00App@D `80 0QApp@ԗ xDl 0  0#10/ P30 R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P:pP   ! D`}P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  H  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1 zPP4 @p PU `@00SaPP# 000S 00PU 0C  pPph0iV0S <0 ,0R0i ܓ \xq lG-P0R@T`塢ڃ0TP$ Zp  !pG0   a!  \2)0L0C\0003R @@GpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @ 00S 3 #V0`F`F` 02NS @0@PpP 0 0Q@3A! p@-@ AP`DC0 P `R C*\0 `l3DR<* 26p S0pR4 c5 # 502,13p0 p?C-@ MP`p7P Đ%T@ 0Y0   CII5` Ѝ P `!300S   Y0 C@@1`0S0/0 R /@-414QPP@M5m`P3 _pP-0S  Q- p 0: S&DP  8#800@ |0$  t0,  l0( 0 0ЍF00Ѝ<0F00FO00 < Lbp@-@700CS00 P7pP  BR  /p@-0rSL wS aSOP lF 0 pLP0S! e C+S ^R)# P0SPPp0KS0LS0DS0ES@P0p@-S4 @M7 P00P! !& 0S 3/PP೼000P @ P q00 `k00aa27@0`` 0p]4PE 0P000@-!@R !P 0C 0 0 S /4p@-Q1P0@0S3 0 LJ 4000S8 0"$0 3/0P:0,p00P @ P 00< R 800p{C0PPGIK4P 00M5  0@000 poE 0 @00` @-Ѝ/p@-@P@TS S S SE 0 pH0p@@,0p@d0p@C6@000 0 0000/<P 0p/@-%E/41S{ O- @fQM  Q 5/p <`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`4#pf APpM_ĀmZQ 0phPUQ 0phPJQ 0phP@ Q 0phP6Q 0phP,Q 0phP"Q 0phPPQ 0p{hP YQߍ/COCp,qaQ@-P @41S  P bP0|CA-4!@ pPP/1S 0L1 @P!<PPPUQPMoPP Qp W ?Cp_oR:Cp7Cpp@-@P 0@@A-@`YP] VapPLPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V B0@BB@SSC-`p@ M. Sr$QU$( P 0PN VV0( R{⁐Q 0(Q^ 0& P  Ѝ0Co$!? R (aБ P^Y P 0RX%Ƞ\XRI0C p(q !$ P$$(  Y 0( ^ \ :0  P8B00,1  Q$-(y( (R!  Q (剐0$ 1 ($!o`0 `mPp Rl$|O-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 ``PM 0@SP㲀1UJ[K ,Ѝ 0 7lPPu/  $`wlPB 0 $ 6`P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ 0L `PP  6eP 0 hPp@@,Ѝ$`  0KlP   eP(q@GT 1S(Q0 @-@ ! \ @,)A 0 ,1"A0S@-@0@ A00,1R@-@1  @0A ,!@0 0O-`Й0S ]MH pPw@P Uq  @| @P 0 p <* 4ɟ4 00 84  Do@@ k@PXP V P0 S40R !Q!3^ thȟ ^ ^@43= P3p D H 0$p eP8ɠ3 LJ<,0( pQ>PVNP -P  0)p pt 0} Vp 0Sm A/ 1 *4+ )4p+́* (4) (<' 0<' .4 .<0 4< <0 4< 0#<  <$ 0 4< $( 4< (, 4< 00,#<0 <400 44< <840 4< 8<0#<< < <08 8 8Ġ  4   4| pp $ <  x0$0 (p , ( 4$,0p ,(048 < 4x0080 < |@ <4, 8p | < , <00@)Ġ| )  p' pJ0  | S!tpH (( x 岠*LL,| , S[,CC r A[X3pWTA^P  8/@ PH( vPD 1DpN8ɠ0  !N[V QU0 aPP$4Q$Py 2ŸrR@B  ` `]ߍOPiN>P| 0>p 0 pp>P>Qi>pW/ <*  8004 D^>@ Z>> pX ژ>00>@P>P>P0a{>@>@t XahnHdO-(P`P10p5fS@(Pp6 R ؑ唼P. ( ,0[ D`D` S`1 005,`5Oeꂡ RP ر " J= ᝽ؑ@-@ 13/, (Q0@-@Q |+00 2 > 0 O-霆MS`p & 0 Z0 P U E Q[ [ R Y  YYY  =00 Ѝ P 5%0  0 @P 0 10$!12ѺP- 0@S0 200X5V00L500D50 0<50 04500,500$5000 S S =00P p  20 2 80Pp` 0 0`UP U\3UX# 2Z 00 20120QSpE  000 E9@ P0!03w/\ 009 0)P0 "  *P 1S0S1S *0 29 20 29 20S 28 2BR1S " , |P}P r R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480 < (0480<,0 4480 <*$,00 4*,80 < 40R$0SO(P0X0 0TXS 00; Ii0$ U"* 0S @0C/[00 P0: S 5200 R I R+2?00A@V# 4- 㐸p!20S X  \0 RK [ P200W ѹp йP 1@oy; G: R Q0P:Q0Q:,@-@-@@ $ @ p@-@\PY#d.`SP$ p@臹@ 0 0@-@T M 000 @兲P 0S  Ѝ,O-@0lMdP X0o, d8i,dp *0 S00 $0U EX 00 000CSxutsrqonmlkji71a V0 03 000XQ( 0L5A 0 @8D @<86/ Y``10 0,Q1$0C00!0ğ B 1 ! 0C B 8 #(!!#Ȉ0 000Sc  0S  2 0pPK  뼁[K P p,\1#0C00010C08#8S 0C8#80S 10C08 @ #8  S  0C8#80\ 0 000S  P p  LЍ! B("8 1V10 ]"     n 0,0i  4#4 P 0 0 0RX2 @ 00 K , G"ȀB p C !X *("( B∀H 0 1010 0 0 rp3`"h      20 Up00S7 l 0 0` =P0 p00VG- `P'@PN `V8 2 > 0 `(  pW' Q0: R   4P9 `10C08#80C 0 P0 0RpW 0 10C08#8R p W0 R  p 0R  P ` nC-@P`Qp$M a00 WW 07J  (0pGW][:YX6U0GS'00$Ѝ(0}W% ,0u110C0 8#8CS  (101ⴀ  P,0p1! B ("(R  1p  jP弁pP 0 00 P(0r00㸁(0p= `P] 2 [00$Ѝ0S 0S  0X~弁  0po 0S !0!0  P^ W? !W< W(0#XQWR p W!  PC H⨀H(弁W  q1긁0(0弁{g& b⼁n(01ḁ0C08#8(XW% p HW  PH(꼁,0WSDq X0G 1, P꼁,p 1ᴀX0C08(#8X!弁 X0H 1 P1崀ሀ!0  1 nP pp q0C 0( j각 0H⨀H(a0!1 p崀  EPp@-@`PP ǥ0 00(0`00Q(0pO-@pM,0 01 !PD a`F`h&hV2 P`X%XV! @H$H @ 0F8P h 00!01@0 @w 0U @EH$H 00@ 0 Ѝ "  U ! B ("(RQl0 0P Q P !@ B  B  2 PP  2 a0S0 > %a 0R P0F 1P @VT @D!H$H@U `E!`@1 0P  pPF A1@D@@DH$H VP@!  XP `  ἀ@P7   㼁0S0 2 a1 X0C00CRK 뼁0@S& 0H 1'P[ " PVQPO Z PA F`  A ` @Dt  1 01`01z P   ("( R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P , @ (m$ 0"4O-@2,M0\00$0(P 00$` 0p@ @` pP 0 0u$1` !0`!%g#"," !00 &Z0e!e!   0 t10\0 0` pP 0 1 cIC$A$ 00#l! !00 %b !b  A@YIH$*E$00@0000000 00 0 0 00 000 000 00,Ѝ̊C-@PP M' $q`?pW($7 )#0(0 `6`p` b8"#4b4# 0 V@h # Ѝ 08R(@R )p@ bz#8 s#)p8 bm# 0A-1?`@Pp @f(X( P 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW (j 0$ q0 0$ ?W@`G?`@`(`@ W 0$ <@P U 0$ `R @-/ L@-@P 0 6@ (" 0"tR @-/ /@-@P 4@  P" 0$$O-B@6\M0^~?@0P0D00H 0 0p00$00000000(0 0,0000(040,0800<040P0H`8L 0 @(00 @,0 0P$0 `0Pp`p000 D00h$7$)'90#%ɠ%'nj) "ˠČ 0#ˠČ<0 "(0   (&Ϡ' .,80  * $ )'& )80冼0姳 . 0<0 0 0 $0 ,  04 +  !@0 S(00,0403`0~?00L`Hp@P@`       @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&8P[T "PP< !Q` PPqQP0yQ@^vp'Q禉0Q4PQႆ^P%"#-&S%a` " P08{t`p' 0 0 <0#0.0` `!4`0( PP0, !NP/*! B@$*n /!!bp`&,#@$`& '@.p p " @.$@0`@`0P$ PY0p(,[ P@`@@0@ 0 00 0 0 0000 000 0000 00 00 0$0(0$ 0(0,000,0008 400 40<0 08 <0\Ѝ贅,p@-@@DQPUP`  0pRPQp b(!o Q#!0P0H S@ Op@<R Q b!2p !@0A-1`@Pp fPX; -@0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D q0 #@0D H0L 0 H0L W`G``P` @0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6 PH8I `p `@ U e Ѝ@-@P 4@  PV 0$${R @-D/mG-@PM  PH( `p `@h U , Ѝ0 ` a!, a c,/0@-<PM0AP@;P񏐽mdm<840PLHD@<84|xtplh|xtp<84JIzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEm[6Pv  6Py 0P9@0Ġ 0P%0H 屠p Hߍ?CP 0P 0!@ 0\ߍ0= @2S, DP(~00  j 0Ϡ@P000H Afp h0@ P000H AUp D; ? 0 0!@0H <p HP ߍ 0d 0 F0y@0Ġ 0 P`@0ĠSH@0Ġ 0d 0a 0^ 0[ 0 0 0 0O 0L 0I 0F 0C E0 D0 C0HѦP* EH˦P$ ? 0+ G04@0Ġ 0 0y 0v 0s 0p 0m +0j *0g )0d (0a &0 %0[`Rp a@ U 0O 0P@0Ġ8@0Ġb @0Ġ@0Ġ B0- 00P@ P0H Aa0pH0 <0 ,0p@0ĠX@0Ġ i80|LlJ$J,O-P 1` ȁ1!004 4PU 08  R88P@PX`0 A@ E0 801248 Q!:0 S 808P.P8іP 8 ` 0圚`P 80008PP8l00`gꑸ@  8 O-ɟ M@pD,\($ 0 PU 0H"4S3S1`90U 4000Hh00 P.00e d0R 0h@00S d0P01 0CX 0 -?01HB000 Zp90 pS000S0!Q0:X Y 0c/d0P0c/K0  00S 0 Yp 0 SRPU 00$ R 00"00'p7 0 2 30ߍH2SL708 R4003 4P0P\ R400P4`400刀@ 0  跙p 0`U:` 86(0_Vࠓࠃ6048 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q &P`00S 0 SRPU J00$0Sr00t8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R+c/w0 0( Y2 0 SRd@T 00$0S ,0S  !$0(0S (0@TP $ ] P 0 SR@T 00$0S?00 ZY0 0c/d0,0 p 8Q 0 SRPU 00$0S00c/dp x@ X P2 `0 R(SYPR`WY`P2 08@04tRP?P0 S (0( PC_oXRPU``  0S0S\40 40 8 \R8 \P0` @ v` 0 SR@T` h=00[@ @ h M`o(0P`2 ` ;8@P@,@ bY$0S@00B 0X0 0 SRPU 00$0S/@ h @ a l  d ă ` ~ ~ A-`PpX@M@`@K000,0 0(000i0@<Ѝ@| @- A0@ @ €1Mp@-P@Q 0P ! "0 2pp@p@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@D0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ C  /O-0,M "!  P  c 0pS PV `0@"P`@ (PP '  ;/P ;/PbW0 0P``V0c   F BR R  L B@ER !R6 0T0TG SX:P0C 0 0 0p0pSpP0@ᐨ(T **p@Pc`Z* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  `;/ 0P 0D  P@V. ;/PW W  00R0 0 R0T 0f:W  000@D`W 0XW   S W0 0 00   R0 0 S*T W  RW 0 P  WF  P  B B@ER !R AI;/P  ;/PN `P0  0;/P  ;/P0F $0;/P ;/Pڅ00DP 0;/P d;/P ;/PPWAD S  ;/P`  R0 RP=0 C 0N[P1 0 C "! R  B B@ER !R A"! Rw 00ST;/P?P ;/P8;/P~ $;/P$`v ;/Pa ;/P Y ;/P0 0P $;/P`X 0 R0`P-0 M0 Ѝ`R Q0P:Q0Q:ו@- C- 4PS@ M  $3/`t  0 QP` 4P4S  $3/000 Ѝ00A- 4dpV:@T@T 0P0S  00 S  0@P0`0dp@ B ! A-`M pማ@P0: StǑPP ˅P@ P 0 !tdЍx00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0@ؾ , 0SL@-  00AS 0叒O-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ $ 0  { QP 1$R P0)|00@000dS0  pq0Vp 0  $6/Ѝ 0000O000Q 0A00/0@-S@  R   0 0Sp@-@PT @T 0 `pp@TߘP`p  0S S/P/$(0#   @// / ////@-P0S`@M:Q !S@Ѝ0 0pI P G@FЍT 0 @00O-0S( P% 0S" p@p" a,0T T 1 !3/PS00CS@D0 T,0@p2P ?0T` BB \|  i V`! 