'VjA=03?FNetBSD/earmv5hf ramdisk 08=Aj<  =Ajl*t t=Aj@@<@T 08=Aj<  =Ajl*t t=Aj@@<@TU =Ajthh`A=Aj=Aj=Aj$h =Aj=Aj=AjA=Aj=Aj=Aj&A.=Aj=Aj=AjA=Aj=Aj=Aj'A=Aj=Aj=AjA=Aj=Aj=Aj'A=Aj=Aj=AjXA=Aj=Aj=AjYA=Aj=Aj=AjZmD\!=Aj=Aj=Aj (08@HPX`hpx$=Aj=Aj=Aj N$O=Aj=Aj=Aj(08@HPX`hpK$t=Aj=Aj=AjxsM$q=Aj=Aj=AjFA=Aj=Aj=Aj\C=Aj=Aj=Aj]A=Aj=Aj=Aj^A=Aj=Aj=Ajd!=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj!=Aj=Aj=Aj4!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj B!=Aj=Aj=Aj B!=Aj=Aj=Aj!=Aj=Aj=Aj"!=Aj=Aj=Aj"!=Aj=Aj=Aj"a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj?\!=Aj=Aj=Aj>\!=Aj=Aj=Aj=\!=Aj=Aj=Aj<\!=Aj=Aj=Aj;\!=Aj=Aj=Aj:\!=Aj=Aj=Aj9\!=Aj=Aj=Aj8\!=Aj=Aj=Aj?\!=Aj=Aj=Aj>\!=Aj=Aj=Aj=\!=Aj=Aj=Aj<\!=Aj=Aj=Aj;\!=Aj=Aj=Aj:\!=Aj=Aj=Aj9\!=Aj=Aj=Aj8\!=Aj=Aj=Aj:\!=Aj=Aj=Aj7\!=Aj=Aj=Aj6\!=Aj=Aj=Aj5\!=Aj=Aj=Aj4\!=Aj=Aj=Aj3\!=Aj=Aj=Aj2\!=Aj=Aj=Aj1\!=Aj=Aj=Aj0\!=Aj=Aj=Aj7\!=Aj=Aj=Aj6\!=Aj=Aj=Aj5\!=Aj=Aj=Aj4\!=Aj=Aj=Aj3\!=Aj=Aj=Aj2\!=Aj=Aj=Aj1\!=Aj=Aj=Aj0\!=Aj=Aj=Aj2\!=Aj=Aj=Aj/\!=Aj=Aj=Aj.\!=Aj=Aj=Aj-\!=Aj=Aj=Aj,\!=Aj=Aj=Aj+\!=Aj=Aj=Aj*\!=Aj=Aj=Aj)\!=Aj=Aj=Aj(\!=Aj=Aj=Aj/\!=Aj=Aj=Aj.\!=Aj=Aj=Aj-\!=Aj=Aj=Aj,\!=Aj=Aj=Aj+\!=Aj=Aj=Aj*\!=Aj=Aj=Aj)\!=Aj=Aj=Aj(\!=Aj=Aj=Aj*\!=Aj=Aj=Aj'\!=Aj=Aj=Aj&\!=Aj=Aj=Aj%\!=Aj=Aj=Aj$\!=Aj=Aj=Aj#\!=Aj=Aj=Aj"\!=Aj=Aj=Aj!\!=Aj=Aj=Aj \!=Aj=Aj=Aj'\!=Aj=Aj=Aj&\!=Aj=Aj=Aj%\!=Aj=Aj=Aj$\!=Aj=Aj=Aj#\!=Aj=Aj=Aj"\!=Aj=Aj=Aj!\!=Aj=Aj=Aj \!=Aj=Aj=Aj"\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj \!=Aj=Aj=Aj\!=Aj=Aj=Aj \!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj\!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj$!=Aj=Aj=Aj4!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj !=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj?\a=Aj=Aj=Aj>\a=Aj=Aj=Aj=\a=Aj=Aj=Aj<\a=Aj=Aj=Aj;\a=Aj=Aj=Aj:\a=Aj=Aj=Aj9\a=Aj=Aj=Aj8\a=Aj=Aj=Aj?\a=Aj=Aj=Aj>\a=Aj=Aj=Aj=\a=Aj=Aj=Aj<\a=Aj=Aj=Aj;\a=Aj=Aj=Aj:\a=Aj=Aj=Aj9\a=Aj=Aj=Aj8\a=Aj=Aj=Aj:\a=Aj=Aj=Aj7\a=Aj=Aj=Aj6\a=Aj=Aj=Aj5\a=Aj=Aj=Aj4\a=Aj=Aj=Aj3\a=Aj=Aj=Aj2\a=Aj=Aj=Aj1\a=Aj=Aj=Aj0\a=Aj=Aj=Aj7\a=Aj=Aj=Aj6\a=Aj=Aj=Aj5\a=Aj=Aj=Aj4\a=Aj=Aj=Aj3\a=Aj=Aj=Aj2\a=Aj=Aj=Aj1\a=Aj=Aj=Aj0\a=Aj=Aj=Aj2\a=Aj=Aj=Aj/\a=Aj=Aj=Aj.\a=Aj=Aj=Aj-\a=Aj=Aj=Aj,\a=Aj=Aj=Aj+\a=Aj=Aj=Aj*\a=Aj=Aj=Aj)\a=Aj=Aj=Aj(\a=Aj=Aj=Aj/\a=Aj=Aj=Aj.\a=Aj=Aj=Aj-\a=Aj=Aj=Aj,\a=Aj=Aj=Aj+\a=Aj=Aj=Aj*\a=Aj=Aj=Aj)\a=Aj=Aj=Aj(\a=Aj=Aj=Aj*\a=Aj=Aj=Aj'\a=Aj=Aj=Aj&\a=Aj=Aj=Aj%\a=Aj=Aj=Aj$\a=Aj=Aj=Aj#\a=Aj=Aj=Aj"\a=Aj=Aj=Aj!\a=Aj=Aj=Aj \a=Aj=Aj=Aj'\a=Aj=Aj=Aj&\a=Aj=Aj=Aj%\a=Aj=Aj=Aj$\a=Aj=Aj=Aj#\a=Aj=Aj=Aj"\a=Aj=Aj=Aj!\a=Aj=Aj=Aj \a=Aj=Aj=Aj"\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj \a=Aj=Aj=Aj\a=Aj=Aj=Aj \a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\a=Aj=Aj=Aj\ !=Aj=Aj=Aji!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aj B!=Aj=Aj=Aj B!=Aj=Aj=Aj!=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj!=Aj=Aj=Aj!=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aj a=Aj=Aj=Aja=Aj=Aj=Aja=Aj=Aj=Aj=Aj=Aj=Ajbpf!=Aj=Aj=Aj $=Aj=Aj=Aj $=Aj=Aj=Aj$>=Aj=Aj=Aj#$=Aj=Aj=Aj($s=Aj=Aj=Aj*$=Aj=Aj=Aj0A=Aj=Aj=Aj2m =Aj=Aj=Aj8@/$=Aj=Aj=AjH3 $=Aj=Aj=AjPA=Aj=Aj=Aj_A=Aj=Aj=Aj`A=Aj=Aj=AjaA=Aj=Aj=AjbA=Aj=Aj=AjcA=Aj=Aj=AjeA=Aj=Aj=AjfA=Aj=Aj=AjgA=Aj=Aj=AjhA=Aj=Aj=Aji3}18oj @{ؽX-wK}X}o`P@LSb "DL@gFclKqlo%G"*M:鮀 duN~xz'I+ds4GAN whd Aֈ(&O 5Uh YQ6+n^13haRt:UuSw!KADj2x  g ]oΈ SMdQLg 2JVw[>z ~>.@@IXl&_TMYqs|wr*3)Z2b[f2+ [/F/,# tGm_]/# [UN=bcNۘbHYD!ms,i#+xN(M7; pJS*BQnY"|g%#ju#MMR-#}D$j)X*~KLXm8W$[SpL6Om '-Z.t:na u(U[uGtt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(40Y!4 (v v  $$LL $$NetBSDAPaX NetBSDearmv5hf3D0D 0p@-0PMF 00CS000  00`0CS0D00 q&&uS}%N) &t @-pPPFP 0 ^Uq00 0U00 V^&P 0@-!0@@S\000^ 0&O-P`  }GUt2tIP @  @P  Ѝ@\4r( P PUU  P[P020`00  R RS0IP P 0SOt  h!S@@@@vP4;L~8 4000CS010 SeIPT 0@@00S ` Pj P A P 0@0CS0`00@  FL&j4&&8}%&&uS}%N) &p@-Pd`d@000 PPPP0P0CS0p(00 p밝&& &G-@0` V VЍp-PP 0崀 尐R`00`@0StP 0S  0 h0 0 k?o2S @`sPꨝ&,&8&(&P `00CS`0p S00 P0S X0X /X8}%O-pḢB帲`0S@ BpPG0`F [stlV000PXDK4 0, 00C0Cf 200CS010:0PUP1 ` 00CS00 P U Rp0V00:PJB  00C0S"10 00CS000 U0P 0@ J |f V 0  00 0 @00S 0S YI& &&uS}%N) &8&O-M`DRD000042000$20S y@ r0`0#0P 00%T0J?o20SS SR9 0S 0E  0 K0P00CS0l10 Ѝ YS ]0P  BR   @0S 0 0 0S  R Z@T    0S Z dl埀T  Z    00 00S@@ &8&0&&4&&}% &$A-P0`!SP@I? 0?pP0!S P I#P 0HnHy<00S0 b$0@k0_}%6M&e4&A-Ppp@`V0S P I, (>$tá@&uS}%jO-`@ ؀0SP uĐĠİp0 T T R R j0pOP Ѝ PP P   P Pp@&0&8& &A-p0`!SPeP@MI 0 @X PP0!S P .IqP 0HH<00S0 UpGP 0_}%|&eO-@bP00CS0p0@h H@  0 `001 pUpP@0 儱p W1pQpTP0PP00 PH8 `, 00CS010 y 0P0CS0000 S00 @ X 0000  T0 `0U0 0T p 0 8}%&}%&&&uSN) &8&&O-pLP0 SPEUP ЍE P C0 X01b U000PRH  00C0S 20  70 0CS0L200 CZ 0 PPE C P 000S S  `V$0 V00>P HEx tp 00C00 0CS0@100 0BX 0PFP 0 0ZPF C V&P嬀VP0PP00P Gt pPl 00C0m0 P0CS0<00jl00`6ꨝ& &&uS}%N) &&O-P@`p P`T  0PS }P 0@^S00\P0S @\[ ` 4P X0 @P+0P00$}%P@-@T 00H0 P 0S( 0C00S 0C0 Ѝ &ht@$P0 R  QQP0R/@-  &G-pPQ@ `V 0S0S  @Ѝ0S V 0S@@T0S VT@T0S @NP 0S  0 0 P 0S &G-@P tp0S'`$PUP 0 @PP @ &X0000D@-i 40aA R    0/% &40000 01h@-J % &G-R肟@p0 0S0"3( 0`?VJV$ V00 0 0S0 =D TFd @1@s4JF0"S04 @pp FQvQSSSR`SSP[00`F`0"P/  K P) 0100CS0G'(P; 0堑0 S,ڐ  S  XPC` 00CS00  0堑0CS00  =0Pz &juS}%N)A-`AqW ڬQ1ECe R00  C0|00PPB Z00CS00 t 0q0CSQ00 \R `R ` &uS}%N)O-0D0!10Pp Ѝ0S/  $SPPPPPuB\ XT:00CS00  ]0Q0CS001ԃࣟ! P 0 S)"Rʜc0U```00rP 0b0CS00 =1 Q !@o!S/ %S !`V U 00 0CP 0帱0CS000!000\Q00`PR# !RU``0``00Pc 0a0CS00jl0` 1 1S 0S11a0Sڐ  S`l  P6 0a0CS00=?10`! S:`Fp00  1S pY<a0S ʼ1`0 BRpE`  S`l  P 0a0CS00   &uS}%N)&4( Q 0@30/@-E &`01S @-@0!S @|>P /.P / &m7@-A00 S1 RUVʐ0\00OPBAW 00CS00- 000 @ R, R uP Ѝ00!S HP )f0 Sڰ 0R0CS0000 0 Q  tP   &%uS}%N)HY?A-O0 R ,Sp WX ! GYQ_YR\}}}}}}}}}}}}}}}}}}}}}}}}}}}}|}}}}}}}k}mn}}}}}}}4ss}}}}my}}}}}}}}}i}Ljjklm`nXoohpplqTr}rs,t4uxymyL{}{PP00 nR pR lR 00 S  PP1S 'PPPP0 nR pR lR 00 S1S /PP0PPPP0 nR pR lR 00 S1S  P0 S00P0PP!R "R  R$ 000@ `PP 0 nR* pR# lR$ 00 S{Py PPP~0S!S 50S 1SkT ^P0PPpP`T +0100 +0X R000@ <PL 0!SP 8P00 nR pR lR 00 S(0S 5 ^d.PPQUH  P G@ooG`GoobPVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 SH)0S << P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PP~PP0 nR pR lR 00 Sw1Sw P zP0PP  P P` 0 nR pR lR 00 SR[P0PP;P P0nQ pQ lQ 00 S 3 PP=; 0  P/p PP*0S\ `Vl0ViV PPPVPU$p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S0|40S402P0PP0S 0 l0C0S030 S~1S 2SqW P000@ 0S0 0h`PPw 0 nR- pR& lR' 00 S[1S[!0R!S X 30S1S 0c `PPP 0S0L 1JP0PPPr`0 gRG  R7 0 B RL= `8@p?B=0"S; b#pR1 rR1 U0 R 0 S( 0U0b0 * `P'00CS00 P00 S2S 02P00PP2P02 P P $0b200CS00ULWP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"% &k4$$$&uS}%,&& In!&$^\3!2R000#2 0# 020 2 2020P0PPCPYp PPT0S) `V0V PpPӒʈ0 nR pR lR 00 S,1S,02P0PP0SPӄʈ0 nR pR lR 00 S P0PP QR000P0P00@h `P 00 00 P0 nR, pR% lR& 00 S!0R!S  >20S1Sm bWW 0 P0S0P0PP1S 2SqXP0S 0 l0C0S030 Sp P0010CS 0nQ( pQ! lQ" 00 S3 00SE;` T`凫@p;0"S8Y`r 0  PP00 nR pR lR 00 SK0S vTPP0SPPH0 nR pR lR 00 S,P `2S1HP0PP P   -@-0 0 ЍЍ/'$&-0^S0]S0]S S]S[S .0L0S^30   Q  ]Q RoG-`ጁP@0 SS&tPD(!,RF`a`qU`0``00P,:( $k 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a 5P0  0@S  0Gcꨝ&$&&uS}%N) &h8&!p@-0 P< P@01SE0p0S S u`Pp@0P 00S0PP00 ,P l0X 00h0Q P0J:0 ,(ꨝ&$& &&'uS}%N)O-|b|B0 %Q + \r\P00 SM Y< U 000O"P$:V 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00P 0A0CS0000 P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pkꨝ&X&& &uS}%N)&&8}%A-0P0 0p@ W 0 `BP! 0 R00R000 1BQg9@X @R@p\90"S,$@gR000ꨝ&X&O-ScpгM@00 0GS TcsT`0``00eP*9m` \X00C0+0&SK BR D R: Y J @p R9P8@ 00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?ˆr L\ DR-WpBp@| \   P 8D @2<h00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq0  bX&& &uS}%N)O-M0@ 0P 0k (40S  0 0 000 (0 pP `CԳP0 S pSP(0Y01ڜ Y   $ I$P 8P` \X  BR +@30 #   BR 200S 00  20 0(PP0 ߍ000Y\ Y   $ $P  BR 200S 0 z 2 P004 Q' 0 p1pG Y<Z  L1 P78 40H00CS0tX 0 00"2 00(0 AP< 00CS000\^W 004 00 vT00S 0  '2< "2Xb`8&X&&uS}%N) &jO-㴡A0QM0Cp` 01 00C S00`NlЍr 0 P5 3P!` 00000`P00CS000  [  E0S00CS0x00` P  P(&4&&,&X& &O-M R B000bsp 0soЍؑ؁0S1  0 0 0P@ 0##੟ɐ Y Fp10S 0000000p0CS0C01; & \" \  00#0L\ 0C000@00000000 0C LN +0&$4&l&&&& &A- `P 0 0Cs 0x 0t0 l  C A^  00@pT }@ 0l&4&$0&G-p@P0 `R0  PM(S%H0  d .P 0 ,a(l&uS}%N)@-0 M}%O-GMdM0PS@p$Q403/P Ȥ0: S500W ++ P9:5?0ؼP0: S 0SP0: S 0S 0S 0/S&ᮼP3᳼P0S2P( lP x#0 PN++0P 4#]P]zP Y/C/P CPpp`2P! 0S0S r<$XG X00CS0kpp Pph pYWr TTvk\H Z0Sh0S0?o25c 00?G YU.0.0 /G=0JPT.0.0 /G=0INP804@pil0l 0 0  L00S   SS}%& &&$0\ 0S A >&S0L0S/0 0 0/0@-M0S    4 ;$}ptGhЍ\0\@ X0R@P0 B ?) 0Ѝ@ꨡ&&ġ&̡&ȡ&P `00CS`0p S00 P0S X0X /X8}%: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\巼@T10S H10S. 00 00,10'p ᛼@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?) 0kT00S ꬡ&&ġ&z& &&&̡&ȡ&&s@- @P@P `PU00S @GT CЍp0t  Q \0 \@-T (P@$U &(&p@-P@Tp0 0C0  $A @G-@0M'(3$30S` V0Ѝ0 0C0{ 0XPS !$߻0S 20Sm 4 "; $,pt ûA0(  p庻H20S 04岻 $宻 20S   妻0 : SK( "0 08"$4哻10S10S51!0 0H 10S|10S : S0: S t`x81p 01Rp(1 B?' 0W'Q p| , pCP^, :00S (&&&&ġ&z&&>&&& &&&̡&ȡ&&1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQ0P  00`Sp|QPPU% Ѝ  B 1`0    0S[  L0  $R,   V ꬡ&&ġ&&&$$(&410G-S$0@010S 10S,0000 0 0P?0`VG`g렠paPUG m0 0C0 W dp0$S,  `YpP T`ꬡ&&ġ&&&$0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG -0 0C0 W ,$p0 00 S p0$S,  Fp` ꬡ&&ġ&&$@- M @ ᒹp ЍT  P \0 P 00 0S@SQ0   0}%0p@-P0S``&@P `(PX As@P8 G%P岹Ἰp &WSC-CM@m& 萟P`J+ F+`T *F0  pPPCߍw ? @P)+w0S ?@׸P?lP@@%@-M 㘷#}% 000/4&@-=0 ۹ㇷI}%@- M0P!A00P00!0 0R㕲 / pH Ѝ "$ 0P @000 l0l  pX   DH圂"$  (0啂4&SO-@Te-MQP Pn *0Sr  pP 0S P  Pt00CS01p0pЍ0S  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxݱP PPԱpPX ") 44 Rl(O p 0! 0 X 00CS0Xp YX 0 P 0S  xlPᰱP X0: S P@Pᡱ P  ꌱX0: S)PX #pP`1b0S ㌲    P= ߴPE ֯ R (6MP /0 ¯S , !00 a A^ (! 0  A {{z}Kp گ00@0  P Dp lP )0S X0;X0XP ߘP )0-S ҘᣯPVpPx0S  H堷OpY@4& }%8}% k)S9DRfss@-@ `PBP 0P U*\ZЍpU \@NL0 P4  @ $A-~MAM0pS P0` 0`吰P$)p! p~,P )@!1P~܍Ѝ0 0`pP) ~,PP( ~,׮P `0 0RP(x W Q `104 0:P(0( b1 $m 1[00CS0 ҷ0 /O-`UDMp E0%00000 0000SHHV"4`0p Q 30Sa4PZ|PZ|(0d$1r000 0K<$TPh( $00V 0030p Q  #7P0 0I(#00V0030l# P4(`#00L3000DЍp(0: S ]0 S" |P 000 S|2"00"0 0R0  Rz2`2Vn `i S0% 00 0-qp'0S 唠00 0p) W W)2`V%  ? p" 10 R0  S0R 0!CQ:++R:0'WW`a~0@ 0 B"T04[@T ;0W ` W00l W0~, ~l0`Z BP* BP*Q*S  Q T0` $X&(&X$$N'x&6 $)$Hm8@&&8$}D00S/@-~M0@0S~, &P~܍X& $@-0p@$0l00S Ѝ00 0n0Q (', /JP $X&yL0@- R<U/P 0 0 I/X&tO'&A-p`P@ ٬0PPEU`@T@A-p`P@ ᦬0PPEU`@T@p@-P@Tڬ` 0Q@Pڄ0  Q @;;S p蚬@P00T@ &(0, D/( . $X&& *@-,BPU` Vb0P$00 p?W0 pGWhPh&0 SV.00P ЍP#ڀ;;S 00 00Q P?PpH1p0$ppQ Q (% 00$0SP ( .E&0S00?&0ES008&0S 4&0ES $0Sn.)&0S %&0S !&0SPU &(0, . $X&KO'*ut!0SX@-M`Q0S T100CSD:.Ѝ0S0SS/ 0070S S00.S@0S0T0pS0p L Qo 0c p T0Q0P0 0P000S$ʲ/X& $X$5mdG-PP`0  ,p@P"ڴAQ"Q 0Q P 0Qx%D  .ЍP 0S $X&@-PtaMP d1@0S2 SU@D;00U0p0p 0QB%!-Ѝ P0S(0S 0nQ)%  Pڌ0U 0?  dW-0 P 0uP % 00 - $X&'Ty&mO-Mr,M R(`RX0E@FP!0 0S ጒ000 S (0S d  T"zpL20 0k8"0JmJ? "00fTo" ?K܍,ЍT 0S =! !N!0`Ho ^10Sx1pp1 00+8!0J-J?08!00,q00$1(`(0 C0娀J 00 $0  0x  0  `   TX$}%X&O' &tO'o0& (& & $* C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S Q1 墲3 0S kpP (0: S0 0< p10S10S P٩P 0 0 0S q4RZ 1 00 0S00p0000 S(00(000 P@0S 000S x0 P 0+P0p0B 0X2 $(&X&DO'O'@O'LO'tO'[ x&X$O' O'  && A-MM0 LP|##,G @Pp#",RB$0`SF 0`CĂ0S2t+p P}  Px 0 u S( .p`+l^+h2Lr0`0CSXXU+R+HP+DN+@L+<Z+P,l P000 0;+2 `ލЍ1+0S  R  sS SS YSQP+yS+$qx+l +<+P,, P 0S8 4# P( 1P *0S(*PP ܯoP0000**TO'   $X& P'tO'  $$ 2 X$ j   =  ` @O'W x n    1 A m]  ~     00@-@HpSp`\$O-L|q| \0S(P1`XX@P"@U(,L0 R1V10S *@DT  A0d#0UPTP*PV0S tw*`@`ꓢ"H 2/L0P ! 咣#, 0:L$@$(&X$ )& O'O-@Q0p`F@ f[ PppWPH=* ЍPT10S ,*p@ 0$0 3/P$ 0 R T  A@> 80  3/PtP`\00Sd `) Q < 02/P " "O'(&" X$H k 0&)&  @-AMMP//@P+ p`pEP/00P Up0p *AލЍT0_"/0P0 0, 00`*4& (& 00CS0 x0 /O-0S$M00`Y P$Ѝ$P0,03/P00pT30S ,@C@sFP7PPP 0030SY  PV ަ20S v!P!P x4 CSR P8 ,G ѦP 7"y) H70/SWP A=X | 10S  P0S !S 0l!202;/P Z ,"81  0S a0S 1100C `]0D0 3/`7 0S 0S 0VP0x0CP0&P"P0403/OO'O'0&DO'O'TO'HO'0&^4&5&O'LO'(&@O'&@-<@PM ( ((&x@-7p @@8  (@-@p+  0(@p@-MPkp@ 0S  0C0  `Up 0: S@S NS Ѝp`C-MzPЍa0H03/P0 03/PtA]pP@ 0AS0 @0a3/PE0 0#P)3P/P WP0/S4P A00 006@ t 8(0(03/\ egr0 PO'0&4&5&}%8}%TO'O-MPЍe0H03/P0 03/PP㟎D50S 05坥P ^%'50SuJG>P 0(03/ #P 0AS0 @0a3/P|4C003P H4 C(P(40S  gP T 0 0  \P 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXP, A> S0 0  P0SW 0S = $ `0Sd002p0St000S "SD p 0 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P |1 Hb X RP$PP ,1Pv 0 P E @ ;/0S0S P0S 000[\000*4S 0S 0O'N'\$O'0&TO'&O'4&O'O'&0&&5&O'O'DO'LO'|O'`$@O'G- R@}P T T 0 4&@H03/P0 03/P0SB0 Y Pq0 09paMP P: 0 P0(03/P@F P0 0 @0S 0' 00OP@' mo?P0 0)t0 0S TPP \0 CY yPO'O'DO'O'0&@O'LO' TO'tO'&T0@-0S\PP 00H03/P@O'O'O-MMD嬀0$0 PP PpP4( 2 孤 040p8N'0@-PM@ ڞPh00S Ѝ0 $ R\ 04 0R\ O'0@-MP @ᴞPЍ000S0: S|PPU GH 0ၞP 0a8 0O'LO'0@-M@, 0000S# Q0S 10S iP'0S% X0 ?A3c000S&!h0 ?A3c0 ᠝P 0NS ` 0Ѝ0D 00S Opl$h$MbG+p@-@P`SP p P $0 0YpLO'r@-!@P 00 @DLO'O-P0$/SM`p//0@P7 P. jp /00 ͝P&  P!00S  ᬝP P0 Dx ЍO'G-@P 00/S (QP 00Q G &ZP70 0`0S C뤀夐p0 ɣ,P0S@$<jPH0@648 @D8N' O'LO'$A-M`P@pEP5(10S Ѝ 0RP  0RP 0: SP eP 0]PW P  P W$ 0@?O'5Sd:(40@-: SM@=0P - \ 00[ P0 לp 0: S0 Ѝ000 t~:P/  0 fA-pQ?ZdV`WPWP!0@1@0S/0(DS7 (1!0 0 =  "4S pNP-p 0h9 040Ѝ@$<@0(DS PL(DPL(DP| z00 0O'O'l$h$8N'O-J#3(tQJM0 M`p P 40CS񟗄$3P x30S #P0: S* XP2,3,0(So0S| ( 4S~ 0S20S 4m0C?o2 000! "p"{p"0 ,XZ/ Z\20S0 P"0 J>0P@z=0 Czᒚ Jލ Ѝ  s Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40sPz eP#zP% 0`0 + C`\ \0Q0O0S0(4 008 00tO' O'O'O'l$h$O'$ E/O-Mp@ W 0DQ 0S8 00<000SPP0C080pG0S `0S : 8 00 x! x3  P< @0  0R X2@ ?@ Q*@0 :0嘰 R ͟P` hЍTT F   ` `@{]P'P'm P'P'Rs@-Ѝp@ 0@`P Qc< 0$ PU 0HN'{0@-@MPPD00<00S =  J"Ѝ0HO'G-`QM MJP Y@ #p P p 00PP=! SR J(Oݍ ЍkPJ8 = $ HL0RP J(L00 0+ QJ8 PT6G- QP 000aq@T+00CS0pT0 0S0T@ 0 S@ 0   P 0S@ 00S 0 S P LN'XN'$8}% 0 0 S@-0@0R00000S0@000S `1P PP40PO'O'LN'O' HO'p@-PP 0Sp `@P`  @P0/S000000f PR @@@p)DLN'h0 RX R  H R/< R/ $R/Q/ LN'O'O'O'l0A-0S X0XPX`Xp@0T R S9 ᇠ0@HO'LN'uS}%kC-@b,M 0S0S/,Ѝ0 0P50C S>$P$$P$|#0$P$P$D$D$x20S X00 00!P 0 000! " PPP  0!$5$!0 0!0 㓝z I XBp (4 : S>  S8  S%  S04 0L! 08!  J1P6 S  S0  S04=! 0400S -Ё ;ЂЃ"040+0 4P70P 00  0  OLN'HO' tO' p@-8M@  FD 0`P`F 0U` @uP8Ѝp&x1A-hM0@S\ ዟhЍAZ`(x="(<p@71Wpp P0 0000084g40CSH$0"60"$Y0( T4 CR+x KhЍB>'TBS+<  hDO'uS2DcVOk@-=XM"@p:(0 XЍ^7@-@Pp P Q Ѝ00  F Ѝ0@F0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 30@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 0EPpANQ0 C S*80P @-  //O'gA-@4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<= P000 L % P000U00 S 0⋴P P00  @P00LkP5pPJU%PLPPP, @WP` P@PU @p Pf% D`P  lP 8Pr P  P P_  P[P P 0S  dp@605pC0C 0%5 ßp "B;405% 50 0R ԙUet0d0T?o0c8D00CS09 GzR񟗹F@@@@@@@@@@@@FF@@,F8F@@@@@@@@@@@@@@@@@@@@@@@@@@@@@?@@@@@@@@@@@@@@@@LD`D@DD@E,E@@@@ETETEdEpE@@@EEE@EEE@@@@@@??(@<@@P@@@h@|@@@@@@@@AAAA B B(B@@DR@P꼃@2PH |-3 @ >2 @ 9`3@ <2 3X2 @ .83" *2 @@ %2 @ 2 L 2LP 20Aⴁ娑00 RK aR eB Q PAAAAAAAAAAAA !00000 00K1]PJd1 J T1 I 0 I Hꈁ 0010 L0⥖1Pd HtO' O' P'xN'@$;w%X$LO'}%}%&l&%O'h$+O'O'l$O'DO'O'$$$$$x$O'@$]D|O' Ei8}%k$nJO'O'd$HO'O'L.*}%2fO'0&E\O'O' &O'O'O'O'O'`$pO',p&< P' G 0.O'$w%$xO'<$ @#4L#0@'0  0 G 5가z0P  ,G#,1 F  1@ P00F 4P|`1*PE1 E 1 D s1 1C1WPC1PB 2 B 02 A @2 A P2 p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C ጗0 0S3# C*SS8C0U Pg000Sv|30Ueڌ3PEPhPN0000S3 Y0P  /xN'l0P/`0p@-0T L@LPP@0@P6 'BxN'O'Kz}%tO' A-` @PA?\+ \ *\.  Q R( [\SPQU  !\@@]^.!Lo \0S8 /0S 0R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ O'p@-@@0/SN00N P`RpPQP`Q*C0CT0@"03L00Q*pQc  1@-M MP AaqR P/P 0P0Sۍ Ѝ.S@T|`l @ @tO' Q    m    $!O-cM M33 "p@3]PW00 `00S 0f00 0UP` 00 `;RSVz 0 0@;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 展 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S ᛕ0S s A0l 0 x劕@T *0S0T00  R S ( 0 0O' O!!}%!i!C-`PMM RP  p\SP RT P0S #  0Sœ\S R. gS PS$ SS GS ᰓ(0 0=pS sS0S00 R @@@(PP"P ᄓ)@P p 4P ; ᐠ80 k ۍЍ!D""0O'!!A-PP 0Sp`p@PL P40 pR `@ @ @b"w"0O'X0A-TPT`Tp@0T  SU ᣔ0@0O'uS}%"`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0 04‮P 0S/  00p0S/  `00 @0/S000 0D$ /0O'O'O'8O'""A-0j40@TPp 00S0o`0 00/S @Tx0T0oP0 SD fP040O'O'O'2A-@0PS' 0`.S0.S0S/S \VP 0 Q CR S.R  S.R0S/S { 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p x00C0V0@0E `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0T T0A0 B!"00%A-@QpW : J(S20d 0900CS1000=P   0 R ⨁0≎ᩑC  S.@ 3 b 30  J(LPu[[0P001  =ЄЂp 0(ZP0<x SP0@ LP00 0 CPP t00 08P` #PJ>PP P >P'u*****+X+;+N'// Qp@-(0PS$ l` @P|t 0000\0 `%V0 $ @p}+P'++O-P`P Ѝ#:J084YqW V#c/0p00K0CSt3l IPk 0<00D3  a  d 㒝 (|qp  }? $00040J0H1gP tq@0 B<(1P lc<0 㓍 H K06S 0S 3 CRUꈀD,gSy K CRZ 040r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $R (4 @ 04&"**0000 02S($0 *4($0)40($84  R  KS 0 040r;;000 0KS8  0( $ P'P'+5,P'+ ,,O-z4MS@- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA | 0CS*! *8ЇX0I{{pP 0p)*NЇX0G{{P 0pptk 1  :x0p!z 8 {PpX  :x0p!z 8 r{PpX  :x0p!z 8 `{PpX  :x0p!z 8 l{P!  N86PpX  !L8@ Z:w0@! @ 8-{P@W p W0{Z{p8P'S@-G 㒁.}% 0p@-P@T 0Q00S0P0T`00000HFD00CS000S pHQ'DQ'A-ph@h`0P000SP'U`00CS0$00SAHQ'hP'DQ'p@-@H`P0S@'T`p QPhP'G-0a000P60@ R'QS \!0 00CS000S 0 딀唠`D pYG70X0Y00CS00 W 0pHQ'hP'.DQ'h/X$0@-S R' hP'A-pP`V@ @P*Pp@-XPI>@P hDP0P 000@aT8@pInS 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R0'o  -R0(h )d%b#`0 ]%$Q'bQ'5/ Q' Q'z/0 @-Q'/0s@-P0`0nZ0`0S@ P 0R@P@  P@0S00S 0ST P000 R  ЍpQ'4]'H$/b/@-L ^ԡ,ThDt8\T @@~, \ 1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !/ 00O-`pu딠 %RP@@W &R X(4! 0[00 @ P@P@ ЍQ')00@-4M!@p T` 0 P@4Ѝ0@P SWP@V P@ 0 F2P@( P@X :XQ'p@-@P0)SpQ'O-@D4M`pTV TY T( T) #T! @$TU "T 0#S@P  +4Ѝ'0DSYG x@W'0I S@ 0 0S@P'Y00!p0p~ W! sz!P l0 @@! `0 @PWWM'T@@p4 @P@~ Q'`070E0O-M8Pp`4! @00 R@0DS U# 0 \ 00S^^ :U 00SY` p PU@ 0DS ЍQ'C-`p 0BS00@SP! @00P TP@@ ЍQ'G-`d0SP@! p000 PP@Q'@-M@`P2PL0P  IR NRpp PpEp@@0SP@ $z2ЍQ'r0PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P03.3Sp0@)2PH0@P 0,aS@3ꪬD$<$ X'4]'J@P/-0 /RRR00(Q'@-@PMލ0/S\  wp wp 0RP 0RP꿪p@-`\1@=P 1D0p@220"SP Vp~(Q'0p@-T` RpH0@Q 8 PP 1pp@(Q'$0O-pHWR 0S)P |B000000000CS020S 3@T  Ux U`W#LbLf1U~82@000/Sp?EpPI0S0/p0CS0oppW00D2000pA0P00 8|00,1 hU` U00CS0810S 00CS0 0W00 pR0S/S0@D00 2@ 3P  R*0000t/S0S !P 0/0CS0 pG0S 00CS0001@1@1@(Q'HQ'DQ'00 X'D$<$mA-p`@000|uP 00CS000S q00CS0Pd00S b%@ HW 406 R0S 0QHQ'DQ'0H$(Q'uS2G-BMP8)r0@T%+V@P' 0.S00.S000/SSJX20Pp  `PF } ePZ( `V+?PP "` A0 E`0E)}@}0-S0SH1@T@@UPT0GuPw0S p 0P0: S W p/PXP PW 0S| p/PsЍH$0(0@ ? `0d00@T !1PhoP0 `0~@Td0 0,o 0hP@plPT 001Pl 00$0`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0d>0S$0S h@HnpT@ xP H0N7S 7S7 >0S800SD -00000,(00 0p(0P =&0S67S300S 0 0S+00000P= 8  k = , lp@ P <P ,`,Pj<0 M<8 V  &,( z%P000<<0S @3 @J$ 0 $ R 0T0<<r1,Hh@T: =pP{`P I00CS00 G 0PppI@T4`@T @ t[00CS00 G 0 H@`@T0k PU#00CS00 ~G 0 :_G 00CS00 jG 0  bBPP @07L:0P @PPHP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 vH$0SP0077S 0C8#8S0)SS C708#8S5CP0 Q A!QF8 R 0 00 Q0 -PP -P R 0S0(0(00(00S 08  @  (00(00@070040+70<00L姕P7 l7H 00R0( ?$0SP007,GQhJ 0X'000 000D7 <'004'00(0(7$ 10103/$60 G6& 6& !FL0S TL68 \6  @ Re 4 0  ` $E~$6 @, Di &00CS0 rL]60S 43P 60S%,0jS55$5 h0 MX5,( ,0Z0000",( 0T#E0$0(0S,? $4 50S 4,0S pit<$040S 0 @0 $BPDT!? 00<0$0 0C0 000D00048` \X/R00CS030S ⫔P) 30S*T0SXRK38 P3 L3 3\ T30叔C*00A< 3 0 0S '|0R"C"0 0 3 BhSL00S0P}0l"0C0000QFKP28 2 2 B 2\  <*0020 T0S!00CS0 1 R   01D0S$uߍ;10S 0t!SSsL1 08 L0H@pKip10@0@0S0  @0SH1 0$ @0S 0 @0s0 RK0S0   B  @0S @0S7S@<N<0 @00S ^'8]'XQ'4^'4]'H$Z'HQ'3^'0DSQ'o A-@MP`Rk4P1000  8p"XZU h#CB Q PBLBQ<C 00AS 00CS00 B 0* 00CS00 zB 0 ЍQ PBB000M |00CS0 TBBHD00S @0`^'454>4SX$HQ'G4Q4W4DQ'[4p@-P@@Pp 0S%SpP @p@-P8@Pp 0RPp@lL0L-  R0S P P\ 0$Q'G-`@嘀0唐0P0|Up00CS0h00SG0S0 S 0S00lPPpHQ'Q'$DQ'0A-`0@0pP Q Q:R@ @:QR@P0SwppR %RwDL%Ppp0V:SP0@w@^''$z4A-`P倀000|Vp00CS0T00SAq0Sp00Mk@T`HQ'Q'DQ'0A-PSp R+=`a@T"W p000Gt 0 @0 0 tm00CS0H00S -`P `@Q'HQ'DQ'p@-P$@Pp0@P0l@-L@000@00 Mk00CS000S@HQ'Q'DQ'O-PM/`@ 0P @@@ (^eP000 0S 0S 000Ѝ#   P@ |/P @bPR R R R 0S  0  " R0""  " /R0 dpP>Z0 R"000  pPZ m P2 @@ 0@00Q  0S/R10SZ $P %pP A0000S R pJt#Pm R i R e(dP0 * R; R 6$0@@De P R  0o T@0000S R   BR =D R9 7 a^'y4$Q'T$0_z4HQ'4D$4DQ'O-@M`p&PP'0S*[ 0ᬲ000`0pSw|2!| S6hB?01 P@PЍbPEU00p`@[ Q H0@V  0P!0X ZWYV M10 0 _0S& 0s1TP P*X 00SW0 0 S0 P 0SPYT 0s P k@T400(K 00CS0$00S Ѝ0@Ѝ0HQ'H$DQ'@-gP 0S?KO-SM@p`%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩l|00S"" 0RPW>= >0@ TW 8L> P 4>>0 R @ T Ѝ>>A00CS00 4> 0 00 x100/PXP! l ~ZZW Y>|>TUbPWr>W~`FTjWxWtWq ~W 0` @ p`.>`'410S 0EC0P0CS0X10S Ѝ000 @H[ [` V (Q$P  PAP 0 SR BR  R  B ~  ` B `FAQV  RP PR'D$HQ' X'DQ'XQ'f1O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00Q @ @% Y0S" SP P@P PQ DoP @@` R'^'R'$yFA-XPX@X`P0p00Ne0p0CS00S R'HQ'DQ'p@-P=@,g80 @ pR'Q@-pP0G`0S `*00E@`PAP P `R@ Ѝ0P@@0`SP0S0O- Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc \QQ PP $ ` $0( {P1 0$0 $`( }{P%L0(0PP QPQ P !$ P80QP*00$dP d`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S p @35bO- MP@0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ RA0$x RP  R \$$Ѝ]PX9$P| 0U0/Sd 00EpP $0S/00E0S``0` xQP 0S V/00D0x RP0  Q: 0  R/00@>A0P .Z. B/o" R  P V0 d$R'_DQ'0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0SU P $$$b0$000CS0H00S < 0S }0PR'HQ'DQ'p@-@ PTp 0@ @@R'G-p 00 SQA 0P `V `R`F@ V pplx@S`` S =QQ RU  0P   PbG- M⨀0`@GP0 }(q000e U00SV-00ED`PIPE@T Ѝ00CS0@ X' RO-@@0M-S`P S! C Rd?So @Sy 00C Sh0 0D`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 D7Dp@,PW@A0S 0g0CS00  P6FBЍ666U0000Q00S h6h pR`&XV(0 0S 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 RI 0  U  Ṛ~0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   c ~ ]   0S  QAQ$AQ!   Q R V  BR + `w#~  0 BR儡  BR  ~ ~  `K E a Q~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00DZ'$Z'f X'R'H$X'|Q'8$^'$O-0$M00 Z0 0H'0=,W0J0p0 0 7'0` 0`F#ZGF@Y0/ 0o`6@P Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG, A!9 6`0`FP 0 0S Z?0Y : 5% @ @AQ TK[Y0I Yi @ ZD5  A0B F0  %5T 0  Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R'%x%&&&&&&0%'''''3  AQ AQ~00AQ ~ K R  BR  ~00  BR ~~0 0x @0RP[ 2 20AT[ @T 000S[@Zp Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0000 0P  00B 0C 000 0000T00 0qP 000l0 GR00#S000 B0S0p0 G0 B0[m$Ѝ|00S[0000p0SQbR' ^'D$H$5 X'$Z'f4]'5616O-0M Pp0 5 500 E 00B 00~S P0 0`Z Z":Z =Z Z! Z     BR  W PR 0 AAK J R񟗋L,)l,l,,))*<**Y 0S`Ѝ0S 0S0@S0=S( ( # #00CS00 w 300w00  4#00CS0 0 u #000P00u00"00CS00 00 00(0S 0  CR  SR`0C 0 Y 0"00CS00 v 00v000aS000 S 00CS00 ~  BR   Zl!`00000~00  `  000{  BR !  P  AA ^  ~R[=Z0SV 00|m h ` ^'$R'D$4]' X'x1G-Pf0lAlS 0000X1Xq0P0L1 ` (V0 S;000`0`0CS0!0 0@' p G 0   X 0  R 0 00 0p H$R'D$<$ X'4]'0R' @-0 @D$O-TAT`0$M`F*00V 00CS000S 0S @pWZ00萠 @0 ZSꙂ! P00 R @V'HQ'DQ'H$A-@S`!1pP@! H$' KTl1@WVK \1N0S. U 0S0PBMPGLV 1SpT $$060S& $$$V''U 0S PP K\qKP HHuV WT0  X'TP 000\'HQ'V'X'H$T$DQ' G-pPE@P ?P1N0St `R@LT @ LRpS r㠠`@0S0S 0S0S$`@Y 0 X 000 .H$$j7V'A-@P.P PT0Q 0S nxlP@ pP@ ZP@ax|06 R0S@@d`Q 0p* 0 0 Sk.90 000E000PS V 00CS0l00SG E  P0( `0`00HQ'<$ X'DQ'T 000@0A00CS0/00S/HQ'<$DQ'p@-$@P0 0C0C0p<$ X'p@-(P(`@0@D00C0p<$ X'( A00C 00 0C0/<$ X'-A-(M@@`DHpPpPVP u }T(01 0P @ @p@DP`U(ЍAЍ/T (01 p@K0 P Rp:X4O- PtPTE=EA-@1S@D`pPU 0@P00` P$Z'O-@Pq刑00`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \`T  PT<0@@T0SOz$Z'@Z'&===Q=^=H$A-PRB00і 0`00S 00S0S006X pWڨP ֨P6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01PQ00SQ0 0S1P   000S  00^0 PA! R   R0 0H$$Z'p=Q'P0 y@-X@000D00S 00CS000S HQ'$Z'DQ'000C S/ @-&P 0  $Z'G-0p PR 0S5Q 0S 0@ 0CC10?`@! &,z`` `@r@j ``] -R \ -Q0S `0@T0:SF 0R@1T0:Y " @`@@ `0 T 0:S  @`,@?:\00|@Y00 X @0 CB!08( @ Ѝ)==~==\$P@-H'D0P  Q 000CH Ѝ=$Z'4Z' $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0@:T  ($$Z'==G-pR@ 0S PP -R`@@$0P 0S 0S@0-S =@T 0T T@1@DSq0000@CA!0`@S:0\:0l0#1@ T030V:0 000CS0 10S @3  0 #@0Sp` 0C  0XZO0a0C  R0 0CS0H00S @0S PB$Z'>>&>HQ'DQ'=>p@-H@HP080Sp0u`0CS0` 800C803,$ X' 0R @-@T 'B 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @,$ 0S/xQS  00 S/00 0/0S/0/b08 0/=P/P/0/b0 0 0@-,$>p@-`R`@P:P t00P pd0 Pp0-S0S0 0pV ($00080@pW' W'?,$O-MR 0p0뜒b"p%Q  X @  [c { R00CS0`Q``@320`0@Ѝ X @ ,\[8R /^ P0  BR (000Qp 0 S B R  [000>p X R  [R.@@  B@!0   Q P Pp P  Q  R P000@00 w 0 C $D$ X'<$,$0-@0DM P R`r0 Ph h "  iUP 0T<0< 1 0 01 0 ,$?7?`?u?R?@-M@P0 G 00SP;p@`T*vpPT @T?PLP @0 ;PЍ@<$D$PZ'??l000S p@-XP@T T D0T@p8040@p 0 /,$R'?^'$t^'0@-@VR'p@-d@dPR\PpO P 00008  P8 9 >p@:$,$A-DR0@T @ B 0S 0 @0r 8 0 00CS0!0`)V*V V v va A r` 0F Shh<hhTh V0@000 @\V. |V ;V&P0 @ ;P0 @ @0 Ppx&P0@ @0o|P0@ @00@0@p P  00P000K0  ,$$@R'DR'jG-pc00@ T T+P,0S)㰀" PP @ }@@`P  0RoP `FFa@@T 0  ,$Pp@-`0$P P g 0R$, (@R   RP3Pf    Q * 00000S@p 0 BRp@ Q080@ p,$?@-y0 000,$@-@oPp@-. @fP P @0 000p` P 0`@`,$O- С`P0 $ @CPp/0 CR00SY%3PB'V0  H100SD (100S @ 0YP@0@Y PX @PW W! V! s0 @00(pGWVoP0V     u 000,$O-KM 05P0@00400 Pr400D0$b`P j 0S +> 4 0  |4 bt$0000 `SH4 ` ,4$ ($00CS0c 0Sf@pW 0䃟RPp *0PCp0pC0 Sڈ#sV@0  ᯫ0 0C0Ps000=0 000CS0030S0@2 0 2 0 02 P B1 2R Bz0u`0PUZKߍ20S Td2h@d2dpD000 0S V0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PP@0000 F@!00CS0 0000DP38 .1@@*pb0PC2P \00 0-,M00CS0`f R {00^,$p0PU 60 d0 e00CS0? 1P@0H21SZ0 0#<R00SQ 0SJ60쀟SPV 0P@0 P>WUT@>P0 |P0 &PU000@$P0 Ѝ ,$$D$h<$ X'd@R'DR'@~@4@K@c@@@@W' W'%bPZ'D$ X'jfP0 ,  0@0 0 S 0Q >W @<P >P" &P0000000p0p0 ((0 P0(0-P   pO0YP0  0{P BP 10 }0 010{W0E000C00Q#PpIM}PP 1 " )00 0: <}P,p )PP UP 5)? R rP0 00CS0t00S T0 00`Q RPZ'X$p$T$W' W'YBHQ'8$\BDQ'O-`p#pCpspM0P` `00 9p(V, PEWUCc 0 pW` u@p00S0S᭝P20SU0SR0sS vS 庶V`p0+S -S X嬶 @ምD Q4 @R: ۟ P    !2PU 0 P0SAO0OЍVF p p0 %  " Q  %5S' X(p"a1 Q  0E(0pT J00G1 2 X0 M IU00 Dm|,w%^C, W'W'C2CcCCX$CCCA-PQU 00CSQHq10SL R@ 0`0CS00 `01L00<S0S  H0qL0S 0CS>S0SS|l R 00CS00 - )m Dp@-@ἡ,1 RP-!Q)Tp D/o"PQ Q" P+ P' 060S  R 00S0WTp\ TR P R 1S80 wPp;Z'Q'H$HQ'DQ'@-@P @ /PTP踥@-@P 7UP 0 . )\'PDQA-@ 00CS00 |p|P ` }?U UD?U!P0P0CS00 `SjG-@Pp000 T`l 00000CS0L00SGŴ0S 00S .@HQ'Z'Q'DQ'P P0  /\ Q0 S//Z'C-QbMP pWw10S 0S@@U@21q0pWpS ,20S@20S YU U U@160S@@0S1N016 RC! R?0S@@0QM ᪝pF 0S1 T9 T p Y0BT]T0000 00E>S/b00 )&XppW a01ЍCp@0N R UT Th ER60SЍQ Q"!030Z'X'H$8Z'PO-`@T^P P@XP 0SP0FpS@` PBPBP>P24 0PP`tDa0S! 000,U 00CS0 PT40S 00CS0 40S P@U00P@s胟`1 R 0PU TgR@`@VT c刃@Q0S 00S 6@@TP@P @彜PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tu@X PбБ@DP; ?P`1 x10S PP0-S0SPV @X Xqp0S@ `p:0S5 0@0U000P1 qR +pVP  00CS0\00S 0U00 P̷sD{5PDX$]DZ'HQ'DQ'_DjjDźUDT$DuSA-@P⠀0` Pp UTA0S 00S 0@D0@o000CS0 00S XPZ'Z'HQ'DQ'p@-PD@`02S@20CSpV02pZ'40T0P?o20S 0S//Z'C-p@`1010r!Q0@S10C1 ЍqXPU X2宼KP%N+롼P 0S ᤼Z'|Q'$0@P/!!R /Z'p@-8P\2Sp@EB?\BpZ'0-MM01`"R !R X"R   1 1d"1!d2S ,OPh1, ,OP H!0,00O@P 1, @T0d>%`0P, U @T 0S P娴00CS0 ! 2$300 0$0(00D>S 00 l#h"!031Z'|Q'0 " u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' DEh@$0Q@$@-@@@$@-0rSIEiE0G-p0 P0R(0帐@0=00:=`6`F@VPpPER000 S=S B`` R`ĥ`PG@D$ X'<$0@- 4@ 00C000 0)Ѝ ]'E0P P PR00/0@-@DP^ ^ R0L00bA-( 㴀 R P(p`@pW p0S 0QPU  0S 0S   3/P@P00<]'0SfA-@PՕU p`pp0S'STP@HAM'ᅈPP,  EBgDEEESA-P0@S`p    3/@P@PX #W p0@=S0U 00 00CS00  0 00CS00 x 0 T "X$kO-@00pS 00P㜠Z 0 J@PU* Ѝ`V Y   [ QʁeaP`0p ]'<]'0@ R P=R/=R/A-`P0S=SPERPU@'q\0\pV!0@qpT 0S tPVpp@ ]'<]'1@-`0@S @ PPV 0 `' Z h  `R Ѝ@'Dq   R <0 2/0`& 0R , R  00 0000@!L@0P U U0 N00CS0`00S Ѝ@uY0#L 00P P ЍH$EHQ' ]'DQ'|0-GM00l00 0WKP @0 80 Gߍ 0 0  e$&;$0S R   0 02/0 #$00 0000 ]'($H$A-pP`@P 00`PPEPvT` eTp` fTxTp`X @V R@:F000@-@46000@-@(0(S00 0 0,0Ѝ`t p@-@PP뇓GP[`8僓<偓@D}Uy\w`, 8^`vV0,0p@-@480,0@-@480,0&ez@-8@]ga( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ P_W ЍtsL@-PRWnt |L@-|PGWot L0p@-MP`0@-S00(000 0P  PP 0( RX  0 0 S40,J03/Ѝpp?LL KA-@`PpQP-U@QP00  PP 0-U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<PpTHp@-P @0S D00Pp_'Q+  0 BR @- M- 0 S^0@Q 80^  ? 0  / /) _'_'1Kp@-@dP`V PCp`HV4;08 30_'oSC-MPp`@T HV@P  @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        uȅ@0ST  ↭lℭ>" 9X@ x3@W d-t @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY AVl2<08 *(@@V  S W   2VxApr`VЍ00 d @V   Q  0넑 @0l  TOlM@ pMMMMMMN NNN N)N2N=NENMNUN]NhNpNwNNNNNNNNNNNNNNNNN6MMNO OOO#OM4:OMMMMMMMMNNNNN(N1NM2M:MNO OOO"OM*O1O@-/ %?O}%00@-( P 0 0 (_'jO}%Os@-@`u0 00#S@Pj0S 8 S00S 0 SЍpSFP0S/#Sp@-@,P(pw0P 00p(_'j}@-PRP@ p`p 0R" Ѝ(0"S0SO 00SS  00@O%@-TxPL0 up@0"S5SЍP8_'P@-TwPL0 Zp@0"SSЍP8_'Pp@-Pd@0S 0S 0SS <<< U   S(e000P 0p8_'vDZPp@-Px@Ql RP L0 P      pp@ @dQ8_'0@-@MPP 0SP(H00Ѝ000 0>P0 0 +QT_'CQO-P`Mp` 0S@;$ ,7 P 0S }ߍPꃯ0Q 0S s?@0P P@ P@0 ST WpU: 0S L  09/PV 0``8_'YQoQUQQ@- 0S S S8 4 Ѝ'S$ ЍmRSRQR7@-lP$ R`R;@ H$0S p0 R  R Ѝ08_'R0e'S-Sp@-@P 0Sp@{0PS P00*00SpaS@--H@H H`HpHP0S001 ddSkS}%zC-PMP` 0S*00(p0 /pAP" @/Q `0p0@1P T0 p'PH$0@@ 00Ѝ+QT_'8_'yS0G- @TT HRD2DD1H#( 4 , (0 8 4 #4R! !4S !4S !4S h!4S Lp!P0S t0T!T0S \ ,LPp8W ЍGs0S. a`` ^0 t 0 o0US !S| !3  \b0US:3 0U  $T0x OpPS}%d7TSSSSSSSSSSTTTBB#T+Tc3TBTr(O-Q ,@Ql4P0QT 4QP@'PQ,!80S,00 80<0S804 <0P<PP<P1 QB"9묱`8X0apS pR   <0R\P 00< S8P0S9`(yQ (rQ @P0S0 BS `a 0h R  R* P*ha (ZLT[TlTTTTT8_'2UUUVTUjU1VO-;$M p*b 0P$S  ߍS m렲@PT[D @P늤4 婫0X ZS' ("$0f0Qf/ j},2!S!R !SS衟01,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# ST 0 p #> 0"448#8 R* 0S 0pj9 P 0S 0 p1Sq j  @H1S j2 f/j }01T T%HM 0e'8_'WV~VVEW}}NVWEVVVW:Wa'}%A-P@p%`P %R 0R000005Sw D $0f0Q, O  8_'0e'ZW`_'p@-@,kP  P$p@\c$0@-0S ,P8_'@-P  `_'O-@4kCM: MP00 8XP( 8kPP00880p0S :,oP  1@00 Y | ~P 1(p` w pD ~P$4  X p:0 $0 %P$0S $02P P pGGqr~P,圙圩$ pW 0S$00k P$00 P$00$0 P$00  @W~P pWa 0SY] 0 0$0P @2 8$ 1\ x$ Z(P $0S  S;Ƒ8D0;RZ,( ~P  T%~P   ~ P 00$0P$0S ++RP0 0 S } P  00$0gP$0T0 @} P  00$0VP$0`0 } P  00$0EP$0X0 } P  00$04P$0\0 }P p}P  0 0$0P$0d0 ,}P  5 0$0 P$07 } P  l50$0P$07 {p} P  (50$0P$07r jh_} P  40$0P$07a Y(N} P  00$0P$0x0P H=} P  00$0P$0|0? 780aJ0S0S  P0X:h XT0 0I070t 0 ST 7 . 2Z/ ` /0S 1 س#0000S05 0 3000"0$0   00$0 ]P 7@$0!SL /@-0$0|2$ 2 , #@pCލ Ѝ0S 0Cz  QP0 Z0P!A"A-z0S 0崡0S 0C RS񟗚 nc nccnc nccncccc nL ᪣0S0 0S Pz  0S$ {o 0 S Pe ~ 0S$~ {t 0STsl 0 Sk PI b 0S$b {>W 8_'WaSCQ1$WgggWWW`_'WW| h_'Fgx_'X(X Z0S6 TQ+BQQ+ QIN10S+ 8@0 ^w 000!C0ASLx,x,x,xx,x,x,x`x,x|x,x,x,x,x,x|wxc0A Rx t  Ѝ0zg{{' Q{ zg{k Q{ { { @0'aa@-MX@X0T Q L P 0nS yS0 $屡00ۍ0'oabP `00CS`0p S00 P0S X0X /X_ 8}%G-P 0p`0t@P nI< pGvT@Y @0 @gHBPp Expᄠ 0  aᆲ U v`V` ` X Ѝb# v}%O-M M@hP`7\%\TuTT0S0#!pD P yP  H P'p0 p( P 7  nTt`(p P  UP ` Z P<808 Tt`( p P  UP  0(0Ss`, p P  jUP p 0,0xSXs`0 p P  SUP 4Y 000$Sr`8 }p P  ;4`P92a0C" 20< S :A("YAx5|%.A p` P0 x5< A B0qpAA 0Q<0PAHx[0x5< 0RA | ITP 00 00S pP0`(V R s S 0 00 0`PXuލ ЍAeTe$_e-BHveeeefEfeTfe'}%0'lf - BR0 R \A-P@ R1!0 0 ᢯X0 ᜯX0 tᖯX0 `ᐯ 2( H, <0 08 $4 < $$$$P |T xZp0 1R0S*0X`p\PQ eVlEAgglgggggggghh/hEhThghphhhhhhix2O-pᔀ 2MSR R@`aX 8QU ,[R 0u0 u  1u0"@` / 8 u,  u u08"@ ( 0  !R21`  0S 0C RjSgꈊ܊܊܊Ȋ܊܊܊܊܊܊܊  1 0 0p8QI tT <0P+8quQ* 8 0A0t @2<0P+8WuQ *ЍO0 0 0 0t d8 T ЍOЍhhi"i i'ixii:iKi^ipiA-@Pp(De@G`8SAf 0`ii 0`( "4`#/A-P @"440 "440 `lpr r((,,004488<$"444$"444<D$"444$"444$"444$"444DPPTTXXQl`pQ("448(@"448d0`PV@P ~ {0T0A0T0A T"440AP_'@-@l40Pm08Vf/rWEVT@-@P TP8#!00Q@/WEVP_'80@-@0S B08f/q`' 0\ P0//@-LL@LPL`0 @m88O R 0ai@$n}% jP7@-@ PTsP0 08P8 0p0 C Ѝ0k8'vdo0@?o2P0S@- p`Ps@P sP sP sP@V@lsPH@T@T p0 8C@@ Ѝk $j8'udoP0@-M xdPd@ p HC 0 4T00+ +LЍ08'zd@'j8jFjs@- @p hC0  00 *0`P   !0   0  h0  P 0  8Ѝp8'td@nj{jjjijjjk;kjkp@-( PM@`Pu Hp  ( uV V h PЍp ( lH( -p 0B0 8'}d(@k0_~d(kkP0@-M @  kP@ B4P4 p0 BЍ0k8'{dЀoC-`!圁圑0,M@Pp00 : p0SPXX@A p  4BeP qP p` $0Q 00S*@P BQVSW V0 a R00AtP 0S,Ѝ00* *  1`@|,w%k8'|dkl0P ' ?0P 0P8 0Pp@躗\p@ 0xqK@dkp@tU@@壗oPptcidyaraprbmngntsHEJSp0D S/ 3C5C$1 4! 8<0/@'0@-0A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @@' 213/P/h'A-PT0p(,`o@o,0T@@DA?@?@'@-?00@0 (20,20Pl0P!P30@'> 0R//G-0`p(,BP 3l En@PPW ,20CS(20CS G0@'rrp@-M@`42S%^ s E 82<"@l 0(2,"eЍp@`^垖<"82El@Q`呖,"(2H0FX"\4Ѝp@@@'$"r+rTr{rrrrs2sss@-P`&q  0SЍp00S@q0"S1Ds@-$M@k0 0 0 0<몬}%sA-P`0 p @Tʬ> /,s0d  ? gqp  RЍAL`0S`@D@,k Ѝ$Uvkv@'A-0ppP@`pl!14P S H d" R S R, 0;j0vU@'vp@-P0@0S( 9pB01p@'O-TM0(00,0x0$ #0P㈰匠s80@300<080S: (2,3`_6(0, 40j404 D$0@?j$0 0j$0 00  j@ D00@b"dP ^=$00( ,00 ,ᑔ 0 RL0 $R0 S t2000#1-R0" 8LpL`P@4fx0P00S wP  wP  vP% L`W0L00 S? j0< |g2jE%KUP15\"?C$50djP@\2S@0x0XR@x0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (00,00 0 h$P @TЍ P @#}@'v$v'8}%fwaS%yF4ws7w;wYw-s@-@o00CS0 @)P` Pp pt<0 P00CS0))0 Y@oЍp@Ѝ/8}%}wfO-0` p_<Pp/B$0e@O 0`eqp Ѝ  R ЍOt`0S 0Geqp `BE,i 0S $w@'p@-P@2S t`0n/(2i1!41#41U @0&"UU  p@@PC @n@Tp@''f'G-@r,g`P ;` VPmYTLE J$S,Xn0U !VU ! [E@s_Ps |iX2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t000@'bA-@PXPAds 2Fi t B B$R00C0@'O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ w@'wwO-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q  32 $450 (, T02Sx Y< ЍPT 21倰[R RS$ [0 0 2S Y BP:Y 2p00`@p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$sQ00C0@@PAy`d1S  14 8<   P00P2S. Y  a14a8a<0#d1a#h#0)S Z0)S R0 Q !P800 0c0@   0S8&@'y$yy$yyyzyM{o{SzyqymzuzzUz{*{zxBzzA-4RUP@P@DЍp(0PPB1P@XaXaPTS <ЍA0!14!8!