0 0C00`@000CS0 0T` @pQQ   D R !,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ,03/`PY M 00CS@D0 T@0Tp  P@0S*V* 6 000vP@DS*`A 0`V:Ə0P 00``F0 ``i  0Y0C00 00KP   00C000Z`  0005P s00r 00n0% p@-`PV 0@0@DT`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 0 Pp 0P0, @z qPtph R0  R/ S/@-0 00@0S 0  R 0   0 0c0   0R0I_0 P @P ؏0 0 $0 蜳 @@-@`p`pPM   >P0:*C/o" R  S L D0( 0R Ѝ ; 0 Ѝ;0ꔲ C-#3 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0p0S `0Py X"X ` 0R00p KP0 0S!$`@ ޒPc 1 0FB0/Q/M-,+*)C'&%$#"! C- ##`00  00t 0SP p 0b `` ` 00 `4hPaر  Lp@-@0MPᝏ00Ta埐V( Ⱀ0T1S O0T1S墐0`劐 00UTX!\!R Ѝp@x\!㏐00Ѝp@o00UX\! X\!0 000S/갭 xp@-0 00PUp@0M00TQOU0` TQUP ApX1P0X1>0T0`X1ꀭ xh0h 000S/@-@0&0X10CSX1 @T1Oz0@ x0 000S/gh x0 000S/p@-P@0U0 \AQ\ X10CSX1 p@`0T1OF0p@@ x-X X0 04M 0,008 00 0 ,0 304Ѝ{딫 l  nt,@O-MHP@0@Q0@0BU PR"S0`8 R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@gR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@8Q `T ` R\ ! 㲑R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/p@-T!T1 @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@곧p  ! X O-p`M@P-TP0 +Tp S0T W  p S  0/j  0 ?0 0 0   P p P=Q PS \4 !Ȏ\ @00D ^a0DSW0DA0DS.70D S+| Y[Q PS \!S@` ("00!"00 0S \0F0 0 ЍS@ `?0t0T0i XR A B0A PR W  p\ ppX @p` QWKppK0@-BR"^L M @000 Ѝ0@@P00TP Ѝ0褐 p@-BR"^p@ @P0T0Pp@- M@P`0 pUT 0S*0P  @p Ѝ @@vp Ѝ$S T@p~@@-0M @ : 㲍4P < 00 0 0 30ЍN4  80 S( 0 / h 0 S 0,/ 00T<0 S, 0 /00  0 S 0,/ 00<0 S, 0  /00(|T 0 S 0, / 000k<<0 S, 0 /00<YȌ 0 S 0,/ 00DH<0 S, 0 /00P6< h0 S 0,/ 00X%$<0 S, 0 /00d갋 0 S 0,/ 00l<0 S, 0 /00x$ P0 S 0,/ 00 <0 S, 0  /00ꘊ 0 S 0, / 00<0 S, 0 /00 80 S 0, / 00<0 S, 0 @/00ꀉ 0 S 0,@/ 00vh<0 S, 0 /00d  0 S 0,/ 00S<0 S, 0  /00Ah 0 S 0, / 000P80 S( 0 /00܇ $ 0 S 0,/ 0080 S( 0 /00BX T0 S 0,/ 00H @/ /H-Mh 0ЍH-M 0ЍA-`p@P0 8#@T0P@@-M/"O R ?#0!PO$: P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A -- M0 09 ЍЍ/0@-0M 0 0000@>S@P  !0#00  P0ЍZ000 @-0M 0 000@>S@ "0!,03,0  dP0Ѝ700@-@,@,p@- MP 0 0000`@`0@PP  BP< (0 0 0 30 Ѝp؁ < X G-QP@ ` S V 2" RpSR Pa 0Cj /o?o BR00 b8VS& ?o/o0CSpp0 c08ϠT \  Q0SpᢏVP00B V0 0T0d0?oc008?o/o Brp!0 S c10pV Veo0`08 @c0q< Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /o 0@-@$P  000dw\- /-$0$0 0M 0ӊЍ|  RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/  //s R RS0  0/U/00 0/ R S  Q  R  /SR  Q 0/0 U0/0 0/0/R  -/@-\0 @@0Q00R S 0Q00S0 0/0 0/0 // Q#/-Q S  BPQ P0C SP PU0-Q S Q P 0S 00P 0@-M | @!00qq00k m4 ,0 0 0 30ЍNs r 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/,q x@-@p@-0@ ,ppP^0Pp//////! //O-㼱` Pp U4M s i1 00( 06/4Ѝ0 S@' (!S0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUl00 \00 S00000@ P//O-˟ MQ0 ; 00$0 0%SSSJ 0@p` 0FZSZeXW_UTSRQPTM[J;}|{zyxwvu?>=<;:9876s43210/.-,+)('&%u#"A  TO V V @ 0,`,P@X  6 Q ZK:  Qc ^ Z034S0C\ [0Մ0ʄ R*f @HT@Db [ 00ʄ@T*\00F`00F Sbp   0Ϡ0 0Sp0-p 0000t& 0ST{00@ P T @Q0N @X  Z*  QHQA [0ʄQ*p03,-  t QT{@ P0X08h`p`|0PU t0Q  _ P0~  BT@0d DG` px`0$ p 0t 0ST{00@ P|` D 0 0 000`lV` pp`{@ 0,P,`p`@p+``pQ ` `*VS 00F S@`A@00F S`500< 00 0 0pt{SN P 00  , 0e 0N D L$ Z  04F HP@ 0 [ 00ʄP* 0Q [  [  0[`ʅP.10e0PQ 0 0LN EP D L P00(: ` c & BP Pß|c &h `dX0Pc* ` PCN0C D Ly S 0 000  0 X  0000V h 000 0 k< 0 0u0 Z0J0H",2 0 0 30|Ѝ0 0 /    V@0` @10000 y ; 0 @  7    @ 0 0 QPv00d D00!@ Ϡ 0@ @@0(0"(;0000 0 @ Ϡ 00`@0O0INT0 0 r8n 8̈d @cA-`T0T 0pP@PU J0PES 8/`uX@pW b | 0SS S 0R / 0R0@o/ @- oO-,,@ CM Mp4čP`0@  0 @0 44 30,Cލ Ѝ 00 00p0 `0p2P m}t 0h pL+  }  0}/ꯚ4a ` ` ,l,@G-0pS+ S'QU$ X!`@0`S  0P 0#S@0S 0S0S0S%  P V Q@0 R!R  "R0 R R \O- BMM!dQčHd2 hԀ&h Pp 0`V' 0  YP@P ULZIZ0 ZP~:PH <0 0 4 30BލЍ^ ] O-LL AM @ MTč4 0Y/:0`x0(SP05 R%S3 #ttx0'x 0@T YY0  P pW t   0FYPP D0 0 4 30Aލ Ѝ x (R궙t] l\ O-M Mϟt p / 0 P @T 1S 6 S`1  0 ?t@X@0 X0 p tA @0H0 ^0S3 S90PpP@u` R HP' p 0 ] 0zP R!R㇓ 2P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  P @0P P  4 <0 @4 D 0 T<0D \@0S  H0SQ <002p0^ S00H00SS *pt`P|@600P @9/P"8`0 0PF 0  Ps |+: 0 6 30hݍ ЍpW 4@P{D0Ppw} !D0Pp0 e  0 : X0T D0pd4000S70X08<0PS\0S  |P@U  0`F0P?$P 0,0 蘰 P(0 0E0, dP [0.(  QO `1  0 T90 X0L@0 Y  @00@01$0 0 0 SO@0b0!0\p?A9c!.P 0S @0P Lz0T(0@' |  ,@0P@01 Q!  (8 0 {P0`1  0 70TX0 @00 00x  1 01 0@0`1  0 (70X0 @0r0 M 00 X6PW0&0< p X8|LP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 p5H@X0 0@0! j~P0D p@0P ry0$0@$ {  (0d00@0\y0$0@L$L {0 AQR `1S9 0   0@ H0@@`Tiʋ |@ A`!!! Q=   30 @| X0Q 40H RC A aV *Pv|@0p t@p6/P񏐦]0+S .0CSV@T0POPPU a0 2@X0 0`!02 @HX({i S0\01S< 3`0`00S S8P1< a`0 ~P 00 `}P101@PD  &VhP p ` 1}0P\`0P 0D TP B("(R D0DI =}P0d0P0@@ d06SF[D [ [ hg hdV cCa``_^H^`]]]\[WWWpWVWXV$V4V(UU,UTSSHSPSS0SR,8R@R 0U6pSZ06H`("( DP TP B("(R D0D |Pj0d0g@e0P w0 0@$!$ JzVW0 0R 0`1 d 0 L1t0XP0 &0R  Rw0!0@! z 0 P 0 1 X@ 0&0 R  d \H0S] =00^w0T"0t"t y4& G("( 0R00 P T B("(R D  R,#N|Pʌ 0 ]0@ 0}P`P 1011S100 0 30 X0z,<0d0d000 3@X@0" j&0 R  Q$0 4 X0 Y00g0d0@0P w0X$0@$ eym0d0j  `0 ^`0+S .0CSBY@W0P v0$0@%  M<> )MLO-嬡 AMM  čRzpPLpPG `vPPB t @+0?P7 0S4 `  0S+ 00@ p'2P00@S 0S0S 00@ @K @ ~t @猬 ሬD ,0 0 4 30AލЍ蘑d= H= hL ; O-ß CMM`,č@pPX\@Q0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $IQ000$0D DR @@ 0S+ .S& 0P0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S PV0 gO0  Pꘐ; : O-p0Ÿ\M P@`&T V 9 0 D#à  #4 : 44U@ 0U 0 \Ѝ10>  0 tVX0 0 0 FOP0x 'xnPkP0SUPPH   B RX00 0 BOP PPMPNPGP @ຠ\Ѝ0 `F 0S0   7P 3P 4P0 +P0S 0  @<0\Ѝ7 HEG-@0`P p)@D T@-)P0W O0`  O O "440(",40@$  CCG-@P p崒b E0S@P0WU! O@OP ,uEG OEs B(0`( "4`43Z1S//O-0P䡐 M0S5 @@d@t@`p S S0  P&  P0 |PI  uP00^ + 0  SR 0  SRS ЍWPd1 00d1 HsGP0 xs  =P  6P060 (P0 Ys P  P090\ As000<:si0:0  P  P090090| P010r  P020h  0P0Z^ d@ ?R? # Vq 0 2M$ 0P0ZC @e ?R? # ;q 0 (32 P+ @ P010  P010BBB#|BAAAh"$A!@A@D@@@! L@ ??t?T?@-@HMMwx7w% |Ô0`p 8   0  xa 08wxHЍЀtp@-AMT v 0P0 ``00 0w 0 0Ѝp@@؎@- 0 Q0|MU0t00& v 0p`0# @0  @ 80 0 t0 30|ЍPPꯍ, D, A-@P2u 1!01n0SPpuOPp !up0Sp@-Q@U x3s|p m01P m01000pucvVxtP //)P //;A-`p@0.V0PVSQ@ PQP  + '0 0O-P*: 0MM050:@007M0RT 0 3k01)0`,4 05@ d!A  d!. 0`111102lPx  J0@ʏy p d10 d1~ P  `@ o`0D@SH _H S`\  S S00 Q`@0S SP C0SQ0 0CQS000008qP PP@0 0+ 0~:P 1#S;S 0x(S 0l(Sw 0`(S: 0T(S 0H(S <8R0sS2 S S(  8R2 S S0S0 S S SS@@ ` `0o_AP`@Q"0A'A+S? d7R2 S S00 R00S @0 S S00 0S S 50  00H00@06w 0, 0KPj< Rf0P 0< 0R@p0}@PP0d!S 0 0 2d1 1 AZs0 |3崦1 |tpA τ0`0S V `0`SH@DH` .S`0SV Pp.O`FV00W0S 0 0P $ )0$00p4 0 5 30܍Ѝ4 RB T T Z|44P00$0l40p000Pp(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0P  @0劁 $h1P @@T;T P3P0 0000@@T;T   P @ Zl@(`,0p4Pt 2R2 S S0Si0 S S SS@@_  ``m _AP@`0D`SH  \R?* S S00 Q`0S00`069O;P.dP `n1=C` lDQ XaD@`oQ<0 SQP@* P  @0劁h1P0- qA`>`Pa 02 Jq* ) ('99 domasearnamesortoption`8in@$er6<X 55# listԷch$1<11!1 p@-P@hlHM QP  T 000HЍpp Qx#r c8sV p 0xP00>sPT $000HЍpdtA-p RP@`0P  R P  @R0P\ R 0  0 O-h4h0QM n0P0 pg0P0 0@P($    ?`P{ ?lPY 0& SQ 0 - 0 !#Y㌰pG 0P ` `P lP0`S Y 0@000S R# pGPd @0Z* @ $0  T Q A PT pG #Y /[4 0 iR00pQߍ @ $0P PEQ*$P0 0 0  PY a 0p S : PC U 0 :` PE0IⴰR 0 ` VPE$` R PE` T$ (  0 PE a T ` Z  0  P嶣 0 0 >i 0 8ix壣 0 r @-<0< 0@P @M7 0 0m0 X @-$0$ 0@P~00 00/ @-@P @'700m @-@P]000@- @P  0 p@-@@000M   mmPP0 ]P ?>P,  0 Ѝp$Ѝp  0 Ѝp0 @-d1d0\!\Q Pp 0 RpGS` M, `5Qp5 Ѝ A@jP! 0jP 0S@ R jP@  0 `j Ѝ|| | 0 j ЍXX X 0 `j  D xw('&&x&&\&0A-0PU" 0U"0PUP!q@@``FMgP $EgP 0!E`1$(`P 02~P|v''Dv O-Ff@0`S M, 0 4 & $0( |V|FP@RB 1ȖqYT0i(1<0 BRQ#)16:  50(< ܅ 1 c0Aş0 p('(p4 < P 0(0 Pz hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 ,00,000Sğ0( 0 0X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LiP0440^# (0p Ѝ! qQ 0Q*# 0$|3p040(P8p!@(%01Rx$#30<!^ ^ ഇrp S:p 0("< !0(0% P^4+|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10(0 R 00! 0t1t00`10Op (4p Ѝ:p N5p 0q^$nqp2  Z 00K hu xu,uttH4tܦ tsss#hs rrrdrؤrq4hq  PH1H0?:Q@ Q$10 p?  960@`@0O-i @,hآggfffflfb<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH OP (0$( p 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p $ ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p{ 2P 00 Ѝ  Ѝv00PO-1PSM0:00 X1*q`I`[ 彘p@ p W 0 P tZ 2< 2ЍЍ]P O-MXr=*`00A̱P儘pP W [K D]@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 9 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR v0  PpX U"B Ѝ 2< 2 Ѝ6]P"! ЍG-pZ RbM'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-邀഑@ 0`P? pp Ip(1"(R B!81. !0` \ 01V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0P08#80\2N0C2Vpp@- @UP ` PP  mpPp@-P`@Q _00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M $00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  c0P 4Ѝp$  0qp 0 іP 2: 24Ѝ?p`(0 0,9/P 0  0 \pP   00(!S$! 10$1P0 \P @p0弐ᲀ 0p 0 S 10 B\x ἐ;'xP  $1 0$1(!00O- @T @0`0CS0P@D p M!P S RP' 0 0  dP 8#8R0 Ǹ Ѝ0 0S0P 0 0PA000@- M@ P p10 Ѝ0O-M 0`p  0@HPpJ  P6 D0@X0 $⸰†Ạ ะ + Rἰഠ B0 `p0`000SD0XЍ 0  wP  C("(0C 0@0 0MP @G-plŸw?`0 (MR$@l2 S:0JS P Pp2 S *p 3 P ZPpA Z1C PJ: A  W#: 0C8#p#ȅϷ 20  2 0 0 $0 300(Ѝ00C @ ష1px'x 8p 000   ` 00 p匨P202r  A-@pPQ`M s00 2   Q `:1Qj0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝ00Ѝ0PU Q:(0 $P0PU`POP  0 QP 21 sQ@--M0  @ Xh hP 0PSP000S 3/ X;Zl 8 80 $0Q/ $0S/k $ p@[<<0 0R/$ 0S/8k Թ xZA-@T 0Sip`/XP0P@Q0@ @@U;P 0A/PX **ؿ%O-@$M`zRT [pܴ4$$0Rab    IXpVBP b0@SFSCp^ _ _^^ _ _ _ _ _^ _^ _ _ _ _^^^^ 463 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$S] `3$pd `jU$Ѝ $  ( ,  C # PU! Pp "P\U@P5 ` R PxB `  p  BR LpPG Q]($R0 U tWS UX,$R$ ^ip4 Iip0 W$RD $pR $R !T&@ $R $kip P$R& U Q R  T$T&@ @ $a5  ` &@ T `   ᬊp Up$R UM0ip -,ip P  ^"ip U?@ Pzwh^*J,%%S3t,%,ؿ%(%Z%݀Ox?[,V,O-@`MpPxEQ뤳3#@ @>Xp#x3B RP!GP P( hf@(hPF  H@ P`d0c0c0ctd0c0c0cc0cc`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @^` `Z`r`T =yPP   `Pd 0)ȱ0V!Xq``pWpP @ 0% B R|eeefeHf(fee(fetftf 0S U X x0S X  R 7/ P  R ?4$ VQ  $ MQ  ZP0S PX =Q*%,t,%,d-?-P.-H-O-PyM`wCP0p I 00 00 Yp8 PEU( 0Ra S 00 0 㙐vPePRP&GPʠjf0@ShgghgghggghghggghH0@ SDhgggXhglhgthghaP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSppU0U PE4U& 5 P Q6P/[  0001c0SV0Sppp C C0S S/R <Vp0SDUa(0S0S 0 0 }Vp ! 0: S UH/[0%ӏ sV0: S0( 0 000JPU   B0P0 $0P 0)I0P @/P050CS"kk|kkk|kkk|k$ `O M I `00PPJ0S X儏0Sr 00 $  B R0\ L` V `,Q& /0  P@0`0 a P0` J/R  S/R/   C  R: x ` 2 3 0S S/R$ 0 SR& U0sX/ HL!R\0X\!R\ X00: S h C C `U0: S P1: S ,T : S!  Sn  Sf f S_ S L0S !yhPL,0SK QF0(尥 0Z Z80 S80p1p!pp'Q OUP!P1: S p00Z0S 80 0CS!800 3fPR X0|-T D0S !qh0S !Lh婿N*%Q-%^--%-%8-P-H-.f>._..@.(%. 6./ ? /O-@P:uXMD&,Wp<868V@,FiP60Pfi0S0 - PbSP 9i4P0805HP40iP0%.(0@iP7P0\ X5X%HP8SP8P H08 00$%43/00P08004 i4Q 0U0!iP (iP 0 00000 k@0D 0 kP0; S @,0(D 2#!H8 01/0TP0P( +T2PP P0Os0 CS 01#SiP0 0( ,S* B"!0 0 i8PH0U 03/p;0SHfH0803/p,^PP܂ h`0ld 0 GS * X  0 $03/0  0-Q3  Q H0Vj0  0 -1/ s0P0 0 0 0 `0d 0 `0d P0$ ,!i 0,ؠܐPYZ0     00h0 l 0 h0l   000 Ri0 0013/s S`h S=ehXP\`0N ( E(0, PU`00 XP\`= :"M*2% 0&Z%& 3S3@&0&53&  P@&,M3!O-M Mp|s4Lj$$H$ iUp 0 Q 0  s0(0G@-P񟗙y yhzhzhzhzLyhyhzyhzhzhzhzhzhzyhzhzhzhzhzhzhzhzhzxxxhzhzxxy$yhz0y@yXytyhzhzyhzhzy0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S $PU RnR oR0P<0,Z`P  HP8`P,FPPPP jt pN>LR8S;T5P>P<a4 1S}H @0R. PV`@0S0H0S 0  lP P 4R㓥' FM SP3mY`, 0| ,0Sl 8 RS P0SPP4PD0S $00$C`İPE@D0p/SP/P0 S: p  _tPPU*@$&%d@A-`P@Mm D 4 00 MP  L MP  L MP  L MP  LPl奷h3P0`3P P$PD3( 0P+( P3( P7( P;( P?P ( PP( P SP8$@Ѝ(P (P`T"i(0S ({P(0S (qP(0S (gP(0S (]Pq0S KP(!0S0S 8p X`PPa D1R`PU 0E /R  BP(幾PU  00,0/00)v00CSXlҖP0$0u00S pG0s00ԘA0'ؿ%_PD'TX_H!%;`b8<`&`&g`A-@PlvE`p Np 00S VۛPLP PP ``P $ 0@-F*%%(%S3O-MPlE 0Մ0S $ ?RR00R0SW3 $ (E  @0SX  P w 0!0 0C0 JP 0S' '0S 5S 0S 0S!KP0 0~ >zX ٽPtIA0Sm;P h0S 40Sa 00?S] ,0SᑵD$0S 0?S 0SS D d000: S0S<0S 0: SIP1 0S!  S/o" R xP SJ 0SJ սP 0S 0?S 0S0S *k('% kPH--k=kG-P@jDkCp8a Lp 1 R1 `0C@P 5DpP vP0p꥾IP '`0S oWP /P 0S 0S0`IP0&00S N*?%P'p@-PM Խ 7 $ 0H3IP3I@JJUITD0 00HP00¡CB#P3 gP 30S S! S  3J d3! l3 00T30S  R 4#6 R #!SR33 3 -!20S ( 2 20S !0S'002@T$P0"@B00CS00  0 D 0S60016 R0S 10S<z0PT<0 01 10SQ 10SM(ux1d1POT10S P10S l1 `1 0S  160S 8" @$1 pI01Y (8 8 0S0F0S 00Oq0S0S 00 B@`|P@To'*v8"%0'l'(''8'4' wD#%L#% w$'!%$,'vh G-@MP 9iA2br@@0 S ֻX "KpC 0 L1 0vP|7x HPdl%`x HPLd%H8 HP4\%T; 0DS 00S8 @0xL )0QD0@0 0Q)@0SZ L PUa0@S񟗷@|Ht@|GP \@@L]& (P %P V(P 0@0 00 @L,BL-B0@0 00 0 夽PLQ&|\ E+D0S hx QHPT$A* %%Bt @ht@t@%*t,$gt4@-chFAO-M pZht@_@0o0C?o`DT20<$<4@@@ Gp$4 4 00S ST [@ Y`> Z``: ?RPGPP! *H@ Pꐥ4`hP dP fPvP$@``j1 00T 00; R4 : _P @*A0S #S!*d2 00 0 j`PXL 0pL#>.  P (5p -p * XGp €0S<0 0@0050C SRPhhhh4hh4hXh[ `@P^0S? 0㘀$ p@ G p0 R qX  Pp P    3/P00 S #$ p@ t pZh000S @*'ڌx#%%t,~{?-X$'.-H-PԿO-M MPsJ ^nr5 00 5!s5005r<:0 00P * ްpP pVPp*Q A@6P񟗹ĪlԪHT`ȫTȬԬ 0WS }055050p HpQ Q 0X(tȟS SSy `050505484 ុP 嘻P) 7 *ط  pB0"S {ꐷ  p .0"S hL  p0"S P 06xp*0z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 0ot?WPE2%R U%RpUQp0%0;vP%5S 0EP80: S0550GS̲ԱȮU%R 2' WUz05-Urt0z4P$040|@ʊp`!`uvPP /D\$iB5%`75wTD00000 0CPP#2 C6DC2DGD=Pc`0  0S #P}p@=S&0#S  vC!D㟫 ;c0E?o2?  cC `V4APP!f/屼,`vV 10`PDhV@00CS0 vP Pp PNU0 P00CS0v0 U/0S:00S:032U51/1S)1S )*Pd`d!iB4%lZ6Ux@P 0TL,P! /`0U0w0 k/P}0PEUiP@}P  f/X0 T  .>x9*P('w 2Pt,Ėǖ#%%'bc85JP'(%p5@O%mdo!h'PC-6 0P !@㐐`p@XP? P7:`00CS`0 @@T ЍX0 X @ :('(%<# =O-`@pP0dMԄԔԤ$`(`,`0`4` ` 0Fp0$@DTlUU!Z  e:tPcPSPPPPd @"nP tP0 aP` rUdU 0'Bp0#|dU4 RU SU" QU040  |pUY [/lUT  .:  $б@ $ |Cp0 dЍ $± $ nCp| 8⵱ 8 aCp( 8 8⥱V  H⟱T@Dn8PP`p p ~`TEP 8 9Cp@_*P]*`("(! L "0g`_5V!  P Q !L|*0P0J|THA, 0@Sxq>pn>p:55xX8 㡽5 P P% *PP%[:`V08Z8 pᇽ0PZS  9 3 > 0`||LQt,%XUs~DdDq{D|D(ƭҭ}D>[ؿ%yaratcidO-0p OaMԯ$22242222322 pp .$Dpb>4 $0QPClo2 0000U1dR0 U% PPL0Q;p Lw7P  PPL0D;pd2SPBPX0: S0d2232d2oPPS|0 t=EsP-0SP FL bzPGRP 3P@/PA1@P>꘽S@'P6 ؿ$00H<|HXP @<A@P_:00H0000k ,2,00SP zd<.0d2+042(02%02"0202@`[`k @ =Taߍ02 20202;/`/P 0S 9p; 000P00S 9p- 00/`P Q 9p 0 0/ P   R 9p p0S 9p0 0z0)2i000 0B BP 000S 3 S;3Ş)00\i 0t ӇP 000SX"\2R<RX2i/ᮦP P@PX0 : St9 r `P j8/ᘦP @)0 P+z XW?`Ppb@p X:x\10@  X0,*6?X FI?b:!14'S9?̂038  \703L77 P 0@ pQ S\2S S 2S 2S, 0s x >p d2SL d@pV X!\1 [\1X! 0 \1802T7,2P700PU%>pP  >P@x%8P :dU 9CHPh 4CXx 3023,2 3(24T\2S(",2QX"\2 !14!8!P@0+ ^0 \ ñ ` v $!ijp  ZY0d2S*'0\ ᭳ ᫳[tPPL00<08 4\6P 40 S8 *"<02#L SX U[#<00R,b(H"L2R0;\2QP 00',%H'Agt,CH# _h<''c@'UԻ'UK}UjԼ޼'2P'rdAedA#'>rM%%߾ X''9 #;[(%'41 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0$u't,`%edAqx( @ؿ%'*'66%%3*'\lw'zd@x'O-`@pЁБQ =p%W㰑 0S 0S p10`VA .P d)0S L#D`V.Z ЍyPmPPP fP 0Dn0@ S0D00000000000000pQW 0RP sDPoDP 9XYt,P'b%("{O-4$M` ;P! B:P|90pD刔刴00PPPl$B=p3W00S 0S 0S 4Pp(4 a X' 0S00P 勮0S 兮傮PY30S ЍzPOPBP4 FPo hP@*PPPPPPPPPPPPPPPXPPPPPPP(hPPPPPPP00 P2 P20{00b 0 hp6o0` 0֯P00e @ϯP00^ 0 c rhPV tQ000M00J00G0 m[h1 P :s000001000-00*000&000"p 00000000P0So~]QP>~W00S 0>P1`I%R~hZ 8hZt (p(t,(%8x (Ė0'$*;x%%`s{O-@MP8@ZUQ`(*PUPE10ŴȭvPlP,HP8 TP3@ ` 9p@-α  :_qp@!±0 S < v<0@Zy rm@ Pllll,` 8";p,2 R Q!  R 1,0Q ĮP,00S  0( @WP@Y00-SF 80@0$0 p0@P?Ѝ$0pw1 4?