< 1 11p|1 w1!1<0 n1 i1 ?0c1!1<0 `Z1 PU1 ?0<ЍAM@'w{{{{{{{{||%|O-0P-4M`@,0 q 0Sၴo_l,P0`("p/o" R 8 0 0(  [ 0 U䢑 Zz @ pD H L( @` 0t0x0| 0XS T0@˟`( PX=0H @`21S /0.30010204458<0 TTQ6 R:HL"T 1"R. 4Ѝ0(Ro_0hP(0|H 0 P(u( 0 P(lx Vt  @D H L(@`0XB`(@ Yw  0 pt0x0|9pW2SjX 0!h ?  49 ܂,j  R    0$  $   00@P`T 0 W0S 8`p@W 0`S$0 @0u 000 V 0S@8Xr\" 0c`@,@ `SRp 00 RW00 0w,p0S| 000 72PS XU9 @`@ hw@ ` 0R('0Q0[042 @`S`Q $ 0q ^A$ D 0 H L@   @`021S  "/0.0010T0 320445 8<0 T @` @`2S 00 0P52S X@U @ `@ 0S4 2S H"%>0$0 0 0S- 1S*  X000P$  00SX0!14!8!<!14!8!<X $ $`LLD(`0 S( 21S$ / .0$40 81 <X S  PX 32 $45(, X\ 00$0p@`\3"Rq2S. l 50 00 P 40 00 PXS (00D#$0 #(#< 0'4 0'80'< p 00pr0 @2S` BT0`l#PX 0 1<A 80@@,2 0C0@0@p`(2? 00@@0`Fa ?`1<A 0?``@@,2 0C0@0@`X(20? 0@@4`Fa?`?``0S 2S@ @TJ041S0Sg 0s XPX2 0 RS  0BPTo_P(L@'6|v|'||W|S||||}}}G-p@B42gS03,r,bP42S 0P*U42S 0S qԁP 42RSfP: 42S]1!$1(1,ЍG0Sd S^`兤d 04Y2S L` ` 0)P"PR S0SЍG迋+@D 0ЍGSPm 0Ѝ@'*}h';}y}}}}_}}}}}@-0@M0@ pp`PLphߍ\ "a0  0@P \ et02S 0S " `PH '!SR ⶼ0Pyj0 ~$~@'-~@-0Xa0 0LAP d2S8 eP("$!p! 2SP0U0 $tp" Rp\EU$p0 00P d2SP +P@ Ѝ0P0!!1 $@'mdYh'h~~'~A-@T2 @PbP bP bP@ `p@T 00S p`V@bPD00S @@b@P0$jD',$A-Pp`'@''000 0@@@A-p@`T ``PP'( 0@@'@G-M0h4 P@ TPD jbP @ 0dbP(4 00(0 4QT(0 ,0{'4@# 00@,0S @@((,0@`00P0s刃0C@0ᾺP>P0 !0P1P,30  ,3Q #   c0T0< p@8 PA ,0S ,< 00S< 00@ $YP&0FSʆ`B'P0S -S@= 0RP00@@P,0S ,^A0 NP a8800  {0 R00S' 410XAXQXa40C 00C1Td0S0SMd0S0S C l0S C bC]CX$0#4 ܍p PSn P弻긲'vGoJZ`0$o0/ᬳ'0/ᬳ'0/ᬳ',@-@-   /}%G-P`pc@0S  0S X| "U TY0S 0S @ 묳'^AГ0ޓ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @PPݍ Ѝp!rOddPp=0D@@rOP,0: S0RP00 0*PP P81: S  S U r*PP++P%PPPU r#PP @Pꬳ'_'S-Ge@-;0P  44 0 Ѝ   꼷'0@-4S 3/ [묳'@-b00 @ 0 $c^b@'@-b@\V^S^b@@-p PL`@@0 7/0P S Ѝ \00D'O- MM06@  @  @ 0p$000 (0t+P(LL8@ ܍Ѝp 03/0P0  #P @$0SP (0SDUI*`P 0 W U euX0YY 0 `p  W p[ 0S $P % 5 e@uUT \ 0@W0SU 000 !0^0S# 0S,aQO00CS0"@ T 00CS0! P @YT Y@DOoB 0Q   @OoB\ 0 @0  0 0 SNT`'#8}%}%o@-0M 03sc000@Sqo HPP* R!@PP<] 00@ G  0PS PQ `Ѝ0S 0S 0S\0Sq\ 0/@ \0Sp0 @ 0@vp 0S0SE @g0S:  @"  @0St( @D LP@ @0 @ `!0xP|"%#   T`    P @@``a/ ] x Zp h 0@``'l'd'-E3Cf|I`(G-0@  0P 0S< 0  Q*a @PPZ  : 0P` f fpЍ!URQ PB l ^0 p H0 0W40p P , 0Q0   040 04! !$0 0 0( 1 0, X0`P` PD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0p%U00 QP    0P 9P y{9pP1S1S1US1S 3S3S3US3S,  pP0p* 20212 1300p 0pT00 QP  7  I 0Pp00S1<01@040  0T40  QP   I 0PA0O  A09P 4W ء 0R  N eYa_]X`V P0EZ 06#++R`HX< $0S,0,  RT0CZD0"#1P0P  0QL \0   0P 00P00h00dl0d@ԗm0JfRRaArrAaUј<`ܙ@-p@`P 00 P0PT 00QP  Ѝ 0P< !@ !0 P0S 00QP 4 ]0Pmј@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k 0zP000U;+OG-`XpP @ P W Ѝ0!0呗 0ySXY DF FX0  X0 P꒚O-@,M0p@$0l@`P Ppr$PP @,Ѝ \0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q 4(  0L $ P 20 2 p(p,"  @ "  p@! P0 S@  2"!"0  0p@ĚWD-0P s s// /_c+O-M`@PpP0S Ѝ X  H r0A D00 s/ r ql  `*P0p@P q x `0 P 0 00 P 0 00 ` P s `0Pt P0 0X `<P jΛ>[o֜R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R09PO- p`0\PPX $P  qQ0 0\Q@T(2 R0@ P" R S C0BTX t0D s  3 0 TX  R 0 0 p| P YP  L BPTR2 Q PETН9O-X`0Mp@PPdЍ Z0Yl0L 02 R0 r00 P葟P#ر 0 STR rH 0/KP U  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX0!  0P0 QP \ P꒚AG-@@P`pP0S 00S <0s+@qa$0S  0S 0S,0(  0  `0S"P  S`pl S HD@pP q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hTPP 0Wp0RQ@0Uvž@-XP?`\@#@3P@T@TpW @@T`Lp'O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0O Q P 3P0 W:00 0O Q P PLR 0 P<0T 0qBp'O-M@L0S<`@DHp S!-P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T: xDp'0 A-B?$@[`/p0S S0ES PC Sp@@0T?  C0p'0 PK} %/p'O-pcM 1W, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#<000< 0,00N<00 QP cߍ0P@4p(0@pD0 0$00 C``02# , HPV00a280`F0L0L08 SD00S   80< 28000,00N<00 QP  (1 0H 0  RR R0(10D04L0 `0L0C < *9P. (1 0(11  J   4 ,0B0 D0P 0D S140S  ZI@(1  0I@0;+ C P(10(10@4 40 0S_ 0@ H @0(0/os" R$ 00 ,P 0W0(00$0@0 pS@0! 0C@0@ 0㓲" X 0X  PP  :X R: U$0p 00pP0 4n U/0 00pPd(@\Q UpW$     Pp PK/\0W g0x!P0p0p0q P$ b QQ#hQh  0 U P p$pp000 000 0p,@Pp0S*0  Q b.0 Ab  @ @bρ G?@ L0C@s PQ*W w 04L |1r 8 <|1 0W4 8 <1t0U`0  0\|xQ1PP|!R \  P PPL0sPP|!I6@0|1|Qx1U0P U* SR   1S \lhP@ I0@ 000014hSPP 1|!RJ PP 1@]300 0Q (0R| U$0 00ppPt, uL00U0\`0) $ 0(\T P0000 0 0T 0P0 0 0,E@W 0$ Se1Sb I_1 S0(0YRhSP0S 0Sl \d|RR P0S02S 0S0SV 0\2SJ\E|!2xQP >PPx 00I@ s 1 |1P 'T$P PPPPPPL0Is0PP@1@S!U @[Sh+SP=PU p|1WS P@ |qppL0Is@ppP !SP| t@PP 0 1|10|1#40L0s_?00010PP$ K/\PPP05ZP 50Ph00h0Fd 0ES:\P |!d1PHrH"HP : 00|1@2PPp818 ,%80PI 020SP0 S0 U$0 P 0c000 000 00 0,@ D00S< 0,00pK<00 QP80,R0 PI Pd01S\+!0\&P %4QIP0%8%\@0 Pip'ԟ۟p'EbW4mzԠaӡ6G-@p r W pP\aPP Pp( PK/eTD08QP0Q:" 0PS00  Q pJxPhdP80 "8 R 00 05 !$xp'Ptm@p@-@5%SQ% 5%QPR 5UUomQQp  0Q   0Q0  p'A-`hPp5{@ @ 0% Ņk@ŕ\p'O-OMPp0P* b5S 5唢@TE  EQP@ ET \T 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0 J JQP d d0P Eh0K/0h0 jS0D! X,qr0d 01( N j  TS  PS,10,1#40L0sK?000/1001001#40>000310 00 000T0 CI(%,5QP Hd 2d0P qp'У'{&@-@ P o0 5p'0/ᠽ'0/ᠽ'0/ᠽ',@-@-   ]}%G-P`p6S@0S 6 0S X|- rU `T"Y0S 0S@ I렽'^AГ0ޓ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @PPݍ Ѝp!rddPp=0D@@rOP,0: S0RP00 0<PP P81: S  S U rOPP*'P%PPPU rPP @P꠽'_'S-Ge@-*0P  44 0 Ѝ   '0@-4S 3/ 렽'@-9R00 @ 0 $M-R@#'@-'R@7LMMR@G-MM`P@p`bPR0 `: SW/_0P  rR R00A 0C @H#@ V& 0S UP0P帐`0'PPJ0: S,^0"}P@TP&P  OP  PP @u3M`@ S @ S@P PZ PPn UD e-x@+S R U<PXp!t0# PU\00`0L!0 T@P2 PdQ0S\`X PPK0 PP YW80% ܍ЍPnNPUz fFUv oTrU h FF F@ 0`( "4`#/ p@-"440 @"440 P"440 "44060( $0 $(K XXKddhhllppttp p@-"440 P"440@ ///DD/@@/HH/L`LPPTTX~X\{ \`Kp` p{K p@vKp@-`"Q@Upf@p@-@P////pA-P@M4Q->C/->?n}C@X=X\:\79>/9>:>C/:>CF|/ 0? AC>s/C>mGn/Fk/E~EnFf/Gc/ 0X J~pXW}m  $$((,S>,>/S>G:/F7/HHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W 4vTrTpXnX\j\`g`dddhah`l]lpZptWtxTx.0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P \`" :x"0S1 \ L0008t 0 HP( $0000S Gm0  0.P3 p\t.P#0 0;"0K 0 8 @   0 0S r n  P1 "].P ЀL00 0P0 H [ y 0?0 X0p20J0  000r00S$ 2j0 H0 h0H [0 Z0C 03#  4 S 0040EP!lx1 0A 0A0  k000C0 0 S  8  0000 1    m0000 0 !0vs  000S ''8'<$g''٤5Բ@'ajmG-P`M@HXpAZ 10S t10S 00 0O P<ЍG(PE@U> 1 RP1H i0  P!`. H0S$00S U c 0S k0S G B@ЍGdX0-P L0 ЍU'''8'<$ǥޥ' 0`( "4`#/p@-@HP081200@ 00 /00 @Fp'00S 4 /' 00S/' 00S/p%'P000R0S82O-@ `RMPgD R0R0`ď080S  C/ S ! R 0C00 0@ἰ? 0@\5p!Sp 0 0Ϯ00 ?@U '  ϬR7 R  0 \5S0 00/70/0 0 Ѝ  [ T R  P00 0080/'''T:RrP0O-@P:1 R0* 0똑嘡0 `P3Qx 0 T B:\50 0@00,"1p R 0 0 !Ž p 0?`0 C c00p0S   0 .0x 0? T0 0x 0?400,00S Ѝ'@''T,''#0O-p PQM P*H PW0k:, `\5 0 0?00O,"2@ R 0 0 !Ž  @x 0q?`0 C c00 d0@C C@bA c30B$ 0z, Q,040(0PÏP089,10S 18P0XpC9 ̡PWEʸ 80,80<01p!0<S0<0<0Ѝ U8  P\E#EE#k# U00#0 S0TP0S0<(԰?0WTEFU  P 0R0SE ?Z0:P0EU 000Q@'Ц'T'''''' 1G- 0pP `>   050@ 0S 0 0 80PS `P` 8UH0ZP000PS　@`4BAQ$,$ (,`(PP8'@''@-@8P 080@'G-ܡP0S100 B?pg> PAP` 0@`8|@Pp1 ?L>\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ%d0SP 1@0  XPP00Ϡ^P0d000 A''' '' ''?P0p@-P @?=800P( 0^!SRp' '^p@-X`0SpL0LP0@1CA0SDB000p< ' '' 0 0 /,'O-H0MS MPp` 003/ ލ Ѝ30 P00 +0G000 tp¯0 @ S 0V  0}=0W0P3p!0S& @3Q2Qg 0*"  10 ! 0[0 02H+ 2R2 t R9X:000\P  $>$+ "2P Qv{ {  Qt Qʰ1+!!0Q3 !03H0 R0C?o20SF P1 B <+B0((P4 RP& P g P 0S 03/     0P  0`V c9''''u'ȧ'0O-S㰄0`P0 V0RM#@M( , : S T \p"(5R4<R P  RSV 0 0 h0S  <V ,<v0 唓B?PG<0` 00p0S 00W \ 8ő @5D0LT 031 a> QP!000T00S 0C600>*%P( 0ˏ d ▭ 0T0 C c;  뫴 h$''''MT`'''U w'''''O-lM3P@ 0p8`!\P  ? 尢 ? &0 92儲0S0 S 0h"S 3S Tn@X =820p] 20SPs \`X00X010S, 8#'00X0S 0 0 `0\ *l!00ST06 0,!S0\P 0_PJ80 20 00 04$04L3 2$ @  *"0(0S 0PX P& PlЍSu pp5\t2`d'$'T`'''U Բ'@'@''''O-Pl20Pp0@P"`V 0 0 Y0 Ѝ 0k Ϡ?R 4G g@ WULQUW TV A0 %00100 @ 9 @TPTpF@TP T  @T 0  P T 0 !00V02 0 %` 0 70 7[@P 0 000\000 %00S0`0000 ''O-Pࣟ4MX{3Xp0 raPp0 g3G0 GA3B3w T 3(<P 4ЍhT+a83 0p R OA 4000?02@20000<T 7T- @ @TpT0y6@TpT 0 0 0 @T p & T 00  08m000XC` 1 0b(P 10010SZ 뉑  4000?0娱  0 60  6Y@ $0>  10@(Pr 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $hQ''ר@- U4}%s@-@P `⥫0S 0S 0 Ѝp覩O-MtE M`P0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdu0SP.0S 0S0 08Sd s/2#' 00 " " 0D@? !? 00? 05 05d!! 050 pPd0SS "04 0 R0  0"? 0 , R( 圠*,4ï0A8?S% 78P0<P0Q R0" |0S lhbPUt @0S HDb@PUn ,0SP@PPDPtH0S  `Cn* lxl%|0S l,l?0p00S00/%P 0,0UA:000S 0S PL1 H0S 0S,0S P  $P   000(P 0S ]P XPP ]P'ǩ 1Orժ4Vܫ'G_gO-PH0pS`M W0R0: P <"p`G,"0 S m20SQ I_Ѝ౟࡟ 0@ 0 000CSY?00 1> R. !P\!0  S  L P (  . 80< 0 @`80< rP0 V P0  ?$0 S@ `00 R 0SQ Q\ 0I'Y's''L'''00S 4 /'00S0`( "4`#/' 00S/'O-M,M7L@"p<,W $ :00S`HW ` pP( XP 0 0 00؍,Ѝ:00 (P t XXPh0S  0D j@ P i0S  , 3 ; [; W   054%00! ?0S S :00/0S 0 S :V0 0#03 R00S l:0S7 `  02P: 0S R< jP0 zS04`Ə@5 K)Q9000 B?73pQP%90S  0 0  0L 06P 090S, f3XP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P ed80S (0 0x0` K (@(70S 0h0!7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z 0@PP6BPx"h0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt ?A7#Rp 10S0AL 0(  Z$0S 1000S 50S $0S 0#  t ?'2$0S 1000S 50S $0S  <x 10S0ꊡ  0_000 04 0 S 00  000 0n$0000 #600SH40S l4P P @pt3000 00S1 LPX S00H00S9 0S 30S2 \P&  0HIDP 2 prLtoPd<2 0Q\00&& 0:00@0S428040/<0a0#QP8`\@P 1P0H080a0A`ppA3PPU0\(85  @5D0L 0T 32 b< RP1Q 00pZ800 3/ UV 0 P` P00S 4[0S@ 4H0S*  0 # P0L B#P]8h'''h''!@'@'''''׭''g''' !''ƮnH'''$''Z86O-,,Ɵ,|M@P,0S%40AHDLdP T0AX  55 $00 ᨥP 0@, R<5@|Ѝ 1o\%v' R  `  0p`oQ0P  0_S /  p!.p{0Pp?00 1> p'@` 글t|$\5Sc%Ϡ<# pD ?'0 w0D40S<40W SW ,4,t`V0x@@0`S 0, d2 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  90S\00T0 @T`0V T?  @`@T` 1 0X20qA000PἿ0P0$V8 !400 0 pS ;*00p0 VTX0 @ @ PX``W0`3V5L R 01`7: R 0@ 0 00   0K0 TR 1VS0`   0P W@*  A 0;4 00$''T''''`'''''}%''U 'ׯ'O-`pܐܰ 0M @ 0 0  BRЍ P PU QP ~` {{@ pQ RP Q @p''L 0`( "4`#/O-dMX 30P0\1 0X1 PP1PPp 0,0SdЍ0S 0,`@d00 `00䰟@ 0D RpT0 :N`P 0R0A ST TX0S @PptS''''(}%'' 0000@/00S 4 /'00S0`( "4`#/' 00S/'O-MH@@`MVP`,:0S 0P *S *`0080< 010S y0 00P X P )  P9`0S 0S T)D P00 09 #R0p0,0S01000x)(0 0!"4410< 000800$k0P@ ` [_V@00C0M 2100 0Sz 80 0PtE0$S 0S '00P7~`| .0X0S01,000)D'0 0!"44,'1px 0pp00ppP*0S  YPa 0 1`YMPU `@   80< 0 80< @00C0 Ɵ0 00 0Q.*0S  P  0"pWWލЍ0S 80< 080x5 0< S dW0 00$001 _ P 0S 80< 0805 0< S xW0 00`S $`! B("( p  ᴑP@180< 0 80< U00C0 80R<.PSR$ .R  $PPP3P`080<4l3 R0 *30 0NP2 0 0q$Xp0AS񟗴0إ$$hhP0SS 3 00#20S40000LP x2 =#R0؀20 0 #R0tQ& l20S`20ST؀0  P  : S000 0 0 #R0 Q   0 FQF?d!d  @10 S& LV#R0 š!ɡ0S  0R {ؠ 1P 00 00lPd0`P00C0X?P8\  '''''Ȱm'߰Q_*p7'^m}*''߱O-WM M&0AS}`@, vP7 _l hiP }P7 00[@ , 7 TP 70S 60V6 kX H00`06`00ĦĶ100V0:6 Rp0S8`@aVwPV}Wލ ЍT P@P (  5l 0S ` F Lq@H0 ־00@(0S S㜕u%px-`pG(pP* 5 0  B, !D ]850SU 00(000]/0n 0S VU(0pApL-0SpG(pD bQp(?T,p/40xpS@09Y(0G5 A,0 S1 #(R& S000000!Y"!"7 dxhp9  (  ]/%   ,0 S1 #( R S),)-*-{ {d` p 0S(0S , 6/2 p2W (,@R@ )'Ax 0T!W"!"dh ZR@ )'A 0 T dx@0 (0S 0$ QP 0  s00 } 0$ 0`10S x10!l10!00C0L10!P0 X00000C0!" }pH0S|@0{ 0 0C0v 00@q7'Q56' '','''h}%'''jԲ''m00S0`( "4`#/'O-M̒"0`1Ca2@Tߍ0S p@FDAG@DPd0l p`+00@00C0 00 R2PU 2PUp0 0S0S)P@R1PPUPRPU P0:0000S 00"P D100C0(P X `P-0P0!p!0 000LS" dTaX|!Pe 0 0w  W000pATt '''.}%''''8'P|g'wThO-`쳟p3张PM @?( \P  ? 匣 ? c0 (`30SX30T ST H0 S 3 S 0!@ 00000CSFTYr P 80R000303L32   ?3(` a Q2!,S Q0pB*`2@20S P P B PЍS x 'Pi?00 1>!  R1[ 10SJ0!T  0 S@1`0 ? '00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 Pp@'$'T`'''U '''''00S0`( "4`#/'O-lMX ⤒夢,p200,0SlЍ0S 0,P@dc)0P PDN00040P1@ 0 0 0DRpT0;:`1AQ \`X00X00@SS̹p\t`d`V %P 10S  0q@P=P 00S  0f 0S  Q\ {{00Z 0Q  000T  L  <0C''Բ³}%''''<HPO-MoM@P_00 +0|2?0SX0S $5Sڄ0SXxPYX0S $XmX S R<f8?`0Vd2 P\20+! `" d" B+00!X d"B1h21$\Pl2ڬΟ\0C00p21`t2QB1l2? 2l2V0CL0=SLq Q\20B ,( 0S 0『$5> *d>X>0S +0 0객 S0B$5111`R B- 100 ST $| 0S% 4 0帀- 00$%BR㨁0`S<B11@%L0zPP  U PN 0S <P| *堀<<0S 0 00\0 bA?L0<5A?X0 =<0T0.H0*; 0VHRQX0h0@ @0*8 84<ϠQ bx{ S P,0 SZ?^@ P< x;0S @ A>+@B@  CϸP$; @@ %000P:J*: :0S 4G0 0؍ߍ0<00<`/  `!.0i0S ,pd#' 0  00y+\0#Q  0 i ?T E%0܈St90o So d90S 0l)S 3S  0S 4 r0 0t80S 8 0S8`0`80`O 88o;\Ş&"\ `  0 0Ϣd h  pBnj `b"368+?P囓)<TPD  0RTT07P pDP0W`C ?Q `,00C[S +Ϡ\<#Q  0h ?\0化S  7/0S P#D60夦h 60S 00t&\Q`\uX6PH60S6@65;o\Ş&"\ `  0 0Ϣd h  pBnj `b"36e  `$5S8&x( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2( 2D%S\2/< ( 2%Sd2/?L (W=SL5s45`?? p`00SF[ 2$Sd2?/0?  (2l$0C(2 2Sd2?/0?  (20C(2`D0P ST0030^`0 D0 d^"{ `"{,00C[@% ?A! |"k 0AS 20 2(2@#0C(2 2Sd2`0/0!!!`pV0: 0`P  Phdqz q08PPN$20$2<0S4 d"% 2,"S\2/0?! ! 2"S?ԀP5/`20PZd%p%0 0 %$000$5S `0t63 03080D ` ßD <R ,2`0,2! 2Sh2/0^>^00\0/n'$'(''t''nѴ'''#}%T'K '$'''k('8 ''ֵ'''''5''`'MU m$5St2h ` 0pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0gP3 00ᆡp`Y7 0$S\0000S7囡!"pW`㵏X7 0 %S\0 000S7囡!PpWO-PLL`@T(ᗴp ᒴ W @KA-Q0 % C@*r`! 10" q0SU 1s0a)0 a* 1t10S 0 0T 0@# 03A0S4 K@ 5*< 5 000S 0 0@TPYUATt0Tp Pd0 0S L P<0 0S ''$+'''C'a0/'0/'0/',@-@-   }}%G-P`p%@0S ճ 0S X|̳ U TY0S x0S@ 屳'^AГ0ޓ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  㹱C-M Mq@` @岬PPݍ Ѝp!r>ddPp=0D@@rOᘬP,0: S0RP00 0PP |P81: S  S U rPPP%PPPU rPP @P'_'S-Ge@-t0P  44 0㙲 Ѝ   吲'0@-4S 3/ J'@-$00 @㗪 0 $R $@X'@-$@E B $@P/00@-@0S 帲 @ '^A0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPPp  P R 8 4 Q  0/TTT8 '''''T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/' 'T8 T 8$'0p@-000 0 00@P22=000=000X0X0<0<0@0@0p \0\0H3H3L3L3P3P3T3T3u/s oh p@0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p EH3H3L3L3P3P3T3T3u/9 5EEP  /4444K4K4h # 5 5d0d00000-P5BP5H5H5=Ch S>S>p@O0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//'4O-M X hDhhdhP@quP@D@:0 0 P\kP SЍ ?0p  P\PP0S 30S30S xp3p#0Sh d#S\ P P0S D=0RS Z$c*30S O@"\5S2 2\5\5" 0C"?o20Qh [řX24 q'8d p$2 ?6:010S?,A!Ϡ<#\ Ÿ P  0B ? 0Se0S 0āh 0S |!\5St1\5P l10S(` XA. L!0 0@! 0 * 0S  0 0 00OsG@hpİppHT* 0R A '''''','Ϸ''<'8 'T'S'(''m' '$''9 O-M *0M08pP'P!! 80S ḧ :P! p0: S \ gPލЍ48H0,hSO )000S ᯯ007 7009   Y` T8 N8 H[V``Z`T7P`VD 7P Q NP  ዐEH8P0 0\86 R>0 0p 0<&0&0P7p0p(60pw>0 P0p,2S# *^P *YP *.qVXZ hY 4[ 0SZ?관X V. 0  0 <\:P$V, Q3C ?t|PeP 2S|3%8 S20#"20$#20PC 2SB404040$4嵮`02P&V20A2\0@22 040C` `Fb( 0 |H ? 0`P-tT#0\`P`Q=S/0 5P` ( 2RV0 S0S_c 5*< 53 30S 0 0`20S 06#0 0R V 10S `2R\\0SD{2= C0 ,0|"t000 00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000X30P%,yq *(, 10S @S0 0' ' '*,''0@'8'('Y6R''~߹.U|T<Zwʺ)Tڻ' 15;\!Bܽ'j'#Lu('I'''''' ''' 'տ'ȼf3''''߾'''''$''''q=SZ0SR Tp0 <<00X3P%0*0 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 5r(1u 10S 0 000S(PPq00*R1U 10S i|0 00<cQ0,zPr 0<0*2(25 20S I\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*2 20S * #0 0 00L40q"  400cL00SPs*330S #0 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*d4\40S $0 0 04t R,5S0%45S R! t004e0SP*s$5v50S T%0 0 00刅(0S xQ$ V0S0< x (%0S8Pȅ*F5I50S ]p&0 0 08%<5HSR$ ( H00850<S_^P*660S /B&0 0 0܆@%D5LSR$  L00@50DS6/P<*L7D70S |'0 0 07 70S ,帇 0R" 0Rz7 0SQ `@PLX  p@ Tʰ8 @/  @!. A@O@@P 5  ,@$)P0 ( 4   Q LIϠR  5d)l)t) )pݨ)PWpp \9  1 P, P'Qڨ0Q, D0 0S }Pz*7:: :0S NaD*0 0 00S B0S0QQ 0 0S KPz*::0S / +0 0 0P A0Sh A0S A0S^Q  "Q  A0S&! A0SQL<Qk A0Svq A0S0 A0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*<<0S -0 0 08=0S 4=L=0SHm*gT=jL=0S ~0Mh V=w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T1 `R.B!!@tN00 00L 00*>>0S ,?.0 0 0@P0 @DT@8 HLd Lc B 0b03"4 `@P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6冧@  |6PtE h0d& 5000T60S 1S <iP06  (6@ Q V @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 G ``0  0 04 8 L H$C0 5L5s0P500ߍT'B''0 \P/Q/ 0 Lœ|  ,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> 7S*3`30S 0P 0ThSXS,Ts&P`UU00Q AP 0S ?@?`P"hR0"00S8 lr003Pb0S* xB0S* 00RE>0X4*4 2p610S J]0 00S9XP10S 91 PQ`1*X1` H10S 00 0H10S <9,1 P0*0`00S 0t 000S 0dP`[ 0` 0OGL''''''''|'''''8'`''0','I ''$' ''%O-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP t \P  ?HH  ? }0 2r0S0c Sc 0!S 3S  00兼? 0!0! !!0S`0 0 0 `Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*0`0S '` ` `Ѝ0hS  $  B$ $ R$  B  '''T$'`'''U '''t0A-P`p`ATR @P<[0S @ 1p0A'E80 0 1S/ 0S/'`0 5 /H0P 3S P 3S P///'^FPO-0(P,0@4p8`\ P P0P` 0S 0 S   000 00 00S 0 S P0 v0       '''Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐp80` R!!  P/! 0 P  C1  1 @-a0` R!!!p!o/ 10#/C!000P/@-a0` RH","""  /  /C! C!/! !/@-a0` R""""  /  /C! C!/! !/@-eaO-$5 SW@ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ PP` PP` ` sP P7 ( ᷘp K0S  oߍ<08 H(00,0 0000400!4 04$0D0(0P WZ  ᏘpTp ቘp*d SX坍 8 ` 8Os ,s }s ys us 0,0os0 ks  2p 0`?`a8SPb   00*P*00)  0* }d@edAzd@ho A-PMPp`;@ p@P  0P6P៖U00 ## ݍG-MM`P@p`ݗPR0 `: SW/g0P  rR {00A 0C @H#@ V& 0S UP0P帐`0増PPJ0: S,^0"[P@TP&P冗  P  ~PP H@u3M`@ S @ S @PᄗPZ PPn (UD e-@+S R UPXp!t0##PU\00`0L!0ⓝ ϕ@P2 KP0Sו`X P7Pƕ0 -PP ԜW80% ܍Ѝ˜nɜPUz fUv TrU  FF F@00S 4 /'00S0`( "4`#/'O-p\1T1`00Pʟ 0   X 3#ˠ121@ R` 0 0AP!0R00S! 4% 0%#s(0!ZXl000Z T00 pp8P,0'''[''q' 00S/O'O-,Mp0됡`P@0V000,Ѝ00 ?U0$p$000 000P$00S X00 ? $0P000  20QP 00 0p|00`P 0 R> $90ğ^ P Q P +Q 1 & 000|2Yq `[Pl3  ,Ѝ8QPXLPD3P0QSt? )` M 33 $`Q0B$0 $0h @bPX$(`0 $0R. 000V0A+>P2  Q$``! $0@-P$ S0 000B`㼱"3@0 $0V' 1 1S2> 410S tn1$ 0R00 00?000P+ 0o(P0$00 00{ $0 0{000 0 R  000`@`00S >j'}'Q'!t'^FF^'٤'',9QO-P1AQ P1a`3$MS0_ 1Pr1100` 00 0p8000P0@T <חP$XpXT 000/ 0bP'0Ġ[@    0S 0    MP PD0$Ѝj'>}'''/l''p@-P0 % .  @Q 0S pPl# #3 l0# #:>0 @~0SpP p'^F'R/4G-P `$ 0p@V` 0@`` V`@&!D`( G-PC4 `p 00ȠX㉑ ,Ƞ0 ,$ Ă Ƞt h,Ƞ 0 0! ## ?Ѝ  :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  ^0@`S ppJ` 0 U 07Π 0nÌ ^VQ 0V>  0P" G`p P 72 b0 RV1Q0V"0  P 0 P$ ` U P ``Ѝ\J <0A-1àQ`P |0| ||5^0@Sp࠱ P$` p@QL ࠁ PQ l} <p@-@PaSl0l ll ^0C800S   0–0080P4 PR*Sp0 Z, <p2 ,0S/`0@-@0  L.,堖0,0080S 0  ]0@萖'p <,0@-S ,0, ,,]@TP |@y <O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D5@D0  00 0PA U0#03?\[[UX `0P$0<5Q 4&O0$0 .=D 0 XR @"<p!8pL0(0$0 0H(0 0 `,0`4  0 4$F]HP$0 PT40  (00\ 0P,05S00SUSP3S` 4 $ `UQሓV  `F0w00<040@00 C3 4`00DHpL`<0@ RS80 0 ,H0 PpT`_@P,Ph3Q 0Q+ 0CQ 0SP THpPL`P@ T@P" P0BT`V@ !fᐕP` !T@]00P0 0,03p(0?D00T P rHL PT0RP H-t0, `S24040S@p( D0 0 P  X Z 1!<(H >`400 0Q 800800p?(00T 0`RZ@p(0  0 P 80S0 0C800S   0`O@  D e$@$\Ѝ0$0'LBAW<] NBAWq Z G-0,0S0 \Pl@`00qW40S*ᶔЍ! 0 P@P   k@PpF <A-0`c,0@Sl0l h[Pp+Q H0< D 0P@DT@<a C-0`c,0(PS0 [p@Q |0l x@PEU  0P !  0 P P Ѝ)q <s X0sC-@0Ђ D`P 004 0P 0Ѝp''X0sC-@0Ђ D`P 004 0P 0yЍp'' 0A-PQ N`p@0P R   T0! ޔ@P 8+4uP ,,'';'p@-,@P,0S <00'@-,P ,\  D Ѝ'p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp'''27@-0S S2+, R0 ELi `Q |x PC㟒aQ* Q( PDP <4B 5*< 50d30a3 220S Ƶ0 00@ 7.Bp#x3@ Ŝ ' 0P z`XA 5*< 50d3z81},10S ᑵ1 @ d3S, CQ,aQ$ 0AS#MP R@0a3d3*L0Ot00S cvH0 @ S Ѝ08'''''''1I @-fo$ O-0M` "##@0p $@ 0$0 TpPc0S@P@# 00") qp=$喒LtUhUaU$ bU P?i0E SLUTT,UTTTTTTLUG- 0pP@P` V   00000G `00000O-0mM`t $P0@004080 0 p40S+ mߍbP AP LP d8Z4XcP iP0p8/ 4@ 0 0H4: S@ @0(0D0,00048`0%P  P 0 0! xITd lp 0Q= $ 0! $刑匱@P 0V$0 0/Sጬ<<`V $噎pPp<0"<)P0<0㪉`P< `v ᵉHp< 0 0 n?C0 < n?n/ᄉ0P < ᕉ<嬐!$|ᦐ 0#$0@0P!Sf `V|s 0S `0S  R$ R Z m0H $8H Pp$`G0pR $ 0pK qpBZ  (,PQ(,PQ S Rh Tw%Tzd@wՃ3&_O-P-D,M@p`$P əp($0S0$020S'$p P V 00 0P0Nd 0 #fP AP PP \cpP$p,Ѝ`P 0`P ,p ?o  00 00 `> p 0PEqp p Up`!w%'=hRUdG-@lpP 0p`:D10S:E A p= o09 6X $$ pp+ P%W00S $$ `p YPPU `fV rV GTP$$  Dp$`w%| @-o$ A-@P`pP hh嚐` ᶣU  HA<叐4  凐 A  Z^A}% @- R0Ѝp` P@CYP 0 R SR  R $$20BR R xP0 ꄔ,, P/00#01"$#O-@  @T \ p `? T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C-HaHqP@ @ 0^ \ ^0᳀ 0S@ 0S@ 0S@@00\ ?\CT:^ *$@A0607;00@R0@Q 0BR !C 3O-`$0Pẋ@P 0z'0 03Q P @ Ѝ ƆPC-P$4 p咓`㓁(`@ 0Q P Ѝ  ዆P404-0@-  Ѝ Ѝ/-@-00@ 0 Ѝ@ Ѝ/-@-P 4(奎  ]Ѝ Ѝ/^AO-MPp`@PЍ 0P P 4S x 0ဍT0P$ Q$VP 0S 4S $ X 4P S $VSG30 0 !0!p`0  0 0  0 @P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڜ  0 `  xB   @"tPY 00pP0Sp$~+OsSO-$MХ@pPP? 2R 4S  0$Ѝ0m Q Q0   RSRQ"  "S 0 0000 00  0 PPᎌ4S 0S,  00 000 0 P0P0 <00SS PẐX  , 00`V4S 0$R V P0 RS  0 000P\ H0H 0000 0   H;pFU6@RG-`Mp<Pъ@P$n@#TC^t E@0$4$ 0840; p+p Ą؋%px H4$$: S! R B.T pD $4S8 (4,$0.B.  p 0 0"dR04<$4,$(4$t0K>Ѐ 0 # E  {00`d؀E$t0  P0`P 084S    0p 0gp 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"}d@d@ 8T@-@P 4B BRP pp <L4( VЍ@Ѝd@@-@Pp P P 4PS 4 AA- @PP0T p ` `Xp0 p[q$$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /O-`Pp M@6_Pట`9 `P0P0000 V:Ѝ 1000 0 Pڋ`P10 0 ЋP U P}%c^C$$0A@-P@-@ t`RdbЍpP P 4U R 0 ꄔ,O-!PR0_otM`@R(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 T m0 $8  P P  5P A-@pP`P 5/p 4 5/p 4  C-(00pS4P Ѝ$d@ 0   l 0` 00 ( 0`WP (aO-0 0P夋딀匠p@T Ѝ` OP `VH Dp 0 か@ꄔ,A-P(`(p@0 @TO-P$Mp `@Ȁ뼰0     Q  x0 p `p X0 \ p``00P0  $Ѝ説b O-PQ04p@ 00` ЍP P0S* E g0`P      04 p p#p p04pp  0s@-SX`@ PQ0 ?o2R0S Ѝp脔,@- iR sR aR p` 4e0p@-P@P (`Pp Fp脔,Yp@-@T 40`PᥣP>pp脔,tiR@-- 0 aR bR LR( *sR% tR@P 0FP0S`00p`(j0 ,p@-M `@P` P00͵00ᦈ0S ⠈ \Ѝp説0QG-@MP Q  ЍA~␀ p$Y`Px hB~0 00  0 `PP  pj0yO-$MH@`&P ,`$ЍPP 0 0 "0 $ Y># P0*nQ P0 0?Y S0STP pY0 P pE00 PU 0pop $ څP 0000 0 pP 4  $\ `  0V,S( 0$84 0p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 00PM 4$$  { $ 0$$@xp7 >Yw$~00S 0@-C^M E@$n$$E0 01PЍ0 @x("(!S"`#XT 80 Z @EP8Bw% +@Wu)0$ 8O-DMP`p4 2<0 Ώp 0S8 ! R4!DЍLRd a0BS)S&,,LLLLL,LLLLLLLL,,D10S 4 P $ ᅇ@P  [@ ㉃䰟P  ׅ T `0 0@   T N0@ @ ;P@pw%,]Dk348}%tA-p`(P@cP 0p`P @00! 0$0@-@P$0S 僅@者O-20SK@0SD00J@ DP 0SD0SA \^<40$ 400#qpp, 804<0SP$ 0I,00 P tbU@ qU H04 8PpPTЍ$$0 $(`VxJ0Y `0 XW0 0 0S$ (0 [ P*0W0 000$00(0 00qpp 0 QP Р 0 Zp , 8p p ,  ww%$ <O-Cnpሕ FDM@P# XpX50S LDЍqP sP 80Up#  0qp PPp0#F$$0 `P P  0@40P0  0 H0 0$0#P  P 4  0(0$0 ,0  4 PSf 4,  (WUXtVP 0T 1 T00 S :0 U 00[( 0 4040P (, [0V [(Q,UX? U0U0Xt.P p (V,#X@! 01p8 0   U 0 0CP_ Q QXX 0 0  4p P 4\ "$p0 0S 004  $ 0$ R40H Lp $01S 0S p0`8#8&h$ r/0$0s?`mph4 4$$  //w%P3J$ )VxC-P$M0@ p` P!! ۆp*0S00 P 0SP0SM \^H 0T' 10S#!Q `O.NP. a@ P P P((((((h((TdpT T w,$ЍP`w%dp@-M(@,`6#,P X0 P00͵00}0S } _}Ѝp説<0@-WM M`pn@T8 G0S @^< P} 0$$ 0$$ 0x 0|xP x x]}x 0jlU}m0 $8PM}LK}#<Wލ ЍYqS)$EHT@-0@ n 00 0  09Ѝ)@-Ma qP@Pwꀮخ Ѝ@ }`  } p}Ѝ||| p!80pp\XT0 0 (|8| P @08 0@TS Q2P  Ѝ@|| $m0 8 0 0 ` ppx|1S1SDPЍ@|9)1 MP `00CS`0p S00 P0S X0X /X}8}%G-MMP"` j|" f|:2㠢堂堒rp@TݍЍ P| L| `Vj @B|   `"0F0 BABcP `#|0S81 B-B|B||$ ! @|<#fP%$ !P<#{ pm0 $8D({${# b+@B{0 B{ {   E0S 0CS 080 { $*Chi)<JS$P,'{'TG-0㜂MpP `@ P! Hpd20S$^PD@6 lP`Pa@ P0X8@huP xP @ЍPP p*PPP0S00" P 0S0S \^ 0 Q  .{ *{j0pW {  { Q {  }   up zUw%_x$*Cji<@-LM@P`4 q 1D0 ጃp T  {P 00S 0iR TR a0BLR :lR s0BST pLtLЍT }p$ w%l t@-0$Mq` 0 0@P!! 5p$0S00S P 0SC0S@ \^; 0T 00S!   0*a@ P ꐹعTtpT T  4$Ѝw%-,M0$00 0 00 00 00 00 0 00000000 y,ЍL7@-@ P000 00 0000 P   S Ѝ0C-M@pP ` 0 00000 0 00sS 0lSp@ kP$0㓄( p l@ UP 0㓔) p Ѝ@T@TpC-`PhLPF @TgPP= p0P/ x@P+ .v*00CS񟗆LHlHHHLeP P4 NP o_P 0Sa epP x dLPp`p HMP  4MP  MP  LP  LP  LP  LP  LP LP LP LP lLP YnP  RP ZPY  NP @X NP pe PLPU -p"80xVx ;MP P R2")?LP p JnPk dPU p $ 02#W:0 MPE  dPP? [2" KP4 !0x|x LP) !0x x LP "LP "tLP #`LP m0 $8+0S oP  o  LPp@30T Wu00Ѝ,]Dw%H \  3~-VB1,;H9fp)y~c m B Q}%O-@-슟zMP` -p :0S ЍO 0FS iS:C>`C$T/P YT Ѝ!PP Y Pu9P>f0P0 dP00$$0rYPYodP xdP (0YPTE nD0 RJP $0  <4 QKP 4P]0P 4 "Pt {pP00000W000000S 000$0NdP `Jd0P(0 ]mPP DDDo`P o$sPP04 KP 4`P `QP @ IPn H IPh @0 SD00H0 RL0$ 0l` 0qpD  R$4,, 0qp 0`} !m$4P `$$m$4P`Vc`P cP |g&(tcP lP'8,0 Lo`P Lo8&? ` 0hqptjp oIPV3p o  yIP   rIP  kIP   dIP  $ ]IP  X VIP q@ OIP  ( HIP q/  FIP r ?IP 01S 0r/Ss?p, ղ Ѱ  )IP s/ "IPz$$nl$4P(BlP䳟z n`P  n$$0` qpS, p0@x< zJPj <pP < <(< jJPZ <P HPO  HPI L HPC 8< MJP <$ 8 HP3 8 Z* 0c$ Bp )$ kP$4`  0oqpp$ kY$ < 800$00(0 000M$040P08\ p,` 0$00P00T0  DX@0`$$2qp$$k$4P000H00L0p`"$4'` 0qpf$$k$4P `]Dw%x ,MVpAy\1$ B 9~fU-B,;H7QS$~q0@-M@ P 4 ᒧ abp@ @㨲8 lp(㠲0Ѝ0 'i@-SM@P, 0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`p D Sߍi@i!i@-@    0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!/ArP8 0`0?oS c`2 06P. 0I0r0 0A. 00P0P A Ar000 0rލЍp`r0 0A. 00PH0`P A4 4A@rv`'' -Zqs@-6PP 㯱 P 㨱 )@`Te ЍpP  00SQV  r@ d0 R !0O-M@ Pxp*p"p`P"  p l`P- \d`P:`pP Pdp|`P Id `EP 0"h 0R00  p!  EPr 0SohQl @ Okpal d! R R RZ  0PW l Z ` X (s<W 0j0S, @ hkP@ `kpd HQ L 40R !01Sp0S 3/p\ U 8 Xjp \ [ 5@ `jp Ѝ d:;frzHSA-pl_@P@_PPs_a ` PAjpk3`P dk`Pdk@- 4GP ЍeA-MP pE@P00p`ЍpP  44 jp !0 Fi@-@p @A-P`_pP00&cP@?0)c  FA-P`g_pP00cP@:?0 c  F~@- $EP00 Ѝ_p@-8M@ PDP1!6._P b0 Q0s0S00hbPP  o_@tiDt `  Pb< PX_`]iV8Ѝp 6i0@-BM M@  8p 0S 7  /  (0P(@0S700$0/ (h 0岦dP(@0S Bލ Ѝ0;p@3p@i@vp@-Mt`^PP GbP@ T0T TVd6Hb  4 p :Ѝp6 i@-M@   pЍi@-M @$DP0 C06 p  1Q0r R08C88 1p`Ѝ iis@-`P p@@@CP0 5H@Pl֮ra P@ LͮDv^P 4 nЍp7 ASrm7@- P@=pX X㭮P] P@00 <<50400H^@ Ѝ0 r;f7@- P@p` `ㆮ0LyD] P40 005^@ Ѝ0 zp@-M`]P(P00ЍpPaP@Uxk@PdOP0 +p@>8 P@ PP ni@-$Mp{]P00$Ѝa`k@Pp d0 pPHP P`@ p$m%i@-Bn ЍCH&@-0M00 0  Php `ck@Pح ` @hpp 0 dpRP00bS RnmlU JnnPxi 2KqSs@-@`.PP  1p$ 㡭l0lp@-` MP@\P ` ЍpX (   `  P ]@%gD;vi 0@-,M@ PnBP0 z4 p,Ѝ0 0R0s0S 0 $0_PP 0 \@fD f;p@-P-hp@@@t\PH0H HH;4 `Q P$lp: A@- P@BP00Ѝ  p  N S@-@-MX @APD0D DD30< 0~ p$NЍ踶 i@-MX @APD0D DD30< 0] p$NЍv i-M0( 00G P 㜬Ѝi@-@0[ P$0$ $$3 6\@ r00@ P/a CRWC/A CR=C/@-900@- M@ 0, 0 p\ ЍiP@-M `@ @|v {< <G  mЍ  ;?CHb@-@ZPP )mpL`P`|0 P000rmt0@`Vm`l` X0h@ @@@@P0D ^mek03/` P$ 1}%//// 0L0L0/P$ 0T0T0/P$ 0\0\0/P$ 0D0D0/P$ 0d00d0/P$p@-@pP y00p00D S 0A0CSm0$P9>Pe 0@pP$@-p0p' 0`P/ R/P$O-04M@@ !T20. DPYeďůpo 0$ (`pVD@PT P p1cehT6l PP@ p 00JP`p R  P Q R/6 0TS $ P\(P  1/ P c@0S dp "SR(0Sd\ 2/P W0 [  jp'Qɚ;_O-MMPp  X p`%ߪ pP$ 1000$ -k ⥟ dpL ☟x dp Q Xk P'  ?P! K0S 0 L0S 0M0S 0 N0SO0`S PPV i D p'e}%@-,MP@wpP =X`P( f p0S hݨP =P00@ @Ѩ0, è,Ѝh'8i(x @-P@0P 㯨G-@WPP0 /`@ Y㔀[p[PP  ယppP  H@@@dh@̸ 2' s@-@{W@P800Ѝpl[P^[ẃ@P <` 倚P7hu \'3Ls@-@QW@P0 ^/C[P5[ᑃ@P T` WPhu( iЍpr̸ '3LA-@"hWPP0 //`@[p[_PP  pD >FJN@#5̸ 'g@-@d <PP0P PP.L 0 S@@00 >00Ѝo '}%y0@-M@ WPWP WPtVP d0P P P P< PDp$㙧Ѝ0#5r\'7is@-@hZh P LRhHPH`* P! ,GhЍpBh@SG-M`@PK `ppP"W(    - {ap% (( px" <@T t8Phl2P\h UR T:Ѝ0 P1e@P $@@ap agt 0R gk)g g` p\|Qgp R%P\g ugmKP;ЍGfQ\ 0Q    1 0PgP0 RS gg # Ag0` R P U 0pD```` Ph 8i(i *[̐ $b <E&Pp@-P`@UP V  &V`P *``'`9 00pUTp`A-@T &00`PpZ 0p @-MPP 00Ѝ`0 000p@ 0 P X0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍ$G0P 0,  \p 0 @0@-@P _ @OO-`,@pP(0V0S 8GcP$P$P 40S 04S 0S(0p(`8P0$0S(PweO-M00X $0V00Ѝ 0Q`?  0Q> 00 :PP; XpP ,,p.,4@[T /@P00 D0800X5Tl (G( R R[`"00dUx 000 űPo0"0CSi 0BSe 00Sa25!445^ XpjbPPT  Ჰ$pP tWdXB  0 Ap; 0STw /PPZ!0庤8!10#R0 y0i8XdP Z@ H0 YP@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB@0 0#0  0@D@ TW@@ 0 @P0  S  0 i8%@-00Mt @p` `rPL   8 p$ 0Ѝ  i?}%/A-BM`@( p` pP 0 P P PP  [8 W! lSl pz l RĜ]lmU#0P 6dp 6S30S |]0dP 6Rp 6SP@30S <q] 0P 6@p 3Q? c]I0P 62p 2Q8U]8  "p 0S0 ]8 pu p t  p 0@\ ةPpD2Q <']Bߍ10S ]10S ]] 0  `0000p]PU0``0` Rڬx1000 0:S RL P<\`(PpQ \V pWP ,\.\H0S L\ ~\~\3q\`0Q \ j\8i(ii'",) 7Ei8iii }?NU%]am 0@-[ScO-MM`@ <0< l 7KgKP$7[(0'S` @0$00 `F@( 0R |P~$0S0'V$0$:0 :0: 0:$ 0:0 :0 :[(@!0! X Fp0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PdyE00X90IppcppCppPpp Spp@BppA`$ 80PX0` ~[!0X@"0,0,0S> 2[0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S<L=T=<<L=L=L=L=L=L=L=L=L=<L=L=L=L=L=L=L=L=L=L=L=L=L=L=L=<= ===$=,=4=<=D=S07768666$82S# Spt 0S R Sm &S|h 0R  |T|0 LZ0, 0 B@, W0S 0S p Zp`W>yZ 0R0 Z`0S Z0S 000 Z00C!倥娀`pXP0  @ Zp` Z0S W  04 8 <$S Wf0S  +dZ0S 0\ZUZ ` 0dY1 pG4  `000L04HpY400 03c10S1և!u /Zp 00I %Z3 $( P  #P# ß P#  Zp|P3Ip#S0S lY0S#  PYS8Y0S $Y s 夢 `0V V"    0`YV4Y0S 0XYg <Y` 00dY1   0G p00Z10 `0&"R 1 !o 0B0I Y1 $( !P  $P|! x Pt! TYpLJ|  lhd`\XTPLHD@<P0iqP1)L'' $]bSȻ.$5P@EJQPP-B]b{  $,6;DMThp@- M@P` Q4P aPp@@: Ѝpi@- 8@,P(0( (/ Ѝ @- 8@,P(0( ( Ѝ#  0@-MMP "Q@PۍЍ0@9 P+ PP@9ۍЍ0@P0S0S1iS0@-MX Pfp@@9Ѝ01$㫗k@i@- P@,P@0@ @@ I\p$㔗ЍP, A8@- P@,P@0@ @M >p vЍi6 T0 /$/-@- M,00@(000 P  Ѝ@Ѝ/0@?o21  @@@@08-@-  hYdY ЍЍ/@-@QYiQ 0S/@-'-@-  HYDY ЍЍ/-@-  :Y6Y ЍЍ/@-\00S 0  0000 0YXpЍ'@-@OHOOp0Qp0 p@-pMPڬ2P0 PS 0P@ 0 0 00 0XXp HlP@@ ((@,P0P4P8PS00!0310@- Mx 0 LW@P \ oSLPP @ , 0@@9WP 020Ѝ0$n'*[@-q4P4 @&W  WT}%)eP@-d0 !X !T@0 60\ (0000/@ U j Ph0@-d`  !TD0 60\ ,00 00/@ U j P-P040#^4<\$0000/@ U j PD0 40#\00Q 00/00@ U j PL- 0:# ^4 0Q$0000/@ U j PL- 09# ^4 0Q$0000/@ U j P 4 <# \,4Q00/00@ U j P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00@ U ';j $0@- 00 TP ЍH $A-P@p`WЍ P 3M@P p7@-0P@U , "^T Ѝ0቉A-@0nS0oS@p p{hP`VPAT0nS0oSUPPUPP'곑@-p0 UPS}%O-MM`<(0p@- @20S 00S0?   Ѝk p@-@PᚤP0 0/Sp} p@y   @-k cQO }%O-`@ Pp(,夐s렰0 0000 nYp0@DTq oPX0 ὂP@؏뮂9 O4w%,|, @-M@A> 0@0D00 p0Ip|0S SH uQ 00,0 0㙏Nw   > p@-@PP0 ㏏0/Sp p@   @-9k PN }%O-`@ Pp(,夐렰0 0000 Xp0@DTq oPX0 2P@M#9 O4w%,|,$ @-M@A> 0@0D00 p0Hp0S SH -Q 00,0 0N   > p@-@PᄣP0 0/Spg p@c   @-4M}%Z O-`(,p崐崠崰0@P0 bXp00@DT oP0 ᱁PT̎뢁  MA+˷O, w% -MM0An @H 0P ,0@ Hp 㠎M p@-@PP0 㒎0/Sp p@   @-@- @ 00S 00S0?  ?Ѝk p@-@PṡP0 90/Sp p@   @-!O @-h40 0000,00(00$$0 tN L     k }%7@-P @/00PS\ 0  Ѝ0P p@-@ \0P j0(p[hPP,PKp@L' O-@H pJPH {DDDf EVp,60pGWQu 2@FPmmlllllllllllllnl\nhnllllnlldllllqlqlq`rllLrllllllll n0PC@(0L P@=q吁H`( L0`tDpҽ0KSh0  R <( Lh0 `(I0 ( h0N/@  0PP 00,P 0.0T0 PcPT0 K0$00 00000|00x00t0 0p00l00\ d0X@,KRݍЍ|'  l"  p@-@PP0 㟊0/Sp p@    R R @-邊/@-@M0P`p 0?C000 vDPPЍ0P0 0 0@D0 C0P es@-`000/@P BP0 WЍp 0`( "4`#/s@-`P@00!  Pd00SPPP @߼@ݼ  0JЍp'=# (002P0/0@-@CMP( P41010 0000000 0P K< 8J를H00Cߍ0Cߍ0@o꠆E# oG-`0@8Ppp6 Ƞ,̠Č Ƞ,Ƞ D54$03 00n4408< h0e,b<0pE0< D(0|0040<0pp PXH00ЍpHPD PG PJ'huvQ# 3O-$M0 m+@0` @PpT V0)<00$Ѝ 03/ Z0p@ ' 0P0:@ 0 `  p00P LH0@3/pP2+ 0 P 0T@Pp0  d +P P @0 ` 0  I꠆Z# CC-MM`p/ㄻ ាP  P@1L#d8$#4d4# N@41@㩶D0 0@000 @pߍPHڀ@Td8$#Td%4'G-[ 0MP@б@0P` :i0P`P] + 00| 0 qP U X 0L 00<0ppS0 W0S000S p |p`  hP 00P0S`!0!D0D00W 000 0  P0b"!4b4#P0P0Ѝ 000<0X'`|'-0-M 00H 0@=P ,6 zg Ѝ@-c I-G}%O-PM$  0哺 @00@"b0"p0@@" Qp20a0CS g@PDt00p00@\p ҇! 0zPŇz ặP ͺ0S Q  㧇 p 㠇@zLz [!!D ᗷP ᪺0S Q    .z @z'  p j+zvAp t 0[4S08pS @p @Ѝ?B|,,w%9?d# Z_F@-MMCN@80 0@ 0(00 0@p / 0 G"G!G(=0P( lG,8<0P , TG0LGލЍ4G(GWcp7@-P @)0Lo SϜ 0  Ѝ0Y @-@;0P @j@-@[=0P @>@- @)0S 00S0?  㵆Ѝk p@-@P/P0 㯆0/Sp p@    0`( "4`#/ p@-"440 @"440 P"440 "440႘( $0 $(! XXddhhllppttp p@-"440 P"440@ A>;DD5@@/HH)L`LPPTTX~X\{ \`˳p` pdz p@³p@-`"Q@Upf@p@-@PpA-P@M4Q->C->?n}C@X=X\:\79>ї9>:>C̗:>CFȗ 0? AC>ῗC>mGẗFᷗE~EnFᲗGௗ 0X J~pXW}m  $$((,S>,ኗS>GᆗFთHHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W NvTrTpXnX\j\`g`dddhah`l]lpZptWtxTx0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 Pn@-^@PU  xx~Dpp`0h`Sd@TpPP0SBD0D,kD  dD@'}% tS$  0`( "4`#/00S/@-A'p@-Pp`0@S     ┰D00Sp "4400S "440p$'s@-@00S 00S Ѝp@<0001!Ѝp@p0P0` ,X0MBV nD 0$qC"AЍp'''$','QR/s@-P00S"0@00S |000 Ѝp@貙 ?,4`L0BV 9|D 0$#` 2R  0  ?<#΋ 0 `x 0Ԯ`0報 C c00d0 `c Ca c0b0 0  0P!\pQx 0&0Ss $$TGQT`P@Ul 00 ЍO ޮꉮ0St hhȀ XȐPUXP,ᾮ,''U TTt0p@-`0S[\ @vL00S000000B0E0p'$PP4 00/000/B10B1/101/ B}%O-eM  dϠ 0@Ì `0 1P50S  100 R(0S\PpЍ ` P5B` bL RW@QWR5Н|PP/ R, P  "D PD1  2D1" " P 1 21A0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd  0@ `?5c0 ST0T00  B 0P SX0000Y0,d00? 0 0@ `5?? 0:댠 ,1#  0) ! ?!0 00C000 \S T10S  2 dϠ 0@Ì `0 10! 20X@T40APx8 0 B0 080$0C $$  $ 400@40 08 R R` /  `1> ``& ,''U #}%@$jO-MM☵`,῱ t51^OR0du@DSiaH51y99 ?E 0S/nE ?0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0   0SF0LSia4414980/`&22220_E0? 0 040hl 0@DU 0L /0d4;0 0 0@$ P` 4 <0#0p R0C000ps8x'x`P20S6v 2䢟 0 000`0x  `  2Z ~X PZPQ <,ް 2\0Q0@/,040<09(080 P? 0P@-  0@őD L 00 /4;08 8 0 d0@0_ 0.1r 0傑PV 7`P} 0 /{\0X0`0d090?{(,0{ P { {F 0@Dő L0 0/4;$0 ;87 0lh d 0@Ì `01$','AP$`$ ''TO--)MM,0=0?0(8$07D0D`0S> 80pW:,0 0 0 <''''$'>X4 P@P`PՔ P@ 4 ˔p73 E徔p@ \3T@  @SPp * @P lC(0S0,5 Sx0<0(5002 0,%S0022Q04%>Y 0Q|>Qpp" 0 04 0A P>C 040A 0>: 0 4Q=1 00 Q*=( 00Q(= 004 Q=1 p00W/0G,\3Sr1\suXXT1X0SD= X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001= p4uP 0\0 a Q#$''$$'' 7e'''mT','$OT' $'''2! dS,QS18$Q<4R:xR= @0\5 ?>C00p#!3x00084$0<0D04t p@p.u000pXsL5P5| P4H   ?ẩ8@`D ?೩ p? u`WtF01o&"  A00&"n0  4%8$05<4R< 22 p8400 0 0<SoPx8N @nP@0 ? @P0WPP* ? V@PP(5#R0:OP@0$- 000[0 a`Ә%"`0 ?001>0[`0 c2#, SZ QZ3 ?001> !00   B^B0P`0/2"0$ 0  ?V`1V`#T0`10F 0I ?  0B@TPἐ˨ 嘀 00B1  B[1 ` Y"B !!0 R0C!I0B? 嶨0 `᧨똀 0  B![!0`S1B 110S <5u @P`x1ᐪ 0F<Ĕ84CP0S`84<Ą-0$5BPSQɑ,`RB@L0 0 000060S|0` ?4HL4P0@0 6@p;'!4Lp00R  QDzL7\5?>C00!#4t x0Yx7(T0#2! a, A3 31  0 @P0 04 `  0H$4  $ ( B, @%LV.  R*h 0(E < <(b X H( \ P( ?.@Xd@+@B@A.@B,-8 He`~ @40 `K)s ,p8d A YZQ  sZ0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423tr0S+~됺 ~z000d0S CQ c6Rc(`P 'z'z {'+S: @ z0犸 08z'(rȊ (+S|,: 0  R0:1P000\xP2#00,Q@@00 p00 R00&(0 (0Sc@ Rs: QP0 넠@t: 1J0jF 0 U`K%00S> '^F% _ 'z $& ' @8}%ht@}% ' !T'U T+!m''4!,'$L!''8 ' `00Sa  0 $#% r$0+ V.|00S  C 0=S,⭫0S ?0S0$0! ,00C."$\ ^  00 0?d 2 B< b10 !u9$1H p -3PP04SP0 0R0 S00C0 S 0,0P0P0B 0,0STʚ p开8嘥ȿ+" < Q \%l0R@.  (0 0 @DU`@40 4A{q20 R40@ `0```0T04( s 0 ` pP3$0X`0< I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01Q0C00h0`0lR#00B1 d0R*8r%dU0   (0 0CH0 (0( 0 R R` ` Y 0$5S  l01` p0000S3dᐧ0%ST0T00! !<%0SP5X0`0`P500Sd0 0    00d00080@ mS`Q pH0+H( 5P+HX pH000-ᴰR㰱 ,  BU 00FS0000T0 10X0岑0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@ 0dw`h4  80QT:  $5SʬG $`$`(0wV0S ,4 T d,04  0,4 $ҩ 00`  Vj0S   0帀0 Xx0#`x X\># P 0?d @ `0 < T9\%R `i0SP,xi\`/ `ƌ$  $ l0`S`  0$5S  l01` 0000S1dH0<*ST0T00! !\*0SP5X  ``S 0dҦ먐 Φ   Ȧ 000080@%0C40 0400T$*, Q`?0@$00$0l0h`0@ppT:S $S0ppS $S00S`@0Pz뀐 H(z 00@ o8p`0x41廥pY70I@X!@z@000T: 5@$\ Q 0@08(0 哥 (0d0O@N 0NC n 0p 10SP=0S0 000S.608CM = R0ł."\5S 00 0 d 0/ @. `3,0 0$ $60000S0S 0,00C0S0 d>0S x60S Q6>0S 0n D600:*,8]P>0SNc C>`?0S303040404 0#pCVW*LuV.9PdoV.GV0S ?0 PS?\5=S,??^ E?Ϣ0 0S 04 K dLĒH 0@Ì `04 1,$0S0S 04 3 d ,04 0H/ 04C/)ݍЍSngG-`RMXr@ WuPP` uPP` ` P P7 ( n@-N,@, P42/1}%d! 8& @-0 @   Ꮰ O-@0p L|`GP0 00000ZI00SB_: W `B?F ᴐ''P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p'0P  C @-hr co`/( !s@-PL@` 0081V  @SrЍph''( "s@-PX00SL0@`ă5#000<1V @4rЍpd'h''( 4"h10 PS/C-@PQM@MP`6`@f$a ~1 P0p9 0 T:@6S0O@ D6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PTB 0+ۍЍd''h''l') G-DB`p H/PP("(q 0F0( 40 06# R 0 !q0 60C 0 !q0006&0=06 0  B 00C0( 6V0:!$``Vp 0О0$&? Ȟ0(0 6 C c0&0 $&?ᱞ0`L0SV&% 0: S u&0 d ЍG1< (('T) T"x"""p$A-Ta00S FT:p.PP  0 0 A1S0S0 P @D A01 S p0S @2106&0006   B ! ! 00C 00'Y) "O-GMP@X@*?P>U㰐Y  0@00D/60d& 6F @  H>i Td> R`$0]p2 h XSQ 0@H0}༟ 0 R (cR 5-0$0ᬟ0ᓩ (0姟0UC(0  , (0, P  @R 0 0匟 $刟0F 帼0 060 6r< 0 $0,娌D (@(200UX,0000@h P  D`0 0H\ d04LP&*) 0T0;L05hi/L0So hu.;PU _Pc  ˘L 0R V0400$ & \`# @ \  110B0F0D$A0PpepeC0CP!P`\` :00p-P`0"   0(0d0040\0080<<0(02,0 0C0(0C)@ p 000 SJYLj 000 pS D!*&A 7 @ 0|) 0 ( "* 0 6 !"0H& 00 9]PpD |IH&㠡0SK9 R070Do$0S 40S `PD@ 80S<000 Sg0C  0Zp, 0 001(0@`@ QHR'0 Xx0S7 0S00S00 0  C02#(0//7P p (PPXP 0R SHS SQ`@pb Spm0 00 Y:Y:tV3006X  0+(01 00 JT  060 6&ؠĦ(6Y:$0TSL0S d0 P V50SapW~@0S (D5L R d0 P# 0PDT%_oRU+Eқ&0#̛H6 C 0 ᓔ)6 4y 0눔x ဠ6`U0CT 00C0CSX: Bk5Y1 21[0!!!0 Sq# 0 ᓢ" r 0 0d$&S: 060& 0vg0.M.xGz 0W4#0003 .pXk0SMf`F`VI l30SA o.W ).D3PUBL0S \0:`0l Mf  PP1z P#37'6|0X0000E'09630 ;Pp`2.Wm"f` -p` z̟X27'X0000'f&1 #?1# 0RP  *d "x 0 |P0妟PPP!f v*w`P!\ *P 6 p!dS!PU:< U*!:0U:,0 ,0 xp$L0S\^UB: 5'l'"p'##h'N#{###t$p$ $'H$x'x$QSNt$''$'$`'$%_ d':%`) Q%@8}%ht@}%+!mA&4!%%%.&d&p) &&$|$A$) &'''h'0Q:BS! 0 B6 sPd  00 P S %%* 㑐  0p1Pl1  !7P 8 `U&@1`P`60U/0 x xĞL0S `0 1 #'$/%17&\X0000|&&09020 |P(( ᗞ /0 `p|2& 0x9Df0?o2U+u᪙&0#ङ6` c2HU H0 HD%GߍW@G-`RMXr@ lPP` kPP` `?P P7 ( %p 0S   ߍ<08 H(00,0 0000400!4 04$0D0(0P O%WZ  %pTp %p*d kX 8 ` 8 ,    0,00  ڝ h%p 0`?`a8S fPb   00*P*00_a I 0* }d@edAzd@ho A-PMPp`;@ dp@P  0P6P#U00 ## ݍ@-`pȝ  ,@P00S0?0\$ 0S 0 jS\F\GL \ dtHgL0 SDKT ЍE%KUJ%FZO%A_ 0 M'X'@-lFPP@PpP`P D,<<0 P+U@)q') '}%'A-p`P@YP V 0 {jM'G-`RMXr@ jPP` jjPP` `P P7 ( $p %0S  I ߍ<08 H(00,0 0000400!4 04$0D0(0P #WZ  i$pTp c$p*d -jXw 8 `ᡜ 8) ,[ W S O 0,0I0 E ~ $p 0`?`a8SڱdPb   00*P*00`  0* }d@edAzd@ho A-PMPp`;@ bcp@P  0P6Py"U00 ## ݍ@-0H@\   RS0@  0 S%0 /(Q@-$ Q:)*O-@-yM Mh $`010x00@00D00400\00L000 0<0$0H0(0X02000040080,03l0<080404h04d0F00G0`0H0040P0050?0,0 SR hX0S ƖPX@\0L 0H0- S @0D 0 ?0i/!p$ \0@ SL0@0$ !P  x$ 0@agaPP##!p$ f#P T \H0aS 1L\ : SRQt9  ˘@P@0j V@r@DOoB@b} ᶘP pY00S  ᷘPl  pᬘP 3m`PUb@0D 0 t0@ 0$D0囑@0D QP  D0@ 80S~0x S10S10S00S11011|0 0180SL0 RS 00R0 R0S> /,0P00 @R  T_\0Sj 1Sg 1Sd 0 @D坕1C0S [  [ *0SR3#:\00<0S @!0S mP@ T <0 0P U8 JPpD8P@@11 1 1 d000\\0`S`Sx0S4\0L 0H?0$0 Ip+ p`PpC0S)0p2 p1S?V?`#)$p& a1S)p Q1SAe1S X$#!p< k 2"OKK@0DKP?`|L0OK\0K@L0 0Z0T0Q0S<I[# [ [  ? [l0S |-80S l0Sd0h 000@0D0 0#h0S  d0S   T*,800S0 [0S0S"  0C0T {0#Suᇖ0S0`0S SX e,0S , 0C4,00`00l0S1|0 0S010S 1h0S(1d0S,140S /C40P(0&M'NB0P(0 (pp(f 0P!* Rb R *V000S(dR0(0S00[X`1 00PV`5U0000A0pY㤂 ,ᨵg'HU p 0 pSf:Yf$0pUp` u ?֕ 0`SM:(!XR&0S ,1 S$40(00p000 [ 0R5 R4*P (!RP5P"S4U $R,1SPP,Q,1 SR U |\SRQ SP" 01S<1 xP3P%P5 1CP0lY [0D  a0P000p+!`GP1T0b# 02b!b&X 0S [ ) Y': [;00ŸS#,!T0 S:0㈀ 0[&00@ŸS#00S#? 00T0`000Y00 ! 3 qW5e:0+a! ` +!  G0   [dQ [XQRU10A+!2"Y0 0@b"0` t0 +! 0ƒ 0@G0͔0S1!YV*0*U*h**p* *S**%*+*X00E?00!0D\%1L0S XU%Y$! pO%tM%Pr(bRQE%C%,Q>% $H0S yލ ЍS0315q50 [ 1 1S|0_ ?#H02q!`!PP AdH3?C#!Y 0 T02#H0{ [00H <080$40`0P0#40d0,0#40h0@0$0Q l $   Xt  0|0 4Q0X080 S 840S d8f80 0l 0tP%x$0040S' [#,q4 0W0W03 W00S pZ@ D0pp0S p yp T (  p >Z [,1L CS/o" R `0 0 0 000000P00d00,00h00\0001010100 [L0 @ 0  1$00(0$1,0J?03K?03)001x 01100 0$L2?@1c4 04v 08#$0 #(#<l 0& 0#t ?Q X0Q40S00|00o00 0 R  S4XT @'? $ pH TS l (!R R S 0 S7071011H0T RZ* J"Q\0 [0+0  S  R   0S* 0H0< 0JR?o20S F(0 00 25 010 0P B24 0180S} 0`( "4`#/   k B* {S@--f A 8 /eAD00@- 44@4P\P 0B"" (-@=B'(@-T> #!/}%G-@P ` !>0P V0 0  PP G|pP`0P/X 0^b0S < Wb0  V (,00s@-@lP 0  9X X0T"LЍp P `t9$ 0"(S(0@- 04#$$04IQ   " Ѝ0R@-$MPp  ⼏ @1 @00 !0 0"))"1 p",9`P\pAT"#9D"TV@D:$Ѝ"0#1>1J1c\1!p@-0M,AP`  z 0 0 010R  2   $0Ѝp@"R  #   $R M0S1#$$ 0("( 18#! 0Ѝp@V"0Ѝp(c1111  @- pta(1L@- L0@ R0* 0 #  (P `00CS`0p S00 P0S X0X /X'#8}%p@-` @8!RP#<10<10 .810CS81V <1S 0<1p0 hd`0Pp <10C<1(0 810S81($}%}% (0@-@-4MT !A`!d!hQ !`"R d2RK! s!d2SA |= hk0:P{PSP1A k> * +['Hk;[E{7  (+S PPP ! 0 @@zj{ k[@  k[+Sp!4Ѝ00B:|k{{'*k[+Sb!@@?-C6?Y@@(1(2212B2$x2h((2e2p@-㾎j0d2St(@0@-0S0@d2S娎`2"R2$(@-@ 081 ^"44”P -Q\4M2=p2 04>p@-0@ R R 0 RS000p\RP 0SP0PPx'R"R `0S SP0}%@A@-@ P l00S\ 0@ !0R3 @00SP P990),))p@-P0000@`L?0@ Q-00B 0$10S !0 0C!0R3^0 P 0 0 0*00 R(((((((((()(((( R  C=00pPP 0#0%0&P/0@0%)),)A}%A-@P`pp P0 SR 0S0B0Q3 4@0 0   t)),))P 00CS0 S00 P0S 0 /68}%A-P@pVP x DPdي`֊`V :<<y@0/Sb0 R0Sp/Q  C0 R@ `/RR FR .R@` FRP @D T0t/S`0/R /\꿪#}%0AmO-cMM000@00<0<0<0 <+00} qAP 0S,03,0,030S3S0u8hllOP \|\ T ~ !00 3 S <@@ 0T S S00 0K#=PC@P0S+K K_30S3/S:K+ &K0 @ fO@PT[K>P 0t<  t0  t$  0S  08xS`S*?S DS . y000Oy*0C PK+ C 00CK+ <00CS00cOa0CSP/D./\00D.D.$1D.D.D.1D.D.D.07x7D.8D.D.7H87 ⡉  PK 0@P( 0@09  90S|90 0K  K V {D  ڋPK 0 Y PK. +K  ^  ⽋PoK P 0K. 80  D|  ⣋@PU T80S7  ,$  ⋋P= 8<08808408007,07(07$07 0707070707 0707070'70   [P K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <ψPK ˈt0@Pp[ K> 0 p忈t`hP@@0V"0T  HT\HX0Qx0pW h pR000QSL00D0QiDD0@S0 ` X\ X0S 0V)PPP hPP K 0P@0 K. -K>x%x 0 9P `@@pP @ VG|  0S$0 0C!0R3 0S0S 0`0奊P `0៊P c= 0,C 0  R+ .t  uv0  d0|d0`@(4  yKR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  h  X   `tH0 S   \0T0 S `,@0SG @DUYC  ⩇  P0S|& x 0 ◇d  PcݍЍ ⊇4  ℇ   PPA0S, P p  ωP c  ‰Pt W  ⶉPPh@d0SXT000+ ⲂMP[0)[_&))0)TA)}%ZAwA.AcADi)$;_A.A =8)#B7B\BxBBBBBCMCqCCyCCCCAAA,))gfffD#Ї$Dm=D$)YDZ_DuSiq#bDtDDDDDD@0@-0iS03S !>ZPR))Dl0@-@d   Lm @0h 0c ^)E EEE"E)@-`0@Px0 B0PU1 S2P T0p0S @0R<<G4, 0p\ Ѝ$,))+E_}%0EC-PD1`0B8! Y!tMR!p@  10S 8 tЍ000iS00S 00S  d `P4W @ 0  P ( ἈP000 p 0pf W@000$,)):E}%))$OE`0@- B@T0@T0@1 S2 0P   0S $,)O-tQ0S hhT @P 0S <@  .000PU2 )}%H%H )0A-0S 넀pP` U0(@TP`0  RF000S B@)}%0H )IHA-p`P@P _p0S` 00 0CR?o20S 0DoS 0_H}%HyHp@-/0@Pᴁ 0Pp SRp)@-88 0S$ $00  0 CH)IHH}%A-P0@0`/0000 Sڤ/0>+b T0 P<tP0? 4 Bk00?)*$0@- @00}0@0Ѝs@-@P`P @TZXX H?0 00?|+"+R  +  Ѝp7I}%$0L<S/ @-YtP*$$2O-@`CMV b@0DXCߍpTW B/ .0 S'44x'xp= j@t1P0S8Q 0SD{'{{g W:0000[9*0S 彼0 0S 崼0 000R*Q 0S  F`X0 c#.$cc4"0,4 4Q0 P 00000S  ` )*}%[IoII8$*)D@- p @,P 0@0$ \3O-p0]MS DDW@c@C < 804#{00RS   #0pRp"& >RPP "RaW  0"T00RS[  0"ItRpd"lLl>PL"L  PpHBHHHr0SPY : SVH_`P؀/0  10L<aS$ 8 8  @ ( D `  P  \  T ؂ +b P< rP P `0?0H @P >P)PD "e L P >PAP|]ߍ)}%I)))$II *J$0J>JI_8) SJ)sJp(P\Pt *J}%%J@-$@0 00: S8)G-@ q `0S+ P 00S GP0 S00P R HRڄ00S tK Y `P 0 Y00:$00S ( 2 ))}%JJ_JO-AMM`P@g8pP 084 0 AލЍO/00 09/P7 0p!p  @`Q D D @P <⣁PD z@P@    ⋁PD b@D tȠ帰`TAލЍA. 04B   R ;0 0 D E@D W`0 Om 0 D WЇ*IK}%!KmrKA-MM00 /R p@`PP 0S P@ۍЍ0 D &~`D @P 0V P`_*p@-0@ @P  P@p@-@ @3O-tM0 S tt,p00RS`3`  T3T#0LLC4#S@<<tЍO0 A(PL    +0p`00 ࢟ಟ@L<` L\0@ WI < h`VV#W v@Pp L<0@'pl0xSiSPcP 0'0@$ 000 jL<0@ ^嫹娹B\Rd培X圹L <tЍ0 0C0`10S 0S`%0` S\W XW h0SS  ,58)50S d00X00\ `0F0P!ac 0<qd, )}%K))$)0J$K}%Kk*KL))L5LVLhLyLL)bjLLLA-MMp`@PPx 0p)h!h@PX T5Lq띂< 0,ۍЍ aD D< PpU U`k [p0P o x0S $p T0TP 4 V8 [EL^A}%[*)8)"MMMwR@-P@-H@4#S 0  t 0#S 0@j $0A-@P` 0 P0:| 0pp ?|0@$aH00S$`R*0s@-@0PS  40B3/p00S\0  pH0@P`?} 4 0`$ w Ѝp)*)8)MR}%p@-P,@P@p P @p- \0p@-XP0SpH`@P % P  偳H @p)%*}%R1A-Pa0510pS :pj@P 00P&P'$ zP P|  0c ltv P| T L0U 000@,A )*))8}%]Dk-Rn$*C-Mla! U\ X6  000 @! U 0A0 ( 08 !Q  0"Q / X. , T   000 `  T  8#`Rp000F" t F dв00@ PIЍ)R}%R8)RRR}%)RRp)RSST)8)}%-TTTBT_TT7U)OU!U׷buUUUy{%U))U}%V'V))cV|VV8)*CHVVO-C匃5)S+0`V3R\ipe0S,  0PS, 9RP=0S  U5)=0+5 %+ ]909909 Ѝ02 6W?o20SPR0P `FVpZZ4 P0P5 +"+REUYQ! R  E5U9噯1 R, R" R# 厯10S&UP"MT10S 8`|0S6P!90\,P $   x0S   Px ix00 ?oqp;#;S @%>=\+%]H*))}%V%)W}%+W8)BW)DW0)YWrWWW8 *<7p@-@0MS WPP P P ۍpV0S60S 00P 60Si ] ""442hWhW004488<<HHLLtWqWnWxx||VW9^ERWEOW:^EKWE""442""442T0AS0،$ ` Pk PI lPdT0S40S xxd00[XU R O!"441$40F""44"2"44"2"44"2"442(3(,0,T-TX*X\'\`$`+_w 0# #100 0222#0 2 0 (0#(0/,0H0T0, X0/X0\ `0/`0d 0,der20i0005/(0, |2-02R0L " S" 0x30=00 2R # |00# #X0/80\ /`0d 0 %0L0<040h00S!#3 |t Ap1S 0SP! Da! AQ꘎| ( 9-0CS   R0 R R 0N\ \0|Tt0- =09!m)lT*)}%Wk)WNX}%'X%C?XXXoXXXXC-MB2P000R0 b 0M0 0S q쑟=聟0=P  RP 0AS^ꨑܐh=0ꄁp0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ0=ۍЍt0 h0P0`0\0S H,@嬬8)>R8)T*)))SY}% )XXYY:YO-AM30A(0 "S $U+p0(У͡0AC 5/0(0#R00 Q#00h2P00 (0S $1(#C5/0(0,0S3,00?0!P#0,0@ t'P Aۍ<ЍP(0S +p0(У͡0AC5/0(0+p0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  B0S 8#R00SR 00S \0l 9P tlx3  P8P0S8)TY*)%wY8)Y)Y}%Y0 8)p@-@0SS8)O-Mw0< 0 0 4   ؂@P0 80 0 @0 0H0@0LP0D`P:PPP S  S  S;  S h0 `lp SK  S"  S<60S 00 \(60S 6v0S -Pt 050S  ;Ѝ50S P 0 L50S @@  00000%0p,Z0S40S  40S  P 0 0 8&& V00 0 `40S T 0  m30S  30S30S j ?Pta 0> bbV 0 0 8;&8&P30S` P [L 0 0#p00 020S  v20S620S Ps 0 V 0 0 8%%20S 0 0 m"p00 0d 10S 403/ !TcV00 0@X10S00S 0 0 800S  0 [4\ 0 3/`V 4   0,` 8)Z}%)WZ}%))*[*Z$=ZqrrhZ*)~SZZK?pZZZ)*s,u2g[A-1(   0 !S@ 1 1R 4S8 !4|q04|0`a@00S/ P0S  R+* RS-DP- !0 010000 QP 0PT0 $M $P ЍPB!0P;C0P|80S050 000 0 @ 00 08)8)TY**[ )W[wY<[@-Mxc0S ll hChS0S Y^Pr0#00, R0Z3 2r 0500K rP5"0C590C990C9000lP|n x0S \2d"`2Q09T09 <0S 420C90S 20tS|2"CC2eP4r_ 0R0%S P rK H;#;S ;0``1 v0@%S ) <~0+C? R 0 0B 0S S\2P 00S )XaI 0STP=S 000Ѝ)}%m[*%$*0_}%0)))8))[\kT8 *I))))?\[[[[R\e\)U\\,)()-@-  @ ЍЍ/}%x07@-@0PS P {qH0 < Ѝ0000S 0  Ѝ0@)\}%)\}%|0p@-@PU 0P SqD 0<p000SP ) ]}%)2]}%p@-@T`P T0:pGP 0S 0@P )p@-@PT0*p/P 0S 0@TP0@-@   h0  xhb0 dP\0 P8V0 < P0@ (J H$*EF]O]X]a]f]l]I$*p@-P@P @0 4 0D !0R3 Sp,)u]}%A-Pp` E_00CS0*@ T 00CS0* P yTnTyDo0 @00  0 0 S}%)#-@- T .L00S @P@0PŝЍ@Ѝ/}%)]R7@-P@00S#iP Tp0  Ѝ0R00SlP?pt0 dX00SD D0P<$00S $ )]}%]^)]^}%]@- @  P   P  P  l$P l Lz\0QX X ,r Hn@0R2^}%Y^A^Q^c^x^^H&^^^0@-@MPPPP<  P$0$ $XЍ0P^^^H(*0@- M@ \0 00C Y`j6 ۍ^p@-@0S g't00SPdP 0@00po <p@04000Sp p@_)'_}%)8_}%A-/`\@P@Dp/Ѝ/SpPP 40 003P0000S@-@0S  0S 0 000h00S@ PoZ <@04000S @F_]_)'_}%)}_}%@-@0S 0 000d00S@ .Pn+ 8@00u,00S @l_)'_}%)_}%@-@0S 0 000md00S@ Pn 8@00G,00S @>_)_}%)_}%C-0M.S4P@A`p0/SS  0 0U !            p  xX  d r00@ @;Ѝ)#`-`5`<`C`L`U`\`c`Cߍ0FaH,*@- @ R200H,*NaJ@-$M0h ` X  @PHpP$ЍPU D0P:QaRH,*l`p@- M0P P@  g4`    ЍpVaH,*S-\M0 Pe  \Ѝ[ao(Q -CM0( S Cߍ/caka 0`( "4`#/p@-`P0 R  @  0!S` X9 7l!>T0 d0 Dop`,*=bbp@-@PU U  0<m $fp@[a gbKb}%YbP 7P P / //bbub-M M? 2⮢ۍ Ѝ}%4`00CS`0X AX0 X /8}%O-pQDMDЍO?[@x`pP !W200 u00020PS0C000@@ Rp@T3 W+X( U U P   k  fN0 .|   k  f` .0G  p8M p W}%b- `,*Sh,*3<0S/@-@PMQ PЍ@ p31Q``X00CS000000,"1PЍ@L s!0S SL   cd0AS&lؽȽHT 0S0PЍ@荐$ C = 9 50f1hS fS5004003001 200!j0CS PЍ@=0(0<0$0;0 0:0090080070060 05004003001 2001jS$ $Q Q ( xVPЍ`,*b- ^Abbb. c- . c2ckc/cO-TM0@0"00 p`0 @@@$(@rP P!TЍPP40 @@[Pt p@T:TЍO0 EW y R@x   ;y0P `yK ,\100 0 S0C000  Q,4P 0` l0 0`f L` `X`00CS`0X 0@X0 X Ndii%]Di8}%@-00B Ѝ@-0  : ЍO-4 P@pa TAD -Q P P PPP@D`FRPP00SP Ѝi@-0@ 00 Ѝ@?@- Gi}%@-顽.j@-AMQ M`@0Vp0daXQX!0TL0P 040 TAލ ЍP00 ! !01 d?t0D> [!R 0GS@Pm}%@-0h@  0@ 0\0CS @C%00S/p@-@8PU``p840#U:"X 0rX0X00P4080 0X0p`P -7@-@0 P0 0PR*0 B Ѝ0@Ѝ/O-dMPP d@ T0D 0 S dЍ`p | J ]  ^`e!0 [0  _0  ` .0 V0BP Pdc%mmC-@㸀帐`Pp@"!0# U 0 ⼉pp p1 ⲉP@T0S0 P    Ѝ#Ym1 mm-,MM L0$0H00D00@0 0<0<  $$0n.n7nAnKnm}%m-7@-- `P`@ T@ R 0@  000 Ѝ0@Ѝ/%^At9*lnp@-PP@ d0S 0CS 23 0 0p dLp@l h 0 00Sp< 0 0pc7 Upt9*9*un0_A- (`p 0 ppЍ P 1@P 0 PPYpЍAt01Sh0h  0XXpX2` 0 0S o` FP `nt9*%nbA-@Q(p1S1S` W 1SQU(W1S WЍWx1x }QU 6ЍA <1ЍA%QW(hQU0S) S S 8^U   P &^U  ?WЍA9   ^U  P, DD' ЍAt9*%}%^A&)nn d@4 0Q 000/ t9*%nA-JMxAM1Sh1=pP`0 `Pb c40 0`Kp0S JލЍ;X P0{bA7J. H00A1$L  $Hp`00P0 pPFpb Li0S8b1!0 t9*n!o>o0_G-ptA `1S1SP V1S \$V1S V1G 3PV 0 t\ -GVg\\0  嘠EPe0SVGxR1S  LQ 1S D 0?G t9*}%%^AcWou/A-a M0\ SQR$SQ S0A *NS 0 j1S #AuSp\RU\@E@PVT @MA G`t9*o}%%^Acp0@-P$M@0000 PPp$Ѝ0 R p K-d0 0 1S40000 0 pt9*^A/pO-lqM 080@ D @CT Ѝ0VЍOR`" 1!0 0 @@jp Y PP 0 @@ Yp R Z xx x00CS 8g,$t9*9*kppppq0@-P,M@0 08 0 PPpf,Ѝ0 P  ,!! 0Q P0P7 08lQ(g bpt9*%BJ4qp@-`M@0 0( 0 ``p"Ѝp R  i,|P10 01SL0L /1S*HP h!"pt9*%AqO-DMhZ2 0S 0 00 (0:`P (P(0 %"`P(` P@PDЍ`(Pvp ( $0  pp$PspDЍO(P 0u$  (0CS-  +S崱堑P`p( r00R0S W 0G0 0,X,`1!0< 0( (0(Ps p( Q^( U((0$ 000  00 0 000  00 0P$ 0 0$1SHr"<!!!! gt9*Iqp%^AQqC-M⬀`` (p5YW0P0 000 0y_PPQ ЍP@P PP 0  PPpЍC5 0R 4 I+0W400(00 (Pr 0SQP m0 Pp0!00(WP0Sxpx1Sh0`DS PpP 0PS Iqpt9*%^Aqb0@-P,M@0080 PPMp,Ѝ0 R  *0 01SP zZj{e[fk0KZe[KK[K+Spt9*^AqO-pbM0MSP@ =T S P8"8*J@ ]  X:80@ 0 p2o1ٍЍK] ᵳp B] "R| m* X RX X PR*1 21 0T 1S1!T0 0*~T 1!0 0*ripW 0 <c  Y@W  0 <Rt9*X4 SqqO-JM{ M`@PW3 *{|@-M @ P( ! PۍSp@-IMM @`PIލЍp P0 0 phP 0S 0S0 0S  PS'|L|H>*@-M @ PDXۍ00 R  PSH>*H-p3M℃M`rPPWZO@PIQP @DQP@ P!042QPV 7 {P00S , qP  W hPPi P tQP ,^A[ l, PU, cP0S SV! J1! 0MJ P RB PQ  0 Ux-tJ|!|1h @+ R$BP< l <4S J P  pRPh 0R :CoP᫲ P > PP00 S5VP70p t/h0p TH>*q|xSt|~|m||||c|}g}||}%?}O-MMp`;.pp P@@ p sp p0Wıp0Z:0S ލЍ0 0W$@P` O@PLqLL?HPP(1 Zp}V㟉 1Z SP Z.pZP Z.20Sa00 0ZW0V9 Z-P Z.X@)0T:Z^P Z. |dedA}H>*ۍy}}@-0` 0 0SPP 90 P@PSP Ѝp@4(PP DЍp4 O-@-tM< 840PPwtЍB0P(0 ( pPsU  ֩T T T;xTP0t4$0LT6P0X4XT$01P0H4HT$00SZPT\(4T$0P04 0S0R0S00 0 0 (0@` 0 0@TF*303 03030#T0 Pً(0@`P@,@pW6*40S 0dS0ktDᅄ x  0`7 pt  ;X/ pl X `(m0P02R$0L 0BnS01 0<0S 08 S@ ?@0?D000S, 0竸S相0P ?1LT0  4 JP 0L !L?L 0HL {H 00{'{z,0 0,0@0P00D0@ Bn| 001 0X0 p`?d 4 $;` p J?  4!; h$ p X0  0T0: {0h `0{'{Pʟ 0K 0PK$0 pTY@~*[~~~~~?Hi%Q\u0SP0勤d4 00kS% Dp $0XpH p $;`@ p} 0@U 04$;h4 pq h0` XPɏ 0\K 0pVK$000@U  0`JK$00$ 0P,0S0fd0kSㅤ7 q 0Xp p2 4``$; p( 0U 04h$;  p  ! A!X00 T0@ A { {'{i !PpǏ A!0PU  A {0 {'{J 0J 0 JT0 Y@$*D@- ja}%A-`@4pS  P?T0DPEE$UX GMP00?MP 0-< 0P ((3MDPE@Dp>* Sp@-P@Q0 o0 pMP @0S \F$Pp H FD 00< 0p R$4$h%m*ǀ(++++@-3800S ,0,0 p com*m*jB*O-MX M0S1 HpW-Q88Q8`@`(0 >0+ a=P 0  0ۍ Ѝ0 000nS ?S aS ppS qS|0 | 0h 00L0必@0 n*n*ڀm*8}%*% ,DA-X`0S L00S @P@@0p0pP00*m*n*n*T0@-@@/3@00SC',0, 0S00;'n*m*m*@+C*RC-PtM` 44E  P RQ ğE R`S It`F0Q ğ R   TDR 7 4* CR ` 0S $ LaN44 \ P2004ß@Q [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+SD`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0B00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ%%++++m*PA-@@P@T .@ P`p0Slh0 @ P ,0< 8 (0@Ah%m*9(++$A-@PpP0@S`00|0 Rl  R 0L 0S @!P@`T !+0n*r*h%FP+P@--0 C(+bP@--0 7(+@P@--0 +(+iP@- |- 0 0 (+m*t+oP@- j- 0 0 (+m*+P@- X- 0 0 s(+m*+Pp@-0AM 000 0@@S;-T1 PS" 0S00!C:P 0S0n>PP 0T00aS`0 00S`0`0 C:PaS` 0` 0R`0 0@0S0@T@ @0Q0 00S0V'Aލp(+<+ނق0+,+G-1MMP,<4 1ݍЍP0$C:P 4@@~0 PZ30S Scs 5@PQ h03 cs@0S0S PU~\30S5 0P/ P30083  0(3S 3Q 0Q300?o2&Q20S 2 0[P0002@0 0R R00 R ?P 02D"000 H2 2Q T100?o2& Qy10Su 1@P0001@h, ZK0  QP0S0T7 ,PU Q 0S 0S0 0P+ 0! 00 0}00Q Q000?o2F&Q|00S h0 0P000<0P(+*+ B*m*m*0+n*,+<+ނقn*m*4+ C-PJM Mp0 000 0@@S+1 @Jލ ЍS2 0S! K9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(l! 9P.Y#P͡0 J0S @$00 R   R 0 't00QA5qp P0ST00@(+4+,+0+,+m*'P+W 0 0 0 0 [P+\In 0 0 0 0 PP+\ C-KM MP*2 Kލ ЍP0`"C8P L2@@D2000,GP 2 0S@ 2 ـ. 'P0 aQq0S 0S 00 3@P n.d1@0S t5PL1d 0P <1+8`0H 0H<\04 (+8n*r*m* D*n*0 @- 0n*(+0 @- 0$,n*(+P00P0Sp@- (0!0pP@/`PP 00  00S00iP|0x0 0l A40P Tm400?o2$ S0 (+m*r*r*Z @P00P0S@- )(0 ЍP 5P 0"Pd00}S`00S T0T~0HP80 0 00( 0(+t0n*m*H+ + +p@-0PP0000/9@Pp>p hᗶp@P p@'2@ 0S80 000}(+r* +m*ȅP00P0S@- 'P0 ЍP8 g5P 0 P0 (+H+@-M P'H1 ЍP0! F5P 1@@A+P0P`p {0@P.+0@0 S0 0S SP bPl0  Q 0S L0@=P000$0@(+_*+ B*m*H+n*@-P1'0 ЍP 0Sx 4P 0S0T$P0@P00 ( 4P(+ (H+G-@`pFoᨂ@CP 10S 1ЍG|Y(&1 ЍYqP YP4Y! YUQR 8@P hPPPAD1 ЍGd4C,1,qPPpP&6U@000 0g#T6U@ pV(PPP 0RP@`45|0 @0Z<000X0 =#@0 6#ꪍ,+m*:(+0sg5L]D mNA- MPb&2 ЍPO0S!4P 0 1CCP 00|S 7P /P 0tCl1@h@) PP!8Q@a@q@0S 00CS0S )0 0 S  3P0^0 T0000^! "Q|00S p0 00P00D0@(+]Ds*+ B*m* _5InLm*n*p@-PPMM%@1@ۍЍp|)`'@PC@@@To)077,A/P@S+Pt;10S `{00CS0 :U000 0-=0  Q0 -/P,)@')t$(+X=3r*m*m*0@-M0P 0P%h1 Ѝ0PP! 300CS00GP P5 1>{0S0@> @P @2P? eDU U0S0 @ʤ' @P @Pn? NDUl0 ,0S0D @Y? 9D(+džІm*؆m*p@-0p@P0 p@$\0\`0XPS 0S/0S0p@z $00p(+ + +m* 2p@-0`@P0 p@$L`LP0S/0S,p@z 00p(+ +m*HP00P0S@- $0 ЍP J2P 0hPL00}SH00S <0<z00P 0 (+]0n*m*lH+P00P0S@- ]$0 ЍP 2P 0hVPL00}SH00S <0<Gz00DP 0 (+]ɇ0n*m*ȇH+A-MP`+ 9p@pET` 'P+ ,W+ ,@0 ۍSH+@-P#@0 ЍP( 1P  (+Ї@-P#@0 ЍP( 1P  (+@-P#t0 ЍP 0SP w1P 0S0, i1P(+ p@-PH@P#<0 p0P0 Pp0n*(+!p@-0@L@SP#<0 p0P0 Pp0n*(+/9p@-PH@Pj#<0 p0P0 jPpe0n*(+FKQoP@- N#(0 00SN@+(+m*SQoP@- 7#H0 <@0S 0S (+m*@-0P@-000P0S #P0 ЍP@ 4@P@$ _= ?B(+Xp@- M P"1 ЍpP! 0P 0b#p`1`x0S@1D0 0S 1( %P&P0 0S 0@T 0xzm&`&9@P = d@ &0@ k80 @ 0@3/H0T 00S00SF&(+m*avC*L. m**aS@+0 @- 0貈4+(+0 @- 0迈r*(+PA-PPPPU㈀ Z"00Ppp@h0hPWx00P0` 008T,0PA 8(+0+m*و++P7@-A P000/x00 Ѝ0P"0P%0SʰP 0 005/00S@ 0 S  @)/@00\+70 S +<74 /P(+,+m*m*m*++P@- !0S000 005 0P !0 0@P 0 0 00l00lPL0H0D0LP 00 00 $n*(n*m* (+x000 0@-S$000 0 0n*dn*((+ln*000 0@-S$000 0 0n*hn*:(+pn*p@-@Pp@0 @- 0L<+(+0 @-z 0Y8+(+PG-R@Pp PJ!ЍP`NP? IP< DP`TP5  -PT. -@PP$$`. U(1$1@W 10SV U00@ $ $``PK0 0 S  V Up0l0@W T00S H0H 0DD S 8  4|oTn*Xn*0n*\n*`n*m* h @-j0(+P@- |0 pP \00}ST00S H0Hv@P40 , 00$ 0(+0n*m*H+ + +P00P0Ss@- 0 Ѝp0` 0S P@P i0Q R   L 0Ѝp@fv$Ѝp@}(+,+m*'P+3Np@-P0@PK $0 p00MPp0n*(+~A-P8 0$"0Ѝr0S 2 4vP80S10S 1&va0@ ` 50崁S Cc!!b"  A   c# P0U0CtQ00CS0<k P?00CS0@b P7,! -PS0Tp00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 S(+s*m*n*ԇ*ԇ*w*8}%P00P00@-SM  0 0Ѝ0Pl  E-P 0D)qpP@ 0 $0$U@00(+m*GP00P00@-SM `0 0Ѝ0P -P 0c)qp L0@0P)4 0c0S 0000(+m*PP@-0$0 P2/(+V[@- (0@kP0 @8 m*cP00P0SA-쀟 00ЍP ,P 0?0`P !PPP 0RPI9@F9@@8. p4 H' '00us(+mNP00P0O-SM  0 ЍP  n,P @P@ 0R@9p`-|0 `@P0k40 Р00000@@0 D&(+mND+P+0n*W\Pp@- s0 0p`@PvP |qP llP@L*p H H080 0p0@(+r*r*m*A-p`P[ @Pd0 `AWP 00-4 RU0 ABm*΋0n*A- PP   R ЍAP   R  %@0S00Ѝ@`p(+%m*A-0p`P0 AP Pp@P @AP }00 00(+m*΋p@-PT@PH0 p<00S00p@(s0 0Pp0n*(+,+m*Bp@-0@p@SP`0 pT00SH0p@@s0P0,Pp0n*(+,+m*Gtyp@- @x@RP~h0 p\ RP0p@Hzs P0 ,sPp n0n*(+,+m*O-MMPQ R3 ٍЍP0# C+P 3S`@pX 3 |Y 9PP@P)20t'` P00S 0P @B0S000p@I2 s2@0SP$S \S00P" 0   0 #" P00B   BR 0 D )b20 57@0SPiR0PS 0 D)b20!7@P1rh1 0S x10SL1h`10S ,0r00CS0. B  g20 03/00S 0S 000CS0 S0  )tF200000i0  X 0`S8 (+s*ԇ*m**%m*avm*0n*m*n*@-@P 00P 00P00p0- lM X00S H d0] P000p o{n*m*)m*E*-lMT00S D d0= P,00p O[m*Cm*E*A-@P6P `p0 0C0SQ3  BPP 0 B RQP 4 0 0C0SP3 p@-P`@:(P &- 0S1PS !|-pp@-+`)P %(P008 -:S!0R]Wfp@-@P (00PU 5 :Pp00p@-@0`PP<p0 .0Sp 0h R00儒 Ѝ0 0S0C B RQ"  r*qP/0S/0@-@Q0%Q#0S P   R   07W0C2007W  B%G-`P(P @ AP  APU0 00P0 10S / (Pe P*P@'P 0pS42  PpA*:P'P p9*P :'PQ p000 SPᯐ0S 00S1 @RđU|0 ёh `N0 0 ])00 B-QT /=0S-=p R( 8p p$p0p-0 R&4P;0 00|S <h0S;0t ILM ZH= $= ێ`NX[,,H;P0S000  V$ ::+ 0S 00S -0Py 0Sv v&ܪp_1 XPPP 0S :hDPRO1X :H=PPW xPx0SV x0SZ +0 0$ PE$P %#P  0`!U/1\1X1T100p `10T1S 0S \AT! 0S v3P p ҍUR0 0 ▌0S 00S P P/%\K8UKύ00,! 0!4 8!0R cPP000058401010c/O`P V5104 P前PtPt0S4 0倍\OU@x`PTv B 0k_0P0/EP80S PPk/@ꐗ + +00S Xk?/6@80 S00?o2$PᎻP0 +P60S P 0S`%P 0SX%6Fp嘆V2@P3x)t+Ql60d6qP o00@T #0 5P `00@T 0 4P Q00PO *OM``ElP<Jt')AP<=060S(`x@T*4!@&K,&$&5uPU<0S(0?'"( ,0".0S ?0.T0.͡@!͡!..R0n"0R0.͡ 0$PP#PP0S0S80S#PP ~B~(H000.R0@D0$ .0 pwx'xT PPT p\ X.1X\ P #P U x U R90S 90S9yP $4 0S @DT90S YpF+1!0S   PZ0S= S E#H: H:` T00R0SC rPqJ  %$P   .P Ub d:0Sd: P _*+ ϠP 0; R# L;R.sr ZOȷ.Q!03/Pp;@基 ; R0 ;Q;C/,0 0 S dh lp"0S,|< 0R.Kp n/-0S W000S P000S I000S B00|iލ Ѝ0S 03/0S 000s@- P@#7P  7P0P #Ѝpᒁ`P   7P 0 F#UpP Ѝp@1 0S S0S $ 60PPꊎĎЖь@-M0h 00P P10S 0S00 0 Ѝ  qQa @T0 S 00S 0s 0 :*P 0 S000Bp@T h,P 0|S ᐼ00 0S00 0000r*m* T E*r*@n*]D@-$M`p P%00000008@#*0P/S:S y@PxQ@VZP V$ЍU *PL @s% Y j%0/0=PP":=pP幆@P/000 09@P00)`0@@DcT@@00@0CcS1S@(+_PP00/@-.,0 @  000.@n*G*@-.x0 @ d00S X0X0 p {<0000S .@n*m*m*jG*@-.@`00S T0T0 p W8 10 10S \.@m*m*jG*l0 @- X00S L0L0 p 300 1010008n*m*m*jG**`0- lM@ xDd $800 p un*m*H*0-@lM@[ 00 00 0rS sS p]hd k$\d QP00 p ޳0(d n**G*H+)Km*H*#@-`PP@ 0@s8#80@U 0s8#8000@? KP VU 0A0T0Ѝp00CS0 S0 S 0 /O-TMp|00?x0 X"? 0p 0-0`P0V0X B@մ0 @040SD H 8PZ0S= S DlV0  n@P*-0S -0#S -|0Sp l1 R XaR 0# i-tp uTЍ ?$0000  PPL-0S H-0#S@DT|0S ph@"\Z$0 V `|#L"0 0 "@BHn*m*O-BM MV@@$@ AC??0a>0 @@@0`5(p`5夵P<$V PP)|50S5W h% 0\U  0X,U S00H00S 0S  0S 0 S  R 0 00U!$$PP$p 0 J@P$ p `0u`8 4 ap0TS 00   00Bލ Ѝ3@@30S VW@@c3! 3 0  U@ L30S.;V50G?o20S4 30S0#3 RJrTN20 CRk2000/ U)U00e @0B>W0pXP44220S V: V `2HV"h2000; "00E 1#T0 CR5@V-U 0S1   00 0V #T V00T0ST dT(U@ 1 p1偺L10 CRVT$10S@d@0 @SP405+( "10S (3/1W0     0QR\@\0 RZ P :/ 10 YS P 9/0G G*l  (+r*s*0n*r*m*s*r*4 z@+%(+s*tn*-A-` @T 0 ЍAЍ/p00$  Pxal0 h (o:0S@ mP 5/}s*(+G*l Wr*SO-FMs M`@  @* * 0*0$0`3$ 0(00,@&E0P S+b0 Ẃ3 Fލ ЍD0 @,Q(J!2@@Ȳ@aGT  ᜂ2  D 0 PD0P|2d :P `"`d'!T #!0S 00S ,, 0d g  PP d@0S00?o 2)Pᵰ %06D6D01@ @űp l ʙ41  嘰D0(66S0d000 d0ᢱ]AaW0PS P P 00S t0 |0HP@ 0 @0s0h,@m0?M*xn*(+(+0n*-Bm*HZM*՗ks* s* O-JM WMsn0p0FXv600S00p !9 [PEX6   60 9IPX3JލЍD60 0000 97S 60Sa 6 j`0050S# 䵟0S5 Q S 5R "P 0S 500CS\5|>`00l;0S P97S, 5D 58%8D0S 500CSX0$000(00000 PN 4卯0000S40܀C XSX @4000C 0h00d0$ 0`0 P@ CnP 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""4408'0P 2X$0097S0000 0. 0S  |0 $p48'P820 00$0 0  (  pP 087;P0  97R` S㸁 0S [10S/ 0S+0,< 00 00,1 8P8!81 R  x 0 ) 1Z&P 0S 0097S;70:70?70>7='<0S P0s00UX0 0Su [X  TG*$n*<@ (0S 80(3/0fPn*H+Hn*X+4n*W,n*m*r*H*r* ]D0n*m*z(+4SU00m$DmPPTy zP00*n*+m*|r*_Sa0n*D+4n*m* In5(+s*kA-@Q0qS0`00S Q`Ѝ0.L+P AP m0 R 0000@ Pl00}S0s00T 0S$@,L r*0n*,+m*ϥs*%(+O-P聟a0AS000qS4M Q 1K4ЍPF .P00lP00XP"LD zP$4A(!0ң200 000ʣ@, P 0 ἣ@ P 0$04qp00P0}S0s00U 0S(@8zK Cr*0n*,+(+m*ץs*s* H[s@-0(@( 2SP+A-`P?`p;T @P @ @P, @'Ȧ@-@6P +0 A- 0@0PS0p`0밀P" 1P 0S 0"S0 R S  p`"R"^ 0 00 +r*0n*(+0 +s*0@-M M P  @Pۍ Ѝ0 Pl~4/S @ |P;0@TP/PO-@pP`W 1@@Pp3:pF谟`0X1 0`T@10 10S 0 SY G0uJ Q00S*00 020 Ѝ`+m*@-P0P0 @p CpP0 0SP0 0@Ѝm*ht@`+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C\n*Tn*8Xn*`n*0@-0 00% ₃0S# R 0S0000S b0C("( R S             Ѝ %%7@-P@0S 00p p0lp\{X@0S 00D 40\p( Ѝ0@i Ѝ0r*br*C-@㌐pA\`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR0%R0PMU20S2 2"0S0 CG0Q .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[0N B B0 ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0S P^*0SPZ*@PL0G RX QP 0TJ*0/SE*0< RS=*09 S  7*+0S2*> @ S,*0 0 0GS$0P(0&m*]D(+ + + +/A-p`P @iP0  T  `00T   0@ R   `FVp`00CS0 X PpTD000`000 T00蜧8}%C-Pp` 0崐@T;H Q 00)a@x0@P`0 \@L0L 0 P 0 Ѝ*?m*ӧ8}%m*m*G-M@ `'4P 00T 83 `PG!P #T  30S+  `Q `V` xpb0E. @00002!P El"lNE@Xsލ 6p`,0T $d )p TYq010@S  R 0$ 0/ 0$ pO0$S*F>C0S  7X4 `$Q(00SZ=9Q =(/@#b?!"/0 0ؖp40S 0#S Z0AS  T0 0000 0p 0S 0 0 ᷖpwP0T P<00-Br*#Pr*Mb%p@-@PBp@讗ꅖp@-@`00CS0xpP0 @ 0S0`000#S V 00p0 PA-p@`pP0 @ f0S0`00^0#S V X00p@-@PP` P < Pp0Sphp@-@P h멨@-cP`Ш@-@cp VP@-HPI@@-0lMPQ@00 00 T  40S P 00 P 0 0{ 0 PACcpW' 30S  @ @@ ` P  P Ҝ`3PJ P Tg0S 8 ?000P P02 12 PP 00 @T ^  > P 0 0@T O  /P lЍP 0S @P@E 0    P@%  T T0S @P@&  0S @P@  Tw 11@T 0 x0P`pVX PP)T000N 00 0PhQ XwP@r*Ȍr*m*8n*Іj8}%0k(+y +m*m*s*ԇ*<*m*m* + +7@-PD1 Ѝ0Q0S 1 1YPʄ! 0 CRhA R S0T!L1P 0S4,!S [P 0S 10S 0 0%@ @0@0 @0 @0 @0 @0 00S 0 U(+m*(+m*y8n*n*r* n*0n*ک@+++++ t+p+2g++/P+L+ n*00S#@-0M@,  0 ^P0S8e@0Ѝ0@n* -A-3@-CM000030S3@TCߍCb_l岽P XUH1<#1S4!(R< 03/3CPQ2`P0R0A@SB-RO@P; Rbp HcP7:@00S 00,S 00S0 `10 3/P00000S0S 11 03/0S1000m}p0 0P 0 Sn000 PTq0 0P0 S$R0000S 00,S 00 S00S 0 xp 103/P (000t0 h 000`*+++<++d: 4+_%,++ %Q0++*+kyF3^AbaS (+ 0k++@-f 0 ? ++@-/ 0ż++< +P `00CS`0p S00 P0S X0X /X֙8}%C-@Pp  l18C8S t`  児0S  0壘`V $ Ѝ(+%++ *+*+H++%(+(++&+*+'+;˫p@-BMd,@P4P1 H,! 1  ,PP,`1<r> 0$4Ѝ0&+%@-`0S@ YP0S 0000q20\@n&+S07@-l000Ph@ R R l  R  P4j03/ Ѝ0Q P%&+< %Sp@-` A Q1S 0SP ZA}P00p00s0P lP0 eP0 x^P hh ᬍ\=0L@L  "  \ p%&+N0W}% %(+00@-18C8S 0P 0%,+,0@- $@ᨄ0@ *+H++*+p@-BM` ⶄP@0 S`0018C8ST01y0 j0Pn00x0 xBߍpB/ BR 0䋄00P Fy0001*+%In,+*+ 0?o2 0/%@-AM R   b000000@00  YPڶ0 q LP 0SS WS BSr0 +9P  TsM0S  10S0 p@W 18C8S ؀0S R     |P W 0@^S00CS00  S00 P0S*+n (+H++&+%,+p@-PH@P@p.P P 'P @% 0/@->o/A-@PP" p00CS"s $t t t t t t Dt `V PPNJZP0 P00TA" 0S P0000 !0S0R 00 ꀴA-PA00C!SaXp `V0000CSPu (u u u u u u v `00CS`0p S X0 X 0 "S  x0S`00CS`0p SX0 X ! QX!]I0 0P0 P000 d50"S00HAo"4*0 0P0 ,+8}%S/cl@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 ꤴG-@|P2 pqp =`P`]PP2 00PF 0P >( V @P @0S@0S!00@PP?%P PPP P 0!SP|V,+cl%A-M@PP\1   @P `p崀  TPu00u0ۍ0 DP 0@ 0000S D   P00 Z%ƴk)+дp@-`@.PP 0 'Hp(YPB@pVs@-@P` ʁ i R b ^@T|Ѝp(R( dˁ0P{P @OvP ,KqP (+f@xt yt ,+0@-M@@M0(@,0 0 园@P AЍ00,x0 ⓁPPP{P0S '00@SPH| ,+%(+@-霉(,~ܵ,+@- @ ‰lP 庉 40P3P xstqxh ʂ\ !n㞉 彂OЍ(+xt yt f@T0@-4MP4PX 1<18C8S CA^ 0 9 0oP DR<P8 0E, R ր Ҁ;P! 71PP H0(0S$4Ѝ0=R00ES~ $     th`\XT HL%Z(+}%fcllq,+ٵvw0@- 兀@3(+cl-@-k-@-k0 R   ЍЍ/4-+-@-R0 R   ЍЍ/4-+A-ARp`P@1T JpP'`@DO-dM@P50P0.0P0 0 8p800,@(P40@0`@P p0p,0SX ,0S5TX L @@[ X  ( 0 0 ( (cpsP T+,0o0,00娂00T񟗾ꌂ 8 p ؃  , X x  t ( Q 0S0$S  0S  dЍE3 P ( 0C,0~P@@ ( QQ , 0C@( ,0u( Qh 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @` @0V @,T"80(v5P6 <(50S! X H P ` t t , 8 R0 X (b0R040880P(4<[8 8 (b0R  $0 O  $0 P H8 Pß0000S(<@SX (  P0C S,0( X@S( Pl0C,00 S( L꽶˶4-+2LgmշAgO-lM($ 嗃P㔃PU``8@ p0}  0<02 @02 @0` 000M@P h ŅÅ@` FO`@0S( P ᪅ᨅ@$0 lЍHd?@` d00 S @.  C< 8E0ЍC赅0%$}%źA-MpP`ЍA訄0@: SPPT@G`P00S 00 0hQTP1 S}p P PU0DsLS<(    X*[4-+*2CO-]M0 M-SPP D@p~P3 00S0W0S( 60S# ` pPi40S ]ލ ЍO~v/;]ލ Ѝ  @ppU0* RX < RP |PP(Au |V~P |30v: S+ # 뤳 0P@`Pم |P ph ` 0 0P00 0 0S0S` - |P`|`|v `0S 0 |P |V |P `z{ R }<MRK V|pP \ }P x!1Z[  0T| }.}[6|p`l< 0S'HQ!000v P: v?b  0S-v|pP vqȯW ]ލ ЍO4P-9| 0S|pXP P : R S00 R0S {PPhVX}4-+%*[cr? ӹ$I8}%0 R R /0@-@P0R0 APCU 0APLU aC\ACP 0^0\0R0 00@- @P@@ R!P X/IP00S D00S 80 &/"I#PM[ρH-+i+:+'%@-J_e@-_Pp@-PJ@}p 000/-+p@-P@0-S@@p IP0Tpp0p@-@0@MS`P0 @  P@ЍpPU P$ e00PH%-+X@-@P @ 00S@-+p@-@PPp00Spp@-+A-p `P@P000 P P0 0]@-@P P0P00S@-+@-`qdMPU> 0S; UFP2 @@?T/  `00 @ C /@  I00 *S 0 000?0`?ZP10#H H>&P dЍǻ\ 0@-$M8P0S 0@ @$Ѝ0H%0 0/-+0 R-+A-@0QS`0@S` wxi+h6+,*ADPHj+X-+Zi_ת2,:+(]T]s;L}mM`eclN,E+Y0  -+0  z-+@-@(=St00S h00S\00S L00S  `400S  Y0(=-+Dj+-+i+j+j+0P/0( P/\-+-+0 A-+0 $ <-+0 7-+0 2-+p@-D0@0S 00S 00S  <0S <0S 8S0,=t00S  \00S L0P0(]Sp@ zDP 0SpDj+-+-+j+j+i+Xj+/0 @- @-+$00S/0 R/ `j+-+00SODdj+0  -+0-+0P@-4 P1 +P00p@0-0C0LS ``POP"0-0C0LS rvp` 0  0.S00 U`T  Ѝ0 5 @-@P P  P P ЍQQl0l0ѲQQH0H0 Ѝ@Q$Q5d5 hny/p@-P4@Pp@?0S +S70+Sp@p@@-@@@    ~0 0-+5 00@`/%p@-pP @     <00S   4u @p  -+i+D0@-0S 00 @T@IE@i+-+@-@0 0 0@-+@- Bo 00S tC0 H%-+A-PRp@ FqpADFqp MP GPp P`UX@DTUtl@8/p\Vt @W@T*U  A )ꉼ˼ $0 0) 0 00S/:+pp@-@ P 0s cD@pT%O-`0Sp @)0   ?990 VጠY†T00S[  RP t@  )D0%:+P 0S  R 9  (0///:+<6 O-Mट`V 0IS(,  RQ0 R005r:4) "P  2"RfpV  rq$ <$Q  $Q Q  0jz# 0P {  {`  @`  0 PP 0 @@0bvyf`p{VX!SR@ 0?  0qp1CЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pk09a 2 q4   10SO  09ϬRXV a0SGlC002\AP10SI `10SEPB H1 09 0$ 00*b4@p 09c|p  RB 0P  ks l00St0PRc0SL00S\ O:+lk+$j+T% .T-+Si+E+@6 90% x+800S 900//:+@-`@0Sp <)00S000(0,0(0,0:+p@-@0Sp Q Cs00h@Wz00p098@00sp000B(Pp 0 0%:+-+D x+G- q`V= P@;U000P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@:+ x+@-P \00S @ T S9 (,0 :+p0@-@TI0 qp0@ @}00p:+ x+p0@-^ 9 @ 0@&)60 P@ ^@T:+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/:+P00010 0/T%7@-P R I0 00# Ѝ00R* 0@!"0@@^qp Ѝ0@WA:+V0@- 00N Ѝ80098<@ q|/ 00\ /:+A-`p!PP"@f 9 @0@  P09   w!09 r`A-+:+@@A-p`VY@  @ @ 0 xP0 0p0 qT  00x0@AA!:+-+0P /:+\ -P0S0@  P2:1S0BS /O-@DQDDM`@|@0S(!U B ЍO bS9 .S8 00C S 0  ? QP @cS@U:t@0@0CS000 000C/  0?*QP @@:+vf;+p@-@P 0SP`pPQ AP@dPQVP7@B0P0S  p P\%%A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o21@0@ 0C^S0S;P@u0C?o2:+@-`MyX@PPLPHPDPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @n?y0:S f?q0cS .S bS S@ @0,S@pS wS0 SP,  KP 3pxPz@Pv@Pr@P0 0  Sxl;Pg;P b;P];P lP ^ꪬȽ;+;+;+<+׽:+.9%0<+BP4<+ %$) 0/:+ @- 01SP R t0 T!WP R HHx@08 0 %w@"P 0:+Z8<+y^ 0S 0S 0S 0S P////// 0S# @-@PPPR0 `0aR R S R0/0 R /!0 R0S //@- @P| , 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0P@\@P0 PP@@x<+A-P` @Pt pP `P @P  @A( @ctT p@-Pl@P XyPpHtPpp@U p@Pp ]DnO-MM`p 0@P ZnP0: SXutX  >P $ 1@P> ᛠލЍ R R R00 *P@ P #PP @ PP 0"SU T 0S0C0ʡ 6/ q>P 0mS Pk#%9*#%2P P / -BxD+s@-@P`n " 00 B0ЍpA-@<`Pp R 0S up@?@-P`( p@0` G Ѝx<+@-`@ (8R808Ѝ< 0 CS  8 0C 8x<+D+p@-`Q@PRpP0S  t$0Sp tp@0S S D0V@ ` 0V, tU  p@t#%uS*2?(0 ((((8 0 ( /x<+#%0 ( (( 0 ( /x<+#%C-@`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0;+x<+7@-P@@@@00S Ѝ0 7Px<+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08n9 80 8 00S08`9x<+.+@-0AM0 08S0Ѝ0S 0SP8 (0S8p0`00 0C?VRh B(08 80C 8 0 CS ڤ 0`x<+.+@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00x<+.+s@-@8 R  0R0` (0 RP08 80 8880S Ѝp0CR80S  00Sʵ808x<+.+p@-p@XU N8PE``VH0 (  p8Sopppx<+#%(080S @-/x<+p@-D@0S PX*8 P 0( ppx<+#%p@-`xP@Rl0 R(0p0CR0R:(0 ( ip00x<+#%7@-@0@P@P  AP Ѝ00P$ /x<+0S/0G-P0`Sp@U @0pP0 @@@ X dP001q/q @ UP00i+P R/-@-4@$P(0,0P $8  x<+#%7O-P0GS` 8(hS?Pp $8SDG(R008(h8! 0S0S ] Ѝ0S08R00(hjP08 0h88S 08 ЍO`0F?o2P0S `&0 S PpP0@S <  ` p l l l eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)$h0V48H"3P( 圓R( B( (( WPV  PPl;DqH80S 48PS8P o08880X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 00PJ``` P Q`*ZXP@$ 0P;+x<+D+#%xD+D_pC-0 M !0@P 0 0 B R   0.S 3 `! P`4HP X7 Ѝp0 P`000C/0 !GP00x<+R0(8R/x<+0$P00 /x<+00S/  T-+d O-MⰑpW]$ 00! 0U R`PQ dPp\X@0QSQ0Z00-p@P9 p hP 0: Sp g P)d0 R'0 X& o@X K  0G0  x*dgZnXnЍ P00pT-+#%i+ euSh 9800S ,00S 00Co//-+-+-+p@-|PPF@T p@``!nT0S S VS 7Sg@ @D+p@-@0S00S 00SI8P 0p@qp  00S Rppp0P@ ^P0PL0@p<< SP@ ]P%Dj+-+p-+E+Xj+:+@-4=@>4G-@ ePT0嘀0  0`0p 00ST V0 000S T28 F+:+ x+A-pP1 @0000`  (P0;0 A' 2 A0  PP    P $5X A*D+rp@-|@Pp$R0%S!S0C Sp S} $ 0C SnD  7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP m0S0pnp0 p@Z0 00Sp p@B0!S $P l$t00Sp$dP`p@&L00Sp7D00`Vp(\' p@4pD+-+T-+p@-P(0`@p@LD+A-`P0@@@p0P/00,0S W HT T 00A* ~D+]DE+\p@-MA0 70000\0  b0  ]0  X0 S0  N0  I`P0S1 0 l;PU0 D<<080 ЍpD+_-BE+@- 0@#%0PiP/D+< S /@- 00@4 Ѝ7%@-@r0 @ D+|0p@-@M@T 0S P0`P V@Ѝp`F0PS p:+@-@D( 000@S 0D+@-@@P@-@G-04B-0,2凋0$r0?0@Me`00S0S  A10S x0S 0S45L0P P (2oP`0S P 1_P 0SV80S! p62O80SeV|Z0SP0S[ /S TS S S U U"*8=P d2Z 0S B:1! "1D+-+-+ x+L-+Dj+E+9D+)i+#%P%X-+?>Sj+i+i+Si+ F+8Pj+i+#%S]T-+]Ds#%\d-+j+-+7S< iS0S P0 P P P 00K`P iV 0FcS񟗘h  < ,  < <   | (  h   x   P H  l l d   X | ,  L 8 p |    l    H ,          P                               \ 00E.U S``ydP ePeP= Q0S`Ec 0SP0@_U0b ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  {@0#0P MP 0 a0CS00 0`/P  ` 00P 0Sa0@S @P000S =V!P 2,00 @0S 0|$ {-P 0S.P ,Ta0ES000,P ,0 /UPnUU0ESf( h | *U( @U6 !U[ Pq 0S US'T60S# PP pf0SLW960S 60S0 97R0<  K60S07S ;07S 00,'#i|C/K10@S @0007S9 :<#0CScP A=P 0 j0S e`q0 S (0!R0*?0I$80S { n0 S h(0!R0*?0/ !R00 !ı#80S!R0Q !R0 0!ı 9 09 !R00 !ı\90S!R0)!R0 0!ı !R0*?090S 90S `0 S 08:0S y0 S 0  "n H8L!LjR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0~<1yP0rP0~i0S 0!ıT; [5 /U;0S0SPl <@ $<D ,<H  P 2;!W?P@!R0 0!ıPH &,P P !R0>>0i?Pd!R0 0!ıP& !R0>>0Q!R0 0!ı?`P,E kP ?qp X? !R0 0!ı?`P+!R0 0!ıP h?`PI P 0`0,`IP>)P 00,00 &20S?"V 40 PP U U ?V"R0 <>P|P U U +"B0 PlP U U J"10S %PXPs U U.P!0Pl`!` %(P0` !R0L1 0S<10գ?0/0 $!0 S00C00 C!R00 0S00գ?0/0 000 00iS #h0 :P00S0802T-+#%\9"-:FNi+.+F+E+@j+00S/;+p@-@/!PpO-S`MPp``@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0c80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;0P   80 fP f [0J0C;+0   /G-pȀWY+p S@0, @PPP 6ZPPE0S`0S P B 0 0R R@0`Yp@-`R P@ d0P @@@ 0ppM-@Mp @900PC  RT0Ѝ `? `m>P ?0? `P>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8 0 i+-+E+A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ#0 DPzdP fPP Q gR 0S 0R   R E0 ii+-+E+@- @ @ E+ @-P@, E+[ @-P@{,E+{G-(2pW pЍ]PP) P0`]pb@P 0pWqp&d \]? SZ d0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP+T-+E+p@-`l@PP<J,<0SV@` `<D IP+p E+ 0  E+ 0  E+7@-`P@ PgP 0S  P Ѝ0 E+Po/@- + ЍSA-`QpP P P@P%U0P 0 P l @;cT @P 6/P*c@-~x 0pl ll0P \ \D0P P<0P@04 4 #%%%  (5DMW]P1C-M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@-+-+-+G-@M`0PSS003 @ R S0\R% :R R D Z /Pp P0H3/0S@@ R0Ѝ$6 P/@- p S( x*IbЍ00S @  h g*\0PT T O( 84qp eSi+lG-@P` pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(V0p  S P0F@ @#%#%p@-@QP }0S R SppQ0 QA QR P/@ PRP/p@-`9 PPp@p>p@, 0@-M + x@sr  ) PP  000Ѝ0-+`E+400S/@-$@P P@i+-+@-@P  -+P/ @-p@''0@-M@' ZPZ00S@)PaP DP OP AP )dP oPi᳥|0t00SЍ0 YPP0 005qpY00@+)-+0%_O-M$0S 0S B0S@ R u P 4X ЍL >@j Pp 00n pPPP`XP HP  PPpP0S P``30STPQPN ((@(!P3`00P0`0 tP0`0 4P T ( u` 0b>YPk& 20SP `JP   @( YP 5YY |2 hd2 p 'L2p@20WF0b,2P 0S IP (IZP11P =)&0S )/1 \ )P H$P h1 P_L10S Q_ 010 (0 qp 000Sp 0 I$P  R0  [ R 0 0P: l X -+-+8t]Dj+`E+Sp-+-+tk+i+\-+-+-+F+#%i+ x+&%P0@-@-+00@-P '@`E+]DA-`pP`VVPU@JTWlP0 x+ 0 -+@-yP@0 @ -+ 0 -+ 0  -+p@-P@@P Pp@7pp@-@`P*PpVU p@T Pp PpA-@Qp`P g^^U1G-@䠟@P`  @PUЍp pP^7BP ^8p0SkЍG-+@-W00S@ @y-+0 R/%R %R0 sR0/@-(@0SP00tE+,:G-`dd@p00CS0 @p PP 000 P U 0D IS  N`X^p@P@- 0PVA-@0 0Rp@`0S00 R0S@00`P0S U  :P@00#%#%O-M@D`(p!PQ Zf`@pW*p%pP` P` X k P UpV`PC`0` 00L0@0`c^Ѝ8KP _@00#%#%e@-@+pFPPP Ѝ@謈g@d@@ L0L 0P0`.