$040P ?000R0Sp c```8⠧pW0S60S } 00 0@@`p @$@ @P Xm 03/p TᲤt,%3 +%%@-,@,@@ P(&% O-@P8M -`,@垰F8 0♰v`^ qp lp r6 R|,0 P8 /P0T 4P0\80DGpHP88F U1 6V(pCE C`0IPHPU 0  :p 5pO005S 0(0,00(00 0FPPPx%xq]PzZ`ZNZU 3AZF CZP0 p 00aZ CZ LZf a J0RkhPpPPPxPPPPPPPPPPPP WZ$00!0 0 P $0DS -(K0L0J0~O0{05xN03Xt X`CpM0nH0l5$00!0 0 ᔃ $0@S* x.qI0X00PTp 00J Mp0kZ0{mJ Z =$||||||||Ȃ/Ԃ-[mPH0SI0SO005S* LPO0S U5S5 ( p0 (0S  0C!P ٽ@P!@tp``$p! P|! Pd! 0S1H!3/ 0\@ PH2`P0()P1!" HR #40 p" PP 0 " 00 pS@&%`(0'%60&%Y0(&%q0`'%%? +'%&%t,0H'%0'%00B''00*s)1.W*? i1 1? iui B1m@-,P 9p@ J (tp@-D@DP@( p@(t,%p@-D@DP@( p@$(,%`%#A-|@|p `(P,0`8P@@@4,A<(h-%,%,G-`M5PhPK6P0 $p) P5\5@P L:6H2HP8"0 8288@ۋ d6 Hp HQ  6P  @ p1a 00 @ p0 @ x080<0@0D00 0000P0 0 080$@P  8q4 HL@P@T@X@\@HP7 H3444 0400,0@@,0( 00P.pPPUPh0PP 0/`ЍI?a?>s?2?hyR~p> 0 3p@7x>pt>a0SH>D$RX$r R  $t gt00<4A @0<4x00<$ 00p N <4 L!H -8+`PEB@D4TGtH((`,<00<@ᓦP p< $y劦Pt  k << l ,<$$r $dT4S`P T3 2"Fx2ŸS H$L4P*pg0 L4H/0#! 0_pL2 C  g0, epĞt   (0P 0T+ /!L4HϠ0# 4S 0 )?X %뼀04$$ST RQ  X  0,p0 XR00R104Qg ;R040 Q$ Qr*8(n(OOOO%/%hQQQt,Ėؿ%O U:P[lVVVV%`PWqPWWP0%aFFO[PP~{VPPR(P Q0]DHP=.X R04ʃ1$4Q :$4"+ QT4S% Z-d0<"tU(T,+++`,\4$H1H4L1x0<$0@ 0^,p2tnP Z > [PbP  4┎p   T4 v &.0< H'O-0pIM M␹i4, /pP_h9`4pGs04WZ h☤  ᔤYa) 4S<44S $$4R0(=+p  h,p  4 SP,0S x0$V $tZ0 0q 0$J P$H 1Sh  $$4Pa*` eZUCUDPEU T0vbPEUU0`6 ( '8#80( R&0C RI ("(ve044s04=0 00 d0 p6/0(00 ,V0,P0@ 80 00  0n0*00 +0b 0*00 +0V0!00  0J0c 00 l0 >050!00 < 01,00 1 1 %40(40Sd00; T$\0P0<$dh+p 4S  *PP#`$>]`P#H  <(@忠P04(0(00`V Z 00p"#8$p = 0奠P0 r0 4P ⤠P#0d3}p$p4S80S4` 1S 1!0"@ 0S0₠P 3"b|11   $Ĕ!<#\pT2   `d$ pܑ I!P pe 4 $$s(4S 0@i&?W  g" $tR $4&S 4%㏟X0; 4 44 W  0*)p0dpWsX0:S Q 4 $S  0 _ =)0S Z 5)N$!KHX0⫱AX+P(]^t,%QQp (RR`5% ^ U:P[VWWPR;^QR-RqU("e P U ZK > <;Sں'P $f $+f 0T =TT PX(  =0 2S1<+02L0WC.p=0S- C@4P&#"""",&""%"""%(%%"%""""""""""""l#"|##"#X&#$""$"$$$%4%@%%"%& 09 0zl hh0P 00R0S 4af 0;8;08;_ 00;ppGX䋟h;h00S 0KP  +;KP= 0Uad h`h000S0? P< ) 0< 0: 0 :a@0 0:0@; 0@0 00 008;0ꨊ h1h0P00S0? :Pڌ 00v 00s 09p8 hh0`0PS 4t hh00S0@S ec 0; 000)  0 0 000) hh_0 ɟ Lh00S 0KP h:080X)X9 q&PL zZ 8JP d&P mW<09 ,d P 0: 0 >0!.8u 828P80PS ̌p 80PSUpȌ 刀ppQPt  4s`Up 0@ @ 8 0PUP 0C S0400000,00(00$00 0000000000 000000x0 0m0p Ro PP@]"8Wo "p$8; 00 d0&p^8; 00 d0r&pP8; 00 d0d&pB8; 00 \d0V&pL4 pDV  |0 x;0 E y;z+吙0;0; ; '0cy;0z;(0x;P+@xP d0'&P;"0#10@00 0`c`QH `    ` 0&Pbc0S PP c0%PU 0  00 4%PHd '60 X! Ut``0 T%P`l4l$4%`㰙!2P(10Hd 0`[[[[,Q0Q4QPPPP;㗙4d<;SS%>؀C 0 <Pjc`p)O 2pR 0Q 0Q 0%hrN% 0;PJc@XP O @2PR 0Q 0Q`"2R 0:IP ' "2@P/IP20S 0 ' @P 0IP@P 0IP2 $p0崗#p00 dT廌@+9@0W0 00 D P1 ppW $ P 81%P`dAQ D]$P]E $1% 0%c&)-pBp[prq2)?qeAq$r%t,bpp`RMb@Appppq+q=q2)0Y))Rq02)Uq{Gz?qq0()*))Mr%rrrr@2)2)os)s2)Jss;% ))-C6?t2)seross8~AP))$@))@@ssؿ% ()sh))@)) tt;%Ktvt2)%2)t;wu"u?u`u}uuuuuvv.v>vOvhvvvvvDwvv w-wYwtwwwwwwx#x3xGxYxnxxxx2)x&)xxxA PN @1P@P 0 &H`PZA@ P 0P 0@PHPE 0 HP NE1 PO  p"@T9 0S5 *$}0Pl0l00P0p+t"P m0S tx唋$t;L000!R@  X1 0 04 2d"RRW 0 T !`HL 1@S= 2R`" B8#<48#8Q\P3!TR?LT0 L0d0 d23X%XN  B  xx#0|0?t 0O#O 0JOJ@ ]GP# !YGP#!p# 3PŠU h2X0Ph2dl P  ⱖx 0# 0X 3% 3أ0#$$L0(00"(0/|4" BQ2 (Q: 4 Up3P0؄#tt5x!'x0G0C8C8S ! 0G 8(#8"( 0 a 6q   DP p5 0U:3؃0#$$L0(000"(P6 V  I999994:<:D:L:T:\:d:l:t:|::1 0#!# 0Pp#x         $ 0 PG D 0 P> Q:;; ;      0 P 0 #$$0(#"(!0 P  0 P4  0 P Q Q l p pt n0 |P  r0 rP  0 iP  0 `P  0 WP  0 NP4  0 EP X 0 <P | Wp; 02 .0SG S Sx U1؃0#$$L0(000"(PP 1S@0IZC U I 0K@0 @0C@zp  JpZ  @0I)0C9! @ 1@0C0YIZU& <;Z   tPU (  ḫ cU!P P J3Z U 9O-M`P8@0L-S@ᑖP. @,4 t ]#p+40SP a`F0pP[PHPijQNpGK1!PN  XZ]P@ \3pC d0@SA4A4A4A4A4A4A4A\A4AA4A$AdA4A4A4A4ADA4ALA4ATAL@20SK@HGG 0屓 0p Y |\ZZ'R`P P`0b 2 R o 0 S c ^U+ 0 t!0!00X  p4 ,pt0SX` pb0SXP0pp@@ 0Y Vp;Ɇ`2*y%| yߧk:y*y 0 P@T[ꌁsYb82*|%|{t,{{]*{;%|ɪ:|H|b|<ؿ%A%|||;@}O }$}=O-PLM)@pPph/) p\?,#@DRQ0I 4q@@0SR8WvP cP SP- TP0(3 LP Td0@SMDMMDMDMDMDMDMDMDMMDMDMMDMMMDMN0D003030800H00 30$30,3n*u55mn*ho*?ۢ͢]G-`XMP&: P 8y8I p  90VJ &SDP% b0@SS]$]]$]]$]^$]$]^$]$]^$]]$] ^$]$]$],^$]8^$]D^x80 60$60(60,60064060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 0&7RaQpYPA\7C P @嶎P8W0S  gP 00004P6T&0 ^IKPBP061 X(VUsp0+Spl*d6 000>_<00 0/16T& P 0 000p :XP00G00Xg{pՋ @Pb,`a,`a,`a,`(a,`Ta 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0qp,4y 0P 0PQT)QrJZp3V u`(os`F P% 0SU030#:U 5%P|m P l2z T!P&T6K/r003PvTS0 0S0# G@~SPEiX: P~ 0 0<6SR46SR 0&2RRPh2 01 ~(6S |#P W0`W  0ŊP /~!EK/r0,6S m/`P V0PQ!V~~<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @ D @뼏@:|0P)t*%t,1Qz*݀u*u*mk:%UX(%BPm ߧ y +z*KmkLq٧A-Pp`IHM p10PEU* 4HP h0@ S SgHgHgHggggHgHgHgHgggHHIIl1yd1T1 P1 `q 4pP p 1!;qPP iP Lp$@@Ѐ@(@ @s Q\P P0S PxV SP X:P0 0000 G%t,E%qxA{**yt Ct 0G-`HMp06,S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 ^a0@Sj8kP` ;MWOJ\bP1 JP/0: S2  S)J -P0 JN@n` 04S00`5i΋0S J[p @J -PJ -@PJ0@`*%q)C-PGMM  U 0M3= <8=8X@8DX}Px=0D80l8"=`{C0L `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8_}PP   ➁P:?  0LmL  J}P< <D}@P  P H0P XPg0Pl ShŊ` 0 j P4:Ty | P :h(q\ P 9T(X(g8 c,߇P 9h(e40GDS4{t{tttdtttt8t{tttttt||ttttt|t0}t}t~t~tttttttttt{{t<| y\|l|t|tttt|}D}\}}}~~t  8(V@S h8X(T(N T8,J8 8P 00S= 8 gK8, ,, ,0 7,, 7H((Bl$8pZl7, | 7L(w+L P:?@  0 D7P(74w:lp6P78x7 7<( 6T( X(L7 *6P 00S 70  6t(6 x6P 00S 6 6@p 68pkp0⤖80 P 0SL6t pW 8:p(f\+ 5,0 0l5L(5k` L5`(d( 85u9h$5P @ y5?Q49\GލЍx5| p,0D\<qH{S D   * ( bG-P`00Eoh='P03up2S lB PHU-yyPH t圄9PB/PE0@ *  pd40pEWQU H4 000`eP L,}PE0S#3 4# 3 PvP HvP303 Z`pp h/dVyP\304D}P^z4S @SyP  (Hm P 4SqRyPl l PnRx,p`bG1/΅<01 1> 110101$1xdb`4㊂#(2R$$g ip`g Pd Q18C8S vuo`q؁ؑwx00l V B/o" R yP  \x=`S 0 0000 ly18C8S+`#RS S=?o20 S S lly18C8S 0 S ` S S S%x ^zxxh++g{%%k+k %P%ZP%i+i+B ZN%*Z@-@`%P᪃P 1 q zpx10SAQ\1PI D1C@千P 0刃P 1 nPbP9P0P 00@0c0@ S ꄌhhhhhhhhhVP     h0  X0  H0 T TT  0S+$o+u%++S%&r ؿ%AA-`P 8E+,*%+ؿ%t,$%?+c++S3O-pMuPED,P4/ᯆ4PP 000 0P0X00@T/`P@@8$.pB,40HXH[p 0S u@P ~@;#P30# Z -R R -R eB kR R|# QiR eRX#P#sPPPEP IP -Pd Q@"Pꐖ P`p00~l2l!yX2\H20P^Up0Sm ?SPPi20`^Vd0Sa ?S``]10@^TX0SU ?S@@Q1100FDꔱ<00 (0\  `0C !1R, S` \0 - 0tZ(, ,A>^P  mPY  $0S% j f bS`0S   Rڰ1\0 1 ,00+z.,%I.%y/:.d.K.t.~Z{%P{%U{%t,...,ht@@+.ؿ%...gtO-@Pp`LM @  p1 UV P[p DgP uP GP000`0S;@0T _PUP   p  !COP0P 0S UCd p U  p T # p V  p|CPU _ ThtPL@@H 0C >/t,%E/3W/;~//[pyp/0O-@Ȕ$04};}] @p(@WPP,1@ 40(V,@q@P M 8SO00~$2"z2傆PC1QW |cyM 1 <Ѝd T5(40S6 4P(pU@P 0p 0U0 0 0 00 pP ,p|(z40S(s`fP1,@+6,7,",6,&,p &1,8,(,6,x1,ؿ%,xS.,6,&rt,T1,L,/,} ",6,.,+; O-pKM)0 `HE 88`0 `  pPJ5 W_Y CpP :0(Pu ` 0!0 04QX 000sX%X pP02 0P` PPAcPPD! A ] ! ApUaUbPEUHXdzU" !0  0 00 0`3 1 H 0@u$300q`o p00: S) 0V0[0S3 Y   P,`P<  (5P (Lx Hx,Pt( (yP\!b`PP (h(,JVG ,]Z(,0!@P5 9A {{h  [P"   5P0S T pI0S KT0 0/X0 N@p% 0SS RQ"$0p00S uP@0 *{ T@P Pp`(,g%%ht@Ft,s\rO}8@2$0O-PM`P 00@|P |PVߍ*. }C`?@P1X?/01012211B "L122pppN&KpἮ\10 .0>p1F0[X18X1`宮0  F1|!1hQda0  e@Pw\1j >0[ >+00. X18X1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯괪DLDDDdp|fP j@PP񟗞DDhDD0DDDDDD@=0P1`$<`F@pԌ}\1F3\1Kw0000q0\1lH 劘@fppcph`0 P -P \1P q0#P\ j0[ Z0  ɽ@P 0 P  Q84'0 *00X1 ▞pxx 吭  ⥮1S -P 8  z ::0P \A@ @0 Lp  pp `( \ X1 Q 0P819:\!p*X1 d [pDT C>P)(< $X11Z xPPY* 9Y) 9+ 0)\1 ͗P} P S Uy 0 09太z⴪pHx  W "0S L ׬ *PQ }0S(  vX!\10\1808"/0  X!2sP8"/0 2X!s"/ p= X1`嚬  P%D|X!\1 0\1 00 8өp 137 y ⮟zPtwht 00 7sp>}0S ${X0pGW0}0STy)}0S %}0 S X1\!8 0\!'zp}0S &|Qp}0S &HD !P q  :wBt㽟X1 I S0pT9 _p5 P <%\1A>\10L1] 00 6Lpwl s0L1L 00 5Lp(p Q_p P \10\1Q|)~d宫\1 @0\1W!pP  <X1 X40  ⠜p` X!\1 $  $$ 43$ fp   ⡞K-p嫫 00 4咧p@埫|!RX14X11  ⰭP+p0v!.P0!  