^] ᕈ@] ЍX=kA-PPЍ0S `p;@8@@B\PP D00@ 0`^W #Pj  "qp 00S #P ЍOl0 `F0`v40 ЍOiW -+0j+'%X-+xE+i+Xj+pi+xi+ ЍO *O-4M(0PX0@ ,0ut @P4Ѝ40SX400 ?Q)(@PPTdp00$0Dp P:J  ` V0/ C:p` P P@ȳȃ00P0v V `V@P,0S4 x3X4 @ P6P)X30pW0  0 `P20S Y Y` P P `V@Y*-P `@T_@ P0S x20S  P0 (0 S =  >&PI 20S @0   1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``y81`@P !X$0l$0@P_ V Vd@Pr P P Pl PX@Put$0O$0@P_{, 0S V V0$0$0S <@P I`0 xi+V =R+` =R-`8 s Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =gPV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` ` P` e0S} 0Ps {LD`'%E+7%]D8}%k 49?Ho+$0 RP  /E+0 14/E+$ 0Q/P/*%@-04 ,    00X6+P6+`6+L6+G-P匐剀N@NPT`ppP OT O  ᩽ ! ᤽ O O @`匀E+A-@4pP0`S 0P0aP E+@-@$ 0 @zE+P 0 R   /i+p00S/p@-m\@PPPpP 0S8@pPp  j+E+d@-@P00Ph0 0  ;0@-(<+(8)(4'(0%(00E+qLF+XF+dF+pF+|F+P/0/E+p@-0@00P0 0R 0.PPPPPPPPPQQPQ(H(D'@'<'Pp P0 Q00E+LF+XF+dF+pF+|F+C-PᔁM0@Sp`Ip`ll!0 0!0S~0@ 0  ᙼ@ aP00CS7  `PU7 0 Ѝ P 0-!0S @P 0R 00rq U h Q L S  {PwP(j+i+i+i+E+i+@%8%,0P$0 00S000/i+i+(j+i+p@-L@P`0S0000p01S 0t'PE+Pp@-`0 p@X10S P@@p(1@0PSP5P/o`0P@@S  1CP0 1C%@+P 0S$000|  0p  0d  0@@PI 1CRP ;+E+\6+T6+d6+H6+O-MdtC00wvP1Sy\0P1 0S T 0 S1C10q&QF 0 0000PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S %i 0C# R Y1S1S  ` 0kP  00KU1 0[0 `0S5& U J& 0R 0èQ0pP 0C001萄 S rI  0E+i+F+j+.+LF+i+A-pP`ʺp00S HP `P 80@0@D@ 00@TЍj+E+.+p@-P@2 02PpA-`HPp@GE$1S 0P $@@F+7@-Y 0 0R  x00S U d00SX00S D00SX   E+.+i+i+i+46+86+j+<-0 R!  ^ !0E+04/E+0 R 00S P@0~0/0P 0/\!4 0 / B  0/E+i+0 /E+qp/G-p` @PpP 儐u U 0 0 W 00V@00CS7P P 0P@PE+ x+PG-P0P`PpЀ@ 0@Dx P nV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSBE+ x+G-p@0@`P@0W  S #R0C00C0Ѝ -,P  j H 0 CpGA-0T@Pq1k`EP q 0P 10E+G-1dp`0 @PPP0 rS00TD`0PT@.+-+E+p@-@PPp P0S0MJp P*%@-0P *%80P/ R/0 0S 0 /H+00 0S/$0$ R TH+(j+E+A-X@ 0S0dS 0(0,`Pp` pU`r0H+X0QH0H 0.4 00/ 0 08I+H+8Y+A-@PU  ^"04Pp4 04 R0PU R4`40 0 P ^PQ p0࠱`  0H+O-1P0sUPP@PP0⸡p`@` V R0 SRA 0 V 0  W0PR 0*9PA `Y0 0 y W`@TP0 00 0` qp +@PPAp ` W0 0O0 0`qp @TP(j+H+ x+P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 000 r  0@P`P`d@W 00 000 r  0@P`V@H+ x+G-`@뀐P@p0Vs 0SP@`-P@tu TUP-+G-V@P吀ጐp0`P80 @p 00  0`P 080qpH+ x+800S/,00/PP//i+i+00CS0 S0 SMH0 /O-P0-SP d   8 l[?p ?PS?@P0S,@ 0R S%|@T NIF>6?>AX   l 0 ЍO`P ៳@ᜳ@ D@4 0 AfFE\jX=*E+G-@ $P`P,$ppP `~ | z J! R @yz  0Z Pp@ ;p Tt p@>q *f80  p; {\jE+C-`Gqp pqp@@PP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P  W 8b+h+h+Y.Pp@-9 $P" 'P= P !srp? p^P 0 &- P& E06 p+Pxd0`]d0 T0f&@PAP,@m006pp-+8b+~-+h+G-@tPp`4T#0 5T Ta0'000P0p0 D@6T` P'08b+@-o0@-MPh@P   srЍ08!P D00 0 &-+8b+@-HP!sr@ 0!0 &8b+@-  sr @@@6P0&6 eD0606Ѝ8b+-+G-6@PP`j>T6k.sq 00P6 BD06PU p)`4DP0ЁPP  G.P 8b+-+j+@-P ,0 0R B -+}l0l 0@- ^ @^TSa04S '005S #-+8b+,00@- @P QA6R 008b+G-[X@pP P`PC`Cp6W @8b+00S/G- M`:E@唠唐pqpp6W @ Ѝ 0  PU!P ˳P P 0 Ei+uS8b+]D0@-00mS Ѝ 00 Q >@P 0 S#  PP0P`0 S  Q0 R pV`PPp \Cp00-+17@-PU0P( P@ P0 Ѝ000S9@PP 'C^P C Ѝ0@H00S@ Ѝ0@? 0,0 09 T-+-+0%0 -+<07@- R ,0,@P?@ 0 Ѝ07%-+@Bj+@-P M# @0.S ^00S Ѝ 00S0 0 00S000 p CCjP0@  0R 000@0,07%(j+<^e<07@- R ,0,@P?@0 Ѝ07%.+@Bi+@-P M# @0.S 00S Ѝ 0S0 0 00S000z p BP0@  0R 000@0,097%i+^@-@PP  @M Ѝ@-@PZP  @> Ѝ0Sp@- Sp00S p@t, kl0p`P p@qpP@ 0 p@uT-+:i+j+P07@- S SBl0 Ѝ0ܾXPX0@PP A@z Ѝ0@A00 0 7%7%XP/L0@-@0S 00(0 $ @ti+-+pi+_P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PvA Ѝ04@P,0, 0 10 7%7%w+7%Tj+S0/0 j+P/VP @P/5@-@| pl@0TxSPLHD@<8@b7%g̐m ?}@-V0dSK@S!1 CRJT" R&0CO  R  |  @P3 @.A C#Rꄜ  ̜ 4 L d  k C \0 0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~i+Y2O-`-HMN@00PP*0 S 000C S ?  000C/  0?pEpU:Y U :TЍ D0!R1@0P S 0,ST40, @0D@D1!0C 0 F+H+%L+%C-PM MP 0-@̭ݍ ЍC` @A0Sڐp吀吐ṭ PS#0Uᯭ`A᪭P0P D#D @ݍ Ѝ 7BH+%sF+)~L+%SP@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000#%#%P@-M 0   0t0 @lữd P 0S>000D ;0Ѝ,0P ]Di+i+P @P/ 0 /h-+P/00Si+0/@-@0Si+0/@-,@0S0 0q00Ѝi+0/@-,@0S0 0_00Ѝi+0/400S/(00S/@-(qp@i+-+P@- 00@ ^S00S00 Ѝ0N /7%Lp@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0S\ 0Ѝp40@00 00( \? @i+i+2f~,P@-P A7 ЍRS+DSSS 0e C R ( 0 8 @ E C CS -S 1 CR 0CrS dSWS ^S0S^0wS     0  E000 0 FK N R WR Q S-00 0  i+800S ,00S 0P// j+i+i+$0P/0 0 0C/j+-+i+@-PU  C@ Ѝp`@ɫstpPQ 00S0\Q0S 0S@V vP 00$Q00i+@-0 S 0,, *q> Ѝ * i> i+@-@ &!Ji+P/0S/P 0  //-BoP@- / 0LP/ i+ 0@-L   Ѝ i+@-`MP@៺0-S0p00Cp S T 00ЍU X P PTU $PT00W`*O-P$M cLP 00S S03/0L0$ЍeL0 @``Pp 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P =⃺=9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  00 p @ =RP   R R tq000SPP000p00CS H ` ` ` ` 0U ?o200@S 3/TWU 0 [ 0S00S0000SL@40 S 0 _P&00S  i+ti+-+Cm@-@PM @PU@`p0@ mPPU   c,A R  | 000CScd   RzV)00SS# P}U  U Ud0?o2R0P 2/0 RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES` RU U U , 0 S0R0  b R U2/U}00SS 00S000 S000:S U000 0 ~GkE+s@-P`@း000C S0 ` 0 B ^ ST00T00VЍp( `}S 00 000S/P/Hj+ti+@-XP@PL0  0S0S  0  03/$@P+%ti+ 80S/S/ 0CS/$P+%O-@LQMp0S [= 0S 00 Ѝ`V/$P  0P! AAQ-P $ SQ@ S0 厨0 p@@OoB0 R ` 0 0S 0WppP+% @- PP07%/-4M@20S4剉P 2      G32 0S 104Ѝ! 0R0< $0"1 S 10S 10S1 `11S(  232 T!2 R (10P!0000 d R  R3 0000S P 10S 1e\ 1P 0S~ 0#Sz ,0 0S P 0 !hj+lj+x+ x+0I+i+7%:+7%i+@-lj+@-  Ѝ@-P%<`ᮧ@᫧@@S 0`pw: Ѝo@-@<P 2xk+G-` @$pP 0M(S%0 B P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 a2ЍMb@B404@-@@T +2P0  7%k+E+@-@0@7%0$R/ $吼k+p@-@8P 00R:0 @0 $p7%o+k+p0s@-@@d`D \0 Ѝp偼0U4@PP  x+k+E+@-@@PC- `?@P!M0`p0PƟ0 0ᠦ 0 eT-00EPN:ЍA-PX 0`p@ @ 0T0 P dU-  D@C:ЍO-0M` p! 00@C QaCQW@CACQ7@CT?0! ` ?0 !@PPX [ЍO-PMpP 00@C QaCQW@CACQ7@CT ?0? p ?0 ?@``P[ UЍO-PMpP 00@C QaCQW@CACQ7@CT? 00 p?0 0 @`I`P[ UЍA-0MP@PЍ%P p@0pnP# cP% dP  %PsP xP   ե@`0P`D@0 0 M`0P 0A-P@`pߺ<Һ` 0 $k+@- R$00S20 P00S@o p@-@ 4P0 4哹P~p@ [00SC륺hd0`m`P뙺H0@늹80@0@S(0 p@ k+i+H6+7%L6+.+E+0@- 0 Ѝ䪬7@-@PP Ѝ0@(0  0~ Ѝ07%p@-@P;P %@2P D800S00 QT㕴p .+E+@-P1@0pS Q*㮴0 0 R 0?o2 `B@P 67W ^@Q ㏴000 PT @P 27` Ѝ7,j+w+X-+@-@P 700o/O-|MpP `@; ᬤ1 Y0 00  \0ACX 00^YP P0@ 00  `0 W" !Q0S|Ѝ@0/0S00 0 0mR P0 l0S0 0AŒ\Q0X0HR?!1P^ A A ,j+/)p p p@0@(0@ 00/0@-+o+@0p@-P`40V0 F@ ӂ!1P@p-+o+T0p@-PH0 A@!Q0a0Ӄ1B0` `Pp-+o+0 0/!Ȩ-+o+`0 0 P0H0@-0^@P C0/o+-+<001P/0 R2:/o+ 0A-+0Q@-@q|0A `0L1!0sr 1!0sr  Q o+-+@-`P 0R@T 0  500@~rq 02C Ѝp-+o+ 0P0PP@/-+0 :Q Q .Q 0?Q  \QQR/ R//A-`2@p0P; R0C @1@C" 60000o+-Bp@-@DP0Ts 00CSp@[@qpp-+@- 0 @ Ѝ@- 9 Ѝp@-@0PPS b0C0S| 23 0jS BS bS 00mS tS@p 0lDj+p@-dw`P`00ST;@@nkN g,PVc`pq o+ti+Dq 7%C-$MV0`S@p`$Ѝ:S/ %S .S 0 pX@0S0S x?S \S0S 00@ 0X 00|xX@KXBX DXV @LH,X @ @ @ $ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  , @ x T \ \ @ @ @ @ x @ @ @ P @ @ @ @ X PP50S4匤P40S 40S Yqpz P Pi P`4 iqp @Pav 8P0V{0 Pv3XI 00BH@6X? 0   H \ $  Q0R 0 oqp 0 t2P0h2h"0 \ P B B??g긷qpG0 PP01P 10111 1v3 P  T10  0R0:P0P Pj 0P \ 0 U 0R0:0P HmSA Pc ^ PHH_ 0Po+o+F+-+]D(j+-+i+-+`-+2g017%H0@-@@00SOoBl(0(01 0 Tj+ti+o+7%-+07% 0@-P P0P0^  @$R \0 P$@R@0^ @R \ 0 @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P 200@p@-P@T `0S`0 0 p`0@0000`S @@@A-PQ@` 1 P 1 PP7`ЍPp0W"0 S 0 @o0 0PP A200㢯+4 ⥼2P 0,2P,j+w+A-p`@V0  ` \ Q(P  RPQ(SQ $0RQ? " $ \ (P Q S ^ U 0S P$RQ $2 0SP` 0 00`Q0S P \U 0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-boP/w+C-M@@8`0C`F!p/ऀP< A YЍ0 I/o"P R  ? 0 Q   Y0 ? @w+O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C P$Ѝ@w+0    /w+0A-@0S 6PT(`V0(0l00Sdp@ '(`/qp ͲN@00CS(wE+w+:+-+$1O-`wvB 1!0РS ЍO00S PА@00CS& ЍOM 0qp   0Z qV Q {랲P@ Ѝ@%:+8%E+-+p@-P@T <0@@@ @p `2000@w+w+p@-PH@U p@\Qp@F(0?o2(0w+/w+p@-P@c p0$ 0P !U@pw+O-M,070( @40pap70<0h78D @9L70S 870/S 0Ï0@{t , (0P0s007S(00(00 0,00$0 `00060(0, rs   T000S 0S$Ѝ(0S,0 00000H 0C000L0 " 400 000zy+  0Sqpyqp0S`I00 00S0 @ y50S PIUPe U 0V 1P40S 4L H^04P4U 'V4PR0 QR S P PS P400S0R0S44L0SP`rPHL0 #PPUP: 0 0`0hP0p`PL0 P* G 000 00 L0`$ L0`     h ` D0D0P$ T 0P@TX\P. . P ` @ 80<T0s00040T0PU$00CS$0P20S g000 00 L0`e408 CGPPI h0S8 Z5  `J!` 0C pQ0_00 p`0S0' 0 aP0o 00 N0S0<1YPPYPUp1G. E.0S0$0`P0S 0S < @B X0C  BS pa obZ0Yp0Pp0.+-+j+i+i+ x+(j+i+w+i+|i+Pj+j+w+xi+F+E+p@-P@U < 0P !U0p P$@w+p@-P@= T 0P 0 Up PS @P@w+p@-@`PV0010S0 sr ^U00 s00 ' 0P p 0P tu !R0(P Vp00@00S 0Sp(0(0Sp pi+@%8%w+xi+w+p@-P`dU 0S0P@T0 P@|0 pPc-@ƪ0 00000@Pp@O-0P00w+E+@-韴0PPw+O-Pг4M00040c@0P 0 X0S0  P4Ѝ0 $00 $0$0X S38 <|r utE T %2`0 p0@_  0 rs 0Z0 P @0s00P 0S/d2 0  c4 P 0P0@ P(200@_X 02X0QX`pP 0@` p P 048<00 0(00X00 00 0 P|#(sr, R0S0tP 0 'qp@P *F`ut q`pu80<V 0 s00 } V0zHPu 0 3qpm @P`p0X0w+04S S S ᾦ0S  00 [Q嬦0S 0 C Q ? 0   ^R000 Q\ S$R0C 0N00P000\\ 0  C R  C07%kx+O-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T Tۍ ЍpPS@DT2Pݖ@ ږז @@ 0 k X  )| T@ )T@"0S000ⵖP ;04P ST@ 5 Pp 0Q 1T TP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P? T00p000,x+7%8}% x+%r k0@-@ᐘPቘP ᄘP pP `zP !P.!7%]D@-@P @P P P,@S 1O-M0S" @`0 ЍO^<Pp00 0 Ppxy@`00S 000S  0P Ѝ 70 000 { ' ' 0S @`x+ x+(j+j+\0@-PP R^0S @T 0 Bx+7%\0@-PP R^0S @T L0 Bx+7%0/x+0/x+00S /x+@-MMP 7 P2 P-@-0x+//@-L@ 0p PS0PЍx+\ QR0* /QS QQ*/0000/@-@P '000000/0S 0C0//@- 0#3P Ѝ@-@ 0PSR? P >BQ`  娔&` PЍpA-`pP@T@  A-P`"pF$@ .QP ,00(00 0dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00@a0C`S4   $  T        \    d  l  t  ,  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 +f \a[P@1!0  f[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 8ep\00X+P+o(_ p@-0P @R RP D D < @D@ p@| @%X+P+1C-Qp`Mp묁0@ `P0Y 0 1PR l1@d1`\0 de\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R,0 R Ѝ0+P+X++00@-M00 M/SP $S+ +S00+ 0 0 9S#\S @P0 0 d0IS@P R00ۍ Ѝ00@00 S00@X+P+O-@T Ѝ0tS bS rS aS @{S000pW G`p 0S 0QU t0t Ppp0 db`0V 唔P0 0b$P x++X+P+O-MDD_.0 0\0.> 0Dd S \|.t>0 5d Q    |  X  ` X l 0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ QP  P 0S| @,Sv p0S 00@P  0S  00@[VXS|> - - - - - - 1 - - 42 d2 - - - - - 06 - 6 - - - - - - - - - - - - - - - - 0 ; ,1 1 - - 2 P2 2 - - 2 - 5 - `6 47 7 7 ; - - ; < < - ; S S4 0PS0@o0P0  Q Q*S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0j0 P^S0@oPL0 R: L ` 0p100)0800400S<;8 00 [4 00 |<0S  _H0SSP80S4PU 0`  Ez}P0800A E4 r0T P 0  004 0 0  0:}00z040 0H:HR <00s, 0P 0S p0S 0( JP2S 0 H⌍` 0S0`V: F$ 00@ t9@忍0S P 0Z H0$FP x0 0H$0X$0 S8`0V:$ `000 00C 000P `80 R:P`80 4{ `S p z70 P   R: ` 7B7` '1 01S:` 007 |0 S0`(78 00 tg4 00z<0S  E_Pa0800 OP80Sf4 00z<0S  80S0p4  HD|`P <000F400<0`4 0z<0S  V 0400<058 00 V4 00z<0S  `L0 R: L !` 0pP00pY R  Q $5 0Y4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ <0 0 t  PQ8 p0V `XDcH0p0<H<p(0000S s4 00y<0S  Lp PB"000Q 0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s "p0 Y04 040P0 P 0S 00Pn80S0sp!pp 4 0o40P hPo P R00`<pL0p<R80SO4XL  0`Rl0&004 0V@*000P++̒+ z+@+j+}%\9%ڻht@P+or eiX+o+ S@%+++e0p(pW10 (W0 P0H !  R 0e 0P pW* 0$ (1 0X`pH0`h0<H<h`x0h041 8<0 0R,,0vQ 0{Q   z++p@-@P`Tp0wS {S sS 0p P 0 HX0`@p P `SG-`i3PzPU00W01p R  p@tPVCGXpp0!S < CQR2|@ @ @ 4A @ 0  W0 0 00 00 00:S 0S0S W00 000 0V 0S`: wP 000BS ӵ*[+0p@-P@T P ~P1 0S-A $B A B \B xB @B 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@+,0@- MMP@P X 1W p8)W+  PۍЍ0SH0  BR R R /8}%}%@00CS0 S0 / 8}%@-(A3{0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@a$+1@-01\ @T P#Oo\B@T P P P QQ R P\ \ P P Q R  А,$+0@-  `Ğ\ @ T\    %R    $+А,A-pA0 5S$\! R  (P 00/F00/O00/\00/f00/p00/00/00/00/00/00/00/rD00/00/c00/00/*(O%/g"b @-0  0Ѝ@- @+@-x+s$5 0S04c@- +@-x+ @-0 + + @- +((5 0S04c@- +  @- @-0++ M@-+ @-+ ((5 0S04c@-z+ < @-q+< @-h+ < C@-_+< @-W+  @-N+  q@-E+ e@-=h+ e@-56+ e@--+ @-%+  @- +  @-+ @- 0++ @-+ @-+  C@-+ @-+ $0Qa @-+ @-@D*P d 0 e 0@- 0|1։,+p@- P' dP% <P j SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C`'al1SS !0C B/?!1oG^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@P{   0@S ${ h ${ ~ ${ T{ ${ { ${ ${ ${ ${ ${  ${ ${ ${ ${ H P3P$0CP?P* <P >P P10!1 NSPN0Q^ B 88C8 P P?@ "0C S񟗉`{ { ~  ~ $| ZvPq P1aF P Ny~1S'ʰ1 F P ?y}P 00P1 RE40S 3/i PPP i P,ЍPR0h S` 0Sp0W 0[ 3/pU P `F P x vi `}qi00x00A<0 b02P -00P000d}Qiꈔ+k}%`,RS%\,C% 001/ሔ+P0 R0//ሔ+O-PP$p`*@ [ !  0P@ Ѝ0y00 1\$<0P0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @ꈔ+pP/D0 R/0@-A1 P h< @7yꈔ+O-0Bp W k0 00p0 Ѝ`440S 0S rP  I[000 @  S" S00 50S qP  -[ *[ 0 0 0! R @ S0 0 qP  [0S  [00000 00` S 0PSHP P0SPPq0 00q0S qt ?C S ZPU  n0X!0C0S;3PP0 PEZ꜔+% @VUUUO-$MHZS  R0P 0L`DpB :0Y0 0S 0g njzs뤳`PQqRq_q0@@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C0D S0  0k:qX 2 j0  BX P0{ P>  PN P P!VUA`E D\@DP`4\j Yj Vj@`"PD P AP;  JR !   ` D0\0@0!P1 `V0p00@  d-`^u|`F`FV0p00@  DPEg\@DU`E¨` Y @ 0nr@T`— R    BY00000S 000 0 0n$ЍO0Y S ꜔+-XE%}%A-`PlPp `pp@ip@0T c`P@ P P0000蜔+@-@Pp 00T0* lp@Ѝp0 00mt` 0 0 @[h@t 4tP  $P%+[h0p@-P@XP0Ps H` R :̢P 0S@@Q@pv$P%+@-@C0000蜔+0m꜔+0m꜔+-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  } ЍЍ/@-@@S@-@S@-pMP@`,0 0( 00 0`Ѝ@- Ѝ䪬O-M P`@po@~oUkT0 0`P~0 JD0SPZ 0SW L00SSDvqPPL00PTP^y@DO@W :p &dPRWpV`KЦo`0 S`K0 nt@PD0@ >PT0 0P600L00D H0T BZ  *u eyeeЍD 00R00S 0S qL0X#3pztP 0 t똰eIIgg Bʂ0 EGt``PLIH`tgwg꜔+c`,@-,, ($ *Ѝ䪬@-`$0P@ 0  00 0`Ѝp@- Ѝ䪬@-pMP@`,0 0x( 00 0`Ѝ@- Ѝ䪬-@-00a  2Ѝ Ѝ/ꪬp@-PWn@\np蜔+@-7@- @geB$[PU % !d+/00h@PU %T d/00000S$$ Ѝ0+'h+9h+}%PhO-AM@@ PP4q@ ' @f ᾙ@bPࠟ   P.Aߍ`V p O`PX Y  ᖙ =R@᎙8@l `VkkaSuS}%Wr gh1@-pO-0MM 0p@v`P2 L{PP* P OP 0S0 0   P M HPPrP 0 Q0 0PtۍЍ0P 0 c0  0] lh_,00S/ 0P GF@-++X@-fP eP <aAq"P@_A-@M S@0t00{%P.  $t0S%=}P  X0Sn Y0] )PgB@Pc$b-E (3E*B^&^(ЍP@R@%6PM(-PD(20S AP9(.Ap0 $!P[@ ( X,%P 0)AT nPP BP p`PP 0q+Q S0p 6&V`T(pA`T-@p0T-:W@Q  R@4Q p0Q  R@AP`003/P 00  h0S  R l 10!84@sAPd+ӡ,++S@-MM+@(i+(\B+(iB+\(@PލЍB@P `0 @@@@@ @@@@+j'B(?lM B-MM+ iP+ i\+ {i+0a\ |@P  m?ۍЍlM0@-M r1@@@:$P @B! ;P A0$*!PRW)Q`'Ѝ0RN00S 3/P 0$003/0$*TAP5aP1[P-W@P)FAP% 0P )?w  0S 0_ ZF(P APL4m0kk&^)*00d+,+bll`,\,ӡ@-M Qr0@@@?#P* 6@  P 00*!R00$Q q*@P  k0S 0` 'P#&)t*Ѝd+,+O-`M  0 0X#*0S ` 0 SS 0mp0 S00C `@m0S :doPP @B pQ %S0S iSc %S, dS 0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@ B T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^0  3/PW Ѝ 0 g%7@- @PU ! ` +00 Ѝ0ll P \ !L  z`Pq( (0[!+9h llllQp@-P @0@0S   $0p@v9 0@+o+7@- @VPU L! >`*00 Ѝ0PP 6!| (`d00S p=L L0[p40 ,,+'hInll + m}%s@-`4Q@6=gmZ}x cPgqbkgm cEg8`gb9}ci 0An@Pxx"8PP CCbb ᳇>}Ѝp\,S2}%1mO--{MpP`a0 i!p E 0S  P R  0S p hP n_XP i_Rp@T Pe75 6V+0B? 0H.P ")@P ")00xHmPhCmP; P  D; ;0S ;<P ;  W00|3"0{ߍ3X3 ,o0z"!03`ˋ1,0ʋ D0,0,L0 L  0P,00z?"!!0 P#  | PL  YP U $ ltjd2P ll<o0S hPU voL P0 1T 0  SR \Z1P ^1 X 0I2 iz?0YC0P0SP @ 0V 0R0SQ ᛥG^0S9  P#a{u  PS 2 +Z%ptbt|mf@++nmuS_m+m]mkmm+RmmmW0@-0,M 000000 00P0 00h0 PPP@P DD:@0Q ,4,Ѝ0@ꜥ Z%}%m+ -O-iMps?!0:WP 00iߍOЍ/lx;@PX1P L!L00&@P jZ` 7PPW0FSV030#Z0S z0W0"(!` P Pp0W0'U80P , 00 'P'k+Xu n"n-O-0MT@pX   p$pF `V\  @M'U` [PPhPD@P ?;H E09ᐿPU 0'SP0U*S/ {P o [ h0@ 0 0H0 4t1P1Z m4Dp`PUQ`V( /2S022SP0220C2   S`` τZz$00 0( 0 0p|W  @0   (PU @f4c@f0U / _W 0X0C?o20S ~_c${_df[z@0Ukq_n_Pz00CS0000?' V0U \$0S  r9SWi3zi 0%S @SJ B B*lD00 o/00L 0.RP 0 0`jPH00ZpX@P 0A0 \ 0O3 4Ql9iWy00X (#Se@0U  fyz  0UX ~oc^cyfU PPW  WK0ЍO Ѝ/5nQnu/fnht@\,8}%jin0@-CMlPP 0S .QGZ@P8 bCߍ0 Pb Ĕ+Õ+G-p 夀夐PB`A@T:00Z W ,/Z 000 ZP EQ 0 @pn%A-`Pp p@ l4 pb PO@–+A-Pgo@gt pb0S DQ0Q.SP @$ $\U XUĔ+Õ+@-M4 0PDP  Xb 0PDP  Jb =p@ ( k ;b \PU*p@ l`lp (b @*PPЍ U U`!i˜+%i+–+8i(+EO-M4d0 @aT400(f0 ,h40P,   -8 4d0w=C $ CUSTrRP, .͟ 0Q(<P 00 0( 0uPPPPP1<@`,0tD0D,Dq,o `<`J /  0>0pa Xv4a !hPP\  hP;PU 1sS 1lS;"000 PUP p@ v |j! HxjlH QpXKX[X{01D+0~0 gP gP gP gP gP gP gP0:4: @p A*.0p HA0kp H0St:t*10ll LP 0H0H0A kp 0 APvPH , o$U zY TPPP@;g@P- ,`)0xV)0wQrgP\8 0\8UXLy0 y?T. 0)0z8 ;Yg@PEPSfPN X0 "\6SE p0 6@P: 5 _\YVxSp O[7S' X HHEDBw#4=7(@ P (0AlAP\XP@Ps!:4S 0 zP '0APxP 6T'd0b@Pal\8D'08\80WP8 _8 W'8P00P8 _8 W&8P0060S\80\8P8 _8l0S h&8P8 _8] VP000S\80\83P0S\80\8P@sT %0}C\8%0|;5T$A Q0:$R$ Q9ğP \8şWt^H4   3u4SP 0@?S @P !_4{ 0Q0:$R##\ğR#$R#W%HR3$$   (Ts0S1 Z`P 2@T NJ HH#00S "0S @#W#"3S3 TE 8"DC?00N?C0C ,>$wP0  0@F0@P]JP$A?ep@x0a80CP,0@,P pP0S ,c oX >0S@0 <X+4AS< ". 0 0S DbDMW5S !!o0 0S $b-X#WXzĔ+n+n}%n֕nn$Z%%$ u++{nwn_i+n=/p8po`u –+-%or|Õ+˜++*o +InpCokooolooooooooopo?pZp"pp+IqN+qSr++BrrrԘ+B s$sAs^s{ss$+sssst7tUttP 01/`u C-鿏MP@(pdP3S0 0` 0`:0 00`@00`n0/0 0P 0P/S/00 0 /S 0/0 P0% R $b@ ` @0ߍ eotvt~tC-CMpP@wdP`#0R``T  Y00T0 x0 pX@ \2TTCߍ@2AP (=3 et++ts0  +@-@4 0@+@-0  0 P @0@ 28 0/P  {Ѝ+ ++00@-@XMP0  0@ P x0x t0E[2l@P/Q  0 LL PN2 /R@0 @0(FЍ0Ĕ++ ++++-MM QPcP  \ \0 0n0SލЍ`0` `9PP0  0@ 00 +|++++ +t+t@-CMRX6S `P \8lPXT20S Hn2\6S 8i2424"(2 r`P\8. ^10 :4S !zw\@10 n:4!SO *00 0 Bct`tti2@P) 1d VXSPP@M0S 0!0F(!(B0S  : 6k1P4\6S /,V UTCߍ 0 BĔ+tN+sp–+t +uuu+ uoԘ+uIn9uDuloooÕ+^u˜+vu"uSzu+uuu*u@- @T^ S C @TR00S0\\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-phM@P 0S'hЍ0 L03/P 0`  Q 1/P P p08℠0:/P 0 083/ 0\ P0//!01000/ 00#0//O-`$MPA@T _ pbP00 0S 0S0S$ЍP P00 S aS, R ,0S R : 8 80R:P#3///@-@M MPp! *0 `mp Wd5\\ SS=S 8 d3R 40 H$0 Cڍ ЍTTvv@-`QM p@ ញP PP qPЍaPTP t0@$PU@@WT @D 0 @RPvv)0O-Pp0 '"M@pPP ԐԠ`0 R % PЍ 0L03/P  0^놁0 ^  @b$0S P @M @M``+vp@-P`o00S@} 0p@,o0@-!Qp0ML0` 3/P< 0t@T 4/@0p0 R^ 0M^ 0@O$0S  @L$0 @LT d @L @L@`^0S0C@ ,$@ +Ѝ`+v-mS0S/p@-@PH 0000p@O-p|M@P Y@0P,0+`p,nP|Ѝ ` 0S0 !X V 0S0H L03/P X0p``P , 10000U00 0P100 0<0008 0*pP ,0<<0@Do@0S 7P 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0 0 0`  @-Y P 0P 0Pp PQ` QXYPQH "P <080P/,/(//|u vwp@-Q4@P0@@DPp -PpPZ%p@-P@P  X K00ppIn@- dZ%@-y pZ%G-@MPP N/ b X0 0 0S1 0S X2P aT-P ލ2b0S .b0S1S P a_P @l0 1h0$1d0(1`0,1>1S nP >8%0>`@`Ԡp( p$   $0Y 4 P 3SG lt {a wa00@? Ԁp䐍0gP 0S0)#0C?o27 #3RR  0R6p7P 'S0HpA(\ C~ QJ Nh P XP L mP ,04! @<#p8\2P  @000@"0A0N?P0'SpH0AR 0 B Q  > 00B,04! 㐀@<#!0pJ  ` `KR `00K?(0811$1~0 1p00 @0Eo`YG_FPEH]P 0000!9PP 00S 3/pO003/No;-P4']P (S("+" I b+bI`ZP@``VB!aV>+"H+bH3\QQ0QUh $P 00S 3/p $QUY 0` p `` pb.x;8/0  ``px`".;6/0S3   H U0 0mq倁們`PU" b ",`P  T<P"f+"Hb_+ "`P \P# \P \P z\P u\P p\P VxT UH  QH` ,-mPx_v +,+~-w$jD0Sq|x 1w00A-p$0p@` PAP0 >@ p C 01/@P00pЍpP@00003/003/$Am6wO-UMMPdh.(@4P|^.zx^Q_ xHk'vW`V`$Z^  UݍЍT  n? 00 70 0P0@0Pύxz#Pp40,Z^4S =07h400C27\4=1 V =V?h400C26\4=1 0 000000000 00eplp` ( 0440640s -1yv0 00 0000 0 0z=p` 044040s -1ଔV4 `zv00/ nlE "ITX5@[^ =2,XL=1Pp0Nόfp h \ F$v00?00,Z000Ӧ?%N?/&"@LdT`( Z4@0S N?/$"84@pW(4 0}10  A S "S S4!0p 1$,01( L!!>,H48 C7$ 1^(1)04 $,10 (q ,148qHL$!R  p} \ z^x# @p#0"$1H00 4;$ x2P p>{\ {$100$10H0 0 0:0G80<80Sp= Pr $003/$`QZPM `qQ! >,!  6$H(@GS  GPn<PK Q<ISG 0.$10B04!8C0(1}1S0}1$1S `4@@d+\,8}%$ ZSxZ%,+++h++~w_PP$030/0@o//BO- M@MPA E0*!Rp0)Q`U0 $0 '  P  Pp ,>*?(0$0 |$(pP d4\,q ܍Ѝ<4p "H0Spp0 @0 4p0SW00_ , R\  000;x8,9/PI0  ,x8;;/0  ,x8;9/T0S8S0CS񟗕 t p ( Sn "Se S P0~  R{ <pWv  &P d0S T"8yH8 8Rd0S ("8k\0S  "d8&`0S !Z8X0S! S! 80݀L0@ \Q\0S ` R !8:x8 ȀlQlh€`Q`\⼀TQTPⶀHQHX @1R<0Q0}P00P0)0YP0 U @+' 'pPv 0Q  c,+'xf1x_1w cJxPxw_xfxmxQ,Htxwxxw~xxx xxxxxwwxwd+O-MUM08*aV"e&'@&| tew pW &0\0 T Q 0rލЍ Z )qWd ^P FP' P D @ P @pH圴` XBT0SYl, d) \& 0S 8$D 0P000P F0[P14s10#5:$ q&o&m&0S h&f& 0I W0PZ@DP!@ ( p `V T  `80p  P 0 0 ,0ST0 S00 P0p800SS40 0  0 ;x8:/P00400ST0(ll S S P D      <   Sc  SV  0 <0XW<0PPL!@  PP ,0$ 40 ( P R ,1XP$ WP 0005S04+^P 14 5 t0 S r0* i%а 0İ 0,+&y +y+Dy_y{yyۍ6+zzzzz9 {8{>{D{M{T{oyxE_xxxxy yyyhz~xy Co*| 0@o/b 0!!/(+10/Sp@-@4P0 `L1111p(+O-P䐟䠟䰟@p`0/ C !  !0  PU00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 Ѝ(+%  \  0@-MP@/.U1, 00 0d000 0X0@@@@@10 00@0 ,PBߍ0 (+O-P4M`@p 0SpP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  K0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- 0R0 DQHa@ 1QRpB   !LAPAP0` A0Q     TTAU @@(+$Z|O-p\BMX1SL2X\1S,2\X1S \QUЍ0C`13`1SV`O1SP \1 XX1! 0`1V$ 1x C H0C 0O[P 0 S 0.S  1K0p `Z!XP TX`00 0@"XT\P \!yT000: SX1x 2 \1` 0_ 0 X1 ` SX10 2 ( e =(+0\% '+4 . @ _p@-MMPFPoۍЍp3P`@+J P*t+= P*+= P*P2Pv1S_p@-M\ObK^@F(7/L`P9 bk< 00O P (09(0 Ik`H  @P ލpa2bc|c +8v =p@-@l`01SPPP@pP0S0@1S "P 00 ! !@(+O-M@PP! c0 Q 0M븢p`Y  pP 0 04P0SߍP W%0]PPP0 a0CS0S p `Vp08Sڠ0S' R$ S\0 0 a00  sp 0h1U0ſ0 0s0ZD+ Tp q`p .0P![h!R( 00@P(O  00O0 0S*?0 !C M0  00t00 00S 0xV<a0 :|1 d@edA+|(+Ê0 X01SP@/0S0 1S0   (+C-d1`\1 R0``DADh90 0 &S Ph9!P h900 ! !PV0<1LPD~T{PapHMLP MU `1DP1 MU `1TP1 MUP1 `1M808 Up!pZ@ ЍC- ;v @v (+av Z|@-M@ P @oЍ@-| 0S p]P`0 X00T T0P+L008 80<$, Ѝ Ѝ6+|++~+++@-Ml@p9t)0 0 0T00.00 0 p $0t !Ѝ(+v p@-LSQ44P@ p@H2|-?@-@P  Hw R4 X(0@.Ѝ0@ Ѝ/|}@-0  0 P L0L D@D @08( @0 Ѝ+ 0 +++-3M MX f<P0  4OP Oo3ݍ Ѝ_ -3M M H<P3ݍ Ѝ_0@-M0  0 0S@Ѝ0h0h h}@PX0 PPP00L L0PDI@00, ,0P,Ah++&}+++G}~+++@-0  0~ P <0< 0440%000 0$Ѝ+I}++++( 00!S/ /4+( 00 S/ /4+, 00S0 10 1/5+(+11<0@ Q !@-0 " !/(+0 10 1/(+@-M(q/.P, 0lh6 0X 00000@0 ,@hߍ4\% (+H 0D /Q/QQ Q/(+4\%@-@0 0 0@RPЍP}@- @0S00+d}0@-AMlhP N@ G  P<04Px9C/C>0Aߍ0{}(+w}}t+P@-@ R0P  KЍ+-@-  Ѝ Ѝ/-@-0XX0@P &D    Ѝ@Ѝ/In}}o-@-0XX0@P D    Ѝ@Ѝ/In}}o}}8@-P P P~~'~@-@KP@ *o@-@0`MP 0 P oA++ +@-@0LMP 0 P oA+++QA-@@1@#PP1P#T|p|` bP (B(A6d""KAHA99\A~\\, +7@-@F(P @O  0U Ѝ0J~}%1~0@-EM@DP E >=P00j00U (0($x:@Eߍ0t+(+-BB@-Mt\pA ^ PEVJH1+0;`P Ѝp0P 0`0VSS TP$;-@-0 0Ѝ Ѝ/ᰎ -@-0 0Ѝ Ѝ/؎ x3A-`PMMpdP ppu@D FɽV 0Y,,K((cpW &A 0Su 0CS2PJ'A3S0 ) 0( 0S8 0S r0S 0S QN@|(P$ d0 ᅽT0 @nD2P@ 00b0C?o2 |7&00G(0SލЍ!V|7S'JP{1Q! F?pF@oh!H1P0 H 0L( ' 0S q0Sv 0Sr 0So QN@$P 0 0 @mPYF? fQ. aQ)FHoqZrixx+h++ +0\%n2 etm ++̅-MM P  P ,ۍЍ$-MM P  P ۍЍ1s@-]P' PYP %P/0S D: 9 9 9 P,H` @?P 4F-@TTЍp꿪Ix0|+R/ @-d|+n\0XjT0PfL0HbD0@^<08Z40(+dP+l|,vT+x,cp+,P@-@ 0@X +p@-@M L(@H@K0 #H ,00,0@@X8hPp0: S HHP  A A܍p,ZK 8VKQ @P|@Pڨav <sPT81!#ݟx8<DQiT1 0880n8PP oQtP00S ny<  R t00 00000 000lZp@ m@(0(0tQ!+++++ v ' 6+++$ O-CM00qSP `@g0!`-0S`PW!000 @ @3/@P CߍW! 000Z 0SX 0 @T W  00 0  0S l00S ` y P0W0 ! !  000++tX+S+(+7@-PQ0@ SS 8]0 000] Ѝ02S   _O-pUM((0 4Q  J#ß0/SCP3c܃C00P/UE^# 0SPLYDWC1 l d ~PPxP$ 0RP fP ^^ 0 10S 0S7 0 1S30S kP`F %p2pF3VT 00a 40 0 0R RP 10 1000`yRP 1R QA  1S Q00R /RSR UߍP 1 00000000 sP1 _PKP TQN1 3TE1 )P ~+X+4\%(+C_8B`,\,+/6\́Ip@-Ph`@TU`pUP`dP  pc%SO-MM`p\` `P ^nPP0P 1 .@ڍЍ CnP ;nP PPP Pt@PI@@  Nm0C FP0=S`  4 qPcaV PP  Pl|@  D$P@}S3\ 2aS0p@-4 P@7H 0Pp@@-G-P`4 $H@T$ `V! p0F&04 p0RSP p9Pp Pp40Su p 6CPp@T/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PGP  p@$@-@ ( @A-P@p`p0S 0pp RA05#Ph0020#X00Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-8pЍPq@o` | p{n prx lr 0U`jxVe ^t@t DP\P LP @IT p(q7qFqRq}Dqqӂ~qłp@-MMP`; p  @p ;GP57GPۍЍp-A-@P FT`p P  0QOP(|d zd@@-M MPp; P` p  @0PARPUFPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPA00/00/40@-\80S0 S0010\80S dd@ 0!SR0(SS QU S!0$0S\  0v 1Sp@- l@$\ P0!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X v 40S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4  B(B(Rt01 408 00803/P,000403/,, H0 , 4 T 8 X v 000/0O-p4M@ PPp`/04ЍO+%0 L03/P! Ѐ 0P p* @D Z[H * R T R , [p @8``pp 0S0P 004Ѝ0+O-P4`弁弑弡@ Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P  p!"00 0  `0RPH P00P0 < Q Q  Q R a df DO c pO \O 0O-Mc(0<00PSp@p`00 $ 80s!3 0?h0r@l0S@3 ` 0\@/  H3R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 P?HL0 48 G?00(,(, 00 0:?P23V 450p0P<0SQP0 N T00SJ0Sj!000q p0 0 0 000000  \0 0 00000PX 00808/#?0 PpQXQ Q(00,0 0p4 80 [`\qp a X0S l^ 0$0p0 0(00,0  04 804p` 80+`++ɃC-`FlM0pSP^x >0S >0S<>0S$>0Sk>0SG>0SH{>0SIt>0SJm>0Sf>0Sa_>0SLX>0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0 >0E( H>0SP4 PQQ@00Q00S (4Q (4 $lЍC W3W0P] ] ] h\ 48P Q Q0 L}3003 0=0 | lЍX300P3 0=0 0HS(0p`@ 0 ] SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@,0 <"},z P0   R>0  H0L0  H0L0  H0L0  H0L0  H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC !SH000050PpG0  d 9/0 00(0 0+a df +`+ \O DO pO r $r 4d &)07@GS[ch c C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``0 0pp07/@-M0@0 3/P 0 004000 003/ލ@-`,MHP 8@0 0 0PP@00 RS THP pW >P00P00P0,Ѝ @T@0/W/0  07H P00P0%]D0@-$M@D0X : 0P 00 00,0PH0Dd$Ѝ0&G-%(MpV@PW \a `XPP`D0,` SS0 Q "S `P  P !X$U0$U ` 0 動0 0000 0 0000% 0M<PP2(ЍP v qTw |O 40C-S,MP80S,ЍS S S !S S @P p萟``$`X 0~ e{000  00000 0 00 0 0M`P , > 0 R80p@n $0 Rp0x1Gx1p#0q000`AߍD0` ⇁0L03/ 00`0:x  Q * Bq Bq BQ B B  0>Ȱ 0@` X@@p0 0,(00 @@@@@ p@@Z`P4Uߍ pv'0 `∀pDO #Y008*b0A-@0<0SH04 `pP:V09:?V090VP:0 A!r0S/A-@P0\03/0 0    `0V R!  B B" ="10C+Rp0 !"P! 0 `pPP !@` B""00080000$0 01P0100Az qO-OM@P H(E=a1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,TpP5Oߍş[@lşP @T00C0p0NC2 VH0 0$ 0Rܴ V 08L0X T3/P170 00H03/ T 0 0000 3/P#%#t&0 080x 3/0Plp 7X̍ 0 030300 07000F00, @ÿ 001 SH0 V p .4t`X0 PP00P0003/088q0 X 0L03/l 0 , t T x X h H  0T`X 006/P `0d Q 10  0!s"D  V p0 B D!2 B" 1ᴡ0C100C0 B7 `V`s`V T00 03/P0 0D 2#4`0Z7 uP0a 0` 0dD   p B0 p B D!2 B B" 10C10 0?o2100C0/ !V +hw w a (x pZ TT A-Pp`a!@,0P  p0Q pP p ;`P !@ B":  ;T0 01`0(`10q00004t 0S/ LP0 05/00P 8p<  @  0P4L p P $ Q:  BS:Aߍ L`0 (06/(0Pf 8< b @_0`4 V  V  R U  U  RE ,A0  ( 5( 0P 5 ( p,$ ( ,0P 0 pP`p0  5 0P@5p`LPb` Pp `P@0` O-0AM@`++O-`4M0@\0P3/0 X ĀX p ppP(W 0Y2 2Z  "00 "  !" 01 " X "  !"0  0" " "  !" 00CCW 2" 0E0 0l20h20d2 0J000 0H0P<1,pp@12((4Ѝ嗓)08q P ,07,0PZH D000 0P P`%0,00Y0P8 @ 0S[00S[ ZP sP00S`(U0,(00V,000 0i3/`4t ̷+qz b j uS *hx l|DV g r+_@-@P0L7P/GP0S0_O-pMCO TtUl4{ 00 rs= 8b0  * 0 P  0@0 B )R RPR Q0r Q0CFS0TR000US00Ѝ@0  dPT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(X4@ P4P 0R 0R [X T00U00} [XxT00U 000/SS<x +xg+i#+T8 T++ 8T+_O-0MSأ@pЍ`  W @000PS8 cSG MS  0 mS  sS. gSR  03 0S cS !MS @MSCS GS W+0C?o20S 000 00SSSR mS @ R O-OM M<00(00 P08 @0 (0PP0@D00P P,0 0H03/800<00 0!6 0R 0 , 03/ 0`` S04 H&P408&XCU\a`0$040&00000$030,`p`0pH0LWX0h05R0p0l h ' `Vp Sh `U Th PU h VU 00,0 TP]fd씟a_0`080PS<0dP0O>0=C0H0 8<02$xU 0S T0 Pb]0 000H0P0 F0PT0S -xU5P 0S40Q00`Q0S 0 L0aA3/P 0P P  2/``dF  pBX!ZP0?2UP(0 Z [ Q PD @0    SD0 R8X' a`0"$0c$000,000$0%$0t H 0G2x 0 \0  092` 0$ F0/2Ȑ 0 0l01h 0Lt0hp/H+ +    Z*pV 0 T\U 00d0 T\08 T\T0P0($00 Q030#Q0S $0A,0"PHbp 0(P &A00P3/` 0``APQ1V̿P(0 [ J Z C8p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a,+[$0pQ@-4, #"T R0//s@-(@T@ЍpH崺0P尺0 0|003/@P/@-tM`P Q@0 p@@!P  10@Tp@tЍT0 @T0x p0p d pb K`P P @峺㣴+x_4++͆/@-N @ u///@-0@Q T刺@o?0 \ 0P00P0P//4+@-0M@0 1\00S- 0     000Ѝ- 04+//G-ሐ`@pWT0S0S n.PP$1@00S- 0!X0-0pp@ꊆ4+0SR00/p@-@P+<0<`P" 6D0# A@$!p`++A-`8P@4.pP( 0' A8+@-<@-p@-@M @00p 0S YPPL00`㹳V 44 0( ܍pc+%C1G-`1MP@11P!!  xxaxahtC@Pl7TaP0ԿP 0[bߍ BTB?N+ -pP0=SBB+ ?q@B?`@P . BPt@t P \0 ޾oD ؾi:9}9=kaSP+Se^l1A-P1@5dp11PT T T`T`  P D ᰾A 00c+:9ԇ@-M00200p00`0P0@P a@T 1\ 1T1O/1 P1O/1 ЍoAR;$0 @- P |+G-@BM `P @v/P j@P @ܠܐ܀0p 0p堲0S1O/1 Bߍ  ePl ppal\0S X ULT N¶1, 1s++,%JgM;rJp@-P@1 1  pt+1p@-P`P@0  p@ꈈp@-P@N_P $11P N/ p蔈V1p@-@P(1(1 P1 1 p裈V@-#@ꔈC-aM@.p.T[B嬂rP`U U.>20P$0 JPZ l"J0(@80@PW H",@PU , )$ 0x,P@)PK1PL0P P110PU)!2,A`pPp0S7 S1  @o. 0 0`P@Pd1`TP$P aߍ@G(!0@P>!0,ꥻN?P0@2; E*;   & 0F 0 0 p000  ၴ@]̴0d%+`+t+S=9:++,d+5`,\, ܬ KA-P$pa@P-@T   μ^P( 0 ~lP 0 ᷼H P P+@.oЍW``dX ᠼ< 0Sꁉ +DT= :h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/,O-4MpZ$ (%t,@P @ PR000f 000V0 0$(  0V @P 0(@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 0'@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0'@TPT0 0@PT00@PT Q Q0   ,0@-4MP!! 0 P P P@4Ѝ0@/@-@ ㇾ@̹bp@-P@/:P `@ H)0P P `Ra BQQ pQQ 0@S:p @-H0RH #@-"0@-@P4M0S*!1PP Q*  P +U 0@S Q 0S4Ѝ0,p@-0@ ^T00PUPU' \$ST մp 2@Q^U@.P@ @$ $ 0 00C 0p0 r~p@-,@P+0P ;pA-@d`dPp㌀0S+T 0@P"Rp@Px h+ 00S@- /h++C-ẋ(pX,P0`@$ 0АYĐY T  T: X0WaU U VP P 0NU Ѝ !V0  꾊Ê||@-@P 0  坸@蚸<Yy Ȋp@-@P0S|Tt 00 Tp0"SD0 <00Rp( T4p 0h+,,G-Ph`0Sp;@S S 2@1+1:X p  QBp\T.@T&RQ0000(Q $' Q 0S T vN! 0@1 00 0TRTR"01,{p@-P@q@op1O-@0pS`P  0PQQQS SK0UȰС0r 0 $^0 0"90(Q $U'0, 1QX#  E vQ 0 0  R [ R pR L0L L~ R# Ѝ 0W1Q:P h+hy Ȋp@-PL@0St!U 0E p(0"PE0U055403 0(2#ph+,,40@-@0SZDP0@0ӕh+x A-PA`0SH!U 0E p@0SV Ѝ 4 U(0@a`P 0`4p0@00 )` 0Pp㼷H p帲 `< P0Ჷ0'p(0,0`h+,,&sL1A-P0pS@`  0PQQL SD0 )2  0 r!Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` h+E@- @00S T ]-Ѝ2X0O-SMM2"}\0@S2"`0S2"bd0S2l"h0St2P"pH 0SLU80S 84 SRN80S 㹷, 70pHPASTPPEP嬰 @⚙@ҷ`P. @  \00`0d  00h {X pwh;S \pL!L@0ɺP@;_oRݍЍ0 :S 000a 1 00 0 F0 0C0 :;0CS||3PpTy Ȋlҋ%ۋ  7Hx ozSkPjp@-@TP0SV!R+)r00 S @ 0N Dp,O--BM MX\pa@P 0`^ ;( `MpᅵBލ ЍL0 ЯPy ^ Q 0  d00 0 x$0!`4pX00 pv`$(00C0;S 5 PPW +RQ 0P \P SD0Rpʨ0S S 00S 00 0`S0S000000000 P 0S  2 0 R$ ?! 0$ S0S 0$ iedAO-DMhPl`PDЍ㢳@P >$p6# S0 O" P`;#S0D"p0 d00`0\ h0x00XA P$`P`t0(08 H000 00 00p;y ҋ@-`X0S0 g{\0@S0 h`0S0| id0St0` jh0S\0D kpP S 0&L ЍTz ȊlO-TM000 0400,00(0 0$ 80 0P! 0`@ @vP$0SUФpp Q 0U U H0!<01PRPp!PUp<0L @P PUDp p0S H0L H00LS40D 0@0Pp0P4p S 0  S PS p0S; S S 21+1:$0S Li$0,  QB\X<X4RQ2ȠP,$0&$0(Q $A#(0 S ! 0S H (v80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRXB"01,{O-`0M@<TЍаPp@D0S X08  0 0 p`1/Z  S     yQ yR  080Q0 0p`1/P ,y A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-㳰@p`P1S 3/P @`VTd0@@ᜰT0P0S@000S4000S(0000A޲z ,,y ~ ` p@-@4`4P0Sp@β10S 3/@,,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp` ^$ 4R R0 0`40$ Rp `083/< 0 2 `P    000 0S0\000  00//00/00/00/10/Q@-@@L 0A0003/P@($ @^ SC-`BEM0SP;0婭p 0S㠭0S|噭 0S 㒭0SH勭0S0儭0Sk}0S00$ R!000 V F 3#&> 0!C> f`0 010@0`ꪬ&+`+SO-MPc0@_0` P(" X `b0  000 Ap!@䡟A000 3!币P40g0p@- 4@p@ϭᔰld兲\J@X  H!0 <  $!`0  ! 0p0 R   P~ 坭Ѝ 0p!0i ` ` j OT 0p-0@0 NR S3#:`@0ꪬ+`+%!+Ìq+20A-@\0`3/ pW@@P@PP< 0DW  \-W0 U    ! 0  0 1    x  "l , 000SJCT T0T TT"w0B@@L r!+q  u z y6s@-@,`Pȯ01Ѝp+0p@-(M0P,03/`}0@ S:000 00 0 0 0 垨p` x0A0ᑯ(Ѝp0l O-@-MP4,PЍ ᖮpP 0p r@ @< " PZ0H03/0S@`H@`A0 0`P |" 0 Q"l2 2h"I0C 0 0 000 0A 0 0 0$1 |(0S.("0P L0 3/P X0P@T`@\0`0 S8ԭP\ 80S ,0 0, S001z40P ∡0L0 3/0 0P0 $% % F   0 0  qd 00fp`_@0弤8 @,0pަ`$0`4 4!0 ` 40000 f0,0 p$0$10带0$10\岦\0d00h0@ 0l0`p00S<p0  PÁt ,l3 000000 000 0  080pp` ݣ3d,0à2l0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV 0喦P2Q TЍP00SZ 3/@@OoBS f00&0m 1@0@!Rx!@!x@|@pPpt@Pt0S|0X*@DP PQ 0!@x 0T:x0S@ ᖣBt@OoBG@|0xT:6@,+uz 6d++p R082  , u`s +>SO-[?UM00D48@< ` D ҨP ͨpP Uߍ¨0P P40,Q3, 080S 0R@ <0S6(1SL 0K ,HLAP4#0B4  H@0#; $SP @0PPK @T 2"B 40P 0S 3/P,00,0|2, 0SU@`PD`D@s v0yS Y0N H@`(HD! @<#P`T@P ` "@ ,,00 0000 @K    , @ , 7A00P1:1!tpƤ @0 000000 00000 0&p` DD0U4 Q[T Y   4 v W`,, noˍz 6O-JM M/0`@0廡PP+qP) n0S% jt"`0e`r`!`/)0P T  0CT *0C/Q 00qP@ᘢm+ P:?0  P+0: S `V>00ꨰ  _PJ>0@0/S 0+  S 2P+  P*P 0/S`0oo`bS p0&000 SV|+l P*+f P*-P1@+-@]&Jލ Ѝ迪_@-6]*@-M @ZP(0  @P  P Ѝ0S:$c(#"c  8#8S O-M` PPp X㼠弰`p5!PЍ0S @ P 0 @pLP Xp $0 @公˧ꍎmލG-Mxz `P`P PP<i+@P@]  0X@ Ρġ@P*+J#J.0;+JJ.X0,T X %PP~D4 PPu$+JJ.0 PPe+Jz J?` PPN+㈁刑PJ`hp0 0J>⹧P 0. ֫P UT ލ@P@Y+J4J?PPpJ.@0ᰫ+  㦫P h lJ>⟫PR FsRe'yr8f%+'0:/00/00/00/00/0@-4M@0#|0$P 05P` 7P0T0670 P. 5P @ᓦ4Ѝ0`+@++O-MA Ad2(000PB(0 0000= 80s#0(0`p[05 0%500%`0$0 0$0S000`5_`@ @`-@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0 SW`vp p 0 T$`ⓦ0$00  0 0 0#ァ400 0`00P00 0$0Sr D =3 D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0, S`pH0LC +0V   00 X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0H0$0L01 0,!<10$00H, `, P 0Q00000S p, n, P0,0 [wR0,4  \4 P Y p00p,0Y08p,B YP P 0,00000;0(\cQ  k,00Z`+G+6%,+_C-pQ|MW0PSSp` 000 P  "  S"V 0@T0 S>T2x@X"&(@E@@,0S:0=,"(0P9P@  00+0@080s=0 0( T 厤W|Ѝ#!@&(00\1 0`!00 XT咴@!0(P R P@@ !0 0 h0 @ 0400t0S00XTi00P0 ̟P@| 0(Ƥ@hŸ @8q 3/P`+"NgXdG0U]0@-)@M0 p\*3 +㗟@,㔟P 0ޟ*㊟P fן-ミ F 0|.y0  0sЍ0!0P8q0 S+P ,^P  ]j2+0z sh+ A- @"(0MV( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FAq(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0z pO-p4@`00Y)Z]p !!`PV 0p  0 P 0Q 0S  W 00,0 84p $0T0 0X05p0 P,[.[ P Q  010 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$#P `ᚡPP $0 Sz22@|x 1 0100 0A00000娛@l儘l២x0SS(ṡPPL p0(P嚡!1P审0PA x 0R`( b ",0x  B    0 8Ph l凾,0( 040x0?o21000Ѝ0TQ,+ u\ O-pᨁ娡,M@0 S000 /00 0S,Ѝ/S  t/00P`pU1(5`P p㘁!.PP PP%0(` 1` 0400,00 `T00X08`U0100&  P 0_0k rPӡ`d+WO-p\M@P4 `儰a0 SpU 0 Q$0S   $ pkP9\ЍO|*.j P: 0pR  ,`VT` V 0 0 9 $`00000Y3(0S` ` 0 RH03/0p``0[   80s pȟ0PP00@0  BR0S0SP 0[p08 r  *   * U0'0U " [P R 0S  0 PP p00 . P 0$ PU$p0p[0 ^[np0 PUp[h0[( Q!P$: p00 00$0 0 $0 0S 0X CXZ 0 0P pZ$0 0 S)$0 0S  0# 00#0 P.S 0UPpС0Z 3@ D Z0)  Z$ RRp 0S  S0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S QP 0 0 , 0R0S00`R  #P` P 0 Q ``T R T  R X `( 0Sl0( L03/P <00S D0SS000(( rTL0( 3/P 80<00S (0, S004 Q 0( `O20PP0Z0[ U0s P 0$p$ PUp0 80sd0 : 0  U0 W[p㐁! 0 QQ 80s 0  00UPpp0  R 0S  0  @p0  0  .+8{ ,+X+} _O-@-M`,p0 40PVY ppPT Pp0Z:`PU`J6ERUA 6&Gf00#h R 0  80s0`F`pHU p  h0S 00  80spHY pPp  h0 0l0L03/, 00Y:pPpʞp0㐝0P80l5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0 PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`ppWp < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0 `V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0    V00 400Pm۶} ]+! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe 웟000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$ {  W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`p 0R04$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X \ $ ` ( Sd ,  ,0S} P0 P  R0P0u000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80sb 00_ Q Z 0 SW 0 SL0  3/P@D0 RP RP0{0 80X T,3/00T00X0 0\0$0`0(0d0,0 0Sc 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQCPp`,0 0UB:8  0$ $0S  p p0 R\pᡚ`P p0i"P0R[p Z[ Yl:PpW 00U0#S~ p`Ѝ茀 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0P0000 80sp 8Hp0!8p 40X 00 0S 0P*` p - 80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPq 00 80sh p  Php@-@P(Ml(0S(`,`V000P0 F0 0PP` p P(P,((P(Ѝp000ؐ,G(0,`(P\,\ R+O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1S<1@1X\>ACl70(0Sp, H<#0@ 0 '8  '0 0 W &%, 080000,  0 Ͽ0080000  0'ɿXO00HH0P00T0(0P X0L W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00T0pp 85P,0SXpW) 0GSC0.>( CP$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0 L03/P 00S 0SpW+ WP0pH03/ 0! P7/P%$%$)@0 Q1\YK @1003/Q  01/ 0S 2"`$Є  0;P  0 Hp0  @D@儀 0X80X> &Pn32m,0S e pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000,+d+p4082,u`s _} j@-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-`Yp@P 0< #80 s#  002    0 S R( 0S%  吁( R Q0 2 T 0  < {+800r"000S   y$ 1 SR8C801/h+0! /h+$1p@-S@ x1SP $003/p@x1P$1 0SO-KMM@040`DpPH(00S >I @  0o- 0<0%"P{ 娻 K@T8p0 00U 0 00000@00 ,@@@@0ŐppK܍Ѝ(⛍ (0S*o< !8 ;c&@@$ u.O-M0M,0p1`h@0pP 0S (0 S> 9 H/ 00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000 00lp`ލЍ,B᱐,0S*< !, 00B"X R00C0C0000S0 0,0A$Ph+$ u-@-@ 0  !<$10(10,1P001.@-@ 0 0! 0O-,MTPPT`0p R,Ѝ "P9 @@5/ɕP`K  ` V`G2   "0  00 0(0 00 ڏ`ᶌ%і0,ЍO/@[;p@-@Q-D D8D\DtDDPJ 0  PC40 Pl=<0d p@PP480 P.,0 P$(00 p)*+-p@-PBMH`@  V,EPE|EEEEtF0FLFFFFGP0 P Bߍp`00PS0`40Pl`ۑ80S80P8 8 X0S0!˖@ Ǒ0  P忑\0 `0S ⵖ@`宑d0Ph0Sڰ ⥖@l0Sڈ ⛖@p0SH ⑖@TP`劑t0P^:;&=>5?2<AB)CEF@-PAMH`@o  V(GHDHlHHD`qK0 @00S    8`V@#L 0 PD0 Aߍ(0St  7@d,0SL  -@@00S0  #@^1)23<@-0AMP@0Q*$II0JTJlJJJJJ q0`N   0S (0S  u  q,`VL Aߍ8ߐ q0`N u  [ 0S (0S  Q  M,`VP忐$0 \P㶐 0 P尐0 Pt媐0 P`夐0 P㞐0 P4嘐 0 -S@    60S O-@MV M:Pn 0 0x R#` R0^嬵嬅Dpad80  @Q D0 P  zPD L   `V8p00(0S%:$B00,0S$-$B0000Sڤ$ $B0+ 0 t0B/8PDdpὠx 00 0; Q <0 Sn0y0!$ Bz0#0 0=,0Sn0y0 Bj0# 00;8Q30#ה BY0x#0 0=<0Sn0y0ǔ BI( K 0 R $#⸔ B: 0 R "⪔ B,0x 7#0= 0Sڴ"⚔ Bx 00 0=$0St"≔ B 0 00=(0S<"z B0x 7#0=00S"j Bx 00 0=40S!Y B0 00=80Sڈ!J B0x 7#0;! H!; B0000B/VpWxX0 0  @8 PQ+< 0 \x S0L@T܍ Ѝ/x,,wGb}$jkpIŐѐؐߐ C-`RGM8 C"U0S1 `F` u됣0p⇞ 0S  `,pYV o$ <u4` 00"  `qߍ@ 0  0S  u `pV  0  1 PSN0  P֍ 0  0S @0S@Ǎ ߍGc<0040!00幒@0Fo$ 0DL03/00 Fppqr0S !0⟒PD` 0S  p8` V,a0 x Q0W 8 < RFO   o 0 /@-@d 0  e R0Wx 0V  +]D<̐Z>&G'SM[wc/@-x @B+0 @0p0嶘d=@ tm@-@ @/000(0,0000塘d(@ tꐯvp@-`TQJM0@s@!   0j1S:YYY0ZI1P/S X(-0(0 00MO0SvU ( 0S `Pp  n00!15:% p bP q Q 0, ($! p h$ NP^0 0 8a4Q101T/|,,+kՒ_eq0S@0@-S@00 0S/,_O-0زEM 02@PT PP0 2P |1S$ $P| 003/P `2P X ⻋@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 ĎpPP2@0S- $P* 0 x0D 0ST+_$,|,a`,wP+,A-0M$AT@ Q 0P`p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T @ TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 T+$,P+,x,,\0p@-T00P ODPPp0AS@  1SA@+,++0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S",p0\ Q0/\P  ^U Q0000@-,O-GM0M40d2@`TL2 00V 0 0000000@@@@ h0p@c<  r G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 x0`@W 47 4R|4 VL0G, <0," B+u$ h+0@-DMP@S P08 @\0 D@  d  i0 0DЍ00Sh+0@-@DMP. P0, P\0 P  T  0 R X  @0S0000000 0DЍ000Sh+p@-@Q@M`P<㡃@P  T0 0SP@Ѝp@0@00 D0U@Ѝph+17@-@SW܇p̈ Ѝ0!{P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0P<0 S@  0"h{080#b{0,0$\{000006>OF@-@PD x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍpprD6\@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P 0 $t<  <U\ 0$?P0 |! |Ѝ0,+a80@-S`4M@Pc00 0~P 003/00$1U Ut  4ЍS0  000 0xp 7/( (0 |*|p@-00MPQ0@$ 00x` 6/< ``Px1磄x1a1S0C€10Ѝp'p@-@<P P $ EPp0S@}p P 2Pp0S 4! B! P  Pp0Sp zP R P0 < Ppp_9a`IYbog|O-uM M<p Z-H0 cS_ C0SSyC0S PB0SyвB0Sy2 P    P 2     P\2 TH   @  P0000 2  @@K @xP@ PHPP< ,jh@ ,D@.? 0101010R0 0K000PP0 d|p@  P|y| 0S 10S $1S 10 0Suݍ ЍVP^HOPhHPg1S |!R `qP lf%h+P+,|,,T+$,x,,,,,,,>dRP>,++@-@(00S @P,@-@PЍp$QU0 !`P > PP C 01/P ,00 H$L Q>,+80S 0 @-RJ/H~ m O-`ᘐ嘠嘰@PX0r2 S80S00 00 S80S0|1 P S$1S00 0WVQp@-8M`8 @ vT P $Q$00S U  0|1 08Ѝp!P _P P Q  ሺ P K ᓭ P h+A-Mz8 P2U`ЍDP $A003/0 R   01/`P 003/@P$a0H03/0 `pXDD2 08 8/PD> 0!! `7# 0 3/P"0#"#0 03/p 0` L03/g␬  p` 0SWp`?`B414!44XI0<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv   0|1 0@ ~ H~  h+G-`RMXr@ PP` PP` `PVP P7 ( {p 0S  cߍ<08 H(00,0 0000400!4 04$0D0(0P `{WZ  {pTp {p*d Xp 8 ` 8V ,V V V V 0,0V0 V  y{p 0`?`a8SPb   00*P*00p Z 0* }d@edAzd@ho A-PMPp`;@ Ϻp@P  0P6PyU00 ## ݍ /O-s@-M0 0Dy 0@S|( zPX0vT x@08+{8 P 0  AЍ]Ds0{ @-7z0SЍ@-M@ yT0  CR$00S ЍwA-@lP0ST 0S` @x^2 ,@-1` QP@1`qdQ@p@-@pP0S0ST 0DSTPS$D  p# @0p+8,08S^0/8$,0-,p@- @ 0( 0vS0PS 00S&i ppC-NMMP<Ѐ@` u0  ` P`Pn000 ;0@PD gpKfNލЍFf AydG-xM` ✐堠@pPP! !0@P 0S PU 0 R<D1D!DDs400S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZL    YZ( ( {mvH ,1t-xO-`BMMp@P/0r; @否0P0p X@;$  l P) ez BލЍXjP (0  h   hl0/SX l0H,g l!14"So[ 1 SR 1S  RS1S1Sr`2p?B冯@0Q 0 STS "0SO[@kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0뷇00 " "mo@ U01U01VMKURXA- 0MHL`Pp t1t!tt73Pj@PP0ЍT00ဇ 0R`0 !?020 20a02p204 pk 0PS" $0Q00 L03/P Q P0Q    R D0QR003/S\ ,>8,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @ P^U0PP 8^ @T ,fP ` ` `b` ` p Sp`" 2 `q`!~``Pa 8k00`U08vRP08}/ ^Q 0S`P82S01111111110 8m2~/P/<`0Xh40S0St  P p2S222?040WP 2SX1O-bM M Q 00P $00/;㊤0P0`bލ Ѝ$ ep `|y?00@ P,(Z 2S 1S,2,",,10@0 Ḁἰ        0S@!? U㪋p㊤ < (@jP^bV\cT&PRQ 0 p  W p!p'q ?p? @p  W p!p'q?p0?g@P%  0epJ  i?WU E ,( pij?W U `d@Ho ,Us@-RU0 G1@`d0T `Š P";0H0`04 oЍpϘy ,@-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0.80@0 0",<< . 08,+O-P@pdM04005Q 0} Q Xg QP8B0^  RW* ,50'D0Q   R0RS }υ0^ @^TX 0SQQY WpdЍb004@F@  0@TT0@ 0@4P SI 0`P P\ X 0`VBT@`00T40^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?020 2S 01 (, (0 PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W>?h "QR 0S2"/02#38^0WN 4dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0{h 0L0S 1P0S`10T80< q?r0 8Z o0 ^Q  Rl0 ~/O ` 0( R 0C0#808,1H T, lO-@|MHX0(S S|ЍS S7 ( [8(=/D S0} @(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"~, 4š $(( (00) 00P0U00( 000$00 00 U00040 080408 0,000, S 0 08B4X>wu? v?( $R BT@200r/q?`0sh 00(` 0R   T R,0S0u0<0"f<0pP=X50~;\0o_P"0Ha``V PV >gт0( 8  z@0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0 ,0S00@P0PT0S@0 Ple P0aB0@SP0 0HL R   ? J ?G/Z[d0P @10`d ἐ 09/0P@\Ѝ),+G-p0@PH8L041\`  S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/,+>00@-M 410@81u0!`0 P00 0LL`0 H0PU ! 5/ᡸЍ0,+<@- I^@ ]@-@  0eMc몬}%@-@@0s7],00p 0e0Cof%TX,-?$M0 0  q]$Ѝ-4M0 00 000P4ЍO-p-KMD U] " ]|4 0`p0 `V0 R`V"R0*` ğ p$T0S 0s 0SKߍ0S P (e30SP #)$dP#S 07p{0 A (ԧT# A(e{{:?dSd 0d 3 3R - BPP  " BRڒ "B (" e"2cPŸ 0 R#3SPjSt0100(0 \"ec0 PP 0 0SZP=9 =:rk{x1 AP09 A k Q 5 P;!%#3\Q0  d 0!(0 eT!c(1@P0& d( SP P*!0"%+0!V6 ]c@0S(0d Tc@0 0(p f[Y@.AhX,HX,xX,PX,xcl@X,S8X,XX,Q *jTX,`X,@~r70P 0 A D0 A k{I{7{zWk0P x   c`~f@<\(0<pP~ 0b@  b@-G@rC@SRG-@  9700pP ąH`P:X:00X 0bP@-Pp@`P0S -S :S S 000`  0 P00 ЍU0S T  DP%p@-@PZp  `Z@ZU700@pp@-P 4`Zp@  ZPZ@p@-M@ [p$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ_p@-P R`@0 @ q[0 00S  UPE P3Ѝpp@-P@@@[p9PppA-@Pp p` j 0W0 |0WxX Uh0X`0 P  0P 0haЍU0 P 0 ھ֛ޛ@-`0tM0FP?o2p @p'[ ZpY[@&Zp h2SZp L0V#4 - tЍ=[h"Zp0 p@-@ Y0 S " 0PUPUp@`0S   0 0S ``0S   0 0S ``A-pM@PU `0S@PE7  0Pk00ZۍXa700S @ Q@BPE@C000  pL/E0S A0#S @UX '@-MP @  Yp8 lۍP   `1p@-0SM@` @@>  <P  0 !   Xp0 S 09S 0Ѝp0 S   000 00P0 PS l0@  pDL  Ѝp@ p3  OHYp@-@$`Pm]Pp0 @ `P0 002 0pSp@-PxM@`  j0 0Xp@) yXp'  sXp! mXp  gXp  P P0  < p,4IxЍpE BTX2 3HY0 0 s@->@P`Mp @t0  p``X0 :p <0@  p Ѝpd!B YT!p@-@PqP 6  X01pP`qpJ# W0#1pp@-pM0 p @ WpW@pЍQG-M700ۍ   Y ` @V W@pP`@-`R00 Ѝ@PTp ]@P  Q*@ 0S0S0 S   0 0S0 S*]P ` ^^0ST  ` 00000 0` @@0P ; H@-@Q@ P L1p@-S@T1S#d1S.RU9lRUppbV:lX^lbp1CS^L10CL1L1PSK^0P11CE^T10CT1T1XS=^0X11C7^d10Cd1d1hS/^0h12,P0C2bV!^bp2,P0Cp27@-@0 PP" H1 0D1=80-@@ CB Ѝ0@d Ѝ0Q@-@    bVP p 00` Ѝ@ Q @40 pЍ@ Ѝ3g (YQ@-@    yVP p 00w Ѝ@ 1S70|]>[P| 01 @40K pЍ@V Ѝ3x *Yt0@-M0@Q0$-+pB Ѝ  ꉈ m081/@-@d'P0S  P 0800L0S S@'Ꙝzp!@-RM@ Qtp0  Ѝfp1Sꡜ0@-800@@sA P@-@p t10cSt14 Ѝ@R @0d  Ѝ詜*Q7@-@  ,, _ BUp  PU Ѝ0@- P 11P,|1@ R  | 'AQP |`00CS`0X ^@X0 |p 0< Ѝ0@ X0 X Ѝ03 }%8}%(Yp@-PDsUpp@00X @KVpP p@wUn6p@-P@ `8 0x8 , >U\& 0 0 008 , 81pp@ ϜLǜp@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P+.H0$:0@0   10 &000 0sH00,PQ 0a(!"4a4# 00 >Q & Pp W  g080_P040 Ѝ 0b"!4b4#@- @T0800* HP  : HP%p@-8AU81981s@-m0@  0!x1P PR0$ ( Ѝp@%P P0 1 \ Ѝp@ PU%P P01\PЍp@ 0 l0iP90 ,R ,`Sp0 ,T0,1Ѝp@P D2 p@-@l =  x1P`PUp@d 0S%P% p@_ǜt0@-SLM@P 0$Q0@(p 00 p0 `P  LЍU @ x ` U`H10 D1 xPE`! -O-@PP 0p4` R ' 0 08   m0 0 XU D c <= 0S 08   ЍEn7@-P0@@H!D Ѝ0A-@Ḁx0P P ЍA! E 0 `  0  0x1PU 0" 0SYIP ЍAET 0S 800 էP P  ЍuA- M@` P,L`$p PO 0S PPU{ 0 P8`V,P  E ЍAn$ h$c<080SV $0 pO0SK D ЍA 0S $  @ z p A ЍA6 U0 0S V r P0S t`QP  ,t R LP 0S *T< 0S 0< $ ЍA Ѝĝߝn6 #z 0@-@x P $ LV@ L0p@-S`@P 08PU $00P   81 08006? $0080S  p,& A p  p@K @-@@O-p- M8I@P`T1 Ѝ ZP 0S,W' 08،#0  S0800  0<@X 0U0X0S @ HX   -8C-`HMa0@  ,ЍPPe p0 P , QpP1 P P2 P7 TP@ P8!88k@p$! `Q0S000 0< 00 H B` x;nD!\10B0H1x=l l<,x5 iPʍd OTDMX,dlvS~@-@ 5 ,Qp !P<1  ,N,#Q0,1ЍPDH0<1 P$63u ) Q/@-@  0S@qC-`@ x| @P00@ 0S  h0 Sx   04@ Ѝ0  pPtR @P @00PEW  x ? PP 0S  ]$0$0> > R **X K 0S .@0 S   000x1  @  0SP P0 0'0 S   0>U ^tC-MM0000"@0uQp@00F܁P+ .PP`pQ v?07S ;0 S W l0 0\!`1 1 `Px1 (ލЍ PpP  R쀟쐟PU $Wxx x  0 S   x0 pP 0 Px1p  P  0S 0q0 P ٟ98Q@-@  ll+p07S@Y0 S 0VS0S@3 A-`R@M@p PP U70 h0d@ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *,P 0S( <0 *-  2 <0# |) 0S h0 !r 0S>0 P 0SV>P  *@ЍA/ o;O-@p$M`(PwP  pP 00A $ЍOjaPy \P000 pp XSP    >0pGpG 00 ZppIV4$pp pp N]#3ps 81 18100x1Z*  NPx1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 P  YY p 000 0SZ81181$Ѝ P  YY p 00`` ^00T0 :0G [W0 00x1 Z R& ` @|P `[` @H0 0 0`0  WB W W 0S 0`0 7 0S [ xx0P 0S [{0x rXbiyw% L@->@T( "44p P`0"@"44 0W 6L L0 b"!4b4# 0@> *>0@D Ѝ耼p1p@-SMP"!` P%@P T 0p1!V T 0S X\{ORP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ )P 0 @  B00.$p ,*l1S 5IS( cȨ 0 R/ 1/X,/A-@P 1 !  sSXp0 RqP 0`0S 000S \ \QP0 S   000S00@00P10 paU01 G+0P@-p0p pp%q 00P R0   UA p@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M`@PM (0x`p`FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41V(@p 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@T Hʚ;Y@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@",p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ h P 0 )@-0PT0/ P0 @-0T0/ //P@-(0( ((@008< D0 @-,MP` 10U@0$00 0@p000 0<0S Kp,Ѝ8010C>S>00@( ( 03(00@000 0<0S80 Jp @M Y@-XP@P -Lp#R@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0QPU `0 P  S   p0 J00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM bȂpT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* ᯝP% HLH R 0|S0       @@U 0 HP0SPp0S} `Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/X, @-8 0e(@ p@ t@Ѝ}%A-M`M4Psp 7K0 KQp@ pI@ۍЍ4F P ڣ# "P  RP@@#C 4,0 @4   Rf%}%-@-  Ѝ Ѝ/@-MMP`@u0 p QR  0gpۍЍo-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/f% 0p/SRf%p@-MMt Hp P@;00 dSV 00@ۍЍp P0 4Odf%S0/f%@-@ @#R4 @Rf%p@-@`PL;T ̜4 P P  k RT V00ppf%}%Q@-@P:c@%@O@-q@ H01p H01@!Ip@-MP@` )  ᴸ0X Ip 1@ R! (0 p`Ѝpii$0 /L0s P/0 #:60#//A-XM>PU;V0P0XЍU2700p@ `R0 PU B0>00 0<0  ,> }!PP> *r@-@T?@Q/@-@T?@0P/ R R /0G-`P M0(0S @ P P  P:Z`P 0!00 0  ➳0S80 00 Ѝ080 00S # P`p  P`w0P 0iS.S  P`g0S4 040:S%0@-@PDM QP@T h00p@DЍ0U  ☾P @0S@-`@MPpTЍ 0S P 0S Q 0  pO>@P @-$000Q/Px1P/$0/@-M@    I0 hHpЍ~iO-YM `F/@H9X0KpP pYߍ0pM 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 <PAT1S@\1S`1 .P5\1 S S R@L1SP1 P&L1SPC_oRPU@j P0HS 0s0嫽P 0*Һ81 T48#88 S R p S 0 S T X @@?@0?H0p 0P0H0}>H0 @n0000LPPPȊ ĩiA-p M X`P00 @R  RT T 1 # o0@ @ QPUx!@Tt00 Ѝ S @F@-@vp !p !p`EȀ %0R% -@  %A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pg@P─@Ѝ cP\ LL0P qP gpP bԊ A-PR Mp@ 0S0T00 Ѝ/`P P&`0 00 0  㘰0S XT G8PlP/00T U8'>O-@P^0"S0Z"SJP Y papP wxp700 ЍT WOYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8rrrr8rrrrrrrT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: - U*`XJ:0\S 0}  0 P0N[ SP0Sl  -PTPp@]p%P /0 S S /S/P0/S 0 S S/0/O-P&f@P ЍO^= `Pll a ЍOJ6 U qWrJf@P  ᾖP 1 A Ѝ=ު0@S- uP'[ e`PHJ ``]I P 0 0  0 0ۊ Op@-@ $J`P 0SJ$`P PP(0S $J0(0$0p,` P,` PO-4M10CXP`p@Spx $8yLy܅yyyPȌ@yyzzyyzl{{{{l|y|~y~H~hxyH y؎t  y\pyȗܗЍh@T4Ht}(ܐ<Ph|șdܙDpHU-  `Pp$uP@  ⶕP7 7  '$ !P`0@T\0S @U0 @7 0H050U- H0?0P 4I0 @PA t01x4ЍFP 0 pp 0S 0>PI01#@%U  ChUH070 0 JpP! .R 0R77@0U h 0/pPL H RU H0@1S\d@H000{U HP00q ,0 00 0 N,0S ` {U ,0!00 0 g,0S < K Uz <1E8b0w4儒0000 0 PPP00 0 P p@ 0  @P UL <18b0w4儒00p00 0 PP00 0 P0@  H0:0H >P 0<0UH& 0S# /ᢨp؀P  &P00<0/␨`P 00 /00P 000H060U ,0 00 0 M,0HS  >h 0A  a/ph  P 4@AK0  U 0 U ,BP 0S U 0 p H0 50dh0 50,0 % 00 0 f,00,YpT 7$ U=PePUl700 5 0 $L 5(@p 0 (  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 'M,0HS 9U H0P SPH0;00H090U `h i`,ኧpP D`P 0$'G C_FH0Q7;0UlQ P0l1  P0l1 P0l1 P pE0P p1tH000|UH10 2v PH0 2n ڶPH 0 2f ҶP ͶPH X H000RH020MU  0pPl] H0 S;70:H0205H0600H0;0+H080&UV <1!8b0w4儒00 0 P000 0 P0P@0PU2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =ᏦP d p$PWH0p000S P0<00  P WH p P  PWHp   P  P  P l ڵP=WH#  BjP S  ($p 00t ,p 00qpPh $ ( H,8   P< B7d ᖵPWH B& $rp= BpP9 ((u (r H$8n  P  Bef% n hvϪ :Dg zѫe߫$  /;Hoh^[wŬ*Qaȭ׭k-*r@#a*Tg@/ BG@9LYb3LV +ۮ^l$ .5Nh P 0 PW ,0 00 0D J,0HSu  ӴP /o"Be ($P|/ H P0(0Pl 7$ ! (0'0G ($P^/H  P0(0͐PN 7$ ! (0 '0)UY H0#X U@XH020H0 0002,H000 H000H0 00H0 00(07600 2R Ӷ *ζ350S00T01=5 =5H00U <1(0@0P@470'P 0S<bU H$D_P$U 81 800 (0 00 0 I(0`S, 4`( "4`4# ,,0嫱H0800 "PP0 0 P 0 0TH010vH010qH000lH050gH050bH000]H,';,WUUH090OAK3O\ 00` U0w ZPhbX@ DP3&7 D000 0000 0P70P7}‧ G000 0:00 3000%0  Op 8 +8 0 D 0p0 D+ 01 P#Z H0E,y>P0047{ (8ҨP,:|؍<Ѝܔ80$080,CP(/0782p47,204<7囗 SJ8?@p,D7囗 SD@w?H'0l"L'87<7@7D7p"H7L7088 p,20!3 ((P ((pW 400000(00 0N@(0S 0 S S0P\S @ p p8000SS ,38 P,,00  C0 ?oP20804P0P$0pB((P f((0S0' & - PN(PI Z$dh JPP78=0婬0@(0S 0 S S0P\S 00@ P:0  S|pPpP80,CP(0)S YL 9멱00(hQdqMZPpdq PH ٮP0S (P Ϯ ˮP 0S (P PpP| 0)R00S  ᲮP W400000(00 0 }0S D:$ D000Xԑ X,@  aSo6ʪ:0Q//Q *///G-p0@0P `3P` Y 0 0 R:@CS@D"@3X HGǰU( HGA-TpW0 QT`@V0 L0LS @sP X X| |00 S HH0P 0RS T hp@-P >@Pp^=@-p@-@Pp PPpT0 p@1@-0@lT ^@00T0S0 @- me hA-@QX2X"XXT0p  Q081800` PPW Vpb$0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . p0S pޮ0S@xhPT0$0x x0Rt D@ t0 p0S (ꀳr ;h³A-`PP c_@T T0Sp/@Qp@- M0 zT0S0 PU|0h xPc_` @P  H 0  <  Ѝp聳y hmѳG-0MPp   GP &81@0A 81(P  0Ѝ |B ᡣ@T{   ᚣT0 R0 0800+ P T8p0SS90SS⯢PT0c ᧢| `P7 |0   P @T T0R88tPY0Sx x0R r mҢT ƭ00XXSP  gP T T0R88BP\>p0VS tc_ @TG  0SS`-90SS)$3PT00S8 0 H0*: S R   p g0S c0S G@]T Q00,6 â@Pꄒ  ( QA-PPQ_@` p 0t0cRa0100FS  !A/ѬP@-404 4;h0S /001 <P@-404 4QS0S /001ƒ <P@-L0L L}>0S So/001ђ <P@-H0H H#0S SpĬ/001 <P@-L0L L 0S S,0@o詬/001 < bp@-@Q0 RP0 _0`S0 SQ 0h ):p@p0 p@3W0 p@g {<s1i0P@-x0x xxQl0\ i P R !P BR #@@{ <p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S !0@0 Ѝp/0h`Q ƫ0000P 0 1 <X,'A-0S00@Pd` pW /0000Pp 0 )X, n<P@-808 88Q,0 v!>0001, <Ŵp@-@PQp98 ҴC-TM@` P `bp) 0 c ````c 1 pW0`pV& c눫 0 0 1@ bT  z@TЍ00C>Sq00`"P!@03@000C>S`00p"P!@03@0$  -3@- P Lp@Ѝ0@ Ѝ/@\pA-@R4pP`@0S pڴA-0Pp@`S:0SS 0   RS* R0 ^`V1S* gP a 0@DpR: Q #h O-A TMP` zyB@PAD@081 Z  wp 00ȀP P P P P P P ާpPpZ p Dp \61@ R L:p 081#?Q0(800 00 & &(p L0S% S% p H p P p $  p E pw P0S t00$Q0p T pe x0SA 8111ߞ0x1[:8p M ⠟P> :p@ lWPH 00 \d\$k$P p* 1d p-"p]Dx p 0S P Q Z[ T  l8p  #c8p PO PJ PE P@ P P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!8p%P `V%R  p0S0S"0h 1SqP2s+p@0-j  pb 0h!pZp @ pP 0$8!pGPpA 1 RZ  P4 ЍZ p pkꐓ idzߝsUǜ{8 EH$ ̵׵ 17U]S8*NCp@-@Ppp p@RRA-P`p@@L0s  S  U@ p@@@dW0S R H R U p菜szQ p@-P0U@Sd` 00p ᾥP@T@T:套p/J}%@-`PM1pSAT  p@lLЍ\ ᑥPЍ@!R 0$  00 p@ *a@V 0 !}p@`P 4p%0S lt00#40 PP D SP ]7( 0(ꙓ OT o ip@-PP 0S 1 `@0S @@p00p SU   \@ .S0.Sѧ0_S-S.00  @R"0T0 0D0p% @- @0P PT00Q  ڤDP `00CS`0p S00 P0S X0X /X68}%p@-h1@SPbPPPE @p ⢝0.SSPP \ᖤP LᑤP < P 0  .ؔPP꺄ϐڶp@-@P'Uc 0 :50 t550 d050  T+50H/@,8)0& (#@        40  40  40 40 4 Np@t IP,q"B.8?FK`*SXaj}% 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pPX0p0 0/4QލЍA. !. t l0"4p`0SPE@E p 0S:0@D0bu<{O--,MlhpP. N|`  @P_3 0S  v j,P$P@lP@ X^P$0X2@3)00,Ѝ P,P, R YP,PE0S p R* 0 3 0  9$ R, R 7P 8$ R R ,Pp!@P !!!b P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@{V00ЍPWq"0$?S 0[ PW RPPUT  PR70 0 6 .0@I0 0IU:D X?0 0 `TT  DSPO-p0 0$09`@P00W*0S T [700 Ѝ!0 *00K@P  00T [ 00 P     @ \Jo"  & Z/Z#ʤT [\*00 0000K@P곤\ZT [T [ KP|%Ó C-RM MPLHp`p; @">pE  3p V=p =4  3pTG    |0 Ip P; IbP <I/    VRލ Ѝ   20EV002 0I@ p  p@P0P@T*Cp0S4 9p `@T*T 0 2p @ !p   ߞ0#$$("( 2pm @  ̞0d#$$(B(   ⿞04!c#!$ c$" a2pM @@  ⬞ 0b"!4b$#  ⟞(H   .0I/*P* I/ 82p$ 0S @00SP%D)2pꐣ00Sq  &)A-p PMU@ 彙ЍR` R o00P0S 0 -0 0t00#Q0 .V 0 00 00P0S 0 ꯷O-4MX@p 0S\`d` (0S:0 p20"4ЍO 0  ,   xYp0,0 ,0SPCD ,<IVp 00"0,04ЍP V0 00!00  (, p0Bp00X!0h `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  09,Pԓ ʷԷڴܷ2p@-P`@P 0S $`P(0Sp,` P,` P y 0)0@-MMP+ gp P0@ۍЍ0;0 C#@P ,P @- PΠ R-00\L  ^@-Q00P`PV0 V=`V xЍp@@T   0x@ `DPЍp`Vx1@P 0>0S *|P PU@P PPС`͡/0P@-000 00Q$0 @ 夜Cp O~@-` ,M00<0@SP  '0x Bfp Lp0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xFPT ,Ѝ0 8 0@0S V0xPTvA-@`|VPFPPP2Xxp`Er-P x倂|"x20 V0  ܠ|20|2@-Mp@`P! ˠ (Ǡ (RX( 8pr(PU@ T700@Ѝ i///0@-M @ қ+PPЍ0 3"Qqp 00000)'p00000@ 'plp 00  0"'p< Dp 꿸z p@-QUp@p &-0x1p@-p@-FM>`V P00Fߍp@PF/ 39  0弖p01 0 `Y0 HF?' 0> *PK0 F?' ii@-@MqP4@ $⋝P P@Ѝꌝ Q@0@ @@@-0SSP`///ɸ O$0 /Lp/Q @-@p000t0@0Q00@-,M@P(  Ὗ  HT i'p 0 00S p,Ѝ08i(p@-MP@ ᙟ ` ┟   (P?'PЍp:iC-PQSM M3#T0S3"`V2"@p@"g0B01801T0t0H0 0C@L0@T3H 0H0L00L0@ P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0p 0`00t0H0T@L0 0$L0120@ 2CT@D@@@0@L0 X:  @L0  (XH@L0  @L0  XP UPEPPP@ D$("($p`Sލ Ѝ C XH@ꁳ Omѳ C-`Mp"0` 0$` 0 z-pP @T+Ѝ`+PPA 0 b-pʞ0 S + `@`T*x0V*00+T00V:0 (P|P@ (↙ ᢓY 0@P @-DM`@ pP@  :  Ŕ !> U 134  R2$ $@0 DЍUi@i|@-QM@  00 p |20 x2"d%Ѝp@-]M#P'$p PP -R 9000S0S S SS wR0S HipVPS CQRS@ 0`  x@P -$0 Bp 0S$ H⧝ H2hH S%p 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0v H!>50H \0%p[0S 01S dd0Sc0 0 0 00 00 `TRY>S SM  ]ލpRIxW@P= m@9 a3P0 0- H)$P[%0S" HKM P N000Sii@ʝ ٸ@- 00 000 0 +Ѝԝ 2S/2S00/@-@@-V002@-S0@0 @@V0002S  w/ܝ G-PM`p (P府P(@P0 0TT`0"p<00 * "Pp0S p  G$p PU0S p ")@! ( ( -$p | P&$p 7/PP $p l'P Ѝ@ qB@lBpBfB@0G-0M@p`0P U r"0S1P   m P崡 00S V 1!X0 P000UP0 PPP0PU:000000x Ѝ@-  # ЍgB0p@-M2S@P`x (&VP@0  `(#'00ލp@   B@-P`2$MS@p0  0*00%440 0 0p`!$Ѝ@-@! )@(@-@pp @#p`~B 0`( "4`#/p@-@^P T00p``0@D^"000œ\p@Tp0,R00 -\ 0 # R 00O-QRM@@0~01`Q vV00ЍP0p Q :8Q@SI I딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 e'P 0 0B  0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S ؕЍ@-@ 000YP  R ĕ Ѝ@-@\0S \0\0@-@`q0` 0`00@-8@$@D0p@-800P@% >Q" &T⇕0x1 RpR 0S TT0Q  >0S ,p@ y0800kTTA-p`KPT&P@00<000S@ (0? L@0K0cScO-@IMḠȐ`Ap0 4Iߍ0RS* R? )0000K C&PP d0S  FRV ( Q  R L)Qh 0 0000200> 0BS0*  0360s RpS00n T) $0K0p C80$Q 0 DPV VdP h  Q 4(/$ ⾔8p HQ@`$Q DQV R <0S @HT60 <0 坔 @V20HS80 0 t吔@(1S p0 H0S=00(  (100@ S   F P81#<141816%#8100F0p7spVg 5Sp 0 HS+00 %A CO 5V0@B WeV M 5S8Vp0p 50ST 0HSt300r ) 0HSe 700  0 0 "@, 02 S307 ,0 4' Rl Ip0  0HSA20 0 W@(1SgVp 000DKP*0W(1SW(, 030 PV:0BST  ,,S P R:(, "  PV: ART  ,0 00D0C0W00HS9000 0C!4 1ᇓ@ 4S Y 0 HSM00 $A t 40@(1SWEVuW08 2Sk  8 "0R PHt  [:0Q 2 000000  @V5 VpWH h 6SD 0HSr^00 &A * 60@4W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t00000@0 HS3<0 0 "  2V0@ WV}[Q0000 00@0 0P0"9 0H R 0    @~0, $lzcSc257@-P\ R&@P\0S x0x08  Ѝ0PP @0@ vp j%ֹ o8IYA-PR1!@ `l0P pC R0 0R0 06 30 00} P0 0:000s P00;000i P006000JP00ЍP 00000000 0.p00 0"p0 00 C-@PMU"P, 0P`0P001H0i0P0 0 v븀x0`  ($0(10< cV `!P (@B  ) 0ta!P( ``(1  ( Ⱁ0(t!p⪑0+"70 (P  0p  `>```g!P( `(1" (> *>Qߍ 0*P  ꙜÞ 4@-0p0i0 MS$MP`. 1 !p Vp@p0S i Rp ۍ$Ѝi@ 0 Pp F8QQ0500 04pP!P(& #H8}%$o_͞ u@- 0080PP `V@Ѝp0S  @P  00O-IMPpNHLPL `PR Ӑ 0@PIߍO#0,0#600 0400 0 P` p00,0S2 V30a2@0 0!,0 T9:`0 6P ,:a>@PIߍO@":0 P VT` \`00T:D0 ` :Pꍺ؞ C@+6O-P`@pQb帠,`P,2S$PU`,@ ,t#P)m#, Q 0S,9  _# P,`0 ºʺRO-F00! `pP@T:Wp T  X ⢱00U *("0 Bp Ѝ0R0   @90  #p  {9 @ #p3A-RMM00@` PRp0F R㼀 00 ApۍЍx p p @ ఏ99 U#p 00CSS@- 81S Q S0 000 PЍ R 0# DPD30O-S4M@ h@@ `00_0P o0 00 0 pP 3 00 y0 pP3 0 0S0@0`[00T0 @P0i 00 0 `P` 0 $ ( ZXXmpP  ,#$e(b,8_ `P@ [0!P*"0 0EP 0S $)( ,p$ 5(2,8/ P@0Sh0` 0h0  0304Ѝ$ ˎ 0 k  p(,⾎wtp 00 !0 ApPp @ kZj $⦎ ,⢎,0pS P@,0$S  S St0P !R "R hp( $(,8 $P@ҺֺO-PM0@040p0`2` ##pRp#ppW9 pW6l0S~,0S0p㄂,0噇 2S0p80,0噇 847S0pl,0噇 p"R000, 20wS4~47S 7p 0 pߍ00 `2$p $  0 p 00 `2($p o7 0 p $c7 0 p(W7| 0 p#0}0P,04l0<40 zpo#0n@0"04,040 hp`8p`5pg2pn,0 !P ,@ 0,00lS  R, `" pP 00H1,0,0H0 0 p 7Y, 00}R0S 0b00P 0Ip p 0 ,,0 !P !, `"P ,0 0L00p 0 ,p /D\@kpp@-PUp@bn0L0pp@- MP#p 0` 0 0 `@4p@ Ѝp 0 `&p ` 0)`p  ෑ0U 0;100 p@-@pP`8!(0-080000&0S  0R  dp`H Ѝ@@00 p Ѝ@ Ѝ KYO-`@p 0帀SP$H` 000 0 0000 ``0 Р0 `  $6! 0Q0003H081v H ЍO<0 $5 70003@0St3H000s$80405 L$S< 300080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!500 *S:G{k{'{*z8 S zTkg{{'{* z$500 H0S0SU h R 0R<0S 0S11H000s8040 P14 P18 P|10 804 d@ 0R00i8 |00.0 ap ̀h`0 ] P0 x10S00H.2 r P 0dh0 ЍO Ѝ??}dǻϻ I/\0$;A-P@`T 0S0A hp` |  S 0i0P 0S <0S $4   .p0 p pO ppK000 00p0 pH  <00 0$0 F#5 FAd0h0O-0R\MpP@` 0$P X0 #3P 0 RT000 p` hPP. dL0S0 0@S@0#/L0}a?H00P X0 "2P 0 Rzgjzzz{T0md0S  $ P $[ <X x' h2 0`208#<410,00000<00@0,0D00 <$P(P Q48`LPPPTPH0Yp` jpY  YPPP  h\&h0 0108#<48#8 10 E00`<Va@008#<4 01 P00\ 02`Xv &<04S#1S0810 ^ \ЍO<t  7 0S 0@ 4\Ѝ7S zD, 2OCDC .@-`pP@`L0 )h0X $7S R h0@0 < ` R3 0 Ѝ@$0  ,pp@- P@$ 0 00L0p@ /p@-PUp00CSp@0D $3  (R000L0p@/  |L0p@- `P@pg800  B\500L 00<0L008 %p@ 9]/ R0A-@P` hu 0R 00(P3 081HAp` P08!(0 A+P     Ph0h hht 0 d0 Pe0 $}AvؾX  h00h0 C-@p0 PR  R $ RP508Ȁ `]2  i@0S PP  P0  lHN81 R*8fP 0S 07S Ǜ Ǜ Y  S/  !!  Q 0 S:500 0Ep00 0 ,ЍO Y 0 0Cs0'o0S0 S0L0  p    0 0P l0 0SY0A060@ 600 0p0 0  `P  0 S 081ei6@P P0S0 0<S<0P0Ѝ 0    06 0P6SY700S00YV0S9 0Ul00 0P0 RS0t%KSK?305060 qY 8 i&0 5 @0S0 R 3 P   = rZ0S Y Y 0  Br.  Br*L0 - $P$0 0 0 Y & 0 W3 @ $ 0 0P  S 0S0@00 D$0Y<0<0818 ?  ; 0 P0lP4 000а 00 0 0P00 S*P *  p弄 @ 0ЍO600 0<P0( 0S * oP   p卄`81 000 0 0000H ``0\0S   T!0YP 0 8 R 1@ЍO3Y Y' Rr   0 P0Pd0 Yk 0 4-  pЍO!c+GWiu|.n2p d.x/"?A-h0PR@- A0@ 0BS`pbp ň0 Ad$O-` 0 0䘠x1P@pT ЍT 0S R T0S> R* cP   04@O-,M@`P Q0 ,ЍO`F ,mVWP0@SS 0SP0#ttx'xVI:PQUE0VB:  ፃ""448#8S50V2:1 S/ 0 0P!' r0S 0000<`10a  & ! P ,  0Z,Ѝ G 0 B 4ꀟ @-Q` M\@MP  A0p000 p 0S TH ! ۍЍ0 W`V \@T3 $oA- p`@PAlPU, A0D0S0 A\0S0 Aꙟ A-M0M0 ;`pp@P @ p0壇0<000C$00(00$0C,00@pV004p8 \\ U0`$0 0 p ݍ0Ѝꦟ 3  p@-P@{T  (@x1S0pSq  02p 02022p R Rp07@-PX0D @P 0S6 >0P 7P7;00@0S02700000 0#0 Ѝ0@}JYz  P<gjzz+S$0@ Y Ѝ0zD<5p@-@P0 0aUph0Spp@5O-`P@T Q Pd0S  0 0pd0 ЍP0AQ 0S 0P k+  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 b0800<0  P`00 00 /0S $0 pWp:#<0 2 0 0 R0H0@S 00ppW\0H0-Ht   p]00`n,0`( "4`4#S /0 @Rp@-Y00pPQ0`PE `@@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ SoQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScx1G-`@PMT. 0S pW$ P z zPP@0Sh0S d0S4$zd0 0S {PPPЍ|0d 0|00 00md0 00g090 zP] z PU9$0 00 FPP 00A>d8:dX6M yzPP z|0d 0|0XxyU" *8PP  |{ KzP<p{?0S P 8 P  IU` GP < 0$Q S "  Q  zPp h  5< 0   hhpP: t0<0t00 00 80dQYx X yP z  U ypP yȐY $0% h  5< 0   $0<0|ꄒ  *Y1p@-PP1!z p`01S 0S 0S 0S  0 @T 0Q0 PSP 0U d0S0h0d0p@Ŵß }op@-@T PP@0pП G-Pp`P@Ѝ0E @P00 4l@P 00000P00 000( p, 0 ;$00PP(0 8p0S pc0 CP  0@R 0 0000@@ޟ 3z@-@0T PQ8 00*: SR h0S dP H` Ѝ$` dp P (0Q,0Q  п `P  800000( ,0?P0S 0 h dW $0Q 0h0d`0SHrv0S/0S/   O-M8PRH0` 0xP̂00ЍSpP P0 X@ XP R R R0 00Cs z@ЍOP 0S3Y0000000Cs ЍO^4? @PЍOc    p @@0 0&0$   S 30S/G-P@M T 0p `x 00 0@0 0 @_@ЍP/@-@TP@A0S   0:p@-@PPP 1000p| P 00p0000 S0 @00:S 0S @\S000@:S @X,%0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/j% 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO4E`VK `0P0E@ 9 PPw 00pCލ Ѝ@@v;04pW 40p(0= yP  0 `R0 :R`00Fd4@0  0(8804 PF0P {0S 8O p PP ;000P>p 0S#00 0_w8`p@[ + 0P R 00SJ @@ 0P 0S00 `0 SWG @DpW :Sp:SY @\Sp S Spp p00T:C @DP 0SJ G0@P0 0 Y@ S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 @D0J`FP  0S j j 00, @ ` P D,0d  d,0@PEg P0S G$ D0A00T*y PPR 0PX,j%(y@-0  0 Ѝ@-(@ P 90 0X,C-MB0M00pS 0S`! \0S)  R&    RA^0C R[ s0Pv Ps @ 9 Q0P ލЍ os0P P 0@Py90 PP U PtP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  X,%Eep@-@PDp@NA-`= @P@ d# PPd f_ 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ @ 00LT1 0L\0TSpASBC\ XnnTmn|nTmTmTmTmTmTmTmtnTmTmTmnTmn0bC ^ 0 0 00:0 0Pd @0:SS0AR0@A $ P A-p= `P@ d P`FPd0~ 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P ( PX,kG-Q0S ̑`pʯ PV00Ѝ  kP00CS068 Pp0  W00S@( {P   , P P00SW  X  R00S 0σ47,P R   S@T PR   R X,q\,X,@0@-0S yP `PX,`,@-@WP08GX,p@-P@PPpu7PpX,@-@AP M 087S@T X,`,p@-SP@ P@p p@-@P & 087S@T X,`,O-pPW`@P @ ЍZ K P zPT  RT@ Z //////O-@@00S 0P` 4 PU00 Ѝ  jP00CS07 Pp0 0 |  V00Sp \zP    P |P00SVppZppW  P eP00S  P  P | P ` P H P 0 P$} :^jPx`,qS@-04@0P _ P`,kX0@-0S H@ ;000D@FP0DЍP`,P`,@-@`0P0`Sp 0+P PP Ѝ`,@-@P08D`,p@-P@PPp6Pp`,A-P @`pPЍ0 (084SPUP @`,@- 0 00B;P ЍP`,A-P @`pkPЍ0 (084SPUP @`,@- 0 00B;P ЍP`,@    /A-0@@`P@0 $p00D0& SQձ 0@/0PA/A/O-@PD{xpDpG``b0Y:0z  Z # 0@@Dax 0DA\0:Z: [=0 S: p `$ Ѝ `pTd,A-@`Pphv Wbv Q\v KVvA D00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @P_p TT0 p:{@ <0@%$404 4/,00S 0TЍj%j#Td,A-@` 0s P00p0pGWp0PP @P @pT0 @@PP @Td,p@-?@y0, p`000000PP5p0,0a\+0@00`o`Lop A>0t@lTllH0SpW W DvkP P 00PpXA C9R񟗈8XxԆ܅L`Ȇ܆0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0! 0 ;/Qx$0S` 0 R 0  40><LT@C3^A00@C32 \  02` 3 d ! XC2 hhh 00C0'08S 0 0 00?mw`| 6me,`PPDAލ Ѝ, !,x/P 0H0Td,j%t?0(*[ d,d,0H0S/Td,0Pd /Td,A-PDA@M|0`S*0S',0S S f$0P 0P@ @Ѝ 7ĀpW*P 0 000+m0pepx@ ~`0p!X0X 7/0S d0SP 0 P0@ЍAmTd,d,j%j#G-dqP@0L P12C1b05R0 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0RYm00l0S0PS Jm&0S,P N,@GHTd,-!\  0L0#0Td,t0@-M  L0@31 ^AP 0C! 0ЍllTd, @-L 0 0@11D ^Q       Td,A-@@bM0u L0 @2# p PW%cP_  Bc p\  Zv$0 HD@,X#10000 2R01   0 0S0" V00 S l ЍA X 1(4/00~X1威0 sSV Q`ЍQ0S kЍAk`\c  Z~v luk@l_l%0S  Zlv a00@Td, C-`QM0S 00S` L@P: 0s%@Ѝ l널pW   @l &l00|0pS0S %@PpY00pFV@@PP 00T p@)k``pW 0S:S* k k00pppTd,d,O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1&kh L0C R P!050%Pd @T: k  k0 p[L0CY1T*Q@@Td,G-QT0Sj:\0`S& 2 c@Oop @d(0d$00@X1 0S. L  B 0PI %Q * RB  qu0=408@S 1:X 0p@D7C 003 c0< ?o@@Dp@  kP  8kNP `! @?u0 a 2!`!  000p10PTd,j%A-p0@@ `P PP00`Pl P@bj%Q *0S  uTd,$00S:@-@@WTd,@-P`P U(0SP@P )@T \0@T0T 4/$u 00'0S 0, ( @!ЍpTd,j%u*[O-$M@PpD00T0SdS )@TPY P3@H3H 4/MY(0S p0dpY`WT0W @p pp0Yk0 # 30f*[`C`fQl: L7~@PW KL ) D2 10Z 0F30 %0S6*0S  Yt0@P1'0S 0 0@$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@R0 f`[x [`K``fpP @P00p KF K0`F@  L @:i%Q *0S  @Td,j%*[d,@-M@p0aPD(0SWTP )@T: 0@0 4/]0#880 pP0U6@P  s'0S 0 ( @Ѝm@P %Q|0S0S Ps 00Td,j%*[O-@QP$Mp(0S@ P u`(W +0TP\\0T**P* 0`0?o 0c  `o `S, `P T 1q*{nJ'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2Q EZ*0T00S  Ds`P 00P`P0 0#  0|0S0S @ @pg,h`0<0 0 1p`  1h`P% 0   #h%T#2Q JZ*0T00S  DrVvs 00FP )0S 00@,0, 4/M`PTd,*[j%d,=@-@H0'0S 0 00 0T Ѝ@ЍTd,*[G////j%/j%000/%000/%000 /%000/%000/%000/%000/%000 /%000 /%000@/%000/%000 /%Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/@% <0 0CS0 S P*0 /p@-P0`@DoPp@ Tp褡 0A S010//ᤡ 0P/!R/P/P/Qa/P/0000 /%P/ 0S S//@-!@l000/%000/%7@-@PD@P 40R0PPq 0 2 Ѝ0説-}%PQ 0S///k% 03P/t0 ACP 0AB0P CSoPS//O-M@X @ЍOSQ`p rT} 04S`\x<P0@`S@T~L_U!` $l@T`PE`0rCT 04SX:`\V00 pT  QX Q (   TgkP@PZ P   kT0`0S0T?o20S@W-Ѝ @&0R @T`0-@p@`00P  0S S @0V @ X 1k@0@V X*p 00긮 00S00/0c!܄%00S00/P!w%///@-@HQD-P p( % @_}%p0-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A -p00ЍQ@P p@ p@-@P0 `P  \*. Q  Rp R  (  p 0 B %d,qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00p Ѝ0S/1>3 !/0S 000/d,0S*p@- @PH P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!S0`0A-s肟Mp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ0 0 |R 0S |0 3/000Q R R0SQ|P.0 0R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍd,A-PRp `@P 0!+i000A-@Pp`0 SW' WV00S񟗋ꨲ00000@<000000(V VjpGPX1` X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0 SHPp  B0s  B`NpG`FPe`AA-@`P0S0<R"*1 21<0S0 0PPR0S*! !x000S(!!!,p (F0P A, (0 ,P@%%%A-Pp0 R*S\ ]\ t`@BX T cjPgP`*R; :R8 ]R500A  ?f0 ``BxP⠳ 0(SB(0<R$  DP    r P `$0  0$ 峠0S00pp0Q00pS00p00-S]S0pS00p= m R:0pS00p0 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 00p0S ,Z00V0S Z40 "DP   `hFh400!0`Რ40 P0S 00000 P  P (B( [i 0]S S `Q\  (B( 0  EB#ЍO)0@%d,% 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@%%%C-@pPP\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  mHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB It i @ 0 D OX &(  RPSxPA4#X  z 0   0`00020$U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0SP<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S Y^0<0S 00$000*Xe .X< 0ed,)>{^ ]%0@-``P?Q@ $0A  R Sx^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )p V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   0p00030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( =$,Pu 0S 00h2Q 0   0R  0 S`|* ,Ry  2000< V0 R  !   `0 S*}Q00 0RX}QR  Q +S ( 0  BF  B   B0:  B~?S {Sz   B0(  B 0  B  B  B " A 0000S 00000d,%^ ]0S C-`M pQpG apL@P 6W:( ЍPPP P $PPxP @f0 6P uPP  $ ( , 0P4 8 < @ D t00|0 _000G R:0S005000 S3:  H0A 0#@P  00Q p0 P>3S! 1St Sq S <0RQ00p< 0o )  sSW S<0RuQp< 000p000Q S S SS8 S S4 +Sg >SQP>3S S' "S 0SU\ S:?  <0Sg 20@0020 0H  @  H0S  APR, 0E10S*P  B08B0SE0 A1S*, ^ R0C*@ Q U B!U \1L0XR#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUU$pPd,Ee$1p@-@0PS0<Q:1,0 R40S `$0V':8p1PS58 0#p(00<^ 00^ 0S8op 0! R R0 0WP`@%%%0p@-P0@S0<Q*@P80 p<0S P pH0@0@P(00Ppp@@%%%O-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T )P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  +>P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M%O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0( 0 00 002   0 pX = Q  0 R)  R # `ZX !,    R  $  S  R  V  PP$ X$@1`v X PP(@@ xPPP @(r P  @ @$ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _V _XQ ( X ,0 _X @itg v xx ,    R (ZS $X  $ `0 (ZS  P 00004Ѝ0S00 x| @P %O-MP`80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R>sp 0 `800 0@WZR  D>sp 0 I800 0@@ZH  D>3 1> Q p0p-800 0p@$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T xP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  z9P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M%O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  1P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E0 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T ,P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  .2P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M%O--lM%PQ0y @%Qt ppq        Q 0#RS. 0 YT,Q 4^ 80 0S~ <``F`Z01S` 0s vQR\R 0C1!S` `0Q0 Q[ 0000,@4H80<@ y PP  TX0\ L0``V Vd 00 S`FY10`0 0 ,`P XD0S 00D0 ,`PD00D0 0R < 0JS : )1 PZ Z `p6`XD0S[ 40S,0@440S pj, 0@ R0%00D ;0$00D0 ,)P5DQ/*0 F0,0`P& 00D0 ,CP HP 00000D0 ,0H0SPHDgX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XP4P HP PR [S4 0 Y-,Q 4^f 80 0Sb <``F`Z$01S` 0s vQR\R 0C1!S` `0eE@%sP0 Q.0000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S8 00D0 ,`PD00D0 Z ` 0R< 0JS: 0 PZ`XD0Sf 40S,0@440S  p4P MHP IlЍ, 0@ R0%00D ;0$00D0 ,P5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0SPHD^X 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPpS5 0 Y,Q 40 0Ss 80$0So <``F`Z$0 1S`0s vQBo \R $0C1 !S` `0XO0Q000 0,@4H80<@3PP T X 0\ L0`TV 00S`FY100`0 0 ,` P XD0Sa 00D0 ,`PD00D0 0 S` 0P< JP:$0 . $0PZ`XD0SY 40S,0@440S , 0@ R0%00D ;0$00D0 ,BP5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0SPHqDiX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppn plpj-Ѝ///@- // //p@-08P00@S Pp3ZP pd,7@-@0P0S TP Ѝ0P d,@-@P 0S 4N@P/@P 00 0/ / 00 0 0 0/////0P  P@- /e,P P/ /$P0/ 2#0/ 0 S I0 0CR 0%2 L 60 HY0S100u 0 S 0L@!   