R!牫00|!R00SR\1 X1 0㌃匓 Q01Z:   hX1  1PU3X1\!( ; W A? = ٟ Һ1R@T 0S 0 @K@ 0S   ~ 0S ؝̫PpP P ( RW  R   0010 S   0YPU QR庪\1@0@kNH`\j\1$ M Tf% #"l %*t, q x@Z;}x >9\(uhd$+/g8A:Erq~{G $K<6%  Q/0p@-x@0Ppp@ P T0CA`p@/ 0 0$010$]I,$O-1!bM0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $z`  $; 0 0 +Hp0Gp( 80G( Gp` x8_S0؀00 00 P00 @G0 wP x8##[`@*wP0 l8 40GPU P0 l8@>@] ]<=>(=>0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/;;; p@-`M PAP!@ `` */4T*///*/@-@w@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_RC5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog11.0_RC5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d +D]+b ?f pFpwe  +X +\++x\x?+( ++=|i#+)+Ш/+(]5+l{;+ F+ hyO+U+Db+do+|++++R(<  ߧ??+TD+TDoLB\+g#di+lyDtxvfh+h4+4+4A + 5А++D+$* pushdnepopdne`2B2K1x @@G2HK2@@Q2<W2|18X ^2hd2@@+d@@j2<unblock and -DNO_CONV?}0100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink.n :n PnbnlnxnnxnnAknnnEnZnno-o#7o 7o_Io^IoFIo<Io>^o?qooPATH= O[~tZAfo#xdxxsDZAcxxmxxlyyr Ttpysnyxv  yPb    EOF reading here (<<) documentM! ~~~~~#~'~+~0~5~g|r9~>~E~L~S~X~`~h~n~s~z~~~~~~}}}dv~~qqh<4%vv#v}-+?=[h@iȀ@18vHDv;v>vAvabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''0'1П'1<'8 x'0d'0JP'0Q('0X'0a O q -  OÄ h 5J'ȃS˃Ė !F"H1                  {;@pd@4r u v!yhX4P9{wF|MFܰܰ|TPH$bWLbܑӽ7! 7u\N%uY<L\)0$}x0x d2dPD7>\}DZL55= $CGO#LR! V p?ۼ > O[-/:]?$A+?M ?0X?[>7?߉@B\@߈A B$? B,AIHBtBAP?DX?n TAhADj BÉ#‰3ˉ#ʉ3҉2щ3؉3׉#{ @:@*2A: @ 0! dC$cCiC$hC p|zt@@  nfŊ@͊Պ ݊VU^]PW^em @S[c@9@i@q@x@@@@@@@ @@@@@EKŚʚКךߚ %1@8@=BLR]dj2pv~Gěy~̛ʗۗ-AQd͘q -ǜ͜ӜڜE Im/"V[ӛݛ -~'2,5@ EIM/"W[cgmq|19?DKRY`ipy~șǙΙי")27?EK-ǜ͜ӜڜE Im/"V[ӛݛ -~'2,5@ EIM/"W[cgmq|-ǜ͜ӜڜE Im/"V[ӛݛ -~'2,5@ EIM/"W[cgmq||j 1     #:On 7S o!###$&#1#23#4#56#899:;< =$@3AGBCDEFGHJL4MENLO\PlQ~RSTUVW\acdZe|fghipq#s#t#uv#wx1P]r(E]w;U[tttM!,####6N`yl)))Bax7?q<##pu##)<O[~[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]T@+X[ӛݛ -~'2,5@ EIM/"W[cgmq|returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock, , , +         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readU%%@a Z%%/0T_%% a%%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-a x"!Qo%%ƣ4%%@. = . . . 3 3 4 : : : : = : : ; ; = 04 [ӛݛ -~'2,5@ EIM/"W[cgmq|Ę%%@j 1     #:On 7S o!###$&#1#23#4#56#899:;< =$@3AGBCDEFGHJL4MENLO\PlQ~RSTUVW\acdZe|fghipq#s#t#uv#wx1P]r(E]w;U[tttM!,####6N`yl)))Bax7?q<##pu##)<O[~4%%@?ܠ%%@r%%@f%%@y%% T%%D0%%@9{%%SFH0eC쬦!,SFU0eC쬬!MHah!IdontNeedEFI!!(s*K>;!|nQn- q+!!|nQn- q+!!|nQn- q+" "|nQn- q+"'"|nQn- q+5"=rGy=iG}9"D";Mt?O"Z"mWC 3KOOe"p"yD<#*=({""3Dh&Ǐ""\ M}-""@Mjy֬""-чHE"-чHm#ZIчH#IчH0#IчHU";#2IчH[V#L6 %?ab#g#S'@ )Ѹt#{#*1@ )Ѹ#1x )Ѹ##a0%%@%%%backupstore_gptstore_tbl+%%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsK)Y)h)setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus-0printallmaindo_setifpreferencedo_setifcaps/0zi'% yiFFF`'%'*%FF`'%4x+%H+%'*%1W*%)+%22`'%/)%;2`'%E2*%L2*%D2`'%K2`'%j2u2222 222@2222 202@3 33F3 !3'3 -3@0init_current_mediasetmediamodesetmediaoptsetmediasetmediainst4G54%5n-05n 4n`5 5@5 55n%5media_statusmedia_constructor44q3(,%34q3(,%q4q4+%4444+%443q ,%4X,%paddr_match4 tt8 tltsettunnel"68`'%(6,%print_link_addressessetvlansetvlanif78-%M77-%L7M7$*setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan<<<<sethidessidsetapbridgesetiffragsetifrts=-%=2`'%%=.%$=%=l2`'%9H.%99A* `'%.%*=(.%0=-%/=1`'%x.%9lB* `'%F(.%8-%F=AH<H<@99p@77(invalid major numberinvalid minor numbertoo many fields for formatffs@|DD DD5DDwD@DDD D}D BDDEE.EPEcEL\ rE@~EEEE@ET@+[+EEXEF@F F5"FFljDd@FB DD BDB@FFFFFFFF bnorripbgensbextattbnojolietbnocasetransbrrcaseinsFFljDd@FB DD BDh@iGB@@DDFFljDd@FB DD BDD Dh@iGD@GB@D5FFljDd@FB DD BDB@FFljDd@FB DD BDh@iB@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorFFljDd@FB DD BDB@%K*K#F4K :K@CKJKRKXK]K aK q@IIgKJ JJ  J@oKbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsgrecvrpcrpc_getportrpc_callsendrecvFFljDd@FB DD BDB@DDTTTUOUUUUVBV_VVVVVW$WKWsWWWWXFXfXXX%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@dBdCdFdIeL"eN/eOfS[ealeb|eceeefeheifk fmfn+fo:frIfsZfukf@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:P@@Zl@h ^lpblp flpjlp ` nlsl@ xl $1м|^t0 Non-system disk Press any key to reboot DxstspsHlshsdsM`s\sXsDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY&?lף?_ -WUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printlLLʳгL.LʳLL%4BZLisLɴLٴLٴLٴLٴL#6$BL#OLaiLLLǵҵLLL9AL9iL9L9LLL޶LL :LELLLQLbitmask_scan07<Chw.disknames<g****************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]aР Р : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data*OÄ5\  >,Ŧ$,Ҧ*6,ڦ*-,x1,w2,v3,;F&,ap%,}u4,*4,*5,*7,",&1,ŧ1,ϧ*X1,٧7,#,", K07,K0&,'(,0),>F*,al',}+,*+,*,,8,9,*:,Ϩ.,;,*<,*=,collectƲ[ӛݛ -~'2,5@ EIM/"W[cgmq|NAME=X@+FTmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds[ӛݛ -~'2,5@ EIM/"W[cgmq| edit_fs_type_exti  R R R f g u u 1L S e\S uLS edit_and_check_label [ӛݛ -~'2,5@ EIM/"W[cgmq|disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzh @ D  ( , ؾ Ⱥ ĺ h t $ l $ d \ 0  H ؿ disklabel_change_geom 0 outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default U,U,U,U,pm_from_pepm_whole_diskgpt_freegpt_create_newh ЯdغXԮT44|,xh xĽ(dh@l[""! 9"!EmU"t### 5"!Wa ! [m%*/@+28[+~E=EXEn{EA+/"F@F FmF#O5"gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC쬦!,SFU0eC쬬!MHah!IdontNeedEFI!!(s*K>;!|nQn- q+!!|nQn- q+!!|nQn- q+" "|nQn- q+"'"|nQn- q+5"=rGy=iG}9"D";Mt?O"Z"mWC 3KOOe"p"yD<#*=({""3Dh&Ǐ""\ M}-""@Mjy֬""-чHE"-чHm#ZIчH#IчH0#IчHU";#2IчH[V#L6 %?ab#g#S'@ )Ѹt#{#*1@ )Ѹ#1x )Ѹ## Re}Pp"@AH mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new H < P,|xh,X h $  TpH@  mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free****************************************************************************************************************************************************************************************************************************************control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2Rmdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionbcFdejf>gh=ijkJl4mTno[p=#q9rfsm tuuzRvw4xzߧyABC?DEFGHI'JKLMNOPQS TUVW&X0Z1?4H6"Q7||;~b}mktb)'0.6CW.IOW\lu@default_configread_configrt_compare_proto  llrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtDDrt_buildrt_deleteLLsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_inites/!(2; (FwFscript_buftoenv)Z0make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os9flpuyif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp!-:<dhcp_boundHkQY#a< idhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa~~~~~~VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B 89X x T أ  8FX$ x BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ % !  9  T   F@$  !!!cs_path >X*  bc_base_max* bc_dim_max* bc_scale_max* bc_string_max* coll_weights_max* expr_nest_max * line_max*  re_dup_max*  posix2_version *  posix2_c_bind*  posix2_c_dev*  posix2_char_term* posix2_fort_dev* posix2_fort_run* posix2_localedef* posix2_sw_dev* posix2_upe* stream_max* tzname_max* atexit_max* 9@ ̈ XT p  F$ ,  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::H\4 Ը 08ND`'<L<T\` h HT``hl t|  (                             $  , << xx  0 , h0    P X    l  L    \    4 ld 0        << x$ ( ,0 4p ,8,< h@hD HL PT X\ X`Xd Xh X p x |      L .     \                  ( , 00 080@ 0lx      $08@HLX    (04 !#!9$!'!L,!$1!UTȞȞ ȞD DD D D D``@{!v!z!y!!l(4gnts+)rbmnX(P'& '@'tcidPDUZ<^dNMMXNLN P yekd]T MDH xatadxlpjlloobw4xw!!ă!ă!yara} 8|P{d8 `(@Ldp    (4 L Xd `0tx X8x 8 $,0X8DT`pLPTX!<@DH! $(04<DHPX`hpx|@ (08@HPX`hpx$4@LXp4L`t0DXl  4H\p!<Ш<̨D\<Ш̨D!!!!04\x,Tp000dl| h l x |               (  0 4  T X  l t T               ( 8 X D 8 H P L P d l            !, 0 "D L #h p $x % & '  )  *  +  ,  -  .$ , /4 < 0D L 1T \ 2  3  7  c     $@0HPlt#h $% &' H() $48@D4  ,4DP`l      ``, 4 D L T \ dl`$0@H88mm%C!!!!!!! X%L%%%  $(08@LX`lptx|| 0 `````````,4<`t(<Pl ,@`t4(Hl<Tp 8\4H\  @ T h |     !!0!D!`!!!!!!! ""4"H"\"t"""hypyxtui@94<%4!!!`````````% 0!$,P,`%,l,-Hh-0,d%T% v-0%p%\,$`,d,0%, %y܂i",`,'j-$&%Xw-%g-P!&-x-u-dx-4,,,(j-tTu!X,0%$d%(,<,0ij\,%L,`ux,<P,p,d-8%t%T,<%px-!,,h,Ⱥ%<3`,%%8,0,H,%%|x-X,ܩLHh-%d,!,D,!8(%3u%#w!,%, ,(%$,%ht@-k-@9t,%4%[%(%Z3 &HErP%.~ [b[jXj/0cf[h#[k2[lB[mT[o`[ol[p}[p!\p[q[rut[vow[w[xxz+z[BFkCyJ[O[P[S[T{VjV[X \Z \Z\\*\1\F\ R\[\ c\ +p\\(PuX.vtX.Pytt( u~\(||}t|tt( G R\F\ 1\yz\p\/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin<'}-+?=###%%%}''zazzEVzeFzIoizLl {m{Cn{f#{){p0{b7{u?{Z3H{S{qZs`{l{h[vVVu{xL'@=L#%0#%d [~0tDvVY`y;j0uV1Y|{u gu5ụ:!>|tX7u ī٫*\*ȑ*H|* *О &-70_%%UF ... ... j   *#*Ȫyzq B P q  qȪ#L%1'PH@K (`'%l(P> 8&%AabCdhlNsuvW:w:z&%&%&%&%&%K 1&%<)%K M1'%K K %2ZK 2ZK 1&%K 2ZK 1t'%\)%K S1'%)%K ^1'%)%K u1'%)%K 10@ $(%K hi +? P(%K  (`'%l)0G |(%K .`'%+xC (%T*%(%(%K g1`'%!((%K n1)%!( )%K 1()%L)%H'%T*%H'%`'%X(%(%+%(%0*% *%)%(%)%(%`'%,(%'%K /`'%/K T1`'%'*'K 1`'%*W*K 1`'%W'WK 1H'%!(x*%K E2`'%E2K TX2`'%'K 8'`'%*K 1`'% 1K )`'% )K p`'% K 4`'% 4K 48J +%K q`'%qK X4`'%4K 4`'%3K 3`'% 3K 3`'%3K (6K ,%K h5,%h5K o5`'%o5K 7L -%K $M7`'%M7K #T7`'% 7K <`'%Q -%K =M -%K +=`'%=K )0=`'%0=K P)8`'% 8K (F`'%FK A9`'%* 9K lB`'%* K l2%=`'% %=K 6=`'%P .%8EKADKADKALAJAL1DKADKVIq a 9{q w q < ~{q 8Z [q J q u ~q < @$!y4z  &T D T <<H!sDD <Z tY px[ |K $ P C,R +,R cKF .\F \F jV V s U ?|n #V kXg+ɅE0FÉPcqalsh\g+ !"$'(+-.03569:0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJe%e%e%e%e%e%e%e%""e%e%e%e% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it)i%i% ($# ">FT -E<;G u7O Y b p#}28  ("!9  k &f& )2 < 5E eN :X V %` j 6!s 4h  + , - . *  ?s Ep? / / '" F/  `!0E n| fh   WmkRkRkYcWbkCkc kG ky wb YMYrWcay%L+4Rby%@+0 zBy%+cxy%H+ 44dpy%0+[vpy%A<+Dhy%(8 e`y%8+fXy%+0FPy%4+LvgHy%h+h@y%$+/i8y%+H Rrj0y% J(y%!+k y%H y%H4 Ky%ث+(Ly%ܫ+Fdmy%D+|nx%"+ox%t Ox% px%Hԛ Px%@ |qx%T+)Urx%" +isx%!,+Sx%!+5Etx%p UTx%, [ux%@+gVx%T wx%"+xx%(( MYXxx%A+eypx% +zhx%+"`x%@ ~Xx%!+A?Px%Ф #Hx% _r@x%A+~8x%Ы+0x%ԫ+ (x%̫+&X x%( x%+x%+ x%+, >_x%+w%$+X w%$+ w%+$>w%!+Wgw%!+ qw%!+w%( w%!+&w%+@]w%+w% w%+w%P+2w%|+Lrw%4 w%!+xw%x+ pw%t+5 f  hw%p+   `w%l+ /!U!q!}!!!!#!!!!!"o""("2"<"M"\"g"s"y""""""k""""^"""Y7##+#=#x%C#$J#S#\#i#u###########k $$D$$|+ (press RETURN) G y%y%y%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=<++-e^H-i^C-k^UK%4%Xa Đ%s % %*d%Q *D%pu * 4%Q (%Q }ԏ%s ?,s pS /S /S V V V c b u ,u S Sr W W tW DW Xd c $W ] TS T|S 1S 2,S &2@S pR /R /S 72r ]2r 2r 2r !r XX 8X X W r X X |X t t Lu r X t |t t jlr k|r Y 8t \t `r @+R R 4r Dr Tr R r (r DY Y u u u s  r HZ $Z Z Y Y Y d c hY P] s r ^ ^ ^ ^ <`  ` ` _ _ _ _ _ dR tR R HR uTR ` ` |` T` q q Q Q &@a '(a (a )` ta a p] a a %\a b b a a a lP hP wP P  Q 4Q \Q hQ 333C3R3/yV3ZaD[3^3b3l3Zt333;5X5E7_8x:::C;<<eRf(< =<@<C<<v=[>?.AKAXA5eAAAAAAA B&BOBBBiCCCChD$DDDDD+*E088E?EWEgEsEEEEXFFFFFGGwH IKImI^J L2MNO-QQGQaRRST(TITXTTUUE2VVV%W:W}WWWWWWWWX%X7XXYYY ZCZzZZZZiZM\c\\0]]^A^^D`+aaaAb^bbbcuĮ 6>l #< ? 7@ Q Ah Bh Ch D 12X E h F mh G "h H n{h I *Z * *t (  1u 1e u *7ESap}]\xB]\C ;*********C      #  ! ! _s M!     h*           # ' `+ %/ 3 %F 7 !H "W #c $o %| & ' ( ) * + , - - . .(/ /l01 2 3 4 5\36 7  8 9 : ;! <0 =< >N ?\ @j [(\~ \ ] ^ ^ _ _ ` { { |  } }"~-   -dd-ddTdd:dd:dd t @@`#####$$$$$%%%`%%&&$&,'8'D'L(X(d(l)x))***+++,,,,-- --.$.0.8/D/P/X6d;t;00011<<==>>?2 22 3,383@9L7X8h:|44455 ! " # $ % & ' (  ) ,* 8. D+ P, \- d/ p0 1 2 3 4 5 6 7 8 9 : ; < =  > ,? 8 @D!@P"@\#@h$@t%@&@'@)@*@+@&`'`,@-@.@/@0@$(`41@@2@P3@`)`p4@|5@6@7@8@9@:@*`;@<@ =@>@,?@< `L!`\+`l,`|"`#`-`$`.`/`%`CCDDE$E0F8FDcLcXd\dheel#t#&&0 $,8DP`lp  @@   @@@@$@,@8`@`LPX`hp x@| 33333333``0@\t3333hUTC33%%||~vwP}w|v33x-,339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž8%D%8%% 33UU33UU33UU(%`utuht%%`utuhtX% ؿ%`utuht%<%(%h,|x   @ 333333333333333333333333333333333333 33 33% !! 0000000000000000 Xl-33333333̣33%% % (root)`33 %%C!!!!!!! X%L%%%%!!!!% <TDܠ0@(,4p@x ԟ 84Service unavailable'A*aeabi 5TE  L6L7xܭoAYrV`.T`0 AP:D"MP(onѽ%oΛ\WJ-;W8q&ZڎJYn'kGݭ?9,~Bwڳәaʝcw#Em\5a\.y>dǽ9DgZyG/;^lz 8{gY{{،̯jme\ZFug}q9xq!b񱴏40o?S9p5[hZFc^3򟹶eKj7"݌|ksD>fnN#tl#k4 EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /BHP$ V$ $b$ g$ tt4%4 \y% %!%!0x-!p!+!j!MSGTXTS628 5040 5065 5082 5104 5107 5112 5120 5127 5135 5143 5146 5149 5152 5156 5168 5177 5190 5219 5234 5778 5812 6495 6783 7491 7547 7621 7717 7892 7915 7938 7944 7953 7975 7979 7983 7986 7989 8094 8297 8536 8977 9415 9450 9465 9477 9483 9495 9544 9564 9604 9621 9638 9653 9700 9738 9786 9868 9992 10128 10169 10207 10244 10279 10289 10338 10488 10494 10499 10503 10523 10633 10653 10659 10673 10685 10696 10733 10767 10791 10893 10930 10952 11051 11106 11164 11175 11191 11243 11411 11618 11789 11853 11905 12177 12727 13256 13688 14026 14359 14472 14487 14496 14656 14827 14977 15141 15164 15188 15203 15278 15418 15595 15750 15762 15842 15943 15989 16015 16085 16096 16105 16118 16144 16159 16175 16188 16243 16254 16269 16473 16706 16735 16750 16819 16893 16966 16996 17034 17088 17507 17533 17562 17666 17772 17957 18069 18184 18288 18975 19234 19374 19410 19580 19621 19757 19780 19817 19862 20113 20209 20263 20362 20373 20410 20447 20474 20483 20517 20524 20549 20576 20611 20625 20639 20668 20682 20699 20708 20730 20748 20765 20776 20795 20821 20839 20862 20879 20894 20909 20927 20954 20981 21003 21042 21060 21092 21320 21394 21437 21483 21630 21786 21830 22109 22136 22495 22679 22831 23012 23159 23317 23338 23386 23396 23404 23415 23426 23436 23443 23458 23470 23508 23538 23577 23630 23688 23709 23716 23735 23756 23763 23786 23808 23828 23850 23881 23918 23940 23954 24000 24029 24063 24103 24138 24166 24214 24223 24232 24237 24246 24255 24272 24276 24281 24287 24291 24329 24338 24365 24385 24408 24427 24454 24476 24508 24524 24529 24539 24562 24584 24601 24618 24631 24640 24649 24655 24682 24689 24713 24734 24758 24771 24790 24815 24838 24854 24860 24872 24902 24910 24950 24961 24972 24983 25000 25017 25031 25048 25264 25568 26016 26232 26496 26768 26820 26856 26892 26943 26960 26998 27012 27019 27036 27039 27044 27053 27065 27076 27085 27106 27148 27186 27202 27233 27258 27293 27349 27389 27410 27430 27471 27500 27548 27781 27816 28023 28042 28079 28140 28178 28217 28373 28388 28434 28482 28505 28541 28551 28561 28572 28577 28640 28688 28732 28793 28826 28927 28945 29084 29106 29229 29243 29253 29276 29381 29437 29553 29584 29589 29615 29654 29664 29707 29717 29733 29748 29766 29789 29819 29840 29866 30063 30106 30110 30116 30122 30127 30138 30152 30181 30213 30225 30272 30322 30362 30389 30405 30414 30457 30463 30471 30475 30495 30512 30524 30555 30811 30860 31436 31463 31495 31523 31575 31581 31587 31592 31613 31629 31651 31680 31821 31955 31968 32104 32106 32108 32110 32127 32140 32158 32185 32189 32195 32200 32208 32214 32254 32256 32266 32281 32298 32332 32364 32402 32431 32460 32482 32525 32551 32595 32731 32805 32807 32887 32933 32981 33086 33188 33227 33294 33301 33362 33426 33430 33437 33559 33628 33916 34054 34195 34276 34323 34329 34352 34398 34401 34427 34470 34535 34597 34667 34735 34828 35047 35072 35076 35112 35130 35158 35200 35244 35308 35358 35434 35456 35508 35552 35591 35625 35655 35686 35711 35720 35732 35740 35751 35763 35782 35806 35855 35872 35896 35939 36261 36264 36278 36291 36303 36310 36321 36328 36335 36344 36354 36371 36387 36437 36445 36453 36463 36474 36492 36509 36530 36552 36561 36571 36598 36604 36614 36633 36649 36667 36687 36696 36707 36714 36731 36750 36771 36781 36798 36804 36820 36835 36850 36871 36893 36912 36922 36927 36932 36950 36969 36988 36994 37013 37033 37053 37071 37076 37082 37099 37115 37136 37149 37157 37177 37201 37218 37226 37237 37258 37264 37276 37298 37312 37321 37342 37360 37369 37403 37426 37453 37485 37508 37528 37539 37571 37587 37598 37611 37634 37656 38164 38194 38225 38253 38267 38468 38690 38857 38944 38961 38979 38996 39025 39072 39083 39102 39124 39203 39395 39423 39541 39563 39704 39723 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_RC5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_RC5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_RC5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_RC5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_RC5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_RC5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_RC5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS628 5040 5078 5095 5110 5113 5116 5121 5129 5137 5145 5148 5151 5160 5172 5184 5193 5202 5228 5239 5775 5802 6368 6668 7309 7356 7469 7562 7596 7615 7633 7641 7650 7675 7679 7683 7686 7689 7811 7996 8224 8744 9095 9124 9137 9150 9155 9175 9194 9215 9274 9291 9305 9327 9372 9398 9439 9517 9635 9749 9803 9832 9864 9903 9909 9942 10065 10072 10076 10084 10108 10190 10196 10203 10215 10229 10238 10271 10290 10302 10412 10474 10493 10612 10663 10715 10727 10746 10798 11002 11210 11401 11461 11510 11777 12236 12902 13325 13647 14072 14204 14236 14248 14426 14623 14784 14918 14938 14971 14985 15054 15167 15339 15474 15494 15606 15698 15721 15744 15803 15818 15839 15854 15875 15895 15920 15934 15958 15970 15988 16198 16448 16469 16485 16538 16606 16679 16716 16742 16818 17275 17301 17323 17430 17537 17738 17811 17895 17995 18490 18728 18879 18913 19048 19092 19231 19272 19317 19364 19608 19741 19803 19897 19902 19936 19970 19985 20013 20046 20053 20078 20096 20122 20129 20144 20159 20179 20219 20236 20256 20277 20299 20314 20334 20356 20371 20384 20398 20410 20422 20436 20459 20482 20500 20543 20594 20631 20816 20879 20915 20964 21055 21185 21238 21498 21545 21906 22056 22225 22365 22485 22617 22657 22704 22714 22722 22732 22740 22751 22762 22776 22801 22843 22876 22909 22944 22998 23023 23042 23064 23069 23075 23105 23122 23149 23167 23188 23210 23229 23239 23269 23295 23322 23371 23399 23426 23479 23489 23499 23505 23515 23524 23544 23548 23553 23559 23563 23598 23607 23638 23655 23682 23703 23723 23742 23768 23781 23789 23805 23836 23867 23888 23914 23927 23935 23946 23952 23976 23986 23998 24016 24027 24047 24063 24089 24111 24127 24139 24159 24185 24191 24221 24235 24249 24272 24291 24310 24328 24346 24569 24875 25293 25494 25734 25918 25996 26051 26118 26158 26181 26215 26226 26234 26257 26260 26263 26269 26280 26292 26305 26335 26379 26392 26405 26442 26456 26467 26478 26489 26506 26517 26564 26587 26636 26877 26910 27165 27186 27219 27272 27298 27325 27481 27487 27530 27550 27569 27598 27605 27612 27619 27624 27673 27711 27745 27802 27830 27875 27892 27993 27998 28075 28089 28099 28123 28246 28327 28437 28465 28470 28486 28515 28523 28564 28571 28585 28598 28606 28625 28658 28678 28698 28914 28945 28950 28957 28964 28968 28982 28994 29009 29042 29055 29110 29168 29204 29222 29240 29258 29295 29301 29309 29313 29334 29351 29362 29384 29562 29606 30308 30332 30366 30385 30430 30437 30444 30448 30472 30483 30488 30551 30672 30795 30808 30942 30944 30946 30948 30958 30967 30980 31007 31011 31017 31022 31031 31036 31063 31065 31078 31090 31105 31133 31177 31224 31240 31262 31273 31306 31326 31375 31475 31529 31531 31596 31645 31694 31798 31896 31937 32028 32035 32096 32160 32165 32171 32280 32339 32590 32731 32858 32926 32963 32970 32997 33043 33046 33067 33112 33163 33222 33291 33338 33443 33586 33611 33615 33649 33666 33690 33742 33793 33865 33931 34029 34046 34077 34113 34147 34171 34195 34228 34248 34258 34266 34274 34284 34295 34309 34335 34383 34406 34426 34467 34766 34769 34783 34795 34802 34821 34835 34842 34849 34858 34868 34885 34901 34949 34957 34965 34975 34986 35004 35021 35040 35060 35067 35084 35101 35108 35121 35156 35173 35192 35212 35222 35238 35251 35269 35289 35310 35320 35340 35360 35373 35392 35405 35429 35452 35465 35476 35481 35488 35506 35525 35544 35552 35571 35591 35616 35634 35641 35648 35661 35670 35691 35704 35712 35732 35760 35777 35783 35794 35825 35833 35846 35868 35890 35899 35920 35938 35945 35968 35987 36014 36032 36052 36065 36080 36101 36115 36122 36136 36151 36170 36715 36748 36776 36805 36813 36850 37162 37339 37416 37433 37451 37466 37488 37538 37548 37565 37587 37646 37804 37828 37958 37983 38109 38127 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_RC5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_RC5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_RC5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_RC5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_RC5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_RC5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_RC5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Annuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS628 5040 5076 5093 5108 5112 5116 5121 5132 5138 5144 5147 5150 5153 5157 5169 5181 5191 5221 5233 5663 5690 6266 6626 7311 7372 7450 7545 7585 7607 7625 7631 7640 7666 7670 7674 7677 7680 7802 7987 8215 8744 9162 9191 9204 9217 9224 9244 9263 9286 9329 9349 9368 9391 9435 9464 9505 9571 9683 9797 9851 9880 9912 9951 9957 9990 10068 10074 10078 10083 10124 10261 10271 10279 10298 10312 10321 10353 10394 10407 10532 10590 10609 10728 10784 10836 10847 10863 10902 11152 11324 11496 11551 11586 11836 12240 12539 12807 13168 13348 13667 13687 13700 13889 14033 14229 14363 14383 14416 14435 14536 14691 14879 15066 15086 15165 15263 15301 15324 15414 15435 15458 15477 15501 15531 15575 15608 15631 15643 15661 15929 16248 16279 16314 16378 16453 16523 16554 16584 16676 17167 17197 17214 17354 17495 17692 17811 17958 18125 18683 18979 19160 19205 19368 19422 19557 19593 19653 19703 19994 20103 20160 20257 20262 20297 20332 20347 20371 20404 20409 20434 20450 20473 20480 20497 20512 20531 20563 20567 20587 20605 20617 20630 20648 20672 20690 20709 20736 20763 20775 20796 20826 20856 20881 20914 20949 20987 21240 21309 21364 21425 21543 21702 21756 22017 22068 22444 22599 