PT @0CX 0SY 0 0$Ѝ 0 Q 3R0D]T00S SD @ PTP?: = @   x40z0 R03S? $f e Q@-0M(,4`@0  P#USA\ 0 `U-00ĵЍ~ r0\pFW`&SA-M{ {sЍJ@-Q@M0`(,0  P#USA\ 0 `TU-00ĵЍ~ r0\pFW`&SAIG-0M@p`0W PV P%Y P.X PmZ PNx P4 P [:Wf  T: O:V+  H: C:Y  <:t 7:X5Z! L ,:< ':ЍYXZ-  : :  : :~Ѝ 9 9ZVY  PЍG`8c c c b b b b b b (b 8b a b a a G-PQ00RM00p0` 0 b@P @0S nS a0CSsNU2  0oSm MPN ЍMPZ V000U000MP[Z V070U070PMPZ V000U000qMPZV000U000`MPZU000V000zOMPZO V080U080i0@q@:MPZ: 1MP +MP %MP`ZL V080U080?MPo MP MPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lLP TLP la @` ` _ _ _ _ ^ ^ ^ X^ l^ <^ ] ^ \ \ A- `M0 0 !!0@PH@>SHPPP PPP8"`!P`03 pP0  p, 0 `Lp@ Jp@  p@@@d(O 0PIL!OPO 0POP`ЍO00@lŸO-1MM   @PD08 "( p C. `\pY@D;8 (@.0Sm pȱȑp  ` ᰱ00 $ %0!`t0p@ !0/ 0SP 0S RN001ݍЍN0S 0K0S R Pp 08D<4! @ P0 00Z  0'0h,R @1ݍЍp[ T[ FtH[ Z Z xZ gt0@-M0P  Pp 0p@ PS Ѝ00 0JЍ0@Ѝ0A-@@0s. PP0P 0_p` s``)00`&NppX`p N``00`N 00<4p@-@PCM0 /;P2 ,pPA ` @M00t2 7{C>@ F0 P4D@ F{@?0S VS00 SCލp@@0S@h0h 0P@0 l P@1:M?00@M00@2V V p@-MQMP4@SX TD /7;PA QP0s* JPQaP` 0pG @ 0@Cqp> D Dp7 ۍЍp,0s i/S10p +CP@0 P@0  P@1:PM?00 p 04DM0#S @>M@;M@-p@ 3M00T2@:2:1 %@p981T T @-rP`O-$(X,P0p-S`@/U'W1 ? GZ0 0GP : [#P?5# yq 24x2 zPWi@rUZ0[% 0@-DM@ P, Pnm~^w_(iTTx oT0dYP`Li0PPA)* 3!R ^!,! RX \`T0R@p 8T 0VP T ` 1<`S> \ Ѝ(00(0000,00,0`@PT01C`/ADP`@T0  T   0`0#[ )[U Pǟ ,!\ \Z ^X S:pU T0`@P0T0701 <` 60PP`@0,^0 <P0  0=R  @%0Dh0`@< D {{APP$0S`@"Dx`@ D  ,\VPfS `@0 S  \Q0s<D 8`0d Y`@0 00000Q0`@00L(0`@0(0,00,0D(00(0?$0S`@"x6`@0002`@P0L dS0 D`0D0Dd D 000#$0`@0$0 0`@0 0 `@(0$ S r <\m=Qh$\NPHL X@0 0D0h`@0 ST<\O{H@^{L@0D h`@P0= 0LS0$%h`@d @$0P x0v> 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#$0S`@P" R"  " R,"2!x"~$0S"x`@s`@00m`@ 2 0 Q00$:($^0<P0( 0=R%0(h00c @DHL0 0$B 0$t!#:6 00 0.$0Ϡ.>L!! 0!!!0C 0"  R Ό ( "!P$?#"0/  "1? A ,  , 00S($  0P 004 `@00vvqvutttsܒrl""""'.%Q(\)\²( `@R 0S $0S \0S0Y :6l 46 0! 0Ϡ!>! 0# 1110N 0P 00( # 0,$0(0.,, (?"\ , 0\0#0  "$0Ϣ 0, 0<(0,08C.: 6 460!$,$0,΃1,#!1110L0^( .$0"! ( 0." ?"!00 (  "͌0 ( 0, $ 0^ T P00t"000AA0`@00=`@2 0 Q00:P0 0<R$0h00c 0 0$A 0$$##:6 00 0.$0Ϡ.>L#! 0!!!0C 0"  R Ό ( "#P$?#"0/  "1? A ,  , 00S($  P0#`@  0 P09*^3*{ r0s{P T80<`@ 0dR#  \ Q $ Q $ &PT8<`@  \0000 Q00SPT8< `@D !{`@ 0 D!t`@ 0 !m0S(0S `@50 Q00:c 0$ @ 0$8&#:6 00 0.$0Ϡ.>`&! 0!!!0C 0"  R Ό " !( &P$?#"0/  "1? A ,  , 00S$ (  R0#00 `@0D0`@0  0C0n0 @00 0Se 0 h00$%`@ h$ 0$% 0S 000000$0`@2p rp t t `@  P0P06  0# D%`@D000 P 0S  %`@D000 P 0S!D% &`@000 P 0S D%P R  \Q%8< &z 0 R#P dP(  01) :60 0!$Ϡ0! !>*0!!!0C 0P88*! /.P P$ ΁!$?   "AL00 h00H%- 0C00000S P0 0  B 0@0\L$   C00 00Su ^ 0 0  0   N+ R" _ZO-Mp@$DXl`00D0W0 T/ 0 2c1  ?80PP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T (;0d0P] 0TPP dPN$`P0Sʼ Rʨ  Rʰ  R 0 0` 0S0`@dp?O$@T'pET0}Np0`@dp00&D0 @Dv^D PE  0H000Q0SX0 0d0800QpHP 00| 4 JPQhltxPWx@RSY  Y  d@px Ut Zp 0Sl0Xh0[d0 Rwt [%[8P0>C 0C 0p00@t0p` VP x0S Cpt0 0000@4p d00Pg x8( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?4v.C BAQSx  \tp PpQC 0 qp 0rqp?C0S@T`p VPy 0R?o20S-C00ߍ 0$Cd@0 qp@pK Q#! !pY@#NRp \TPd0 P0,P`000 `0  ZR 0`S 00@ B 0d@  ͲB0S 0V0ZS0 dd` ᱲ PTd⩲ 8<d⡲ @Dd♲ HLd⑲$`X\FZP ?`p@B0SB H2ß̓"bY2+:##c2S% P#q8PP 0d#0dT0>H30@p9eB00Pd000@p `P ?/( R ß&0Q| 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0'qp: @p(p#CA#00A0S@@㴰p d @p괰[0"c01 2c1@T 0A0 Q  s!P AT00A0S10(` #ΌQA00@pvAT00]AT00d|Xlt{)\P(\ ףvɻ %I$@-@T pHEBTpat X00 R 0 R 0Q/  /  ( (  DQ p@-0l` SPPH 0@#  T\  Q p/, ,( ( H  Q j.0 0#  Q/00Ɠ\ 0@-o>lP 0@" \ 0 /8A-@P `p@P@0% `P PPA-`X@@P pjNP@0& FP PP8A-`X@@DP pH@P@0& +P PPO-` M IpP8 찟` nPP P @@ & P P0S  Ѝz P W <; $0p0SD A-PpQ `@Q P 0@DDB(000S  m ^@- Mp``PP( 0@  00S@ %@0"S" 0`000S0 6/ Ѝ@0"S1Ds\0`T000S @ Ѝ1Ds$ ( pj,4. 8- @-@ @O-`P MU PP2SpPK }P@N P K <10`0G@P6 0nS# =M-PP00Q Q (P ^  0\  KB" 0 0Q@00oS@d000S p Ѝ4   [O-BMM@pm?D 0 0xFP:,PP  lFPo00%:P C @P@`K0 PPp 0P0  0PPp `@P" L 0dQ PkPUP p` 0s| 0 P<P @PP0 PpS Q P > 00BލЍP/U ` P p@>0SQ  5PBލЍ  50H00 PPRp=  '> P00 04d! 0 M0 0>@ 00 04>0 ! 4fL00&|> 00 04P}p>  P00 04qd>` 00 04Pf+ + Zg g zd@\* ) X) ) ( ( ( ' ' ' - M 0  PЍ- M> 0  PЍ- M? 0  PЍ8-0M  0;?PЍ& --:( 0P    0/ 00p@-P)4U@p=,0,0? `0  6/p0& p@-P&U@p=,0,0? `0  6/p% @-a@P 0003/|% @-4@P 0003/<|% p@-PTU?o20S@ 0 00 3/p@% A-P`^UV00P00S@$0$0p0 7/|$ p@-PU?o20S@ 0 00 3/p $ p@-`P5@PpH=( ( 0 @p@/$ p@-P@P p 0 00 3/p\$ -@- M  Bbp@(0(003/ Ѝ@ Ѝ/($ @-/bp@0003/# O-$Mؤ @00`P .0Sp$Ѝ<<0` (P@6/$ЍPH# O-$Mؤ @00`P 0Sp$Ѝ<<0` (P@6/$Ѝ" !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////" l" P# " (# L" " " " " " " " x" d" T" <" " " ! ! ! ! ! ! ! x! d! T! D! 0! ! ! ! Z $0(- C^ 0CQ$ :$0S 537$05 0$0(0, 0 0#  $0 0@-@$ MP05505#0%A0!0%mP$00$0Ѝ0 $0R  S 5,3,07$050$0/S 5<37$05 0$00 /0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-DM@YP@f P, p@-; U a@U UP UK l;,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R0#0C R00CT,@DЍF, 0R0537, 5 05 R, S #0C 0S 0C 0S 0C5$0P$ 0@YC @0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S 5>37,050,0@q`@T  p FT")TW*0DSSQPONMLKJIHGFEDCA@>=<;:987bT5?Q10S. 031 a< A0100`w  0 00P, \0Ç0,0,0P ` YfT ?R0@SQ p9 b@S B77r # C  0c1#0p0FT 0, 00 R Q05 705,5 0,0 5RQ05= 3 7,5 0,N{ `f 1$01$0```0VS@TE-0Z0 Q W Q=T, R05@7, 505 ,   R,0 Q ,0 0,0 R :` Zo 0Sl `R` 0Pa $`  ?RX0@SUp9 b B77rb00 `F00b%#jo%#jx%ju-M{00{Ѝp@-MP`@0 0/ 4/ЍpG-PRM[  `Tp|PCa@/'P @1< 000pp. Ѝ80S&  1 00< 0 pp]90S0< 000@ ppL90Sx D90S X 0 < @49000900 O  4   X (@- @MЍ0NO-EM M`X@Pp+`EL/ G0P@'T 0 G@0PT| 0 0EAP " "UEލ Ѝ800800 0 @-`@M pP5P% /F RP$  rR$   0@ P@V rR  Ph 0 @IЍ0 Ѝ@0rS 8 0  X 1 A-` @cp 0P/S /_FP @0 Sp 0 S  Q3p@-IMM@`PP ᚿp 0: S X0 0vp IލЍpA8O00@IލЍp9800 p@-IMM@`PP op 0: S X0 0Kp IލЍp8O00@IލЍp800J - M 0  PЍ0P 8 Q  8 //p@-@P PP` # PP u 'P  p@x*PPp-40- M,0   ЍЍ/HHP --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/(HH0-@- M@NP  Ѝ@Ѝ/O-`Pq,Mp;  PR$ Ppp @P$_PX P@ 0 @XP kN ,Ѝ000:Q!0P00,ЍGXp@-(M @P`Y& (Ѝp0 0 F͌(Z ^P>F͌(Y MPtt>C͌ X <Ph0>JB͌8W +P\=̌1S PO=^B͌`x= 0@ S708T 0H0P, `P P  P P P P` P< PP( QP PP (P Ppx PqP'( Q78 x00CS40000C,0DPPh0 0HLpP(T p( a0P^ , `  `Y i V2 q @0T0 @?T, 0Y  p @daZh@0p@ ѼpP'  W  V 0`1A1S ,0 00@!1S 0D 0| 0?piߍ00,,00PL!!\Z, @  B  $ P8<@ Z& 00A 00@S= 00  1  pW  Pp弾W ,PZ00 0 p,0匰0[$0 1p0@ @pIP  X 0@0@S 8<@PP(04 0R(0Lp DPH1H0኿0P@@X$@L僿0P0 001P0|,`0P000FX0Ts0P00m80PHp( `+a( +l( +x ( + (  +( J+( +( ^+,  ,  00P@ap 00P !AH01 `0V0!P0 @`婼V0,@ `7X4$0Q1B/0( `Pp3`P V  P p (` 0,0SU,0 00C 00,p ` W# 0 C 0`S: Q P01! @TQ @JT0,   @0,, Q 0@@1.p`Pp`$׹PP- U  p`$p ` 0SA 04 ,01 Y 0i1 0 S1 1QL ! @0T0p0 @T0 ,00 P @T! 0R1V@`㏹@0P T  0`,0 SY,0 00C00, @ [# 0 0 B0!0@SC 0a0T !1 P Ua P宻U0,000 P0|,0Q0P0P1}`@=`0P T  0 @\4 0 0R080000SyO-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @7Yߍ 000Sk HP0Sv p`0S @0S p0 S 耍 0 S  10S N #X0 D@-<@M $( ,ЍpH0 D@-<@M $( ,Ѝ H\0\ 0 R/D@Q 0Q(00?H/H$P0P0/ D <  R ,  R$ 00?H/@$0P07 A-D   R'P?UH0@aaS,p10 0D   C(  \@U`@U(  R 00/$0 0 Hl P  `0H?30\ -@@  D\,00D//$O-PL4M  0pS4Ѝ帺PD H0 L ! 0 0|!02:|@奺P` 0`D0ZP`@P0Z0 T+P V@`|@`J:L ?3Q 4Q< D pH0L  00|"(099`P0S R,@PR @0P  : R0`S4ЍT `@004  0ж`Pu @|`$0 0 ]H`0` 0p@- PU 0@S PHgppHp@-@P 0PS P1Ppp0P0% H -? \| 0DR0  0R0 S000 0\$( /$0 0 H 0 0 /O-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n =1Q0'0 0 0 0 rЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 l@40(HC-pP☂M@ 㲶`P {p2@0@Z- @022BBB {`@2C{@@ÅCCnPU C7 pP pK 0p R\ @B0 @@@(P9 0 @@@(P. Sp* #p& p0 @m(P  'h000S :3S ЍP [B2T@ T\Z`Ѝh0S,4pPa4 A-Z`pPp ][Bh2S@ T1++)000 R A! A @@-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0Dl00TЍ!fԦ@0l 0 S/4O-`Dt@M[p+5(($ X0CS0S4޷3 P*40H @08p{8 t%p{ġ\T(ÂLLßDDßP<<ß44ßx,,ß ߂ß@ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ d2 0 0CLr'>ppGl`( @# T (0Ѝ>`@ <Z ^WvT#Qx:N'K#H #EH#Bp-?-<`_9|6o3p0r-y*z'{$@|!h}`a p p%X+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxzH@Тp@-'^(@@k( @#T(PppO-Mܶ6 `0&Jҭp6划006 0 000SVF 9 p 5p PP[ _ p?P4S S S|V0SpPn 0@l   $ `00 4S  00 40 s 00bR$ 4S4 0%00PЍp PP 4P40 s 00bR4 44000P ?21 R R0 ; 0, $Q B q 0 ;0 pP.4 S S040S$ 4 0r0  cR0$0`S 404#` pse0 ;0  p PP4P0u0PPcRT T4S{0z$0P s 00bRS4 000V0ScpP 0@  ^ $@ `00 4S 2 0 zS 202#`B pm p 0$ $P0 s 00bR40 ;0 ㉴p@ P< pg 40 s 00bR4 4$RP2$0$ r0 0C aR?o$2&100 ?c p) p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q0   4 00 40 s 00bR 440`00\0\0! 0-㫲P дQ ,Aܯ,h 80p@-P@ 0 P& TT TpO-@Pd4`DM0+ 8 p$Qi w :Q|#R3Z 300S 8 p pP <0S p 0S 2UY R 0CQQ00AQ0S  B=!ZR 0*"R S 0`"0U( DЍAPAPQ P80:Q !1 0!0:, DЍ!  |P p0 `0 @ 0hZ  6 8s `+2 B#3!0 00S P0 @ D! >PK0@ Z%0S0:3S `00X008! *0`00 <00 @A40 0 pHp@-@PI<ppp@@0@0p@- P@ 7<ppp@$HA-PȯP @pT $T`0 @@TPp00<V>P@P@P@X@-@$"P @"P P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"h P O-P0,fS`MpvpJP U0 pr(ʍ"(0I"Rp 3S(0$00 0`PK PTVP G XRX5$P50 2T P850 0504S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P uP %"oL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D $l h $ <% p 0$0(0lX !P Y  !P Z !Pp2?;~0p220P_0 r("(0I"Rp7XD  PZ2Zx2X  Px2?;~0x2V  Px278x2Y  P<2|2Z  P|2?;~0|2V  P|278|2v1S05 4S1zL%R.pZVY  PTx2!78x2|"ZYZT!T1tx"|2OZV*  ~ P%x278x21|29p2Z y(Ѝp0@-,M @P2 m,Ѝ0- M0  Ѝl0l 0-M  Q , 0 00  ЍЍpH000@- @MP 4p 0T 0 , 0 0 0 PzЍ0H0@-M@P4p 0T 0 , 0 0 0 P]Ѝ0-0M P 0 ,0 000  HЍЍ000 00:3S /0O-J3\p04P  M2pa`P 0p PDo6τd3 p  "  _ͭ  dlm bF?Yn 㸲 `00s  bP` Ѝ,0 #$ 00 0 Ѝ$p@-D@D0@Ppp,0 $0l0m pp@-@0@P:#R|  l ^- # 0p MP`pO:p8@lp@-@0@P :QthQp- p # P`p" :@lp@-@0@P:#R| Ó \ "R-- , p #P`p:p@p@-0@DPSP @p (0008 <@%8 pp$HL0L 0@-@0:#R#R"#0:d0d 0@-@ :Q Q- :t0 0@-@ :QQ σ  #p P :0 0@-@ :QQ σ  #p XPZ :\0 0p@-@P :QQ  Ãp #)Pp+ :ep0 0@-@ :QQ σ  #p P` :Qp@-@0@P:#R   Pp @8 “%\8 --  p #P`p:pp8 :P@H@-<@<0@00:3S 0 0 d @-8@80@00:3S00 0 0@-@:#R&#R) -̌@́ $p $" "#aP`c:#Rp@-@0@P:#R(#R+ -́ " "  $  $ d p  #$P`p&:#Rplp@-PPP/ 0@` :QQ" “Tƒlp lp  #P`p :Qppl0 0 H0 0 H@-@ MZh qQp* c0 K0 `0000Z5 0000R508003 Ѝ 0< B503 ЍL L0 0`0` Vj#c¤P`@4 0 000:P/x 0 0@-00UHX0X 00:3S 0 p @-M P`/\0\ 00 :3S 0- p @-6P`/$0$ 000:#Rs/D$0$ 000:#Ru/000 0  :#Rs30/(0( 0 :#Ru30/ 0 0 0:/dp@-@P0P`M00 p p 0S|000 SC q R0 :#Ѝp R 40,00 3/Ѝp,ht@d{4A-MRBP0@Sy R `P 0Sd 1P 00p }pQ 10Q61 1`p0V0S  100V0S  034p g  03, p at/,%ЍP  QÁP 0: 0 x   000 000 0@,00}z@zht@4H<@-,@@0S00xx@-$@@0S008x@-MT@@ 0S Ѝ< 000 000 0Ѝx@-Md@@ 0SЍ z 0R  (00 Ѝ l wTw@-$MHBH2@PQ :cVW0r3p p 0Scqp 0SQ1p0SB 0 00 BM*1`00|PN 1@ 300 R 8 D y30 0Xs30 0 :3,p 4 aP`$Ѝ0`00|P @  0R` 00 `D00T @8 4300 vvp4u({pC- M @P {cS X`YwD0`00:3S Q I Ѝp  0 000:3S/0 S;,0 0D | 0 00P0q}pI PX 00C [0HSP 1&TX[00CS``[TY0IS`YPY0 0CP1YT0 0 ԇHp@-@Pp`P0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0S 1H`?c`` AD Ap0@!qW#갑@W0 8 0| 0p@ P@ 0@00C _x0 00DHT0 ?o2R0S P 01  //11-(^0,R0^Q!R@O-M A ! 1@ 0Q3, @ P `p0S! S#A 00 0C ```P  (0R0 (000C0T0 02/p 0PS@(  Ѝ1T04 0(0A-S$p`4@P(0PS@Q Qa ppQ p 0p(0p(0S/p@-`@0P8 (0@SpP0@-0^ 0 @ Q@R0.O-@ M`P VTppC0S  00C(00@00 T0@ 0 S `%, 0 S@p @ RᴀD`pD勓 `|p Ѝ@0 S RR Ѝ,P d,00P `00V  ppG , B,(pqqA0 ` T` 0Dp4ȑP ,00 G@p`4 0Tp `0Du@U   PB   0SQ 0 0PC $ 00\R =@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP ~H4@ PQ0 /$ $\/ P/|A-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ETpL @10 0 QTD$ 0R U EBp:   0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q{H4A-PQÈ`0`pP0*@$ P rH00@T 0UyP- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 BS0@( p`0,,0 0CA1!0 0g`@0S( X0@-J8  PE? 0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 O-RQ M40|`pẍ@Pu 0ሰ(᲍P,m ̎PP0` X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 ,!8 \0`0d0h0l0p0 Ѝ㜎P4. uP( :"R! 0 R80SJ 0  V 0P 0PʬR Ѝ ៏ᝏ ᛏᙏ@ᕏ A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,CPP  D0HRD0000H p0$`!bP@0SЍPЍ|s@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED   0  PI 㑏L1D00S*Y p$`(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @q$400@-@PM0 pp  00C  ?o2 0 mPP <Ѝ0PЍ0oHH@- @  0M 0LЍ0o-QPDM00  ( 0@4ЍnP8 /0@-0CM 00 @0C0 0 0D NЍO-QP( P0@{0, 0!0 8C8PT) H00E  @HDHT,0Q0 00SH00S^   R ,  H D S400,01$00Q$0 0P 00AQ 0$, S00,0,1$0000 S 40pLH0@0D00|00ip 0SL01H@400 0,0000,00 0Yk0Y 00 0S` S0F 0R^4000,00 1 1 01IY0CQڸ</o"L\ Rm Y@L0l00P5P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Yp# 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SA 80 T8( 0`V 00P0 0CS 80 @@ NN Œ Č Ȍ N LL80\ɟ`Vpl88( 00S=0X *1h"0( 480 04 ` 0``0, W Pp!q@00S{000 @0#pc 111qW`P7P'PP0 M<00 00S 0X *1h"0f40V @ 60S N6( 0p}Q;0A0 0C00ꄆ 10 0 S( PP 1 11RY@ RRQ 0   W %( R R !%`FPA p0p`P@ !?3 pGWaFeP `/0 < p  L  aP 0P0P00 PP0~P0D0T H00S {080  400 iH (04 0 p`\Ѝ8 L0j bT<00D RY 0 R PP!Y n [R  g[ $R\   0E0 0pT  0E  <000$R ( 3@ H000S2( 0<000h0S0F  0 0~Px 4000Vk0 0C B 040H00 R d1S\Ѝ4 0080@080.P00C\H00^<0SC Q\1( 0, QA@`04`! ,\@XP ppX@P EP0@, Q J   4p@,@ APWp@PT ``W4$4 $H< t<Pp`TPp P0`, @AVPUDE q@DP P! R @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P0 p WPn $ Q  $P,@08 p P LPA\H0000`, Iy$ @A`0,  \- `@0040 0  0{8 0!00@ 0C40a0 pWPx p p P,  BQ 0`  W G 4 DP  LPp 40P pL0Y0I D| p~0TpP:W WP@ o@DT GpGGD@a00: 40R0pp,@0A0,00W0C00P p p000E,0 PU U Ra0 R  W R RR.0 S0@^ 0 RAA$8 LD@H ,@X LD 0B0 B$8 B!! 00Cx 0U40P0 P,0a0 0R0h400,@P d1S ( ,7@ < <000!R 7Q R dP  !@ ``E 0E00p~ 0E  <000P' 88(  <0 00?0,0 0000Ss 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  P9( @` 0  `f@ k0 `C`0  <000tW ( U0 U<`? 0 0LEP6Pj <00p 6U \ʕeH5Sp@TL 0$`P@@U= 88PP `$= 'tƒ /A\  B\  ^tƒ    /T01P0A 00` P;ʀ:l2 S3030 /@P%0000CS 00000000000000000/@-P@M@&\\ Y #3t P P 00 1000 0 [Ѝp`P -P\P Y # /0 0 |  0S h h0 8=0!H00 R/@- p0x881 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R! AR  ĵ00 000:h/\p@-P@0@`M0*l"R R`   P H000 40@ 0 @ &Ѝp,p|02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20 L100 70剑Q:20t1=00Q!0S0`20l000 0剑Q:20h000 0`0`Y0!Q 00`M0!Q tp0 0 0/8|0| 0p@- @00CS0 S 0 S P00mp[xP00p@-0CS@0 S 0 S P00Op=xP0000 0p@-00Pv@;pp@-Pv@1p 0 00S  @-@J Q P\,Q    @/ H0P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Q0p3O-0PP`$MCp@ V v0P   BR.)*)0002T0 S80  22 0@  B@DT p`$ЍIɟ, A A!RA @\e(p WH qH PYW:(PpG TPE0P ?[1 p"`Pp rPP*  U   "0S(@0 TDIPD@ 0(0C\00C tGe$Ѝ8}q X@ @  D0|0lp H0001@D T `V `tV ``  @| 0 0 $Hp@-@Pppp@@0@0p@- P@ ppp@H(6O-0dM@P$0[ Qv pu`PtR P(r0P 0L W00P  040R0000P0@SD9H-@?`0XPP000PEPUG0000PS0401 000 `Pp @R?+40T R80 # 4000C?002uP`F-uHP` &u$ D400pP pG0`000 `p00PP Y0 00 0E4,Q,pQpP Qձpp( X4 R!! B qH" RU`pG UH04 S0 0  4 `P,8p04,0@,@0 p<8IPU0 4Q0 0C0 Sa 0( 0C0, Q00PSj 0007 t1 P  $ 000 0 000K0p00_000C?00jt 0pGPSH`FO_t0Ip0PE!q Xy0 0H000ᰡH XD0|0p/sdЍ004 p` 040T pR0`40  P0K PskdЍ` s0 0 hPHp@-@`Ppp p@Z X0 0 PHp@-@Ppp p@CHp@-P@0 0@`  pp p@/HD0D0p@- P@ pp p@@H0p@-0P `@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``O-S葟M D@HP 0W p @` 0Z  D 4/ 0[ ; $[0<ST10000#10#.Q00S0>0P 0@0 0z00 0HP8  #8 S R0 0?P4/ZWЍ0H\8  #8 S R@0刀0ݪpP4/pWX Q" @-@M  R ! R "R pP^ 0 0 @\Ѝ /@-0QM   S S PpP$8R@ @ 2Ѝ88- M 0 Ѝ D0D0 - 0 $M  ЍȲP p@-B\\@0O ^\1  @ % a ,\'\ n{ \"LB!!A0 ,"!! L0 }p % !    >{ \PUC 0 ER:d!@`P    P0 B! {c\ "0  \\:\ '  px @ l %L  + {l {eQO-M  SnPP 0 &  0 S  n u@`\,S 0 @ 0 S -  QS%S+0L GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 S$p  00PЍ %0i\@0 `f` 00#1.Q0*Q 0S m@0 SP0% p  0  @0d\% 00 @ d @ 0 SP0%  p  0   0 @@%  c  0 SP 0% p    0  G0%  + @  @ c  @0 S}0  q0 @0  00 Sj0 _0 @0  0TY 0@x0 0 I0  @0  0 00 0 <5000D@0 @( 00T0 S\R [# J00 S $0<  p/ 0> 0S0\S 0 S0 000 P  p@-@P0P`M0S PS   00 0Ph 0 Q00QH  < x0  Ѝp 0A-M0PSL!00@0@P0S? `0 6 0Ã!1!1"b2c@AL0L  00210Bq0P pW$P@WP 0fSPЍЍ 0ЍH NgA-M0PSL!00@0@p0S> `+0  0à ‚ @0!0A1 0120BQx0P pW$P@TP 0nSePЍЍ"0Ѝ8 kL>C-M0S!0 0@0`0S2 P0 py p\1G $@0!b!bpG4p r1c1c@0 0#3c`10BqP pЍ0< qW X $`0sSP p`XWT 0S oPptPPЍT -?L*S0 O-TMa뀀lKkpPQ ,$  90: 0 @P5 5 e000`P 0: @P} 0S  R 0[ @ #[ =[ =Pb 0000PX  Y[   RRolpP W,0 0  P5o[ 0o0S` P@ 0 ᤓ  3$ 112cAt3L112c B L00)ɒ! C 0;뉑0P0 P0 0$0 B `@H, p@X 0Sp np= @P0P nXPp00TЍ l  0 ((  9  $ 0ƒ00@ B0! 0)⩑ቒ C뉑PQ 00 @> ` 0 〱   l1$N I$04‚!bƒ1c!b1c N0I 00  ࢐9)1i1c1B 뉑P 0tS0cS0S㴠 0 @00 Z@PV  < 0S pp Jl` gݵNT >kL -?L*S$ A-p@`0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV`1D !00O-pQ┮qM  PP, 00S0405 `$  l@H 0S1  RS Gs@T l P  4 @@pT %T@%T400 R,:PjP 400P,H=% , 00,P0 0͟0p0 :T T) `DV%?#"< / XT c`D`Vfz t``` 0`D@lQ0-0 >T0p  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbevV.`^`0^@ C @0! D 02\* R:0Z'TOP͍ ͍R'RT0   R'R'R@@ppI@[phP 00040ghP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 340`0 R,[*P  0jp 40P040`OU:= !1`010@0O1S  0C-11@ST 400 Q,#*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RK  pR 0%R 0@a0D RA0DS 13 DOS !01000@Sl00l0 0St00t0QU PE@=1QP eOU4=!1010@0@10D R-1!TORP=1=1 @pT!1S 0C110 S@Ra  ?R ;R QeR  pRS 0%R 0 00000 0 B10 OQi͍ 0 0}RR0  R}R}R@@ps!R =1X@ BT! 400 Q!`Q,*P  0ip 40040@N, 40,qߍ! 1K00@QU PE=1@1@QOU=0@-01P @Q %-1 1OS00PhP 400P,V 2gP 400,`V i``&``VP``P``Ì`@oobP``V ፡`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2 gPQ 400 ,R@p\00@W 0 oR00 @K00P ' V8`>00;&@D0Q0VT&$#"y p ]K5#0@0D!@D0OoB000@00- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/`vA-pQM@P 0S! XB nfP `V! 0v0* V U~ ``ЍnpP0U0f ``U 㔧. 0 0 R U ᆧUlP0S U8 q( ap 0S R 8(C8B((0 000SU00P  J  8C8(0 P I  8C80T4U@.4*h $ , ht@t T ( 4 0R@- ME0S@  ЍA-pPP U) @T`V 0PS |V@P0DV  fP ^oO-PRM `Q 00Ѝ@ pPb % BPb <Pc P%60 ES  eP  ]P  W0P P PO0 S  P  `D0 S  `  90Sn  20`S  *0PS  "`V$ `P Ff$`% eP !ePdP  뼰 0$[PP " [ `$@  (B8BBXnS0 sS fSU0/oS" R0000P0`h&h V 0@:  0S  C("(  ` P0  P W0U PpU 00d P`Vl 챟Q`Fh&hVPb   0 SPW   pP`U= op嫲 g `PEX%X U !   YX p *` M p0 00 C PR0W00Pi0X0  2 0P/W  R000WRe  dP$+ P0(C-@a!`MPp 0e P 000S? PЍ`P  P0 &p  R 0S 0PPP  PP004P`Ѝ  0 P  @``+ P*`Pā ԀpO-M M0p0:S&0:SS@ 0PS:S``E[ P!* ;0d@0  jP 0P:S ۍ Ѝ@ۍ ЍC-PŸM Mp@`tpP# 0/SB P/xcP 0 ۍЍCW0P ! p dP+phG0P 0S/S pP UdX vMdY WP ;0 ۍЍC0 PۍЍ  p 0l$d XW P0P 0 $ۍЍ404 0 $ ̑ \ @}L } G-p`@P  _PcU  VP `P@PP @T P  0@010GꔱP-@- M@00 Ѝ@ Ѝ/. Ѝ@ Ѝ/@-@ccc@cc c0c@c 0p@-S@M 0q  Ѝp0`P0 0d 0 0\` U0 Ѝp 0p@-PS@:pS bP!paC- M `@V pᬐP0fU@@`V  ' W0 nU sU  `V  @0*00 Ѝ R@@@C- M PU# Ѐp`fRPU @ H0P 0 @nR sR PU 0 Ѝ 0S008#8 ЍPA-P# P 00`p`0,SS00 0\,\@C`P   `p`@  C-p M@`P(P>qpWX*nUO sUF fUH0D Y)RA @ aPK H0D@ pkH0@0 H0cH0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D 80400 ` 0S00 80 @H0R# ,0 0H00H0H0@ HH0@ 400 H0@04 H00H04 0H040, R0 0H00H0tz  ԉ 0O-M@0[ ` Z p p(080H0_P0; P0  `00 ` ἀ[`   ` `pZ `   ` ` 0@ 0@Ѝ0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\ A-`P0PUM@p"S& `P !P  ᴀ+0V00  p   00 0ЍPЍ^ p  O-P@ 04M 00P "a`Y`4  p2` 0P 0 a`|  @P @`0P ` 4Ѝ  0 ` `,0Y (0 0$0,0% P@ `,, `AR   0S00WPv Y  Tr  `" `Lp W@`H @ D L F , `$fV8   0 P+ pW9  `BHDhDnVDH sV  Q"0 S  E ,@  `b` 4Ѝ 0 B `$R`$aB]B@S ā A-P`0`VM@p(S, U_P$ A`  㶀000 P00 0 0 0 0ЍPЍ]0@-P pW M@`R _P 0 ` 00P 00 0 ЍP Ѝ]O-TMD0 (0D0,$0:080`P ||@P00APP 00vzP|T oPkd:P{Pt^P|  P" U $0 T $0(,P `= $010#0`,00 0xGxwP 0s 0PI (,P 0S , .S  ROS1 = @P# PPD @ HDHt 0n P L(BL00S P PJ$0 F0 0S t 0 0E0TS$0 P0S000040'X0\ 0S# ` @0@SR xGxwP00$000 000 f0:PV 0 `@Z 0 Z` 0 Pg  (\Z  RYX%Q^ZQi @T 0&0FS Aw  0P 0 `I0J0 SE0J/SVTSRQPONMLKJIHGFEDCBA@?>=<;:76{3210/k-i+*)tyu0Z@ Z8 50 00@ 00@0t58 0000  0P` P`00{] 64 $ 0P0@f P <P" 0$00 000000 s0lPi -^ o TЍ  00P0` 0 0  0  0  0  0 04 $ 02 0?T 0 #t  0 S00|Ps `

$0P00?//8 @-M@;0 0C@N $@L0B!b!bN?AA4 1c1cL0P0@$D$C!d!bA@C1{PЍ-?L *S\ p@-0MP0`2@P 0Ѝp], 0 0S Q20Ѝp@ 1!0G-@a0PP04 0 4pS 0p02,0:PP0  |Qp`  'WPepEȄQ  W| 0 ȇ0H00pa(a@-@P [[[ [$[,[[,00!R  !` 001/_001P//_ @--@ \@\ @ 00s@ H PJI HH @tp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (ЍpP P # 0U 0 f {Ukkag!00 P ~P T# 0U0  0"{P  0cP0J30{U 0kk iP  0cP0G20U 05{kF{{TPn  0cP0t20U 0x 0"BP;  0cP0x0 0U " 0P;  0cP0|10mU 0 !a1""UJP.  p0cP0%ʘ 0U " R b0cP0$d10U 0T1""P  P0cP0$10U 0 1""P  >0cP0@00U 010""P>  ,0cP0@ʜ00U 0 0"P  G??htl Xl (l k @k j j GTj j i pi Di i 0cP000{ 0kF{U{# P  0cP0uʠ30{U 0kk Pb  0cP0\30{U 0kk3 mP  0cP0n30U 0_3""[PF  0cP0L20U 0=2""IPO  0cP0ʔ20U 0x2""7P  0cP0EP20U 06`2""%P5  |0cP0 20x{U 0{ P  k0cP010g{U 0{ PD  Z0cP0ʌ10U 0`1""P  H0cP0H10uU 0 P<  70cP0k10U 0\1""P_  %0cP0&00U 00""P  0cP0ʀ00U 0t0""P  h Ph g 0g f \f e e f e f d d c Gd 4d c 0cP0(,00U 0<0""~P  0cP0l00 0U0"- lP  0cP0ʰ00 0U0" ZP  0cP000{*Rk 0F{U{ EPn  0cP0`30U 0q3""3Pd  0cP030U 0<3""!P  x0cP020U 02""P  f0cP0Wʔ20U 0H2""P0  T0cP0HT20 0U0" P  B0cP020 0U0" P  00cP010fkU 0{{y P  0cP0ʈ10U 0d1""PN  0cP0 <10@U 0% Pc  0cP0Z00U 0K0""P  0cP0ʸ 0U "5 ~P  0cP0qt00 0U0" lP  b b 0b b Gb `a a ` <` 4a _ _ _ ^ _ 0cP0_(00U 0P80""DP  0cP0h00 0U0" 2P  ,P  00{kF{U{"00 t3030vx303 U""00 aH30@303 U""00 Q30\3 U""00 D20{Ukk!00 720202 U"$"00 'x20p20c2 U"!00 @20}t2 U""00 2020L2 U"{!00 1010$ 2 U"pk!00 10b10101 U"GX!00 `109X10kh1 U"H!00 (1041 U";"00 0000 1 U"B+!00 00400g0 U""00 00^ ^ ^ ^ ] ] L] D^ x] \ ] \ ] h] L\ ] \ D\ \ [ \[ t\ 4[ \ [ [ [ Z Y Z Y Y Y Y ,0 U"T!00 bP00FX00`00.htp00Nx0 U"!00 I00{Ukk!00 9303 U""00 ,30{Ukk!00 X30vP\3 "ZI aI 3 "U"00 20{Ukkz!00 20{Ukkm!00 20Se"00 `"00 l" d" A gz :PI S @ K"00 F"00 A!00 <!00 kk5!00 0"00 +"00 &!00 !"00 "00 "00 !00 kk !00 "00 0Si !00 }0S2 !00 u0S !00 m0S !00 eP  _0S !00 W0S !00 O-DT! @Y LY $Y Y X pX $X "00 9"00 4"00 /"00 *"00 %"00 I mI |2""2l0 0P2L0 0G 2,0 0>@2 0 05\20 0,820 0#20 010 01l0 0"1L0 0K1,0 02!00 P10 0S,10 0j10 0׳90 @@0 ʳL0l0 0?TR 0R ǼS R Q Q Q R R R P R 8Q P P P lQ P P N N N O O |O (O 8O N PN M N PN M ,L 0P0 040p0 02X00 0|00 0v`0 @@&0 is0 @@0 \100 0Su,1P0 0J,P1 @@0 =ox!00 10 0/!10 0&10 0G2 @@(0 82 @@X0 l2t0 020 0+@!A*?B0CS Ϡ-6S!R#  S Q0 {+C 7G 01046n kȠȠ+S 0+C{6F{7 +S0+C3S S 0A.B B03200PP / /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! ኿V @D8 ,0400G|,0 4 00(@ ( 8/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?000CS>0S! 06c@<=0 Q,=00 C/(0 S0(0< 03@`<0U 0PEd@T0S`& <0-T0PEd@TU0 C0 0,0 Sp P<`@@C0S 0,S40 PC0000 00 0 0 00[0"1<@0Q3 tR0 p (RR  4,00 PUSYt+H; 0 40 30D <Ѝ D R S R  P;0 PB 0S  0 0C R 10U 0PEd@T 0 B00 00 000R00S2P  0 Sf8&#4<f4#0R :00:0 00 80B4 R,5@0 0000 D 00R1 P! BD A   B\000D0Sp90l9 UR000 0 pP<`@@ d0)pS ʈ0  P<`@@ ;tTUL 0PEd@00 S  Sg S. 8a@D00@T6c0PEd@TULQlP80 R H0A S00 CR*ʈ+R~ 80070LQcD0ʈ;70\0T U 0PEd@00SQqʈ@6c@D \700 $ R40,0000 700XU  PEd@T  E !RB 60U 0PEd@T: H0!ʈ0H0;6a0@D;Ut 0PEd@T:0D 1ʈ0+D0 6a@D+D$60[ U 01[![V 0 0C 00  00D0 PE 0CD0 p0D`l QT U5 0PEd@00Rl @Da0 T ld0h \X ! 0PU 0PEd@0S^6c@D0l0\ 0x R! / R>400 Q 0SU 0PEd@T 0V  $400300 C R=0 U 0PEd@T30F?o20$0S0a #3$&$B0#22cRV0S  l30T0PEd@TU  0t$ R R& D U1![ $Q P LQ0Q 0 B0 !/0  0D PE B pD Rk0h" D 0$ R@" D C$ R$ " 0+06c@D;D10 R 0 B D  0|10$0S  &$   0K` `@U) 0PEd@T$0D`S` 010`+@U G$ 0R $P (D R2D507S U      0c 0S PE p0wG =?>?N?P?5?E sM?D Q?H?A?L?A J?@ \? C?L = = B; 9?:?;?0@\,( @Dʈ+6nc2a@D0 D0B $0S`0  03`@03&8#[ (30Q Q6c@D;D  3 +0l3HL0  300@S3D0y `v0aS3@D0P0;T030 0X00\00 C[PEd@[U6c0D@C c P5l01r0ರ^l4a@D0R!B"0$ 8 S0l0S>0p0P00X0?0X00 p0tmP 500 (Cu @m X50`5@0 0`0n 00`P50y5l 0[pPEd@[jUEF0L0Sk 0 0006c0D@Ca|(1 T*U $((UW PEd1岐@^ $(6c 0DQ6k @CD 7L0 $ R&400  0Z87@`0F 0cQ0`+@GP6c@Db 0ಷ@D&a"@`07l00 0 00pP<`@@0 $(C S>0p0P0 0X0 Xtp0(0$$(0P/ \80( &b0R0 S(08@D0 0cSR: 3@ 0@l08@0390ed p T  \  \ h VP H90j0 `C^0Sl90Tp@-@JPP80S $ (2/$0(3/00pPA-@`2PP@p0 QR 408 B4 08@ܷV000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@P`P-@ R2Q <001 00S!B<@0 RE R 0c Pࠓ^ S R6 0 1 R` @ <001 R@ 0 <l0P\p[ G R R 0c P  R S R 00S  0S  pl0Sp0p0Cpp0)x 000 0AP,040p0 p0 0 0 30 Ѝl0S  pl0@@@ ld\S???YP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8 (  0(3/pPH 8 Ꮆ$!኶P S>0R:oRS B P T  B T p W0Bp$ (0 #8l8p@p  BS>00p08 ]` YP S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰P儺X 0C0 0$SQ $C0p`0 sRpW0- p  p0 Ѝ0` R`V40sDJB 0|=J^S3 0b6 08#8^0X 0 0C∀Q\ LX P!P0!01 002T 00(0! T 0SЍ0W0T0S Ѝ 0D?o240%R00S020,0@0000,004@0D?o280 00C$0 (00 00PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0l0\000Sn tP LP`,0S P'p00F S#0`0 h0S:l R1#P0 6SL \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 BXl0\000SЍBO-ldl`,M Pt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ3@0 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tP` l H 07#0H0Xl \0P8 B l0\000S,Ѝ80&6&6!Ɖ909t6l L Qtl \e 7t0 S` R S9 Sl@sX 1`o 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 Hl0\0v0P,Ѝ\P80 B0 5l0\0c00S,Ѝ,=O- M ,0PK[@!ܔ0 P0pUpX/o" Xp ypHor 04 0 0B % B 0 0B 0 #40BVU2W0>&* Q!L:l`\A `Fp W P!P1UP! U:XUppU0\ 8`1  L\ 0PE0 000C00U00\  W 0 B0 0 PpU` , 8Ru0A6,0l0 &\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`ܟ 0P0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPD/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S|>00000 S *S0SWq00Q 0SD0@S>P0 W0Sr S00V0 00#400 0 30  0#400  0 [0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000) R0f9S ,0 00 t0  R ,00S0Q01Q0$ Q R 12 0 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E000S ! P B R  PE[ P 0 X0 *H ֩0 ,0 SR0 B00 0 0 0 0 0 S0 S 00R01 00 q00? R}0ES IS< [S7 gS7 /0S0CkWi @8 RC0SS@ S   00#  #800#"0  M ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S+  Rg00 0 B00,00g  S  0Qq R0000 #40k0q00Y0SZt 6l8&`6&6!ƅ909&tl0I0Qtl0" Yt0SWd :W㴖K 6SW \0l S8  B0 l0\000SEJ\ R8 C0 l0\000S8 xZt0(l 8`R B  ^C 6ƅ6ƅ6!ƅ909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [P Ko᫲[@ `P``0P&0@&0!0ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=q#  #800#"0 00^+B 00d*W6F &R= \ R80l0 C<0,0}j 10 0 0010 B 0L0DC0C t0S*l0\06\0l S8  B0 l0\000SD10-\ R80l0 C97531/-A-`pPTqP@G Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0`]p# 0S%t l00\ R6S S L D0 B C}060@! Rpp\p@-@0PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S{ $0Ss wpVjV`F0HSs0FSRo WmZkYFo᫲[dV @!( `4/@Pi  @ X  P "L  BT  A4 * 0`, ` ( P6/, ` 8(6/L ` @(6/j 0 D(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0` (0} Ѝ8  40 000&-M 0 0 AЍA-P@PUP_8 `堥 0l!(3/@PR T!@啥 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 j, @@ eL DD `&![0 0C006& 0&;> 0$0;/c O-@QM R0 x  0S " !,"pHP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A $ " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4X RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C  0@S 0 " !T," ЍP ""pBW1C1Pu\c g a a a xa Pa a @` C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$'_ C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$'^ @-@P xpxPp`@` 01ē!0Q0 0#B  ] @-@P xpxPp`@` 01ē!0Q0 0#B  T] 00@-8P^00# @L   0 G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#pG7&c20N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/U/0S0`0//8` 2W46@-S k>@@0 #400k.06S0 k΁ς 1O- p:PTU0!`Q` !ᲠZ* V @: U @0ς!\KU V*  p0Q=0^ Q- Q- [ O-@ 00 0p0 S01 ]Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C00 LQ @00^ P0 00Q00S@\ R 800SC00 R0@\<ЍW@  yQ / !02@X1Z Gೠ6;#6pQ^p N  p=A-P@1T`R`QPEP0+~T S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O- M`V00Rʀ@kf W !.⼐ 5b8Z#8$PB 000#406P0cY 8#8V⼐5a8Z#8P000P%TPVAPeY58#8 B("(Q1P8#8000P#406cR!0C 6V V0T@R p` RPF_oRPU RV0W R+AʲpᰐgZ5P8#8000P#406pGp0cY38#8 WvA7Pp8#8k.00P0p#406VPcQ 0C6B0T@ Ѝpᶐ5i8Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0h0cQ^`弖0ᾠ9`jY8`J #80 00#4 0编0iQ8 #8 R0἖`3006/02PV , B("(5VPk.0V0p B("(7k V0&0a8p#8<ʀ6O-Skn⼖0M $P  #  # #  #  "!A 9@b8 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>X8#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ 9b8 Q#8 @Pk`0`00@#4PP06 Bc^ 8#8k0&Ѝ0἖10἖-L] @] 4] (] ] 0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&ʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@, R 0p&]P+(+0N  q/ ! RF@P j   Q&Q3 "[r&k R0E 2 8#8000 #40&0bP8 B#8k0&N.V }G.0 0S0 0xS0  0LSI>X&&&&0 Ѝ,  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[k 0("( Z:8#80 00#40缦0jR#8 J#8+ ZB!(:ἦ8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦv8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦU8#8kΆ000#4 0缦0jQ J!lMk>⼦ / ! Z! ! 缦jR! J!^ἦ   u Q3 "[8!8#88#8z8#8W!28 #8T S $P :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  $N 0S A-P 0@ Cp`&VUV `O'P &/@- M`@p*PP Pk  `  &p , @P  Ѝ腟 0@0 Ѝ~@ Ѝy@,T  Ѝp@-P*@P @;00pe 0 p@-@*0P 0*00T 00Qp@-MP`v*@P P @ 00&p Q,PЍp6PI,U 0PЍp0A-S ` 0@ CpiPe&U 0 &0PP%yara0A-S ` 0@ CpEPA&U 0 &0PP%tcid0S A- p@0 CP!`&V `О/0S A- `@0 CpP&UW&(0PP寞/%yara0S A- `@0 CpP%U4&(0PP匞/s%tcid0@- M P@ %p  @P Ѝ0r@ Ѝ0m@ Ѝ00@- M P@ %p @ @P Ѝ0W@ Ѝ0R@ Ѝ0yara0@- M P@ %p @ y@P Ѝ0;@ Ѝ06@ Ѝ0tcid- M Ѝ- M Ѝtcidp@-@P%0PPptcidp@-@P%$0P p00ploobp@-P`@P  0@$p@-@w@ @-@q@. @-@k@F @-@e@b @-@_@~ @-@Y@ @-@S@ @-@M@ @-@G@ @-@A@ @-@;@@-@5@@-@/@!@-@)@6@-@#@K@-@@[@-@@p@-@@~@-@ @@-@@p@-P` @P  U0@Y$pp@-P` @P  C0@G$pp@-P` @P  10@5$pp@-P` @P  0@#$pp@-P`0P @P   0@$pp@-P` @P  0@#pp@-P`v @P  0@#pp@-P`d @P  0@#pp@-P`R @P  0@#pp@-P`0P> @P  0@#pp@-P`D @P  0@#pp@-P`2 @P  0@#pp@-P` @P  y0@}#pp@-P` @P  g0@k#pp@-P`0P @P  S0@W#pp@-P` @P  A0@E#pp@-P` @P  /0@3#pp@-P` @P  0@!#pp@-P` @P   0@#pp@-P`0P @P  0@"pp@-P@#(0P pF0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`PZ@u#<P pP U patadp@-P`@P  0@"pp@-P`@P  0@"pA-P@:#X0P pL&`P  P `(gntsp@-P@#(0P p0P 0pgntsp@-P`C@P  F0@J"pp@-P`7@P  50@9"p@-@R +0@/"p@-@ P"$0P p00ploobp@-P`@P  !0@ "pp@-P@P K!0@!p@-@ @1 @-@ @I @-@ @a @-@ @} @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @- @-@ @< @-@ @Q @-@y @f @-@s @v @-@m @ @-@g @ @-@a @ @-@[ @ p@-P`@P  v 0@t!p0p@-P@P  0@c!pp@-P`@P  S 0@Q!p0p@-P@P  0@@!pp@-P`@P  0 0@.!p0p@-P@P j 0@!pp@-P`@P   0@ !p0p@-P@P G 0@ pp@-P`0Pq@P  0@ pp@-P0P^@P ! 0@ pp@-P`M@P  0@ p0p@-P;@P 0@ pp@-P`*@P  0@ p0p@-P@P 0@ pp@-P`@P  ~0@| p0p@-P@P 0@k pp@-P`@P  [0@Y p0p@-P@P 0@H pp@-P`0P@P  60@4 pp@-P0P@P o0@" pp@-P`@P  0@ p p@-P@P L0@pp@-P`@P  0@p p@-P~@P )0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@pp@-P`0P%@P  0@pp@-P0P@P 0@ppp@-P`@P  `0@^p p@-P@P 0@Mpp@-P`@P  =0@;p p@-P@P w0@*pp@-P`@P  0@p p@-P@P T0@pp@-P`@P  0@p p@-P@P 10@pp@-P`0Ps@P  0@pp@-P0P`@P  0@pp@-P@m(0P p 0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`y@P  }0@{pp@-Pi@P 0@lpp@-`P:@<P pP U patadp@-P`7@P  D0@Bpp@-P`G@P  20@0pp@-P @P l0@pp@-P $@P [0@pA-P@X0P Np!`P  eP `$gntsp@-P@(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P  0@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P ##p@PP#0S #pz#0\@- @@a#,P 0R @-P Q o//P ና0 0 t@-2 <@-P Q @u@ @0@ 0 f( (0( 0 gv1 1 Ĕ 0S p@- X@`@@PPpP p@ P 꼯pA-P`p# @P  P` `pp"P` " "" `""c$}p@-P @`PpP p@@- j @P $ ~0 0 0 A-pP W @P"  k0 0 0 \PF `P  l` P0 000 ,0< `@꼭.  /@-@P 9@ e 0 0X p. }-A-M `V $P0 P"@P pP  0P" ;ЍAЍ/ЍAЍ/ 0 0t {- hԐUꠉ@-@P @  0 0X `8- h}p@-@P x0 0 0R0 P0P Q # p@pptؽp@-@P `0 0 0R P0P Q # p@p\P/0 0 0R /hP/<0 0 0R0/P///<0P p@-  o QP  QQ #/\P/ 0 0 0R/`@-@P \0 0 0R  (0P Q l#00(P/00 0 0RP///ᴨhA-PPM 00 0/o"P R Ѝ R0 p 0 p`P 0 S  R H  ! pP` (!  00dxlA-@PM 0 0 0R ЍQP 0 Ž 0p`P 0S d  P! pP` 000( (0( $0 !h<( l; P H0-0 0/o"^ R  R/pP/D0 0 0R /@-P oP/D0 0 0R /@-P ʐo긥PP p00 0/o"\ R RP Q  Qऐ /\ܷзfP 40 0 0RP /̤|f(0A-SM`.P@U Ѝ0 PP pP 00 0uP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( ]P  ꤣ{P 00#0 0 P 0S S R/P/ R0/  @- @hHWqxq0p@-S(M- {@ S  P{ Y ` `vP P (ЍpX  (ЍpD P { : (0( (0 ȇd\ȇ,# p$@-@\p@-$@@^(p`@- M`@paP P0P!s*0 00 ЍK0"S@- M@Pp@` `$qp 0 00 Ѝ,0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`ᦆ@P (pP  ፆ@P ׆W@, ,0, (0 LnS< |DM 00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ xЍ00@-M @P  @ jЍ00@-M @P  @ \Ѝ0@-@P ,0 0 0R0 /P/0 0 0R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / 伜P $0 0 0R //ԛP $0 0 0R //᜛P $0 0 0R //dP $0 0 0R //,P/d0 0 0R / 0   \*S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RfP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 8 S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 04ml @mG-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R@" tR Ѝ mR8 pR oR sR ;R@' ;R@< tR ;R@>P P"P \P@ V  P U WP P pR ;R@  uR[R\ BR񏐮qvhg"R /R@S00S@Ѝ!1 0 K    0LPp 0 +("( RB*0 Re \Rb  uR^ 5PY +  PS6I %"". 0)" " <,  0   ,0     SPY$ Y  ͕)  )# < 0,!  Y*-"-  }  )&  u iiG-@p` W W00 GR0S p W W00 GR0SWL 0<0W0PPF <W0@@k`r``p 00 S S   CQ R<S+  rP)   lP#  fP.0@S@S -S 0@@-S0>S @ 0*@0S>S0 @>SSS @@ @YP (0SP  R @W' W0S@@a@dPV` /P @P D $P0Shglgxg4f\e9G-`-Mhi@PX ,ppO pO 0PH h``S`Gp0!  mPPu3  ` p `WЍ& mPPbu  >00T0 mpe`H_Ao/A-PP P`p @@PD@@@P p40,p0P4080<0||J  @-@ `0J@-$@@ }J{40@-@i@fO-4@T ,p` P @D¤@@`T P礀Qㅑ@0@ @@0 PZ PZ Pa( a @-R 0P< P 4Q ,  D D0D 0 ), ,0, (0 zp a`L @a`p@-M@4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% L`ЍpS' RkgЍp 0 0D Zp p0p l0D \ \0\ 0D cD D0D @0D |( @`_ `t_y `T_ _,_iA-@`,pPP W 0 !,P0`,P0`C-`0SM@PpF  PP00Ѝ! 03P ,0SU ! 