22743 22883 22991 23176 23206 23249 23259 23267 23277 23289 23310 23319 23325 23357 23398 23434 23472 23509 23557 23581 23593 23607 23615 23623 23651 23668 23697 23718 23741 23750 23769 23781 23825 23863 23890 23934 23962 23989 24042 24053 24064 24071 24081 24090 24124 24128 24133 24139 24143 24178 24188 24218 24241 24270 24292 24314 24336 24363 24375 24387 24406 24440 24473 24494 24518 24531 24543 24556 24562 24588 24598 24609 24633 24643 24663 24683 24700 24726 24750 24763 24783 24817 24824 24853 24876 24899 24915 24930 24945 24960 24974 25162 25467 25898 26089 26324 26512 26554 26604 26658 26706 26728 26769 26780 26788 26812 26816 26820 26829 26840 26851 26866 26897 26943 26956 26969 26999 27013 27025 27037 27049 27067 27090 27135 27158 27218 27470 27497 27759 27777 27804 27853 27883 27914 28046 28053 28102 28125 28149 28178 28186 28196 28204 28209 28262 28311 28351 28417 28450 28494 28517 28618 28623 28700 28714 28724 28748 28871 28952 29062 29090 29095 29111 29140 29148 29189 29197 29211 29224 29232 29251 29284 29304 29324 29540 29571 29591 29597 29604 29608 29623 29642 29668 29677 29689 29743 29801 29836 29855 29872 29884 29919 29925 29933 29937 29958 29975 29986 30011 30189 30243 30934 30953 30988 31018 31064 31070 31077 31081 31105 31121 31127 31202 31352 31471 31484 31552 31554 31556 31558 31568 31581 31598 31625 31629 31635 31640 31649 31654 31681 31683 31696 31708 31723 31751 31795 31842 31858 31880 31891 31924 31944 31993 32093 32147 32149 32225 32280 32330 32429 32524 32572 32662 32669 32730 32794 32799 32805 32908 32960 33206 33367 33522 33593 33646 33653 33680 33730 33733 33754 33800 33855 33914 33983 34030 34135 34278 34303 34307 34341 34358 34396 34449 34489 34565 34630 34724 34745 34783 34823 34859 34883 34906 34945 34975 34982 34991 34999 35007 35021 35037 35065 35117 35134 35155 35199 35541 35545 35560 35571 35579 35598 35610 35617 35624 35633 35643 35660 35676 35730 35738 35746 35756 35767 35785 35802 35818 35836 35843 35861 35878 35885 35895 35926 35945 35964 35984 35994 36013 36026 36046 36066 36087 36097 36116 36135 36145 36162 36176 36199 36223 36236 36246 36251 36255 36273 36292 36311 36316 36335 36355 36380 36395 36399 36406 36416 36425 36446 36460 36468 36488 36514 36531 36539 36550 36581 36586 36599 36621 36636 36645 36666 36684 36693 36737 36761 36788 36803 36820 36834 36865 36889 36920 36927 36941 36956 36975 37520 37553 37581 37610 37618 37655 37967 38144 38221 38238 38256 38271 38293 38343 38353 38370 38392 38451 38609 38633 38763 38788 38914 38932 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_RC5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_RC5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_RC5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_RC5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_RC5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_RC5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_RC5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisMSGTXTS628 5040 5081 5097 5115 5119 5123 5133 5142 5148 5154 5157 5160 5169 5179 5192 5200 5211 5236 5248 5757 5789 6281 6570 7115 7161 7265 7351 7387 7402 7420 7428 7436 7463 7467 7471 7474 7477 7588 7773 8001 8477 8811 8840 8855 8870 8878 8892 8910 8931 8982 8998 9008 9028 9074 9104 9157 9214 9325 9446 9490 9523 9562 9596 9603 9636 9713 9719 9726 9733 9762 9874 9880 9891 9908 9925 9934 9963 9975 9985 10086 10148 10168 10288 10325 10381 10395 10416 10453 10663 10838 10987 11022 11074 11291 11605 12129 12491 12781 13174 13309 13322 13333 13479 13658 13789 13923 13943 13976 13995 14078 14193 14334 14459 14473 14581 14674 14703 14723 14799 14816 14834 14850 14869 14889 14906 14918 14944 14956 14974 15175 15414 15441 15458 15514 15576 15636 15667 15691 15750 16096 16126 16143 16251 16361 16501 16575 16651 16729 17221 17441 17552 17583 17710 17746 17874 17901 17941 17987 18203 18327 18395 18495 18500 18536 18572 18586 18609 18642 18646 18671 18690 18716 18721 18736 18751 18770 18795 18807 18829 18846 18859 18871 18889 18913 18928 18945 18958 18969 18980 19000 19029 19058 19082 19117 19152 19179 19366 19415 19447 19495 19592 19725 19771 19963 19993 20315 20444 20584 20724 20841 20976 21020 21063 21071 21081 21093 21105 21113 21124 21151 21185 21221 21252 21287 21323 21370 21390 21407 21425 21430 21437 21463 21479 21500 21517 21534 21552 21569 21582 21613 21638 21669 21700 21735 21762 21815 21825 21835 21841 21850 21858 21873 21877 21882 21888 21892 21927 21937 21966 21982 22008 22025 22044 22065 22081 22094 22099 22107 22122 22148 22167 22195 22213 22224 22230 22236 22257 22267 22278 22296 22318 22335 22348 22369 22389 22409 22420 22433 22455 22462 22487 22502 22522 22534 22551 22568 22588 22607 22784 23068 23378 23558 23769 23957 24023 24070 24125 24169 24189 24218 24230 24236 24252 24256 24260 24268 24278 24290 24305 24324 24360 24371 24382 24421 24433 24443 24453 24463 24479 24497 24546 24567 24612 24856 24882 25136 25151 25177 25234 25268 25303 25445 25462 25511 25532 25548 25577 25582 25587 25593 25598 25637 25672 25702 25757 25790 25836 25850 25929 25934 25988 26002 26012 26036 26122 26170 26276 26310 26317 26332 26359 26368 26407 26414 26436 26455 26471 26489 26521 26540 26557 26714 26745 26752 26761 26769 26776 26790 26808 26827 26837 26849 26890 26935 26964 26985 27008 27027 27065 27071 27079 27083 27104 27121 27130 27149 27295 27337 27847 27855 27879 27897 27941 27946 27951 27955 27986 27999 28008 28054 28180 28271 28283 28347 28349 28351 28353 28363 28377 28392 28419 28423 28429 28434 28443 28448 28475 28477 28492 28503 28518 28546 28590 28637 28653 28675 28686 28719 28739 28788 28888 28942 28944 29012 29052 29097 29172 29238 29273 29354 29361 29422 29486 29493 29499 29598 29654 29930 30054 30165 30227 30265 30273 30295 30344 30347 30368 30413 30468 30527 30596 30643 30748 30891 30916 30920 30954 30970 30995 31043 31079 31140 31194 31275 31297 31336 31373 31405 31429 31456 31482 31496 31504 31514 31522 31536 31549 31561 31585 31626 31652 31669 31698 32022 32025 32039 32051 32057 32073 32085 32092 32099 32108 32118 32135 32151 32194 32202 32210 32220 32231 32249 32266 32279 32305 32312 32320 32337 32345 32362 32386 32405 32424 32443 32453 32464 32478 32496 32516 32536 32545 32568 32588 32599 32614 32626 32645 32664 32675 32685 32690 32696 32714 32733 32752 32759 32778 32798 32823 32840 32846 32854 32864 32876 32897 32913 32921 32941 32961 32983 32991 33002 33025 33032 33046 33068 33085 33094 33115 33133 33142 33173 33189 33216 33235 33255 33273 33294 33308 33328 33335 33354 33369 33388 33933 33966 33994 34023 34031 34068 34380 34557 34634 34651 34669 34684 34706 34756 34766 34783 34805 34864 35022 35046 35176 35201 35327 35345 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_RC5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_RC5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_RC5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_RC5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_RC5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_RC5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_RC5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..