0(P ,0S(0S00 0P 0S>0S0"S0:S 0}S "S000"S P  P d @@ 0P , ,0, (0\ ] ]p\0p@-S \  Q @PPp 0  0 ul \[0S 40 00$ $0$ 0 @-u \[ 4 @-R , B04 P @@ @0@ <0 w, ,0, (0 n \[ <\Z80O-M@ Ѝ@Pp `P @ p @rЍȒ  {`P0 004QY  4 R] ,剱1Qw   P 0YIW  B B!)k,0 ` 04 p<0 04 <0 `,VN<V8V+dY& 嘡@ u `  D{`P) k 0,S<SS> dPh @<0, 0`p4<0x<-! j,0` k{Y` [{,x x0x t0F/d d0d 0,WL L0L 0  ЍsP pP 00S 0q 200PX 0S. @0R* P# [` 9P 0P 0S >P' X H` ЍOWP 0  03/P  40R 1#PP 0 0U/i 00C 0P `T@zh h0h d0U/T T0T 0]/ onux4mP 8RSl @U\S 8UP/0 00R/U P H0-00/o"^ R  R\/UP/@-H@T  ?o2^0SYoHU0S A-@(`MV PP !0 jP $0S6Ѝ/ 0P ` pP 00 0P6 0S3$ MP, V8  @P0 00p `@~ ` Dp` 0$ 0R0"S 0 |0  Ѝ~0"S @ l @Pp`>:S =0</P/<  ?o2\0S /0SP/Rp@-4@4P@P] 00Xp R0S   0`RPR@-@<<B T (@@=@@ @l@ ( @-@P (0 0R*QP/0 0R/QP/0 0R/hQ0P D- ?o2 ^0S 0 S7/@Q0S /(0p@-S@ ``P0 ]P0 VP ll `@@ @@pDDD@ @0000 9 <l9:A-PP  P`p @@P @@@P p<```* 0,p0P4080<0O@-@- @*  @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 \O8 9Q(9 8VPG-9 pP0`W:W@ 404 S P S0 2000,0 10,0$ 1P0P : 404 S P PSPL L0L 0( ( (0( 0( t \57` 7t7p@-M@400 S+RP, R7S 1CaV( P` 0 02P 400C40`ЍpR S l  Ѝpd d0d 0< k2L L0L 0< |)4 404 0< l X 6l64 3H6 6$6A-@`,pPP W 0 !w,P0` ,P0`400 p@-SP8@S w4 <0,04Q<0pPp 0 0P \54o@- MpW3 0PS`@$  PW00 Ѝ 0 P ,0S x @0 @P  Ѝ0]S$ $0$ 0` / 43Rp@-@P 0`0V PP p p0 0 0@S<0  0pPp( (0( $0 _I@ 23w0G-S@PK Tpw 40SF   P@i P P 00S 0>~P7 0 03/P0  40R 1#P' `P 00C 0aP  @ꀐ + pG \ \0\ 0 8 808 0 HG@ tGX +l1( .<140S 0C40/ 0  0 @- 100p@-S \  Q @PPp 0  0 F@ 0P0ip@-@P 0`0VP0S R<0  0p@D D0D @0 0 000 ,0 {E h//| D//wG-S p*W`@ V 0P 0R `00 U` yV 0S  Gq@ @0@ <0F/:+0,S Ex /.A-PP 0 0RI4pP 40S @,0a, 40a@T:8 8 402p D@-P80080p@-@P 80 0R@ pP0@pPCp@-@P 80 0R@ pP4@pCp@-@P \0 0R@ p`P00S@#:p@Bp@-P@%@pp@-P@80080p@p@-P@8@@@pp@-@P 0 0R`P40S ,0AT p@p@ 0  0O/mAD $(T+aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@k@=@D D0D @0S//0 000 ,0S/&AL +\*( +8*p@-@P H0 0R@ p`P8@2p?A-@P1 0R`P#4P%80,0!qW&  P  P 1 ,0P < 0@ 40< AlAD D0D 0W/, ,0, (0W/x? )( h%(0P D- ?o2 ^0S 0 Sg/@>0S /p@-`P@bP (0S p p@ = > rp=0 //@-JP0 0 pi( (O-IMP ; @T p `0 R 2/0 J\ P X @ 8/@0 p\PV @T!1 0 4003/X@ 8/Z JZ Z X" 000 R 2/0 J' P70S+ 03/P. Z :/ iJX 0 0(  0 0 Iߍ 0 0(  0 0( Z :/[ 0 03/X X0X 0(  (' '& &&x &&T &d& d&&P0/O-MM(p@ ~T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT00 0=P $ 0R000 Mߍ0 000 ,0H D R00 p$$# 0/0/@-@@A-PPMp`2 0S/ r@0U  UP 0/P B 0CU/PU  U0 0/Q B T!0C@T@!  r;@04D .00mr 0 S* ~rDp@  PV w0P@wPۍ|w?00@ۍS0bp `Hp p _w0P@W # p@-R 0@S PR :   Ppy0P  , 0`0` `0 9L0L L0 :}808 80 ;up!t !!T !!4 |!p@-@Q PPpQp0@-S MP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p 0QQ Px, ,0, 0 $ X8 | 0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ 0 0@ Bp #0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Q>p@c 0 0` Q| 0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P >p@  0 0|  h\cA-PP4 0Q ppXpW`*@P&  P <V`p p0 8/PGPD`<``Q# P3P P 0S #P P PP@ @ P P 0 H 8-t,p@-P@PP o Pt0@t@p {z011/A-\@`pP \1S 0 €  P 1rP1 `p P 0808 80 A$0$ $0 B` 4H@ @-@^ P ^%QRS  T00NQRS"  TŒ 00 0 0 ZH |G-@R00Q(MP P 0 ` p Pt p `nT0?o20S00(Ѝp`0 p@- M`P@00n0 0n0 0n 0     SЍp0@- M0P@n n n000      S Ѝ0 0p@-Pb"!4Mb4# `@0n "44 0n "44 0n 0     QЍp0@- M0P@n 0b" b! n "440 |n0!$$       S Ѝ0p@-@P(MP`/ 0S, R00Cn$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 RM P0V00(Ѝp@ R 0S V00@- @rT00@-@3p00T000'@-@T @-@T000 000S/@-n5x000 000S/@-n5x000 000S/@-n\5x000 000S/@-n5x000 000S/@-n4x000 000S/@-n4x000 000S/@-pn\4x000 000S/@-`n4x000 000S/@-Pn3x000 000S/@-@n3x @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#0001/001/0 01/p0S@-@1/00/T0T0p@-@ P`\ Pprpm1x/d000 000S-/@-m-1x@-+000 000S/@-m81xAo//- M0 04 Ѝvt- M( ,Pp Ѝwt@Q-0 M Q Q q 0 Ѝ 0 Ѝt ^t ($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@p P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P_k8000 0@0 !0#2 /UUUU3333  ~: S-x R Sd0 X Sb0?0 r - 0!=w- S W 9SL @Sx00 r - x 0 w -    RD R9 Rx 0 4 r-w- R6 R0 R& R x  00Rs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-bA@pP8 cP8  bpP% 00b` 0@T lP0=S AP` AT BX!  koncdb o00D)hh"h2C-@`M 0PDH L0PT@g X`P ㈐@@@@@lpk pp lp` n{$P  {j{{Ap[ X0p 0S00R8@<@@@@40040&4&&0&bH1H000D0 00c&X  #Do0S Idp@ ]l Yl  Ѝ_oЍ @ o0 0 ?l 9l 5l(HO-pM`@hP-TPk +T@` 0Z ǿ 0 {i 0 siP !ʎ @00D \a0DSW0DA0DS70DWUX: QP S \ nP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0T W 0 p0@ 0` XR A B0A PR W p<< p`@Wp pꙙ\0BR"\0@-0 M@ 00 Ѝ0@I@PIn0T0P Ѝ0"p@-BR"^p@5@P5n0T0PpO-pM`@hP-TPk +T@` 0Z ǿ 0 h 0 hP !ʎ @00D \a0DSW0DA0DS70DWUX: QP S \ mP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0T W 0 p0@ 0` XR A B0A PR W p<< p`@Wp pꙙ\0BR"\0@-0 M@ 00 Ѝ0@I@Pum0T0P Ѝ0p@-BR"^p@5@Pam0T0PpO-MHP@0@Q@0U0B PR"S08h00404 40 ㅼ0hT0084 T XG-P @p0#03w0q0W`@DT@! b 0 0R ! 0 ;P   Gg0 @pQP@-p Mp @`P PP$ -{0 @p{`0 @P V Ѝg00@g0P@gPg0@Pg@|x0 0 XY H,$$0 -0 Xf  ,0/o" A0 A/o"; A@-0M 0@4PЍ0 fQp@-@ ڠX00QUPQXp X00QUPX00Q1-R@ !0/A-pR P@a@T T 1 !03/pWG /p@-@PIT 0p@/pA-`Qp@P RpP 0D00 00㼀p$`,@(P0Rg00A-P`p@PE 0U0" V W0 p`Pp`PxpP/ 0 0 00㼀@D $P,`(p0W pPpPV W |p|`p`lPP```T`TP`Pf00\\p@-@0`M1PS ,0S a$0S a pЍp0@-S @W0 P @0P 0 0001 1 00Wmf 0 p@-@0`P1S ,0S Da$0S =a@ppp@-@uW00CS00 PsWp P--M  @Ѝ Ѝ/ -- M0 0? ЍЍ/0P0@-$M R P@0S#  S!`0  B0!  0 0$Ѝ00`L0 0 @ P 0S$  $p(P 4000S$/00//8أhA-``!  8MPP 4 . <<  Q S  @2 [|`pU 0 0 40 30.8Ѝ @h`Up  [@@p pW bPX 0 L  @2 G`p(@p@ 8<Dd- M= ЍC-!MM0`@!004041 04p0<801 pu@P 0 0 <8 303!ݍЍP d0 00@p-PP@T Cnt` 0 P8TtPWbP @T@ C-!MM  !0 Q00 P <( 040 x1@`tP@4p L1pt P4400 $ ( ,  0 0 pp~PP"@T Cnؐ` 0 P8TtPaP @T@0S  "~d L0 0 <8 30 !ݍЍ800~( 4P<O-@FM $ M4 ĝ嘤0ZTp0d40X (` 0F0d ;0 P0S 0F PU 0 P(00F`P M$PvPq$AUh ,Ph(8,6FP $.U ,* 5Y "2 0 d4 30Fލ Ѝp 0P1`PPaP KaP: / qP@ @U  =`W= WI !00 0 `0 Q0 HPtt<0$0SP / q@!0 P  n000!10 ` `000 00 ` R0 9l ||8`p 08p p 0o o n n @-@,,1M0 `Pp 000 cT T( Oc/00@ 0 0 0 30+Ѝ0U000 @q@P00oP "448#800U0Pc0@c@   O-GM M & 06 ĝ$,08@0t40X`4(@0p`tP0I@ @P@ᠵ p 5P`0pp00 u@P!  Pfb00S! b0=S0`S"`V`X`V `ሀ\Pb0#S PU v000C00Cb0 @p00000P4ZrPb @8P0p00000 4FrP 3 # X# X0S000C00  040PPf0pt#h`0  ] ]0X045H@PP?bH0 0Pڶ5 (0pC ,&Y0q0Se Sc P\  P\ $P\  Po4 R1"1 0 t4 30oGލ Ѝ0@a2 0z @ 040040 S  P 0pW 0 00004  `zqP4 P0 PHa0S ,00pl-` Pp,@dC-PP!`L1 Ƞ0,̠TM4!0L00,8@#8 pptx00000 00  $(G{P!Q ,|W0 p!@"{` P0 0 L0 30 TЍ@{@ ໸ HHܮL8-MЍO-`!p1 Ƞ0,̠\MČ!0T004 8P#8 @ ㈐倀儠0000 0  $(,0zP80Q ,  W4P 0S 0 @z 0 0 T0 30\ЍpR0  @@z@ ,: 488|4-M}ЍO-M $4 002000Gog0 0-0P MPh 1 S S   t#@ h# S`  000 S ST S0 R R R R B RQ@  BQRS 0S1 @+S7 -S[QUp @Un0S 0S 0  00_op`R0+S4 -SF B]PPUpwV WPR Pp S 0QUp @U40S\ QO 0 ~000+S_opR0S @S0 kPP `_opR0S @S!0 WPP`  G_op`RU8 0 0 2 30ߍ\PPpPp p~ S!@B} y dLPRt"O-`l2 0dŸMM080 0y@P6N 0AM.0 ;PY 0SV ܀ +U+wHQ 0  0 d 0P @P3H0: S4 d10`! 6   pmvmzܼNSflp'jep`"` ek`(g|d{dL`P)a[`dk0 P%hnPbk*@`nKbk&[l[<`@'i@lKLD.fi`kjK(@nᏴa`ˌjK$n @%g a, dM`bKh &8bh  j jl͠Ꮴiˌf$n .f!e+i "  adhd  d)h hb-Ꮴg+n,n  )g p苠Tf`! `)f `Dg|Ꮴe{n"l )e PfjLdka( a)d @He]Ꮴn[n'b )n 8X叔nMl`Klˉh& h)` h0a a;f$%f!g `0)ah@ h3eib *b` +g+@bˌ`d ,0ln hf,fkg p$Dixe{`!,*e P`Xm]n[dkdKeˌa(,@dJT`KDb h nˌ (h& L, gi*i ibL 4d+ˠaˌ, f+$a "i  b*e h 8n` g (d+, g "!8p P-ef+h{fk(pa{pl{(p'i[pPP%gyd{hk" P,`&h `H`KeZfmn[lk@lˊ0n@$f @,MHiKhgdb') iah ,( g&) d$lʠ陠`ˌbb+Tli <(e` * ꩠa\f( !0<\ ag{h$gd+ " b)e+e;b[h)!f`b aakl   0d `,@i;'0#0j8h;. @nb+lcK nK " @g!$@,ɠiˌ(@a# !` gc;,-j+lˎ0# 0  j 7d P0j;`] `PtЍG-`pQ ?P10@@e T0 U?W@@P@@PW*TP(@T(pG  GfI  bIPe W*0@-@ 1M?0 P @ cR c B T 0E ",  Q"$  D 80 0 0 30` Ѝ0@MP Q0* 00 R;* xB@-d @4  R  *4 8/ x0 S\ R `0S Р@- d@ 4 *8/,H{xB /, :#( /$&:0/--M  Ѝ Ѝ/0  0c2 <c-A-Mp 0 `P!@ 0pp DpP R{0,pp{ 8pD H{0,pp{ ,p8 >{0,pp{ p' R /? 0p  ABQ \1!P{̠0+{ p`Ѝ`M0 Ss  @-@!1 M0 MP `080p p ~CP3 * 0 0 8 30!ލ Ѝ">p pPT ]CP* @D0*@"6MԞHtHtdbp@-+,@@PPpL0PptdC-P8AlM@0SE pP< @I` I 0 ``(xI@@P"@mI`pgI 0``(`I@ @ P @@TIQIlЍlЍ'+0hh@B@- M PStqt1p`@PP@@T 0Q P Ѝ$ SP @ Ѝ@ SP"0S- -S?@0 0000 ` O V RP +R@@D!0DSX [SP0S +S!@?@!@Ԁd\$X ?P L0P00 1 R/@P/!R/l0@>S 00 00//@-M `P @,IppPU0D>S 0!3100 0IЍ>SH 0!3100K00K00같/-p@-MP@U@0 ` ` jPx0x 08 R;0Ѝp@Ѝ/0 a0C( ( LИct}dccc@-=Q@B 8XA^^14/.-,+*)('&%$#" R"  @  +S@ -S =S  +AR@00RD - ++   @      0RuS/WS^0@-X0CSMF <0 à 0R ^ @@PSPQP@^  0  0 uS0WS+S -S00T0 0 +S -S/0 0 I@O-LM0wSp 8@0 (P(0,00040)' ~0 0J @ BJ@Th87 `0p00000  0a0GSX$ $00+W@ 0-S.=W000 0P @X B R d \VS  "=W  R   P:0$`4J@ wB,J R "@$`0   Y 0 S:$`J@ pWB J0S 0"0C$`0 X  X  pW ,WypPZS  Z0$`IP $,BI R "@$`0  4 =Wp Y+0G?o20S Zj 0X0 00X00 Z$`I PAI0Si "2@$` 0T 000 - HR;)I?'I0%0# HR<II @u00S@9~I0"SW  T3* 0 S@*- + x  @ LЍ'pC=W   "00$`XI P$API0S  "2@$` DI00AI0@S!!!0C!0T!"@0$AO#`00(0 0,00?!4! 0P!T! !T$/ !.P !0 AP00010`00Pd00@t0Pd00 $s@  R$@h8 威4(0AP `0A0儀H,0 P0 0P1P1P/ ` GzG0Q(\)\(f 0 p<P$ 0S %P @ 0SL>0SЍt `p  0@S0 04 0  0Sx t倄倔p 0fS0fS 000#3R0 4$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 &;P 000#3R0 p# 000 ;P 000#3R0 # 000 :P( 000#3R05 " 000 0#S 20@ R@@?+P00Ѝ0 S S\ :P 000#3R0 " 0@00q  :P  :P2 000#3R0) ! 0 00T 000#3R0 ! 000ElP Xz0@S0 @  u:P =Q*  0P00 c:P =Q*  0P0 0 0 0@0 ුh6cD6,65L5LGPGTG4\443`3833E2DD,21C CT1C 10( B8Cp@-PT,:P h@T$PPP 00pPB0A@-,@@Pn00/O-@80MpQ000p8Rp0W` 0TPz < &.p005 [V P<U (8 0 0 30Ѝ hs?0t0h 㸨p X C7 2UP 2f11 00'0(00pV' A0( ,0;p PpP<<000S[ F<0'0?'@@<@Z 04 9<00'p PtZpR '0BQ #S X BQ #S Y BQ #S ^ BQ #S [ BQ #Sz Z BQ #S Q BQ #S  P BQ #S  O BQ #S% T BQ #S@ U BQ #S6 V BQ #S, W BQ #S% L BQ #S M BQ #S N BQ #S S:U 0'0S" R! B 0 P 000'0  0'0 D  PS0*'Z +p0S ; 0'0'`;`W 0 X[ v;0'0o'@p;@p, 0; @k  ,# 00  "   2000'0"   2000'00'0tp0840@ 0@08040uH  P;00Sr[t+: o;00k 6n  'h '_0`000`0 0SpC ` pG w0'0E0 :0SpY00B[) 0S0 `  ')p+`00C0Q  q'ppp#[_ V;0;0N\t\[X<P$;@l ;7::9-0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFpP !P Ѝp&&A-A`@0S)@@Q0,pPpPR W@ P p0 @BA QA3M@  p0 p0 %%%%p@-p`pP`P@T T0T0 R@@pP00$$A-`P@P@p0S |@@4 R"@`4@tP0090@\T$4$@-F 0 0 #C-`4MP+@P 0S|0V ! EUpЍ ℩0P;  =R6 0Q*G B&R&>$#"M = -RpY WꘀqꈀvKSБp֐0X{FHʐ 05P6P#4#44t4lO K6843445O-BMM00  5 u %0p 0 0 $ 000 0000+0 ቐP 40 4N"P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ P 0S 3 0   \ {0P 0S 'd30\ n0P 0S d`30X3PE0 +.@@3 0`0P\ S@P 0S K3PP[[ 5P200xS0xS0Se "`2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S cH10\ 0P 0S xc10 ! 10P 0 $0000 0000P 5P3M!! X    d0 K  P D/ /(/XH8(p@-d@@0S P Hp@P@P 49P ౦p\<-t/ p@- P@P0 $S ᶏpPP4P UPp@`@` P$p,-. p@- P@P0 $S ቏pPP4P (Pp@`@`P$Xpx, .` p@-0\PP 4P ^p<`<`P@7pl+- @-@@P00O-S,$M0M 60@`PpU 0C   500 0?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[  @[[ \[0S @@0S /Sy .Syw 0W r 0W/So.Z^ Q /Q $pP  /P P$ЍQ /QU 300000  ^[![000  00 @ pp /S \S? S -RF P0 U@ ᱠ0]S^0 p Sv tj p, 0Wl  0W/Sfdp @^`2U0/00 /WU0@  0U ᾠ]QQ \Q  @P PӥU@  Q$ @@  0\ @ 8!  p[Q @ P0 @0 C0 0p`@0U0  Z 0 P/ZY  /#Q /Qk 0000EP@0kP@-@ P a5 0 Q 8Q ?o2c 0%%p@-@lP2P X}2P T00pT 00p.5 0 p$$O-Mp! 0 "  @ѻp` P $"10230Y ߍ辿PT 0 ᲻pI  㲿P: [ ;` 0 0P P) @@ 0  ᜻p@ 0 ၻP0P S P /"> 0 "C 0 |p@4 -R*$>=O-Mp! 0 "  @Ip` P 10230Y ߍ9PT 0 *pI  -P: [ ;` 0 0P P) @@ 0  p@ 0 P0P S P (/"> 0 "C 0 p@.4 -R<;O-Mp! 0 "  @p` P 10230Y ߍ贾PT 0 ᢺpI  㨾P: [ ;` 0 0P P) @@ 0  ጺp@ 0 qP0P S P ."> 0 "C 0 lp@3 -R 99p@-`H@P@ ePpPpPP $ p@-`H@P@ PpPpPӹP ȯ p@-`H@P@ APpPpPP l 0 00 D6-H- M0 S0 00 0 0 0 00\100M \0    R8 00 0 0 30KH Ѝ/66-H- M0 S0 00 0 0 0 00\100M \0    R 8 00 0 0 30KH Ѝ/Y5,5 -- M0 0'--M  --M  A-`hpQpP @Q ݾPD@(0 0000A%^40P R   0//Lǟ7 O- 0S0 a+0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!Tl00p\@@PT B+08@@0/S(@@ @@@(l@,A-MP@+L0PB @!0C `0 00   ! 0b0C S/:-,+*/('&/$+`00 0z0S@p 0S 0S00"S $7# Ѝ T1r0:/00Ѝ*P ׵@-@P1 0S* *@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0*  TD@8@0/S @-0DM 000p 800S DЍp@-`P p' P@ p V U ph9UX Np` *'$VT@8hQ?o 0?oA-@c^?c%^& ^ P@5$&pc`c&0gCh5(5D0c1c  1./ "0;:(0C0 /0 @- /(0  +C0 @ 7+C 0/0E0E0C00 {+C$0 G{6+C{7 Q/0E0E0C /0P!Qo oC-@@`T?`(T) T `P6&`p`3x@y66U`1p1 000? 1?1>4!50;:(@000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J{@ @-xp JE@ @-Bp J:@ @-7pPP `E@-U.00 6p@-P@` 5Ppp@-P@ 5Ppp@-P@`D 5Ppp@-MPP`V @T |00)Ѝp 0 : rp@`$ ólH 00 R :,@-'.00 0S@辴pPA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BPPX `( @4PPY  8@-P@, $1M`00\7 00@|p\ 00#30#^0#02S000R0@ | l0 0 2 30ߍ[pP @@ @(@$f HO-P`~lIHGbE\CBTIC^1\.$876543  -*S$a"MqX(P000@ 000@(P00,= 0 0hWP(P<Ѝ P 0 R R 000   /#b!!"A̟ K/" bP3:bQ#3|,  P\,  !P0 00 00 0 %0H 0?3c112A +K?##+cR 3:+cR # 3 00 0010!00C0 0 0@ l˟v. r00aRaa1B0"B 10#/A!b!b0C 0#/A!b!b0C0l0 @P$`h08P `C  Xh @&  P3P0 @$`PW(PK 00 0/0 @P$`0 `C X? @&  P2P0 @$`PW(P( 00 0  0 P( 00 0UꞵzX(P  0 GS(  +S -S0p000  䂐ಐP:R W (  2c2c2(S \0c$00P 0(0[ 50 ,P(U0X0,0(000@ 000@(W(P000<&0 P w2P 1& P m2PP 0(P 0  R,0W0!0 0 ,0 c0,_0S,0111v>C 0C,0P(  h /"b!!A0,0 W0v 00 000XWn 0  60 SP(5 0 0 0GW] 0%P(0PW%S(PNd6 ,0 X6,,0 v>C 0CW0P(= 00 0!0W045 0 0P( 0, ,0!/A!b!b0C 0P(  0 B0 SmP(PW p 50 ,P(W 08 0 0W  =0 P( WWpn ;0 P 0 0p S 00W((Ph 0 P(]c0 ,0SP( 00$0?2c1, 11,0 02 0 0 000 0 ,, j,0 0C0P(H 00 000 p3 ,, T,0 0CW0P(~ 00 0b c0 ,CP(Z(P000\Wi 0 0 0. 0 +P(0 X 0 Sj 0s< p 0 00|bv 06@p@00dRBnnA1AA@0@10cK@Dnn0C@0c0lN``0C 000C 0  PUS ZSP @  0 0$0H1P0(0v R0Y  R0O P,A00?3c112A  K?#|cQ:t cR # 3 00 001 01 B00,0DSd0,0)\P(\ ף 8 $IQl'\nX Q0 40N0 S0(0@0PpQ_"pG@Iw  W@p 0 40N Q@(0SP` 0(P0 0V(PP @ ACLC  \^JS S  00#3P0z z H(/o"ZPzX7ETQ(P8 pp@+CP("'0p[10 B0,Pp# (' PH!/"b!C;R, a2ba12MP P(P @ @0C2c2c2P$00( (0k00 @ 0 @,0@0S} 00@y0S 0@r s0p,0 0 0P , P(01(000C.$0'3000c^\0M0c @$`PM @$`Pl  0P , qP(00(000C.$00 0$ p  k0P& $,   P b((0$ 00M 00Ѝ |1A-0QHPP P M@M Q%L10 P1$8,@@ Pp . R! v Pp `劵U  Ѝ0 P0  P La@ p `iU'T 0 ЍH "'00t ` * gfffXH@-0M@ ⬱0P 00Ѝ@-0M@⻱0P x00Ѝ@-阱P@lp@-P 0 00M@`0,00  P00Q Q Q [' 0 l d0 0 ,0 300ЍpD ᱮ4 ᬮ$ ᧮t,t,t,0@P/ P @/G-X# p`!V@P0PES  R  D 0PEV R  SS0@0D@R@- 0BAs @Q 0CR &@O-` M( VP? @P>  pP9 !001Sp Y} Ѝ00P@wP 0 0P `0 0 !=00 !&00Q(@-RQM @PЍTT &@㸲Ѝ}& 00O-`!p1- 0M M050d1dPKP @VpB @\;X0 ^00ptB0< O}00 T> /qύˠ@,0  (@P X Px d0 0 5 30 ݍ Ѝ&00@&00lD<P$$0 M000 Ѝ--M  Ѝ Ѝ/ -- M0 0t ЍЍ/O-R M @p` R00?o00P @ P 00 P ! !  3d1XP5  YVP W9 V[XP0Ppp`0 0`f0`` 0 00 Ѝ`TpP% P売0XPC0 P P00 Ѝ7pP V 0pP `4\@-@ M(0S2 X0 `(0` 1/qp0Pp)  0 0 PUR <0PUu ЍPPTp 0S  0CP`&%00PpW@-P MG(0S: 0 "p(0p 1/qp0@`/  0 0 @ToR <0@To-1`V ЍP@T` 0S  0C@o$T00$00 0 R/p@- @Tp0 Rp 0R00 ѱ P 0S P0DZ 0c0(± 0P0 影0 S,P 4P 8P p@話eEp@-P$@@ቱJp@肱4,@- @@{J@up@-,PPn K@gpȞ1!0A-M P@00S `  0 XR0` ` S= p6( V80CS70H0 S0QT.*@DT*T( D0 0QV   "Q  T #R.S 0A a 0C "T #R Ѝp0@,4  R  *4 8/ 0X\S 040:8 R РS /,QxB@-Pp`P@P@0@D尀 UU  o {,p@-P`@#0 p@- h` \\\%p \!00p@P\ ckVmmsTICt70000E00pH00 Z00p#T00 00`;T cQƟF @dQ 1^01 0SS100S0dQ U60100 T =Tr T 0@0060000  i 7@DLDL000B@00DS0100C0y T T 00n 50000  J70D0 0]00X%0 0   ? 00D 009 004 00/00*cQPcdQ{B0@DLDL00D00<00D  0W0C3l x=A-@R`P 0So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@00@10 03/P(!p0 $@0V0 p00 R (00 0P3/P" Up   R  SVp 0S P00 0U PPЎ`(G-@P P`P (rp^u F 00\c<!"#b!0CaqV; Y 0pPY` $00100S p `1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000(hP`0003/P 0 p 0000S\oP00}00|/>3p<<$=G-@P PD`P $rp ^t F 00\c<!#b!b0CaqV; Y pPY` $00100S p `1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000(ʩP`0003/P 0 p 000$0SѪP0 $0~00\ ĉx40SR: G-P000pS` 3/0Y @IOP ٫ T0 0 0 0 Y @IOP ƫ TT0 0 H H0 0p`P   /pp<,SR; G-P000pS` 3/00 Y @IP T0 0 0 0  Y @IP ~ TT0 0 H H0 0p` P $  /TT O-PPM M Q@ \ /\C  Py P8p/\ @ @. D\m `P /RR.\' B Rm/0 F 0P PE00 aPpE 0: S 9S0/\0Sy@/\` FQ .PQZ 0t/S0W0OʨP ! ΰuPO   RB  (/\p @` @٪ލ Ѝ.00Z 0/ ލ Ѝ @ Z 0/ ?    ^P @X00 @>00 @?00 @00 @0000p@-@P Q [Pp`\Pᥩ0@P LP`V c0"S tp[00p@p@- PHaM`=  4QP00 P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P "<0 0   0 @P/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/`@-0@A R R:\|\00\0S Q0A|R  :RRO-M M '07 pĝ 00D40t4!S SP G@`V 0P0  =pP 00S D P R'(' 0 00 PM0E0P000xP ` [0@`0 S ZK :SP\ \S S SP0TD*[0+ P 0`0 SZBUP@0#SS ZP5P00S@0N0SD0AT0:p%5 0 D4 30Cݍ Ѝ:SU @0T:H)@DP$ @pP@DU  00 0 Sg00@ ⑦pP  ت4@00@S0 4000040 p$0(,P= Pv 0:RL pR0t4@00 0$< G<4`P pcPX pI 0:R2 PR0 0E`F00S:S:00` F0HZ#0 D 0  ጨ 0 @CᨧPp`ၨj 00DbR p CP H @DIpGP @ p :00`00000 0(S,P p& 0`S G`#0 SRD (0@:#@00P  P1@P$ 040<4`080 p0 7/p P 0S00S\S00 R8AP 0S7\S5 00S1 :S000 0 S4S[ A 00S :S|S@0@ A@>0S'h!<1 0 8 30E ލ Ѝ Z @P 0 0 C1 0 Y P @P Y @@PP P P @0 0   0KP 50 0Pp 4 @m \0HشXĹl0p@-@H`P` 0S 0 0$0 0p@   <A-`= b@P dPP 0:SS  pd \S @+ Q0P 0:SS ^S0S:S 0Q0@PP@diP{ 0P:SSpdQ0@@A0]p0S:S 0C^7B C@2RIFB?5/A)&"! 0@ 0 BT1 0 BR0 0 0 0~0|:0z0xPpPҥ 0n@ @ǥ@ 00A-`= PP6 db@P8 0S:S  pd%0:SS   \0@@AdP @pd0 \CPAp@ᯤpPብP PဥPg 00p@-@# eP 00S 00XS  @<,00A ^aPAU70AAAW0A^RppO- AM M0p|#Sx3 00(0 0I @`/044 PPN 8P0D 8T  000CS3%10/.-x+*)(&%$#"! 㹝 㵝| 㰝0:S 84Sr0S008"$2 0 (0 30| K  P* 0B.KS:S B000$ 8T S%̡ 440<4 0 S BKJ ; $0I4$ /04I<4 $0C 0$CTB>K0CP 04 8 0S:S X< H R0 0  Q!000@M P04@@0e n0:S r 00UOP}K0 S:S008$ 0S:S00ڿ0 h4H0 00 -H-M0 S0 00 0 0 @0  00^100M ^0@    RL00 @ 00 0 0 30KH Ѝ/ᆿl4@-@$@@00d`XO-P"2 @`0,M0$00㷤d20 R\ 00@`pR 0 @P Z p rP p J  0J0PP0 S#: % U10 r 1$4S1$!@00 P;P0S "<100S (!0 0 $0 306 ,Ѝ U r pP Р P 5SX0(, VT00#    PP  P0S=9ƾ@h ? @-;(@M@@00?PЍH  { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T P0 0# 00Ѝ 0Ѝ-$M0 00 0nP$Ѝ-$M0 00 0^P$Ѝ-M0 00 0 MЍ r y0q/C- 0 0sM@P010pX0^00pAtAR0O⎢!{0` >PPTA P{ %d 0  $@< 00 0 1 30sߍ追pT$$0 M000 ЍtO-PM0?0p00301S01Z P   P0%%Z * 0S0 R $/? 0 3 305 ߍP0 P P0C S !000C 0 `0zSN~|{myxwvus1jh=(c_^\ `ZEU000P0C `0CPE 0SF0 0C0000 000Sv0  IY 񏐐q;$P0 !P 0P0CS0000 @ 0D SA*H0r? R(0 ( 0I, $00 40A@Q>Do_] 0 S0 00 Y8 @@0  P @T0C0@0@  0SP 0 0 0@0 @0 0CP2 0S0 000$0$0S0 =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000- 0@C0 89T@!@r?(0@0 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0_000@T@03S XR[    ( 0>  0          00 0@0( 0CP000&   (   S@ @t& YʱY  P sP @0wP"  P 0 S0 0C0  S  P 00CS0@C 0 S0 w @$ 00S  P40SZ 00CS0400V 0YX $ @0 0ESZ  P 00CS0@I 0 S0 < @0ES$ PS{Z{ R0 00CS0@ 0 S0008 @+ D   BR @ X* @ j P 0 0CS0@L000 0XI $ +D AQ@ 0 R0 @ NT6 0TaAQ@> 0 R0 $@ XQ[AQ@  R @0 00K0? 0r?(0Y D    00S0P0SY, 00 0'0C@0@00<000jS001,`0 `DH@(0V: o P 0C =>J( ro 0  "p P p  p =>3PSu $0PS0000`FSVP Z,`XV $0S0 00 00;0l0<00000:0`090000|1 $1 h, pd܎! ؉  0    0 P P  +P  P0^Z``,40Z`I` 0&@0,(0=>0( #C0,`-QP ]QP @0J Q ,` 000 0  P 0 0C P0 SP 000;000;0000900000000n000090 00c0:0]00YrIT   B R, @ 0 R0 @$P 0 R0h @ X;"  R "  R1 XX B P R @$V$PI 0 SF 0iT nT  B R, @ 0Z0K @ R񏐚D" AR>  BR @ 0X0@ NR-  BR @ 0X0W $@(T  BR @ 0 R0@ )T  BR @ 0 R0 $J$0 S$@5*YY$ 00(0@T 0W020( @' la00 `500S @0S, 00 0<Ze  P 00CS0@| 0Y0  @e0SNP 0Z 0aP 0 S 00 p0 00Y 0+@ =. #RR @R  B   @ 009 @0=>03SS2 0@T0C0000@000& 0S]P @X A 00 000NP[ 0XX 0@+CP5 0 S2 0@@Q?5P' 0Y$ 0@ 3)P4 0 S1 0( 0 N _T?o20S0 0CS0@ 0 S000 Pg 0C =>@H0J  r 0ᕜpP P p ܜP 0Y0CP  00S5000CS0400 0 S @0 _,0p `&  B R, @v 0 R0o 00 ( @<`00 P Z 0@00R,  $ ]R XZ Pp80$0 080P, 4` rO, <`T  P$0 0P(0080<$rZPQ 0 SN 0@POP 0X 0$@4CP: 0X7 0@8PE 0 SA$P P<,P 0 S4$4I2I/P) 0 S& 0 @0 P 0Y$$P P P 0 S 0@P 0 SX,` @ tTT+ @tZ$( S C@ SP 0 S 0 @000B :P $@P @- , $P; ,lP 0 S 0$ @ : 0S@!0@3ZL 0㿛PE 0P0 0Z> 0  0`H0`$0 T PD =>$0 BC  T 0 rp/ P ZP@D7 0ST`Z   @DDP0 T0C 0 p0S0P Y` 0@000 @/XZP@D`A-@P`pI0 PJ@-` MHP@p6<P  0 P3 Ѝ踝2pA-0| !P0@0S5 0`1S010e C000PP! pW@0P@ `PQ 0 0 @0 C PC0000   Q  Q*RQ' @<08 0  BP0P00`0 IP ; B #A ?#@ 0# B0 Ph@p@-@P ;rPp0 $<@-M@ 04/@PЍN @Ѝ\0\ 0@-M $̜0@4/@PЍ5 @Ѝ0@-$<M0  $@4/@P Ѝ @ Ѝdd0 @-M00$  $@4/@P Ѝ @ Ѝ0@-$<M0  (@4/@P Ѝ @ Ѝdd0 @-M00$  (@4/@P Ѝ @ Ѝ 0@-$<M0  4@4/@P Ѝ @ Ѝdd0 @-M00$  4@4/@P Ѝ @ ЍLO-M@PD0Xp@ `$ 0SP  $,0  ;/0$  0H@ 4/@PЍd @Ѝ$ (@- @MЍ0 $<@-M8@ 04/@PЍ< @Ѝ\0\ 0@-M $̜08@4/@PЍ# @Ѝx@-Pp` t@t0@l@ ᢙU  Ἤ@0 D$ ⏙;,z0㸐O-M`@0 C 0P040 0 0p0ʿP0! B0 b8<B p  UQPE @4B 0L3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b 得 P 00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00 倗 P- R@ ^^? 0 `0  }P 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`i8qA- Q@Pp` P=0D! D?o2]R0S h0$"0 !@1= 0 V V 0 P0 A A-P@p`ᦖP .T Tl!0D1(0D,TS0 Ae_T (0$"0@ !1% I6\ O-`'S7UM 0|0L106@001 0 y P 0P0 rp0P0 [00 x190 H@ U1 p00PU`p! X U0 1 #ᖖP00? PP P5%0 >]PU`p0pGGq WP1 P! D`⸔pP, 0 000S V D0 G0CSax1  5* 0 0  Rx1  4' 0 0  Rx1 00x1 00x1 00x1 "00x1@\00x100x1 HP UG `xPUB 0 p9/P~00PᏕ单動剕#3 0 L1 30Uߍ 0S IP/3#0 \4P 1d3d#d0 z\P 00O 0S 0 0S Y 0P0C$PP`O@@@P@T@O (  Zo*03> @8@47p0 Y ,0 2 @0 D0R4 $0pᏕ[P`ZO* 0 $00S$0P4ddxnfsdcuniop@-`HPp  @Pp'0@ "@p`@-M @}p 0: S  p  ]Ѝ00ЍO-`-$M$@@P P300;#;S@00V00S00 e00 @ ` @ p0 T0* 0Gp@P ` 0  ῄp P@D0S^ @Tz0 `I V*@0    T1 [ 0 @ZTgO@Pg V#: 10 001[ 0Z0 0P  0 S0S[ | `Kp0@ @P$0$Ѝ0 g000 00S0i0P   0!2pP| `- ` #pap@-P / @T @)T0 0p  JO-@Q M0" `pbP [ P5@1 P1 5*P 6/P  00Y[ @D:P PU Ѝ/O-RLM<nQp. @<000@ $0劇Pb 0P@0W`p000G<0  00p 0 `8/ PppZh* dℐ 0 `P `RP(0`4`p`,0 PV :/P  W X(,004`V1 011p1*`G0p 3/P00[ < 0G 0[  pW: pW0  [:p  K(08/(0P <0 0K00 p' R `P0S <0P p00[ ` pD000 S C00`` F Q0#03Q0SS (,`0P 48p Pp  8/ P0 0 PR` pp`8/ PY PW  0 S$0 S 0 U 0E 0CU0003  0  Y0 0 SY1:(,`0P 48p R$0S 0R0B 0C00000V  }<0 S8 ἈLЍ<0 ` < <UM `0F0W 0 [  0  S`V0  0`S`h @p`@pP` W @W  8/ PP @pT `00 501 *p`p  8/ PPT: ` 0P S$0KS] 0U 0E0CU 00030R 0J0 C 0U 0U0PE P30 00@  Y01 ` @0PCUp  08/0 PP000UpIp a% 8/ P`pY0 P00 C 0U0U 0E 03 0@R0 0 0S*$PQ 0A0A0C 0R0 B 000C 0Q 0A000D@ 0PS 0pU0`0 P`FW4PdP `D  RPU @  h00- M0 00 Ѝp@-@ PU 00S  RQ Qp0P{ P { 0pH0H 0 R@-@(*0(@$xRxp@-M @T TPT @TЍp0 Q 0QP ``F0` P 0 RЍpp@-M@P`0S$007000 0#  ۀP( p$ PQ# 0 00CR 0 U S R 0S$0Ѝp00`$0P0P 0 R@-@(嚆0(@ᓆh0P@-X  S H@ @B0( ( @oM33P>p3l0R0 @-@X@0 PQ 000^ N/LMPT00@-01@UT0P 0 !032P00@-01@UT0P 0 !02`2X0@-@UTQP  0 0!0<21P00@-01@UT0P 0 !011000//000/00 0//0P /0-@PQ@0/0P /0P /000S |0| 00 9/X0  \\ $0 /0\mNA A- `PV'Ep@0 Ï@hC12c` P@ R0d0d 00 1`(@@T0P10 `P_ N$p@-PD@@ Ȅ0S,000P p@ ⼄8|G-ppp  P@`嫄 `FR0A0A10 0T;T! 0p000 0 ⊄?TTT&?  0p0@p0 0@]  B0B10< @` \| HXG-@`0耟#䐟P #Qp@ PFR0@pG@A0A10  00 0UPQP H0&&```e8800A @̜< 0p@-$@@ @PpB)O-p`ⳁP% Q@0@PpWQ@Jp `X 0Paaǃ0O00pG.wTaX@Z_B 000 D.l@-,@@0@P0S@dM-`@P@_}P(p0@aa⁃0O⽃00ZO.TTaXPB, ,0( 0  82L,D+0p@-05S PP0SZ sX@ 0CR\ڃp@T P VP@ȃ+Pd/0$0! 0/p@-@$PLP H$FP Bp@?p@-M$` P@0.'wP rP DDM00S 3/Ѝp003/ 2A-@M$P0Sp 0(`0p 0@0p$p<Pp0(04,00S 3/@Ѝ },0 0(p 3/pP 0S /A-M$P @0P Ƃ00 `pP zЍ00pO-pd"yM`\2 0(010f, PP} _@Po 2 w20 RF p!1 $@  0 400|L0  00 0. $(p,`Z PP 80 03/``#P"  ' !0 0 1 302yߍ         Ad+P '%P||1d``(d~U"?? |E\E`|> /ػ . .P00/L 0@- UM0H`0L10ϝp! 0H1P|p@{P{0P`p  S 0$< ,0 0 L1 30Uߍ3 "=<p@-M`PZ@@PЍp \P ZP ZP 00000 P4<TO-(p,@PZP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV -P``nc@P V@0SZ V@H00 +G-`R p@P8/PPV @!1 G-@Q0MP`000Q UI U .00P!1 0 0 30ZЍ0p )P00 S0 0000 zPP 0 zPP z0SPUp!0T  zPp0p pP Pzp 0 P@᧹00 0zP":9/ B/0  Q B  / 0R % B   %3 %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 P 00 0p/0S :p@-0C@0 P 00 0p/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0 $000  / 00$0((p@-P@hZP 0S S pp@[ZRYP p@LYp@-P@NZPp> ZP @ZP 0S S0YP p@*Yp0p@/p@-P@%ZPp >p@tZ ;Z0@- MP@YP Ѝ0ZP 0S00 ZL'00000S /p@-P@XPpYP XP XP p@X0S S  /0S0/ R R   /0 / 0 / CR  0 / 00/ 00/ 00/0 0/ @-/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030< :TPE YPA 0S !1 0 3 30<ߍ(#@- R R  R pP& \ R p  ' 0S  a% 0 0 4 p  00<0  O-IM,M`X$@PPJ L4 p0I $000 0S S  $3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " "  J=00hc +4p# 4I8#8  ~ J- 0S K0S> S" UV J=00 v J=00Xe O<  mSP 0Sx %0SG0S  0S0s S0S J= UV 0  2b"!4b4#"R #< v<0I8 0hJ=000 P tJ- 0S.J=  0S) S LJ͍0 @1 0000:00G0 ,0 OP @(& 00SaLP P P J=00X0  RPjJ͍zPa Ø.. 0 O-`$@4 0MQ@pDH 00020P0CS,I6)('&%$#"! E QWX00 R04 0S SYl#3 0 0 30Ѝl`30030H 0 D@pЍOyQWX00VTcWX/ "44 "8#8 e}pPNTL0S R "44!$$("( |"8#8 DL}PTVT008" 0  :} aX: P00Sj!0 $}T@@O 00~!0 }piT 1i #pYp \1\\ P0 pY@D 0   |T00? YK0pPP0 ppW@D 0`   |T00? D |P|Typ`X  |ꑗl*h)<)l0'H+$'*D O-`!p1 0IM0107 P@p/ <P PW PWD 0@S0h 0&h00a 00  0P 0 0 1 30!Iߍ [: 0VX 0S KP 0 a0 %t$A-@ 0P`p0 { 0P qp@-MP` P@@P@T 0S  R0S QPP@PЍpIHPPЍpp@-Pn@tH$Hqp0. AAS0C .S .R Q P-S.S S /Q P_S /0@-S0GSC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ S 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0Sd10@- $M#B 0# A S0 0S  R lQ  hQR 0S0T000$Ѝ0 0S S0S'  R  R R R/S /0S S/@-&/ 0  00S S/ /0S//0S 0@-P M@P 0PoC@0S0S 0S Ѝ0/@-pQM @Q`P Q Ѝ0SS ЍS PP8#<48#8V R R p `000S S<0 W P 0  "| O-@"2M0`C @80:0 0TpP00 03/P 0@&< 00 SS&< 00  4 S R]  pWp@`0`Օ(448X#8E YC: 0,P0 PD0H (0 0C 0S`P00 03/P @MTJT`GTV `t40Se Z  &< 00 Sf&< 00S@v@P0J?o2X  RXJoᩒS@(0S:@p0pY<0$C$80D\8 Z^4 <0 C,0P0 0P,0(00(0"R= @$4 04 0 30xݍ<ЍS00H0Sf&< 00 Sh 0J'ZS@[ TKd:D0(`S,PG Zp 胟XP0 8Dxpp@0 wZ5 { 0 0{% % { $E {0000002P + "P!0P R R 0   `R vZVP 80LE0S. tS00ZP ZZZ4 !Z Z@u@P'JoᩒX00 S0J?o2/8200D00SDvIS00V$0@00Q @ 180aRC`.@f@0.%pyZ0@@T@$S@@1p@ t100 R@PJ00 03/PA &Y 00 S9 @@p p,80RC.@*r&< 0@  00 %x 8(5$%0 5s (0S ,  R` RR400 0LR@P00  @ P s`P )D L0R4  4 S Z 4S D00D` RPD0D0S 0R $ RZ $R 0`7O-`SM$04 0P0D10cspP _sP  $0  0MY80p00S0  Pw 000 UPs @@PY 0  DPuu@p#h3 0 D1 30Sߍ00Z00 R @TZ 0 .T0@T R@SO d! Sv*0 @ DD@Q0000 0000 AP.0=S} Q0SN SB SC 0S 0 +P0s[0Sb Q00$u"u @S @Rd! S1*.T 0  Po  HP @@`!1 0 0 30\Ѝ0 SRJ $@PF  0 x`P 000S P`PP@ gsesT  P X0 SR @P  0 A`P000S`` ˎPꝎX lP001\// p@-@PP@ ssTpO--Mp/0l?  0@P x8 020`  0p X 0S0S  p0 . "2 ߍ0S0SP;0S pW\>37 p p Q P .0 W 0S 0A\?o20 P00S0S  " p P 0P R   L" l1,P0S$d0 RSS 00 0 bpP < 00@(0p$pW97 g2 G520W0 0S   S  R  R Q ^  ^  \Q/o" SS RT0S 0   PxQu x+0 0Sn QRj 0pS\ %y0P,0V 前P , B  0 00PpW ,00 X,@4␯4  &iP1x00x0 n3@ppP @PP `0V 00`nT0`nO-LM @``Q P@   `P00 PF p0p R R R0 T@0P p R ((0(  [P00 V pW Y 00 YppWV$@LЍTG-XM`@᭍P pP @00   0巍P 40S0- XЍ pP n  0嚍P n8<8 OP 4PPJ 0 O-M0A-.L RO-LMP `0 D@00p840 <0T 8 0  0%00#0(<  .  " xb*. ,\Hǂ@# @!p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpGp,XG4pǂ@@# !84Ga@@ 0"00#VP0p: mT0hV@Hp` J0S@@:p`F ATp@-P0M0`@ 0 00 !? 7R8 bx b   D 80 0 0 30X Ѝp@꺄4 Z \ŸG-T L2MH"0 P00  `p0 0\ @ 0 XS@@ ,B,R0C# T/ .0N ,B,R0.\'^V*00D!41 0 0 30DЍT   Aa B8 LR\P 0FS0 S S X0n(."4n4#0RP0@^*0^0 8< 4^*0 8<` L @ - M\P ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D꺃 D LW W A-p8!41 0rM@010`X0P^00pAtA h0OHh00TA Ό 00 LeP" 0 opP 0@4gP d X0 0 1 30 rߍP g00 0P0cX B| $$0 M000 Ѝ  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/ @-$M@| |P|0p  P  @p @X@`V $ЍD ,XX1 @- 0M`!000ap P@ *  ap f`@ 0 0 0 30*ЍX`PpW @@T PU 0SP@AT>00@8700굂 i8 0p@-P@0 0p0:g(0P7g(P,P3g 0\0PP 0P 00,,hP 00p(` 0@-@ 0 0o 0 0 0 厓 0 0 00@-P M @0f 00P 0 >?o2 c0 Ѝ0 2 00 0p@-@P 0U0 0pp@-@Pf0PPf(0Pf(P,PpG-P0Pm `Pf 0@00 S S0 S S tpPU 00  pZ8#<48#808 (@P q0p00S S S@ 0A S  A0 !@P 0S 0000eP    eP;0@~6@$|\O-P Mp@,0(Sz: (T^  0 T0U 00SQ 0 RK@D@T0`F 00SB000 @D@DS `+ T0W  0!0J@0`H 00S#0AS00  0S000   0S& p0@e0ppe(0pe(p,p@ ЍdP  (,@(}0  Ѝ0 00@- M@P  0s P  Ѝ0 0$  0$0 mP Ѝ0:p 0$0$ . Ѝ0O-LM`U@P$`0 @@fPH$ cpPD 0 @@fP9$PPW* 0`Q QD QR Q( 0S:00S| bbP  `000 @ p R  R/ RY R 0 @T: p e 0J[0J 0 LЍ   @QA@ 0S`:   (⼐띀0 0  ,00p   04`0W G   ``` @` `@T: 0d00d `^ \LQ  QA@ \W ^ Q\ @ , p0  S QARU  R  PP@T( Q  A X " X. X4 p X@  P@T):<X X X 0` `p  `  Q@` ``  `p`dZHK dD^'QO- Mnp P`ᣱPe<a00 00@`    $$Z0 X(0,3(``-`P pZ # 3X(00, "(`` -0P p`QK`a!`Q0#03U0S Q:PQ Y7X ЍX103!0# 0 c@ Ѝ000X; S81`3 `#S41`F2s2`Fs1`FS`FP0h `F`04:0;`0Y S81`3 `#S41`F2s2`Fs1`FS`FP0i `F`00809```E @-pM"\p& @]p) `0v0 0 0 @厺P\u `00 P ЍZ] \ 00\t / p@-\ ,@\ \ Q :\ :Ap00p00A-@$MPI P0( S 42 p|:pB8@87 N8nj;p$`137<Ǡ  B-0@ NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0 0 0@-S@ 3/@bO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ 3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr `  P 0 p 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z  Z Z 0 00  0 0 p 0`Z$Z7 Z3 Z5 0 p 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy7? < < hD1p@- 0@P0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDLt ; ʚ;: @-M@0$!l!L1 !1AL PPU  0R4008 05_`1S   ;`1S0 R0 0 PJ0 0 P7P P P$0 0 P0 0 P0 0 P0 0 |P0 0 qP`1SxYz < Pp0pW  0R  0^pW 0pW  0Rx  0^pWf 0pWa  0R0 ,0^pWGpWD 0 PS00 s^`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 l001p0 a001p0 V001p0 Kxx1p0 A[w^L ^tЍ tЍ 0 &10 0  0 0   00 x0 0 Hԡ | ̟<ĝ d<ԜtT4 @-`0 AM0M@p 0 40 0 "8PP0S sD 80 0 4 30AލЍ..jw x 0,@- M@ pp P7`PP 0S@  Ѝ00S.S 0S Ѝip@-Px AM p00 ` $ 0 @P  8 ,0 0 4 30Aލpwx 0 0p@-S@` P0 @S ZPV 00pV00p@-@ M`p PU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ踗p@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp0@- MP0@0@0@T  0U Ѝ0l00 PU:H@@ Ѝ08800 P@ Ѝ0萗 DQp@-`M x00<@P 0PU  0VЍp_40P0 `Ѝp @@꼖 H 0@- MPa0@0@=@T  0U Ѝ0p00 PwU:L@@ Ѝ0<00@00 0Pf Ѝ0 4xД0@-@ M+ T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P0( @T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP꼕04\Tp̓ē0@- MP O@P Ѝ0 0( 0P Ѝ0<0@- MPfh0h@0@B>@T  0U Ѝ0O,0@0 P{ Ѝ00 (Mp@-@ML ` 0 Q0PP@0<00 00. \T @D  [000T H0 0 <0 30 @Ѝp@Ѝ/.0 T.t4 Ēě O-PM@PP ;  pb`^0 Q ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'<&( 0'4 0'(0 ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @ \  S#3@ \ 0RP  S # 3 # 0T0 0N 0L0 000J 00  0;< O-Q dM0 R 8 $ Č(Ȍ , 0̌ 0 0    $  WPS Ѝp C-`@P@ MPpOP @U _VP@ W @ Ѝ 4@P@p0 0000  P 0S0Y@OoB@#  C-`@P@ MPpx@P @U VP@ W @ Ѝ @P@p0 0000 P; 0S0Y@OoB@# \x xp@-@P00CS0 S  P 0` PۺpX`0 0CS0S P 0 /X0@-M@Q0 0᧺00 !R !eP᥺Ѝ0p@-  0S0@0Q R  004S Ppl@0QR Q    R AQ 8 Lp@-@@P@0P`0pp 00,p@X0'< L,D D0 p@-@`P0pp0,p@ LHH0 A-@pP0`p0 Aꔍ LC-P0 M0`pqp@ HD@ <80  "@Ѝ ~24 LxC-Pp0  M0`pGp@ (0  Y@ Ѝ \2ꌌ L0 0 / L0 0 / L 0 0 M Ѝ̋ LXA-pP0 M0@P` p 0 pЍ蔋 L0 00M0Ѝ4 LxC-Pp0  M0`pp@ (0  @ Ѝ 1 LC-Px0 M0`pp@ 400  @Ѝ 1x L<@- @  $M0 Ѝ LH0H 0p@-@0pP p@ 1p褉 L,,0 ( M00 0ЍL L R) p@-P`@V iP 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M(@,`P p 00PD0 R  P R7@ 0 0 B0 000 0ЍW Q\.Q Q. 0 .Q ^ ^ 0X00p@-P0S@` 10 0C0p< 0 pO-p@M`P@P*W2*00V-:Y `* 00 p pZ+ ᥴ `0 P P0  0P000000Ѝ`<0 PFЍ p `DbPDDaA-RPp`@0ASAA0 0SA0q00C0 <0 eP00`p܄O-MMP/$0? 8<0-0 00=0==0p>0?͍0,0= 00 0P08  L@ H 0` P+ 0S@ P0⯭40PH0 0@ 0Ps0(0-0 <H 0(@Pd00H= K$0 }0D0l>x0d   00 PD0( 0LP;VV 0FS`AO^/`s,~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!   0P3 R 0S .S 0S 0S00S.S9@0W) 9d 0 @ 0 P 0D 0 ScD0C494.800$400000 0 y 0CSPI(00p`@0 H5Z@$`p @D0  zP(0Ssʔ0 oP0 0`PX8000#80D8, 000.0   .00Q$0 A FP0 0Y0D:0@ H;C'|7 0  0 30 ݍЍ|7VW{l7@0h`7W0@e P' dP0⯭40H000 0P@o0 x0P(0e6000#80P0寭40H0 0 0PO04 0<08 BPD0H[@0EW -@0d D;06 0P 0  P)4 0<8 B cP H[40@ C=0;@+A0W 10"3$ 0;A0000;A0200;A4;+A0W$1 00;A%>A C5;}W 5@0#@  0P34 0<8 BkP(0DK 0T*uPp\| `$PP 0(Vo  R @0 Y$ 0d  0  P@T0P`*0@t&DK106Y 0zP@   t6!?C0 S 0dP4 0<8 BP0Dk 0PCUQnP@p@Te1 W2 j0d  U 0  5PW  7@0r40<8`P@C 0PP 0 Py 0  PqL 0 Pi0D[ 0@CT 80BW 008d 0  0 PO`Vf@DK# 1RP0 `@0000=pH[0 0"- VDKP0G0H[ 0S@  0 P0W` )`0d D;9 0 P 0  P40<8p@C 0 5P4  0 P 0  %PH[WX )@):@@02 D ` 0 cP  0 w@P[ [@P 0 DKPpP 0 bPa @ 0 DK=P 0 QP0P 0D; 0 *P4 0<8 B P>4 p0<8 BpPw  0  Po0lDK`%)PD[0d   0  PY)PD[0d   0  PG(P (` (<@0d ` DK 0  P.H[4 @0<8 B@dP!\  0 PPDK( 0@(H[( h/ǹPW0S W M0@d 0 0 P 0  P0`00d D; 0 0  uP 0 d 0  gP0PD[S  0qPr>@0W ?@0 _(@\(@4@( 0Y00DX?0Q P 0 0P?@G!?C0 S 0  P=W`=HKP 00 3=0d PEP@0HK0? 0  0 P^ 0YD1*PPp`0p@ DPY V 0  P? `0d  @ 0  P1`F@P 0Y 0P$00h>d 0  0 P '0d D> 0 0 PW=-@0 W4 0<8 B'P0D[ 0S-C100 Sh  0mP=p`HK0 P03 ၸ=0D[@`FHK`=p`HK0 P0  0DP<@0$P( 0 PU0D[w:Rt<@0uh 0P5x0 H[=0 0-P(@4@$@G0 K04@0C$4$$@G0 A 0$@C 4 0: 0PLsp30( 0#@C3 0%P @)`PVV spP@ 0 P&0T0 0 EP00d0V0@DV  0P  0Prp 0@C202"0 2@0 0Prp 2@02"@0 prpP@ᘵ 0 nP0T0 0 EeP00d0S0@DV{ 0VPs 0MPqp1!@G0 $@ 0@X0D:W 0|!@Cx1 0{l 0+PPqpWH1H!0 kbdcc{@c`baDVb\$L``_4`___`_^`___](^,]\p\\R[HJ0[ZHZY,YXX`XXPWL 0-@- M0@R0  BPP * Ѝ@Ѝ/ z% Ѝ@Ѝ/]PRp@- `@#P}PRP0 ?p@+<@00pPRp@- `@P[P0P0 ?p@ <ݴ00pp@-@Q `P;PP0 ?p@;꽴00pp@-P@;P  p@ p@p@-@P 0PS <0S P 00p葴00pQP@- 0R R  ~00p@-PP Q@ @Q Q QT0 D32f00pP T0DS@pP p@-PP @P  T 40,D0S 500p T@pp@-@P Tp (0":k0cSp: A pO-0 -lM`80@pBAPٮ40S @P0 0040-P-+*)('&%$ 000P00o 00@ S@ 1\00C10\0@C 4 00@ SY EP"0 A 4`4+Q -Q0$00$040PA UP4` 0Q440Q 1PAUPR>000ZiQ IQ NQ<4@khP 400(S x  201 0ZnQ q W `lЍ 00XS 40P P00] W4000S @ lЍ z\ 0gkR0E Rk0 PJRg{[{{0S, 0xS0%bP) 0BS@Qf S0 0 {k{'{i@00 0gP 0 S? B P 0,pv@?A9 |6< H N3?L\ @, $ Xp pQ0QKpGHSE[S0SsWiXGjPPM 8jPH 0 p 0zj 0Sc P |g J @T D 10jS*k&0B: @7W  L1D R@0s {{7{8hhh h7h`P   ! N TLjP8 iPP LTQ00pC0 A0,pAR Q6`v $  z 0BS@Q S0 0T(3 @d [k{{DB' T'{`8j`k{'@P{V@ D$ k@aT T74T@Ka@@@7Dj@{@{ 0Q $0@0"00 P@ P 0SAPK \4  0PA U U440PA U(00040Pj 000Q P 4 0Q `1 AR`400A 00100s_0{S4 0PB1G{kW400 >0PA400A SGQP40PE00A SIYXU:$0SPel4@zfP hPP 8)hP( 8g([88 hP8,p 0S55  Y$\ 8jghgfg dg bgQh`P,p`Th`PP  f RWD ۟4ğ [ 0T0j[0S {۴ {:S03:Wg۸M{M{ Qk6 C A@{{ {*30 ST{@0$&0{0G={۴}Z8,p g g g g gßL! $ 긻O{@{7{d۟WD M{M{ Qkf{G > 0W:0:G{G6 @0$01xŸ0 0T@T0 0480` < )c0@ SW PP@0S46Skm{ r۟]s{M ^o۟MM{^MQzQ!#{`@k`@{'QV{D儁5AD{TdAk{' Q{XFDQ@5́Di A5&B@D {0 { *0S{~0*R:s 0 $0 0~ 0Co0 0UP0{S0 0G{1W 400 '\?A5??? ||N P ` {۴J{۴SR 0,p8$ P `8 LPR 5 e8 f< 0@J0kS30 bA!Fk{1W 40{'05&D [  0A$R 0R@R$ 0 0P 0 0RA@40@0C40d P40040h,pPK 0Co0 0 0S,p0S 0SA [8eee e eT  1V{ *0S 8PT  `PX0T 46$ (@D0[ $ ,pw Q R@0 @'{{7{[@0#S[D 46SV00jS  T R*k&0B:@{8{{5?55?P90* @00,pD 46S400kS0S0S{ fPY fPrD0 T8 D kRB7R$eee e ejoT D 10jSQ@Q R# L @{@{7@{8 0$@@R @04T@.p! R  d*'6B#::D00@0!W,p0 8$W AfP |fP"ݯ S |08D@0\jQ pH S80 8$3!knP?0 00M 0ЍVt# SA-@PU `40Sp @ ፫P 0S U@Dp@-P@}PyP0 S :pSSp 0R:pp808 80 e|$0$ $0 ft$ܣ 8$H$ $A-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l 0 C1T T0T 0 D(< <0< 0 E踢 `## \#"p \#"00 ⎙@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0-w-x000( 00#000S wS -S rS  0S /xS /  @-P@20 0 0 P P//0S/ S S/0S/0S/@-@᫧0@0T S R RT/ ?/PP/ ?PQ/?SQ $0$ $0 p@-/  ??SQ $0$ $0 p@-/̝ P P P`/AQ/Q/Q Q/?0 H0H H0 p@-Q/?S0?/0?/ 4 8QP00 / /@-Y 0  p@-7P 0P(0@`H PጤA0Sp;0@M96@`pp@-@P0 ESM` aЍp  Pd0S   p@-@PpP Q 0S P90PS9p@9A-X Pp@PEX `*@P``O- M` V" p@IV P @P0SV F!)`F0 `1 Ѝ Ѝ 8` -BM MRč dd  X @  PP1  < d0@- @-`@# s M Mp $( PrN TG "  r" @$@p `PѦ0 "l2 0 $8 30ލ Ѝ5TB^T"P @0ᴦp 00 B^P.!0 :100A@  0 0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\6S | H $  h  4ؿ 0 $\  t 010/C. *      RA-P(M`p |@ 0 @0@0 P0 0PT P@ 0 (Ѝ8 ĕ  X00 5CS  A/0cS#:'3R31 3:0CS!2# 0@-@P S 0\\0 0NO-PM` p @P-Y] +Y @0I 㧦`Gp"..@0I \ aIQW IAIQ7 IUT^RQ ݩ@ 0T  R Sn 0J00 ЍS T0  Ѝ0Y U P`pPpb0 0XQ AA0@ \QUPpbPpbꙙX0BR"\0@-0 M< 00 Ѝ0@d@P0T0P Ѝ0 p@-BR"^p@Q@Pl0T0PpO-pM`@VP-TP0 +Tn S0T W  p S  00b 0 0?0 0ϣ 0  ȣ p P P=Q PS \4 !Ȏ\ @00D ^a0DSW0DA0DS.70D S+| Y[Q PS \ !Ȏ S@` ݨ"00֨"00 0S \0F00 ЍS@ `?0v0T0k XR A B0A PR W p ^ ppZ `@p SWMppM\0BR"\0@-0 M@ 00 Ѝ0@!@Pᅨ0T0P Ѝ0 p@-BR"^p@ @Pq0T0Pp r  Q0?0S @-P-- MY ЍЍ/G-`Pz00PE! R !U5  ዗G 0SPPU pWU@@bPp X 00T 0 @CpG 0p00F 0 @0 0;6A-P`PL@L@0 @@p 6U  I Ax ,$p@-@P 00CS0 S  P 0` Pp6`@-@ 0`00@- M? ' Ѝ00@- M0 P@ 000ぢ H0 0 0 v0 (0 0 0 30 Ѝ0P,  O-M Q P  Q  ߍ ( &2@P 3`000 00 p@ṐP 0 0 0 " PA R R R#Z0 @R 0PU@D:PE[ Z PE l @@@p pZPEW R &40 0 00 R R0 S S < ^PP   IoP /P !Xa*0YU ı 0Pp P` R R R RQ X4* )P  R`}@ pp ᆡ R  PET D ᐡ PEp[  m  U *(2H `P p 3(2H p Pl `0P`p43`_`] H1@-0pQ4`0! LMP D - @.0 P) V) pp0 0 0 RP S3 0  |0 0 D0 30LЍRPLpp  @ 43TN0 80| A-`P@PpWM) X PP00Ѡ  0RP  3 0  ЍXPP h@2T Ѝ`RP pLL0S/ 0S/p@-0P00 00Sp0@` 00000 Rp` F`Q000pO-pp#@l3 0OM`0410Q`1 dh`P0 Q 00咥/00 Z.` P 20 00 [ !!.PQP\.Q Q :0  0PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O 0 P00J ` `0 0C S::  0  ` @:[ 000(0,$@0ڟ0 0  `P$wP00 0 0 41 30Oߍ Z[0000<4 PPS U.R  :gP NM<    p O-M M@x0 Sl:0p0D50t50 $0 00<:%0x` \ \ 0 0*9 0 D5 30bݍ Ѝ)0 0(M/0P(0 0@ T S#PX (1|50 0 P0  03/P  T:0 C/o"T S R^  0P$0 XH%t$(0txᤐU'x0 T|@0 0L0 `= `<D804 ,PXP0 C 0M P0  03/P Y  ` ZV `W VpG:(0,0@0(0<Q  0d0D P0ST Q  RM h <p `B PZO[P0 0 00PR ! RȠ LȠQo \ V\pp0XP &0 03W <0S B@Gq 0P!SP" SPSP@Qp$`0S 0 0X@@ @PC0@P0CSX@:@p$` @x0D0 C0 0CSX: j04 R  Rv Q9 0B'RS] PA `=,H 0`%2J0 SRO40 80 r `PC0 { `Z$8X00 S58  X0P($0b/0P$ R R < R0$0P0P `VX *P D Q* <0X`0<0D0S S ]00H030 0  `P0 9 `ZL @0(1Q:*(P䶝P PXP寝0 CR00 SX@0(0,8t PHp᚝0XP CR00@S<@PX@ 03/P $X (0@(C 0L0.0P ( @00(0(/뜢0 $  0%2{  0p0!40 U8!rRj(彘$0 PXb0.P  0  `PZ0 + 0Z0:<0S$0(P@0(0'`V D`(>H 0%14,I  G-M0p`@P0P0 0   0 p`DPЍ 0 8PP A-M`pP@P ,  ( 0  P"0@Ѝ, 00Ѝ0@-RQ$M8P@'0S9 0S0S9  04 0 0 0@PP 00$Ѝ0R R" / 0 0$Ѝ00S  0 00S000s S 04  0 | O-DM @$0<4 @Ph00<00 (+0P tPp``-0 `!PP ᢉP ,0  0P0ß RR RR 0 Q Q 0 R R < $0|$0@P s p`  0S S S@ 1Y g*@c@P 000S 0 R0 ?0I@B Z 0 6 @DQ  1 ˚  @Dਗ਼ T!:  @Dpບ0 Sr CF P`0  ᬚ@D q [p?`ቚPT* P`,,뮟 0  0h!T1 0 <0 30IDЍ(+I P ` "P@ڣ P2 0 0 0嬟0 J` P`0 0,,  0 y, 0000\00 `G`P 8 p@-M@P`80 00ɠ tЍp @-M@((  9Ѝ@-M@`p1PP0@0 ) <0< 0  0 p[@0ЍXp0@- MPP@T x 0 P00 000T 9 @ Ѝ04@T001!0@- @ 00M! pP`0P! 0 0 @ RJ0100 @.PQ 0 Ѝ R0XS 00 9P0 P @ A Q QU ( ,$04 c#!$c4" 0]0 O-@p" ,MP $  P \/ 0 "x2 0 $0 30,ЍX"L2 0 $0 30,ЍOgP0:U000 0> U@ 0pp`P @0 ịP01 `V, @ pWVp F P$`U 8#< 400SO U0E S0 sb\ P:U@  ႋP 0:WV 0S  $0R 8#< 40@ P`0S P@P$`@P.Up P$`UP=FU<  e p@-(M00P0 @ `$ C+P* ٓL @0 0 $0 30(Ѝp舝 0 F<  O-lM #03 0P0d00 P m/ 0 #3 0 d0 30lЍd#X3 0 d0 30 lЍO 0 4 $ ( , 0  00h1T@ R@TP 0q0S P q u XP 0SP q, u00 X0S PX$Up#40P@b 0@:0Tp0*PUY 0 SY*  0CR00R:@+{upP40@`b 0\!J0 |*PY9@Tp. U00 S` V,*:0UT0X X- X@P0( R0 J P {P RU @Tpu0 S: 0 ': 00@SP E <  O-MXX P@QpK ៍(Z> U U U f 0 ᙍЍ0` R{  ?0Z& + EPP 0:/qp  00P @ P L)00 0 00cЍ耥p  #0P  * R + L U[ p  0n#P 00 0SN  00 0:/qp 00 `P¿^ 0? <`V<X0`v R0始0~ъ0 j0P :/qp0` a 00 0`VÿR <0`VÿpX0PYKS 00 0^O <?` 800C`V0 Yᬶ + [DL`0`f? ` :/qp= 00  P  @ P (00 0`Y 00 lUP&0S#: 0C ᠌;P`T 0S  0C`ÿ00C`V0 0 Y0 0AI 0^ @0^ T(00 0 00 lh- 0 ` @ O-S$M \0@  H`p 00#p =0 0@H`# 0 B0S0 Q6  R00S B0 S0R ` (' PP ԕ00[U X000 @PL  RWRY 00S ` R00S R Tu*D00 Sm P^ TP`p^[  C0 P CTs ^a Q `  H`@‹3 QY/ P+ 0S " P 00S U0S S" S' S- PP000S 0 0%T $Ѝ`dP`V=W WS SSQg B'p@-@00PFG p 00p 0@0p0TS00- M0 3/Ѝ/ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ R R R //00/00/ R R R //00/00/ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ 0@-RP M@ R R Ѝ0003/P PP Ѝ000P3/P 0@-RP M@ R R Ѝ0003/P PP Ѝ000P3/P @-RM@ R R Ѝ003/P 00S00Ѝ 0R0 02/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/ЍR0 p@-@PPeP P0 03/P U 0|  0p@/003/P U 0@ 0p@/@oppp/M A-PQM@p` Q Q Ѝ0 03/P V*PX %000 0  3/P P P PЍAR X # P` }0SP$,L Թ ;A-Pp`@P  R 0 R 0\A/W 0A/0A-@MS`pP  SV ` P RPU U U Ѝ$000SP Ѝ VP 0SPUq$ 6# P`u0J ط (#00@-S M@P S S Ѝ00 03/P 003/P 0  Ѝ0 000 3/P 003/ Ѝ000@-S M@P S S Ѝ00 03/P 003/P 0  Ѝ0 000 3/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 / L0 0 / P0 4# /0 48 ᝂP @Qa ᒂP @Q` ᇂP @`VT* P ``V{ R\Vt .V DA y XwP Q.Pp  P@] ] Pk  0J`S`P0xSM3000 D P XZ0``/Qi ]QPP 00S1   0 ]R(S  0" P XZnP   R0 F b" R` V` `A ` @R^ .RP @k@ P  0D0C   X0](00$ЍW00P  L`   V 0S000PZ X \0Q PS0 T 4*@DT[@ XZ(@ X000…  Q  T 4*@DT[@Z X ` \A <> 0G-AQ@<*0pS% R3 @R`P00 0X*  000瘠    P 0 S00NAS 0SPQP!00P0X(00d PRO-P3P# M0RP3U p\` @0I @R: R R& (000 ЍQ*@ ĠS? A @ G0RPR@\ 4 R @4 S0A  Y*@T*0PB0 A\ Rɑ!" 40S0 4 0- M ЍO-pS,M@ [ p 0pS 0S0^Pn @^W \iS0 0P0[0Cpp`p0$PUO P0S @Sm  WE@U `PU00 S 0Y* 0 B>\ A X P00S X(0 Ġ?  0P R XAS"`!0PU`0\0[p 00尒(00,ЍPᩒ(00P0S 0 Q* 0F S 0S 0 `  0AU_0S ! " W@mX0y  ABQ AA\ QE    0B>S( 0A S 0$P R0S  P\0^$p?0,4 B0A000 0RMP600$H p@-P0 0M0 10 `00rp !@p < 40 0 1 30ލp@:D  A- `0 0M P0 10@0 (qp 0 p0 (0 0 1 30ލ^:딱 8 Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C|(00/C/G-`@pTY( V W TtP@TY 0P?S  N00I(00 QSp@-`P@ EP`VP@  0R p/pA-APUQ?UU@A`pP W ځ1AP(0000?00Q A@-?SSRB 0@S A00ݐ(00/-- M  ЍЍ/@-M@ p TЍR/0-S0 \ S ^000O-@ MP ` ᑊP-Yg +Y` Q0Yi T@ @Q :9`pa}VP09`psVP" [)SQ" K0I P0aIQW0IAIQ70IS| V[SQ;+B=0S \0J00 ЍQ `Q0YXP  A@0L ^P @T@@X0BR"\0@-0 M< 00 Ѝ0@^@P0T0P Ѝ0ĩ p@-BR"^p@K@P0T0PpA-p 0 0rM@010PX0`^00pAtA0O0 TAΌ`p`0`L PP m$08 @(0 0 1 30rߍ-8 t $$0 M000 Ѝ4  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/ȧ O-QPM@ ^ 0S000!R p!3  ~PP E`#3`9P*Q30A 0#1#2#4#8  P2   (0 A 0U0 pQ*IP 0@pQ 0S  ЍT 0 @00Ѝ 0 0A-@P`p70 P8$0$ 0 M Ѝꌥ T0 0p@-00St@@@pdPddP@P@P 0000 0T xO p@-P@ p@A-Pp`7t@t@l0@ @U  Z0<0 b|  A,p ,T,@-@P0S  3/000S@襎O3d11 "@(,p0p P$;t-t#"0l-cR:d-c2SX=  PP 0 0C@aa0C0C Cr  \\-N2?#c!!"N ,  ! bQ4-5:bQ$, !,-#c!!2N0 p\ 0 S 0Y%0 `R 0 S ` 0 `0 S0C0h  B1;Q/0A!b0\P  tY0 `R 0 S 0  B1L;Q/0A!b0\P  TY0 `R 0 Y0 `:Q0 0\P  1Y0 `R 0 Yd0 ` (:Q0 0\P   Y0 `R 0 Sd /09 b !QQ0 0\P  Yl0 `R 0e YEX9Q0 0\P  YT0 `R 0M Y-0  `;@0 {`28 Q0 0\P  Y#0 `R 0 Y(Q / b !Q  (0 \P0  Y0 `R 0 Y'Q0 0\P  hY0 `R 0 S Q T'(0 \P0  NY0 `R 0 SU#P&UP"&Q0 0\P  -Y0 `R 0 S6Q0 0\P  Y0 `R 0 Sp040080 0<00@00D00000 0 P0%\P Yr0 `R 0j YJ 0K0 S0ڜ YZI0`Q0Q R`MYJ0 `R 0A S!004%2?2c  1R11Aãd0Sâd0CS0c04\P0 Y0 `R 0 Y 00   0  00 S0R05`003\P0 mY0 `R 0 Y0 `0\PS00X3 0 JY0 `R 0 YY0 `R 0 Y0 ` 0S0 @ 3qp dqp  @Q2  0S! -Rh Sf! 1QR'0Z0S@)@` ϠϬq^Z R pSHp0W h쨟츟p Xp@@ @@"V堘(q Y.x|X5:xxHP %^ ` 3#`POPRU@0p XEW`` ȧ p w@F@Fp pW%GpG@@lGx@'Q_Y$AdWO@P1:X8G.BHWN <T3#`PPS@X0 pV弦P@D0" ,!,`AXR o``&ao@划Ꮂᮝ !R  ԕ (!܅ Y`3#p W0C@ STD05Hp 00c\0SL \8;Q0 0i`@Qqd(8JPn (0, UTA WVH V07(0P@`,0Pp? 00?0S  S   (,  0 9/P(0, SRS@PV0B!00u TT00ЍWV `Vpb p-ER  80Ŏ;0R00 0;0800S< 8 0S Q{@#Q!Sz RW0ST 0S ``VJFm F|`1 Shp  [:1S@PTJ#M @A$(0, 0/0S/0  0 9/P P0Sj u@Dk 0PES 0N?7c ƒ c l N0?C?d` `aG`0da2@B#&>b`. c 0! 0#‚+a!!!0C0"[oÏ(" ?00 #2>[?G'PE@@GPD2#"P*"Pr D20,W#10 ?015: 2 0 #"".2Q 1 30 #1`0T!2? B4sppp0/SX0 p c 0y!+:60 0($0(>! 0+Qd!_P!!!0C0D![Ï(" ?00 #2>PVXi`v c 0y &: 600*$0 *>!!!0C0V&) !"2 >n:E.€Qk9_u"mnSc$IųQ\(\ףp= ףdQ)\(\sc 0 ay8 +:60 0($0T (>+Q!!!0Cl 0[_("Y0%R^PP0 0 cQ@ R0!V BqgqgXpC)1? c 00%y0,!):60 0($0!(>X! 0‚!!!0C0t!YÏ1(" ?00 #2>r?D0C00!/A!b!b  S2 B ("502c2c2A" "b1C @S/  0P08P2X!:#0R ό! UZ: 0"#2>"Q0030#0000T @D 0 S0@ 0 0 @$0ЍDv)1?c 0 0x0x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@}T 0 @-M00@P T 00t0(0Ѝ 00p0$ O-@P`M 0S9  V 04[P? -x PQ%  .  0 ! P  0 %0R R !P  td}00Ѝ0 S, 01P0% V 0VP? w 0.1#0 P PQ P% V0 R0R㨡!Yh&0P l6m&NSp@0GSHl`P [ 0S0ƒ! ⃡10hh "0utY OX1000\11001Y <Y20`S0S >S@1S*S0S -S0 C Rp@0GHN<)`h0hlpt 4t|Ѝ*YY -Y00I S@0IS0  S ,S;SQHAL f ;S,Se SmH^(- Q 019mPhjp@019mo\@ pKph6Pc^p@L 9 bp&k htl&ug> 00 0 0N\hP s00@ @s @  P 1 00A1 01P00P 0,Sd0(0P 0SHL Ʌ ah& `p& u&g.tl60$p ,`0ട`p $  $cR-:$cR 0#031`002c2c# b?0cYZ  [  R`p K  4$L)P 0 S 2J$`p,`0 380܃ 0,p0`4 cP":cP0#031`002c2c3`?0cPpcs V P  P㞋# 03,3(3,p01c000`[048 02,p0D004`<@p@ `08@Z"28#!BcRd:x"cRD 0#031`002c2c3YTX @R  *PŸ Zcc Q,  \Gce Q!Q*R/ ! !c 0p?0  c@`(0X$ $ ( 1 0 Y  YZ,p04`8<@@g>fΌ00t 0HSl0Ű1p,`0 QdQ)\(\ ף{P3A-PQ@E 0S ɀ001N  phh6l6r`n`P 0:S eP `VpFPW N hq0PPT`VLPNLg@P`_pdPpV=`P TJA-`PRPpP qP@@W(tPqpQUX  P>TI QQ 1!0 t0`000V0 m``P v}=E0C0C P S\P0e/PE9  lPE0P0U0S0  1@W@ࣶ MN  hzqT,pDPP\ \\ p 0 000#@Е D,ISdd `0@-$0$0!@R !  @-\FH0H 0-  @P000^ N8 PD0@-00@S $000S 3/ꠊ|p@-TP@Tp 0 3/P Ot@Tpp0A-0`pPB@P UP 5t, 0p `@G-@R p@@T `ᗆ% :/@DPPA-@p`pPIT P t`L2P @0L€:00#S €^"R'Ȉh0O-`Q MP倱xP2 LB0/p P2T- P R; S P@T" V0S !Q L/`3/L2 S1P2S?T030# T03S 0 p0p@T@@P20CP2P2SW pW ЍS @  L3/L2 S @(  ̆ [A-!p0 0MPQ010/@``0 80xA|A8OU8`@TA ``p`E1`N30@L @0 0 1 30ލqrT 0 H4 3 0- 0 M Ѝ43 @ - -M00$  0 0 0 ЍЍ/2 0--M0 ЍЍ/0 0p@-@PX]c`00CS`0p S  P X0` X PXTcpX0`t2 ,\ \0 `00CS`0p S P X0 X /X 1 ,-40- M,0  X ЍЍ/`1 ,-8 -M0 00 XЍ Ѝ/1 ,G-p R`@:Q !SIpb0"P U U * l0J0`0+P2P l 0 B 0 0b P0PU` ``P+P I(npC0 00 bxq0T @0 0b Inp--M  Ѝ Ѝ/ -- M0 0' ЍЍ/@- MP *pp`P/ z@P, *0P$ Sʤ00`@$ 0,0 0 ( 0 0Ѝ 0'eЍq0000@Ѝ.  < Lp@-P9b@$C@=bpp@-P`@k R T0U:T0T:p@kqRSU@-l00p@-@!PR ! 00 0S 0BPQ`0AP R 0 U00Sp`P0_P `_P 0 p 00A- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ ^110L00 0A pW \00W00S PA0ASP0@# 80p@#1! L0  A 0A衝C-@p0T@1W MP` 8p |h1p0S D!o00@ Ѝ00p chp0S   jp0 @! p@O-4Mp@ P o 0` 00SgSe %S0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK0 V & a0 Q S  T l4ЍPP؀PP؀010 00C0B Q$ROLP00F x8 0S0V `1!(  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p 0V `1! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B Q@ 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S  pD 0V `1!ex) 0S0V `1!X V  x 0S]0V `1!G +  x 0S p (  x 0S px. 0S0V `1!x0 0S0V `1! x 0S0V `1!xs 0S px 0S p 0V `1! py p p xp& qp jp cp"s R 0V0py V@ `1 | x 0S0V `1! | xr 0S 0pT 0V `1!u ; x 0S90V `1!f ; x] 0S  p/ T- b* p# p$ p7 p#l x 0S0V `1!(P x 0S p[ x 0S0V `1!  xn 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S ppx& 0S dp@ x  0S Vpz 0V `1!  x 0S Ape 0V `1! PZ X PU S PP N $pG PD zB P? u= P: p8 0B Q@ 0 B  0B Q$Rm x R 00p @0V `1!C P C p P 7 p pJ p P  P  P  P  P  P  P  P  P  P 0s 0 S p 0V `1@! P $Rt@00 P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [ PX Vx 0S 'pK 0V `1!l P@ v> P; q9 P6 l4 P1 g/ P, b*O-oMM\ /H0@? T006000T!R !0s0h0`00  0S   R 0000@0D?\00d00ܐ00 0@(匐D0hXPU @%U0T  ` J 0 R 00S0(U` `P0r$P0 0FZS|98Jw]_ p%nWWN*8`rPYP    RZ00sV P=*X1RRdXOX>TQ.Cj~@QD,TDl(8`G 00<\ T@P@qYP@@0@ 0@00'00F@p`A@00F S$V $@GPU"0T$0S+ @0S @;0倀0@0S0000XX - +; 0 6 30 oލЍW000P P:00g  r So ! 0R q0- r  R 0  @TP@@R00S= r0y@ , P L 8 4  V  0}a Pr0 , @P0L08040!$R     P R<  儠 `@VS 00S0r0000Q(1S 00S0001G?000Q(Zt ,0@DT 0L,000p0S0^Q@ ZW@@P6 0 ($0 PCUv<0Q0(吰?0400S@@0S 0 1 00040Sx0| 0t0 7| R1|0Pp @x0P0CD0 ?0P@0  t0S-0r0|080s ` 0`s0X040S)|0SD @008 @CT@Tڐ  Rp@ Q(8`T`FVX8 Pp   Z ` Rm  ` Q%( 0CS@@Tڐ00Sp@0Q/(`T`FV,V uDtp(Pp@`FV 0Sp0Q2`F Vʼ400P`0 0 $0 CZZ5P0 `p@(PJZ R` QJZ@ p5 0\00RQ(LS따吰P T ) (Pd`@DT 0S0Q@D T 60P0@0Q( S따吰P ZwS000P) Q70PP0Q bS000P=<000 S0`Pm` D P Bp Q(0 D`LVfhR . Q "S000P Vt8P0 l@@`(PIY R` QIY l@ `90^`0r0JR따吰P  R000P U `ڀi(p`@ PEUU0S`0Q  R따吰P R000P R000P( |T R`  0_Qy>000(0h 05 / @)P pDQgh>0(000S0(;00000Q|( 0 00 `0000S000Q(|@T0D 00@00P 3R000PD0C(0p0 S R0@D0,0, 00,0@%@00NS `Vr0 x|p @ @ , P@L@8@ Qr0(bQ000Pp  s4 S ph R  mRdp  ! #2 g @ 10  g 0@0R00S000Gp@V*ڜ}p(Pp@ 0 `FV \p Q 0 Q000P Y@W Q 00 0 WC@ ? Q 00P?  P 0b@! Q 00 0 9LPPU\.s` L ,0 4`(` 0PUSp4UPEI0CP QW ,LXX ڐP? X@@@TT80 0ጀ@JZ P@QJZ  80 @L^@( P따吰P Q 80P 80 P 80P P80 Qu s],V /@ P `0(@PIY R@ Q P P P000Pb {8 10R0bB+ S- C S!!/ΟN#cS! C0 `0 `000@F0NQ*pNn0 n]00Ch0h T r0, , @ , /@@p P@L@8@80`P P;80 H000 H000000Q 00P0QH0000 H000@S0r@%SH 0 01H S-0`r0͵00S70 0QH0000 0H0P000Pr0(m0 `, \ ` Q(00, @p/ X P @L 4 s S4 ,p P0 S <my_PXL`P`,8p<P"# . A RJ $\ ,\0\`pEE ,\ R000\00S0 08ʱ [ 44 ?aCoc?`(?yPD?@4 Tb'0  DЍO R   R8C6h0P0U TZ T0 0 DH@J$Q 0S  0P0@ w0P$0; $0`e0P$02 U ,0W   `R`0@0 0 Rul1 01{HK""0 1 0k0KR k0{' [[( R {[OJ:[k{{+S 5A; 0+C 0S31Kd +{0k{*0  G{5Ck6kʫ+K P'{'k&[;*0  C{7{JG[2[Z SPS0:k{k+S 5A{+CG{5{0Fk{J0H[0 2 0 c01k""k(F[k 10{0[% PF[[ P 0@XCZG(0S[ 0SSp$@ N`Pd  0PP0S0S. XYV Y c`PK $PH0W'  W9RpG   t$`P3F`P-$ @0P$0&?@?$@@TU 0p C 0, 040$@npX 0Pi@P 0Sh(0J  PQP 40S(0YXQQ0 R Y Y S@ `P $P9U@ 1PP$WZ 0SZ O pPpIG0U 00 G08[ $$PP01 00 0 0 0$'0S0P$0 ,0W  aP$0 ! `Q;${0KC[0k*0 F{7@{ k[3{Ck6{4J<0 0R?0S0u0 00\ {'{0; Q {'kkKE{{{7N*N BB*N@{*0   P0y< `  s0R 00P 0mXw,0[P   `P 0Z  0P0 P0P00W0SpG .@4PP   ! KTP P0CSg  s9R  0   00P0 070b@(u$PO 00C  0`P 0S40SD G0 4?0000Q[ 4Q0K: 0[%0Ck{00[{ +S 5@$X0SY 9UP p9 0 :$@?@0P$000  1 0Q Y7 Y {7{E{.+ P0x <PS EX10S 000* Q%ں0S$&R !**R UP0 P 0wPt$0SkPpl0S0r 01 0 00 M0IDF 0P0 40S G044Q p9Uo X1P, 4   9P :#46*0/Q46*0//P@-@00 R@ P@Rp@-@`0P0RP* 0PpP  R 0 R VpP !0@-0O- M@SX@DPqapTVq!`$:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ0- UM0,@P.0L10R  0 0  bT 0       TNSP ,Nd@-@-@-Qp@-P` 0E` R #@P  IR00pQ`0`p@-`"RP @P  3Rp-M Ѝp@-@ P` !LNT !@Ap- M ЍP/L -2M")2b3c1@2`1  0ЍC0 00/ 4{-0M 00 0{ p`Ѝ 0p@-@Q r  P p0 S 1P p PP   ! Q @0O-M`pD=@0D0Q0P95X! @0S S[ @   b 0P15  P T@@  0  "W @TQ 0P02@0  0 W` ЍQf@ 0R AX00@P00  m 0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 =T@P@00V"000@000C @~ 0Se0T0 2a PPl"! 0#000 0 ! 0 @ 0~`@P !R/0S 0C0/ 0RA-@P)p`B @1V@ * C BQ   `iU0 pg3701V@ * C BQ   UUb e PPO-p -|M0<80@0 XP0d0p00`l0-P-+*)('&%$ ah000P0 0 00@ S 00(00iP@!T 0PB!T00@l@0 @ R \ $ EQ"    lp l  +RO -R, ,  l  0B ^lp 0Rlul 0R 1B\lX  d$ JR 0 R* /o"0 ZT@gkXpp XFڐ: 5g01[5[X 0S 0}S} %0hSpHpt0 ,0pH ,hH Pp t0h0 pLWt0* t0 0ht0  A R8 , QpCW& pWp hpw0h000(0, St  800Ss,080000 00$ ۟ 0$ S?˟ B @0p$  0HL0H@8 P{  L ! OOp0- @Pp p   !COhPt` E Pa R$0@0P, C0E$@ PP0C PEP`PU00 S 0SPE`FK$0SfEQ<8 0StVl[  P3  PP. 0S0S> ` 00 pSp Pp W 0Sp#a V380, S0d0 p [u0[`q KQ 0Z00SaM<00P00400h 0#Z00St0D0I `\] `P \QRT40pS  !g p Pp 0 S B\K80, Sh 40 B0h  WD0h t00<0CQ?o20S )K{8Ik{ Zɋ%0S    ?@V瞯<? صN`?0Sp|Ѝ 00XS `l`0P P0 0p Ql000Sd00d0R lpm d|Ѝ 0YiR IR NRl@BP 000l00(S0d0 0p 00nR 0p d0lpP)  ^PJ Tl e 0B Q$ Ql  l  0B Q 0pHpWt0,0*W.  @P z000l0Po `00W'"!2|r0{:#:?C0C0  AQ' r!zGpGp4656:RH (30{0  QH 0R l 0R l 1BQ=l0 B`$QP0Bl 0B Z0l 0N0B ZL\#,Qj{p Pp h00h0<l@qP@ l0X0Cl0h Pl00l0 00000p d0s^ 0pHpt0,0pg  4Hk01{p| W'"4t0{ :#:?C0C0  AQ' Pu!zGpGp4656:RH T 50{0  _000d00H  0BPt0,0pHW 501{',PrR  OV 00p S0lppA800p80 t  t  W p!00[ K Pp p800Ct0h Pp~ !T T  TTQʬ$Z<^t0:Sd2 0:6tt0,0`"0 0 5S!{d 00'  H oP. p840S<00:<0P0相00cP040S p0000 P JXPX0 X \$$dX10 300 $ B1kd00 {0G G P {,AOCpl X4 00  h{  A1{'kd00 {'0G GP Y0t0,050`m A%T0000,P0d0S!00pd04Vp_ 0Sv ph0 |tQ0k,0 00C  t0!0h d0VpU!0Zd0 08 ,R0 PP{ EPt0p 0Ct0 0hd0Ppj0Sr @ 0 00p d0Sb p 0p000,0t0P0d0Z!07 d000# [00Sp 0 VZ F0d000 3S 00d0 #Pp  h`1`f`Ph00h0!0d0p80, pSd 0S!0d00S(00(0t0h 0Ct0t@-00,O-@ 0Q@P MP`PV pL@ 0P  "(%(!( Z"8J@ ZpI3q WG N@ "8!8P0LL#8S 0Y  0  0 ЍU@P   ! lI``3ß0O-M 00@Sp 21`C`0 00 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 Y \ 6 Q0R T0#03\0SuWa* G0V*0F@S3 FQ   M0WN 06S ЍW*@DPD@ Q0; Q0Q l l@@ 4 Q:@00XS Q0n MR)AoᨂX " 0^0 n120 00 QP0Q0l1 c 0R:|00Q )Q 0ꀣ O-M<0 XHX8@`00Sp 00Pu0P0P0  EB0SG^E@0= PPb @0 Q ES ZH P 0S S SD `Pb@00@0 00Vp@ !LT 0 PeS5 q00@00S Z 0 @\Pc R  BPPb S@0D0CSڣ0SPX 0Sa G0 0TX 0p 0 Q T @ T TD^ @LT 0CC10BgP0DSy`0 S0 S C U 0S S S LP@"00ЍRq  BPP+\~ -\  L^ ?L NZ P\ #LPNU PPl '@Ѝ \ 0PP0Q 0S00 LS S80S #000 0 b@0ML"00@C |`P D21 `2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf w0 S_ K@"00ЍP@0M@E PL K`"VpK`W  `21 p7  ` PEF@Q@!80Sj80S 000i U U E P 80S800c8080S `T0)  RP!@L#80ST80S P 0 0  B @\ \vj 0`e  BR "@` P3 `2 c"1P 5 ꀟ  /A-@0P R#`pn3 ^P 0 W@00 0p `UPEPU 0 BP @p `W`  0 BP0Up980@-@- M Pe@a 0 B 0C2S6cА* Q*KUZKE A@{ Ѝ0@-@0AC^ 0S R0A  S@-A *@\0L0C00T D B @ ~J0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/ԙA-@T0000Pb1 !0^2, l!p(  ^2,0D10C#10RA! @^ ^@DA0DC1T0R @P@-@M: Q @ 0R Q ~@ЍA-P a 1`pM0S3 U10AT !0S 000 @T0  0S00 0Ѝ@0!0D1S<000S 000` xl? 0p@-@P0p R pPQ`00App@D `0 S,00App@ xlL0  0#10/ P#8 R#4#2#10 0// /A-`P@  1,0@Up00p 0S1pP@P:pP   ! QD`}P081#3S412s2sS/1J //@-@P0@0O-0Z  @SMpPA PaU* F B  H  ^'* 0H0C X000300 ZP@T  ` d` X`Z P` @T@T 06S @ЍG-0܁@pR$A0 QPiV'10SP`P\ 10i1000000S l1 zPP4 @p PU `@00SaPP# 000S 00PU 0C  pPph0{iV0S <0p ,0R0i $ xhqlHG-`P0R@Tᡢڃ0TP$ Zp !pG0  a !  \2)0L0C\0003R @@GpG  \-0P!1^$23\ *G-P@0p@DTD !1PD*32^ ::P  @aP @0 0S 0SQ 0PAPE%Qp Q!! 3 V@ 0 0S3#V0`F `F` 02NS @0@PpP 0 0QQ!P3 p@- @APD0D ` PR @ *\ l1 0DR56 501 P56 +Cp0R `5<5#11<?@-P- M@@;`P  46!z60:S  W  0 C.G B 50c 0 Ѝ  0P c2# R   W C>C0C012`00S/0 R /81@-P0QMP6@m`P3 pP-0S  Q- rp 0: S&PP  8#80 @0 $ x t0, ( 0 0ЍF00Ѝ<0F00FO008 < Lp@-@700CS00 P7pP  BR  /p@-0rSL wS aSOP F 0 pLP0S! e C+S ^R)# P0SPPp0KS0LS0DS0ES@P0p@-S4 @7P00 P! !& 0S 3/PP೼000P @ P R00 M00`aai7@0`` 0p>"5P"F 0P000@-@!R !P 0C 0 0 S /5p@-@|Q|1P00S3 0  KI 4000S8 0"$0 3/0:0P,p00P @ P 00< R 800p"O0PA~I<4P 005 0 @0 0pE0 @0 0ꨁ @-Ѝ/@-@QS S S E00H0@/,0@d0@86@000 0 0000/@P 0p/@-`E/41So O-@ MM Q 5/` t  j*p+4\ ājd% p  0 T  `h, \0`PPt` 4x @ 0 Xpl!$%P 8-,1)p `0(` Tt8 d954 ċ<=  <" # &$ '* +p. x/`2| h3P6l X7:\ ; >, ? ̋ a!*a*b"0*b$*a!4 *$a*8j(*",j"a(!<", a"j(*@",c#j"!$$Da(!c4*"H0i()PVpKM P  0$p pt 0~ Vm 0Sj A/ 1o*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂@ >>0pW p> >@P>P>P0a}> >xn XahmTx`O-@(P`P5f10pSp(P6 R ؑP. ( ,0 [ D`D` S`1005,`5Oeꂡ FP ر " J2> ؑ@-@ 13/, (Q0@-@Q +00 2W> 0 O-S␆M `p& 0 Z0 PU E Q[ [ R Y YYY  (>00 Ѝ5% P 0 引 0 @P 0 10$!12P- 0h%S0 2X5@  H%00@5 0 005V00$5005000 S S =00P p  20 2 80Pp` 0 0_UP U\3UX# 2Z 00 20120pESQ  000 EH: w?@ P31S 0:: 0)P0 "  ^*P 1S0S1S *0 29 20 29 20S 28 2CR2S " - ?P~P r R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480< (0480<,0 4480 <*$,00 4*,80 < 40Q$0SN(PX00 0TXS 00 I;i0$ U"* 0S @0C/[00ιP0: S 200 R I Rv2?00A@V# 4- Qp!e20S X  \0 RK [ PN200W ᒹp ᑹP <2@oy5 G4 R Q0P:Q0Q: -@-@-@@ $ @ \ p@-@PPM#.PG$  p@I  d0@-0 M @ 0  @yP 0S  ЍPO-lM@d0P X$0, d(,dp Dp,d0  ,0,d` H`,d 0,d 4, d@L@,d 8, d<,d @},  dPPPw,d, 80  4 ` `0@ 0@ 0 `(  pW' Q0: R   z P9 1`0C08#8 0C 0 P0 0RpW 0 10C08#8R p W0 R  p0Q  4P ` C-P@$M`Pp  00 WW 07J  (0pGW`^;\[7X0GS'(00$Ѝ(0W& ,0u110C0 8#8CS  (1 01崀\  P,0p1! B ("(R 0 gp0; P 弁pP 0 00(0 00(0Pr?⸁p (=` 2 \00$Ѝ0S 0S 0 X|弁 0 pm 0S 1  1 [P\ W< W 弁W2 W(0XHWI p  W  8P9 H⨀H( .긁0(0弁{ !(01ḁ0C08#8(XW) p  W  PH(꼁, 1z P 0WSBq X0G i,p⼁ 1a P 1ᴀX0C08(#8X弁 X0H H1崀ሀ!0  1: P pp Q0C 0( J각 0H⨀H(A0!1 p 崀  Pp@-@`PP 0 00(0`00Q(0pO-,0Mp@0 1 _PC a`F`h&hV1 PXh%XV @H$H @ 0F 8`P 00!01@0 @ 0U @EH$H 00@0  Ѝ "  U ! B ("(RQK 00P Q P !@ B  B  i `Pq  qQ0S0   dQ 0Rf `0E 1P @UT @D!H$HV@ `F !Pk P `  ἀ) @P7  1뼁0S0  N a1X0C00C\ b뼁0@SA 0H 1P| " PwQPp { Pb g @1 0P aP[ A1@D@@DH$HV P@`F! G ` @T0:1 01`01 4 P( ("( R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/᤬ @-@P , @ ($ 0"TO-$M 2p  (@0\0$pp 0 P`0 pP`@  Ÿ%f#"," 0` ! `! %   X! , pd!d!  0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$ЍC-@P MP' $q`{?pW($7 )#0(0 `"2`p` b8"#4b4# 0 V@h # Ѝ 08R(@R )@ b# 8 #)8 b# 0A-1?`@Pp @f(X( P 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ q0 0$ ?W@`G?`@`(`@  0$ <@P U 0$ `R @-/ L@-@P 0 @ (G# 0"老R @-/ /@-@P 4@ c P*# 0$$  O-LM(6,Bp0`0,$ 4<8 P P(^_8~?00H@040<`p0 `pP , $,p `pP`( 00 400X%'%ɠ0nj) "&&ɠnj .,@0 ˠČ,+$ "$0 !'( ( 0! 0( Ϡ' . $̠Ì @ !  ,  , @( 0$0 [3 `0~?00<`p04P0    @ ,  @ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90# ..YW([T0#P P[T(P  P%0 P P P%P 0!$pP00(p/!~,! rp', /!!,(,#p'\ )S   ( "P p P% p PP%0pP4p p0 0PR4P$(P]8` 000 0 00 00 000 000 00000 00 0$0P(0$P0(0,000,0008 40 0 408 <0 0<0LЍ蠀P~p@-@@DQPP` U  0pRPQp b!o Qz!0P0H @ p@HR Q be!>p ^!@0A-1`@Pp fPX; @0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW PH@0D q0 #@0D H0L 0 H0L W`G``P` +@0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6PH8 I `p ` U@  Ѝ@-@P 4@  P 0$$wR @-D/yG-@PM PH(  `p ` U@  Ѝ 0` a!, a c,/0@-M0<P0AP@;P񏐾>5>  KGC?;7 UQMIqla]YUQMI 3/whYzP;DPoE@5Pz}|ytsrqponmlkjizjRQfeNm^]\[ZYXWVUTSRQPONMLKJIHGFYs 7P 7P 0P:0@ 00 P%0H 寮p Hߍ0?CP 0P 0@! 0`ߍ0= @02S, DP,J00   0  00 0H hp D ?a0/00 0H Mp h 0 0@!0H :p HP ߍ0 0d 0 F0 G00@ 00qP 0p 0 C0HͦPZ uHǦPT o 0[ 0 0U 0R 0O 0L 0I E0 D0 0 0 0 0 +0 *0 )0 (0 &0( %0 @RPA@  | 0v 00@ 00P 0@ 00P |0@ 00P H0@ 00P  B08 01P 0H j10pH <0 ,00@ 00P6 X0@ 00P $0@ 00P  0 0 0 0 0 00@ 00lP[ t0@ 00^PM r Эi|4PDD<p({G-8M(pP` {{70J@U@W@V@To 0S@!Q 0S !Q0S{ Q {0 02{" P0 ! ("(R  #|:W UQ VPw (20  ` " Q!W  U0p& V P`P( U 0 0V 10 @dΪ 㴫8ЍV `0Q  V`W U0p V P`000 4P0SQ 0Si Y @h0`0  V A|AHA  ̏ x X m p@-m0@T 03/@TdPP 00@T 03/@T\Qp聪H00@T 03/@T$0p \ @-MT@@P Ѝ  0 ⺫pЍ(>O-@Rp M ഁУP `B80 S" 0SK: s0  0Z 0!80S7  0Q?0 ] 00 Ѝ 2  Z  0  00 0 P 00  P00 2  P   P  000 0@-P RM@P Q' ! 0 0 Q   0 013/Ѝ0s/ r? ;P100@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP `@( ``0V#pؑI@ T`1 `! @D | T@ p PU Ѝ Ѝ=pP p`O-Mq  PpG  0O PU  @P U`1`!  E[  0PU0 , ЍЍ@- M` @  P 0 q@pG@DP @PPT  Ѝ Ѝ P/0@ 0A0Sw*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:b080pO-@R"2 0|M`P0t00[ 00S80S pd"\2 0 t0 30|Ѝ4P  P8 01 0#\ 40`0P 8 0 0坨 Xp: P8#[> !1ȁ0!` 04 4PU 08  R88P@P`0X A@ 1248 Q080!:0 S 808PڦP8}P 8 ` 0HpP 80008P廦P8l00pg h @ O-M$ ) 09 @,0p020D2(0S PU 0H"4S4S2d90U 400P0h00 P0.0Rd00e0 0h@00S d0P02 0CX 0 (?01HF0 00]p <0S000S1!R00:X Y 0c/d0P0c/K0  00S 0 Yp 0 SRPU 00$ R 00"00't7 0 2 30ߍH2SP708 R4004 4P\ P0R4040P0눐4`0ᔣ 0 @ bp 0`U:` 86(06_V04ࠓࠃ8 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q %P`00S 0 SRPU L00$0Su00s8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R*c/v0 0' Y1 0 SRd@T 00$0S ,0S  !$0(0S (0@TP # a P 0 SR@T 00$0S ?00 ZY0 0c/d0+0 p 8Q 0 SRPU 00$0S00c/dpw@ X P2 `0 R(SYPR`VY`P2 08@04ɤtRP>ĤP0 S (0(X PC_oRPU``  0S0S᫤\40 0 48 8 \R \P0` P  u` 0 SR@T` h?00[@ @ h M`(0P`2 ` =8@P@,@ bY$0SC00A 0X0 0 SRPU 00$0S.@ l @ e ꠿ \~ P <| \x{ dw Lw A-P`@M@`@`p000,00(0 00hPЍt 0 ! ƒI1p@-S@P  0P ! "0 2pp@p@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/8!81@- 0MQ020' 0S0. /!PR*/ "RR /@ 1@0BQ R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ Ͼ 4  /O-,M"10P0 00b 0 0pS PV `0@"P`@ (PP #  ;/ P;/P^W0 0P`PU0c   E BR R  L B@FR !R2 0T0TG SU:P0C0 000 0p0pSpP0@ᐘ( T**pPc`@Y* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  P;/ 0P 0B  `@U, ;/PW W 0 0R0 0 R0T 0f:W 0  00@DY 0ZW  P SW0 00P>  R0P0 S*T W  RW  0 P WE  P  B B@FR !R AI;/P ;/PN `P 0  0;/ P ;/P0F $0;/ P;/Pڅ00DP 0;/ Pe;/P ;/PPWAE S ;/P`  R0 RPE0 C 0R[P9 0  G"!  R  B B@FR !R A"! Rz0 0SW;/PBP ;/P;;/P}$ ;/P$`u ;/P` ;/P X ;/P0 0O$ ;/P`W 0 R0cP- M0 00 ЍpR Q0P:Q0Q:@-隼 4C-S MP@  $3/t`  0 QP `Р4P4S  $3/000 Ѝ00A-pd 4V:@T@T 0P0S  00 S  0✟@P0`0dp@ B ! A-`M p@P0: SxxPP ˅P@ P 0 (tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p  0% 0@d , 0SL@-   00AS 0@4O-SM{@Ap⇁0PS`*0S'  TP [ P0 00!Q    0    Ѝ P@ $ 0  QP1嵟$R P0)000000S@p 0 q 0p4 S   $3/Ѝ 0000O000Q 0A00/0@-S@  R   0 堟0Sᛟp@-P@T @T 0 `pp@T^P`p  0S S/P/$(0#   @// / ////@-@ RM`P:Q !S@Ѝ0 0pP P G@MЍ0T @0 0O-0S) P& 0S# p@# ,0aT T 1 !3/PT0p0CS@D0 T,0p@2P ?0T` BB \|  i V`!  0 0C 0`@ 0p0CS0 0T `p@QQ   D R !,03/`PIʼ0@00 "R(  0Y `1`!0PVQgRJ,03/`PY M 0p0CS@D0 T@0T p P@0S*V* = 000vP@DS*`A 0`V:v0P 00``F0 ``i  0Y0C00 00KP   0 0C 0Z ` 0005P s 00r 00n0% p@-P`V @@D00T`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 0 Pp 0P0, @: wP4p R0  R/ S/0 0@-@ R 0  R 0   0 0c 0   0R0J0 P @P 0 0 $0 ( @@-@`pM`pP   ṗP0 :CoR  S L D0( 0R Ѝ ; 0 Ѝ;0 #0@-S lMP@ d  C 00  "2 0 d0 30lЍ 0`0S p0Pw d"d  0R0p0```p NP0 ```0S!$p @ოPa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ 0 0{'{{y 0SP ` 0d pp p 00 pHmPX < <p@-@0MPW00TaWV( h0T1S O⨜0T1SZ0`B00 UTX!\!R Ѝp@2\!G00Ѝp@)00UX\! X\!0 000S/ x0 0p@- PUp@000TQ0`U TQUP pX1P0X10T0`X1 xh0h 0 R/@-@00 X10CSX1 @כOT140 @ЛP x0 000S/gؤ x0 0 R/p@-@0PⷛU00 \AQ\ X! BRX! p@⧛`徜00OT!00p@✛갤 x\ \0 -4M0 0,008 00 0 ,0 304Ѝ ܣ  t,@O-MHP@0@Q@0U0B PR"S08 R>  "   T0"] \h0000000000 0#0 0#0000`0`000T ^pp@eR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@6Q `T ` R\ ! 'R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/X!X1p@- @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@:ԍ p  O-pM`@P-TP0 +Tn S0T W  p S  0,0b 0 0?0 0 0   p P P=Q PS \4 !Ȏ\ @00D ^a0DSW0DA0DS.70D S+| Y[Q PS \ !Ȏ S@` )"00""00 0S \0F00 ЍS@ `?0v0T0k XR A B0A PR W p ^ ppZ `@p SWMppM\0BR"\0@-0 M@ 00 Ѝ0@!@P0T0P Ѝ0 p@-BR"^p@ @P0T0Pp@- M@P` p UT 0S*ړP  @p Ѝ婔 @@wp Ѝ$S T@p@@-M0 @ ; *6P < 00 0 0 30Ѝد4| $ 00 S$ 0 / Ԇ |0 S 0,/ 00<<0 S, 0 /00P 0 S 0,/ 00<0 S, 0  /00(|ą h0 S 0, / 000k$<0 S, 0 /00<Y8 0 S 0,/ 00DH<0 S, 0 /00P6ꬄ P0 S 0,/ 00X% <0 S, 0 /00d 0 S 0,/ 00l<0 S, 0 /00xꔃ 80 S 0,/ 00<0 S, 0  /00 0 S 0, / 00h<0 S, 0 /00|  0 S 0, / 00<0 S, 0 @/00 0 S 0,@/ 00vP<0 S, 0 /00dd 0 S 0,/ 00S<0 S, 0  /00A؀ |0 S 0, / 000880 S( 0 /00L $ 0 S 0,/ 00 80 S( 0 /00B Pp 0 S 0,/ 000  @/ /H-Mj 0ЍH-M 0ЍA-`p@P 0@T0@7#0PP@-/"O R ?#0!PMO$; P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A -- M0 0: ЍЍ/ @@-00M>R@ 0 000P001 200 P0Ѝ[000@@- 0M@>S   "0!,03,0 dP0Ѝ700@-@ᢋ@袋0@-$MP  0  00@PP  BP< ,0 0 0 30$Ѝ0耬40z z y G-Q `P@ S V 2" RpSR Pa 0Cj ?o/o0CS 00c8ÁVS& /o?o BR 0 0b8Ápp?0ϠT\ S?? RpᡏVP0B V0 0T0d0?o c001/o?o0Cs! p R10 0bÁpV Ve0o`1000@bq<àQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /o 0@-@$P  000: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/i x@-@p@-0@ ,p}pPi0Pp////// //O-`ἱ4M PpU t j1 00( 06/4Ѝx0 S@' 8!S㴐0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUl00`0 0 S00000@`0|lXD0//O-M+0; 0Q000; 00 $0 0%SSSH 0@p` 0FZSZrXW\UTSRQPNJMTJ7}|{zyxwvu?>=<;:9876s43210/.-,+)('&%u#"> T O V V ,`@ 0,P@X  5 Q ZJ:  Qc ^ Z034S0C\ [0Մ0ʄ R*f @HT@Db [ 00ʄ@T*\00F`00F Sbp   00Ϡ 0Sp0-p 0000t  0ST{00@ P T @Q0N @X Z*  QHQA [0ʄQ*p02,,  t  QT{@ Ph0`p`|0PU t0S  [0 P  BT@d0 DK` p0p0$0x`0t 0ST{00@ P`| F 0 0 000`lV` pp`{0 , 0 `p`@p`+0X`0`p `*VX 00F S@`A@00F SQ` d500< 00 0 p0t{S7 P0 "0 , 0e 0 N D L% Z  04G HP@ 0 [ 00ʄP* 0Q [  [  0[`ʅ P00(: ` d & BP Pßc Գ& `dX0Pc* ` PCN0 D LCP.10e0PQ 0LN0  E DP Lw d 0 000  0 r 0  0 x ; r 0000J< 0 0w0 Z0J0H",2 0 0 30|Ѝ0 0 /    X@`0 @1000   ; 0 >@  90 i  @ 0 0 QPt0d0 D00!@ Ϡ 0@ 0 @ 0000 1@0("(0,Ϡ 00`@O02ӤPT0  0rf p$\ p a`0` 0A-p`P@PU J0SPE 8/`uX@pWZ | 0SS S 0R / 0R0@o/ @-oG-` !p1 0CMM@P0440 @  0 @0 44 30*CލЍ  00p 0Xp P t 0 p\^P+  @  0:/;Y lY TY ,j>G-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S% ;P" YP@ Q@ 0S1S00#S0S S \ O-0 BMMH!dQd2 hԀ&h Pp0 `V' 0 ]dP@P Udd0 ZPEPH <0 0 4 30BލЍꚣ W @>>>L>= =x=T=@-@HMvxv{` |  0 %  { 00 xvxHЍp@-MAT Bv P00 ``00 0}v 0 0Ѝp@@T 0@- Q0|MU0t00& v 0p`0# @00 :e @ 80 0 t0 30|ЍPP>`% $ xA-@Pt1 0!1n0SuOPpPp tp0Sp@-@QU x3s|p {01P {01000p~tcuVxwtP //'P //9G-p`@>W`PW00V0S@ 0PS1S ` 0 , `*: O-M0MP@050W0*  OT: 0x`@(,d!0  d! . 0`1111A05<0yPw  0ʏI @yp d10 d1 P `@ ]|`0SH _D@G S`\  S S00 Q`@0S SP C0SQ0 0CQS000008X|P @0PP 0+ 03EP 1#S;S 0t(S 0h(Sv 0\(S: 0P(S 0D(S 88R0sS2 S S(  7R2 S S0S0 S S SS@@ ` `0{_A`P@Q"0A'A+S? `7R2 S S 00R00S @0 S S00 0S S 50 06Hw0 @70K Pj< Rf0P 0< 0R@o0@PP0d!S 0 0 2d1 Ar| ᅦ1 |DtAp 0τ`0S V `0`SH@DH` .S`0SV Pp.P`FV00W0S  00P $ *0$00p4 0 5 30܍Ѝ4 RB T T Z|40p00$0l4p0004PP(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0P  @0劁$ h1P @@T;T P3P0 0000@@T;T   P @ Zl@(`,0p4Pu 2R2 S S0Sj0 S S SS@@`  ``}z _AP@`0H SD` \R?* S S00 Q`0S00`07<OΔP.eP `z1=C` l DQ XaD@`yQ<0 SQP@* lP  @0劁h1P0- qA`>`Pa0 2 ?U" X" %77 domasearnamesortoption\6in<"er4@~ 33 listܱȱch$/[  0 uw^00pQߍ P$@ ` 0CQ* 0 0`$ @ 0` `Z Y 0p  S` :@CT0:@D`Hⴠ0R  `V@D$` R @D`U+ ( [ 0 @DaU ` 0   w 0  ` `劣 0  v0~ 0 z @0@ 0@-@P @ B 0 0px  H(0( 0@-@PY00 00/ @-@P @A00Jxx @-@P800@-@ P 0  p@-@`0   0M!xPP0 "P IP 0  ЍpЍp 0  Ѝp P!P @- MD108Q0pP SpG0`S `[p4 Ѝ@@^uP 0XuP 0S@ R Ju@P  A0x Ѝhh h  0|x ЍDD D  DppP% %$$%$0A-0PU" 0U"0PUP!q@@``FuP $uP 0!E`1$(`P 02~PDo'' oO- Ff@0S` M, 0 4 &V F$0( P@RB 1ȖqYT0i(1<0 BRQ#)16: 5 0(< ܅ 1 c0Aş0 p('(p4< 0P(0 Pz hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 ,00,000S$0 00ğ00( X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LgP0440^# (0p Ѝ! qQ 0Q*# 0$|3!0(08Q(%401Rx$# 30<!^ ^ ഇrp S:p 0(" <!0(0% P^4+|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10(0 R 00! 0t1t00`10mZp (4p Ѝ:p N5p 0q^$nqpy2  Z 00K vtnh Dn`\mmtml$lll|l!4lTkk̟xk,k jpj|0jj8iiixi`iHi0i ihhhh|hDl 01O-0 MX A* 1 a001Q0,`P0 ^/^_?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝ(gܢĢ̢ f(0(0 @- ur ,A-@@`V 0 CQPqrP pG P5rP 00`e@-@00 R \\  !$00D0 0@ ($ Tdd@-@PL  0S  T0S@"s s@sHdP/0d 00 0Q,0/01P/0(00$ 0/cp@-@P0`L  0PS(  1T  0 $000`pLcp@-`0Pp@P  P}pP 00p/P A- 0@S  P p00   ($ 8PP(p`P0bdb$b*O- ,0ZSP4M| 0 *  +~   /` *p@0||ZP^/^_ @   Y@ }@pQ0 :Q , @T  :R^@e 90 pY尉P<``P@0 00 J4 S  !$RK`SATSRYe0Q0,080( RD 800 RC ( 0S  Q (0 0($0 `tHd@(p` 0D80 p4 R B$ȟ  B QP70 `0C' ( ' X 0 G @004`^0 -'列  0A0J,0CQ, 01$( $   (,  ^0s* Ri(0B\$0PS6000C?00S4Ѝ60`P4 )P 6@p0 00  t& 00D0DS:P6B0`@60006@0 `  p As$0S@  00 Q(,0A,Q  AQ", (`P  6pP @  AQQ`B$iP(`,0 Q@1J#S  P@ P 0$ @UL (p(P$@r$ P0$  1\@ [3D@ ( 0$1 [/  T #0 $) T`  000`00@0 # $# 0$@1,$0o$0 Pb A `C@@p9\ P (ErP6 Q R>MP( 01 (0 pqPP$  0P@1@$@P@1@0$P 1@p 0P$1Y,Q$Z  `'10<0Sx1 0^O }σ P +>  P(1(0?:Q@ Q10 p0@`@0fFa ta@<`ht`___h_8__ ^,h^4^]]T]P\\8\X[ZLZYYhYDY` `8PW4W @-@P00Q  P     $00<0 0@ ($ VUp@-l@@`VpPPp;0U1pPE1PSp  (0$ 0plUQA-pA@PT`QV0l@P  0 pPP``p`"@< A-p`@lPP T  0 000P     @-@@0/Т 00(/S000/S004/S00/pS00/p 00(/HS000/4S008/ S008/ SA-``PU 0AP ppR0APn<0< 0 ,(0RR ]lmn/< <0 44 -0 M0 q Ѝ .0 000 0gqp X X 000@ g@PЍ <R 2"00@ϦX 2: 2( `hP0 0Z 2< 21!001 001 0 0100100|1 00P 0 R00   0,T 0 2 13/pTd00-0`PP ` 02 2u00@Z@0S{X} 2: 2p iPv 2 @0 2D001800 8<,C-`@ MpPP  000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH UP (0$( p 2 P;00 ЍP Ѝ#00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p M ЍR @-`@ MpPP  900U,0`V( 2S * 2 P13/PPF `P 0 p 2 P00 Ѝ  Ѝ00P2!O-RPM1: 000 X2*q`I`[ 崘p@ p W  4 0 P tZ 2< 2ЍЍkP 21O-MrX>*0`0Q̡J0P@wp@ W Ẕ PEvkP0# ̱100ES 0 Y 2< 2Ѝ10PE P 0, Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 Ѝ kP"! ЍG-Z RbMp'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-邀഑@ 0`P? pp Ip("(R1 B!8. 1!` 0S001 V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0P8#80\2N0C2pp@- @XP ` PP  pPp@-`P@0S  00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-@P4M0`S  H00 Vv 2+ RJ 13/p* 0 00" "00  0$04 p`0 9/P 9/P yc0  ^ 4Ѝp$  0qp 0 ĖP 2: 24Ѝ?(0p0`,0 09/P  R0 YP  0 0(!S$! 10$1\0 EP 0 㼐ᲀ@p 0p 0 S F10@Rx ἐ$'xP $10 $1(!00O- @1T@0 p0CS0 M@DP`!P a `P' 0 0 cP 8#8R0  Ѝ0 0S0ؚP 0 0Pv000@- M@ Pp10 Ѝ0O-M 0`p0 DHP@pC ٕ P/  X00   0  P @ Ჰ @ἰ0 `p0`000S XЍ 0  fP   C("(0C 0@0 0[P @G-`l"h2 0(M0$00w?0 @Rl2 S:0JS P Pp2 S 6p %3 P ZPpA Z1C PJ: A  W#: 0C8#p#ȅ@” 20 „ 2 0 0 $0 300(Ѝ00C @ 1px'x op    0  ` 00 p}P202{X Է A-p@MPP`  00 2   Q `:1Q堷0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E0 EP VP V$P 2: 2 0Ѝ00Ѝ0PU Q:(0 $P0PU`P{]P  j^P 21 s_@--M0  @  eXhh 0 ST000S 3/R MXIY 8 80 $0Q/$$0S/d t pV<<0 0R/( 0S/d $ xUA-@T 0Sxp`/(XP0P@QD D0@`uP0 A/P*k}%O-@$M`K`T hpܴ4$$0Rab    WpV9BP b0@SFSC0###D#X######h##x#########4 A33 $$3 $ $3  3 $$3 $3 ($3 $,$,jd3 $zd `D`$Ѝ $  ( ,  C # PU! pP "P6`@P@`  R!PxB `  p  BR MpPG Q]($R0 U tWS UX,$R$ ^Zxp4 IVxp0 W$RD $pR $R !_&@ $R $:xp P$R& U Q R  T$_&@ @ $C@  ` &@ T `   ᭊp Up$R UMwp -wp P  ^wp U@? PzFw^ꪬ̅%w%,}%}%8}%%ڶ]DkSO-pMP@+_봳3#`@ @&e#|3pB RP!GP P( wf@(hPF  H@ P )'''4)'''\('(`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X D㑝` `Z`r`T စPP   `Pd 0)̱0V!Xq``pxWp @P c% B R<*X*X**X*+*X*X**X*4+4+ 0S U X ˄0S X  R 7/ P  R !?$ 8_  '$ /_  'P0S PX \몬$N,w%_o`SO-PyM$I` #^p000 00 lfp8 PEU( 0Ra S 00 0 ̜vPePRP&GPnyf0@SL-T,T,\-T,T,l-T,T,T,t-T,|-T,T,T,-H0@ S-T,T,T,-T,,-T,4-T,D-aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0S 0ppSppU PE0U4U& p P Q6P/[  00010SWV0Sppp C C0S S/R <NVp0SDUa(0S0S 0 0 -Vp ! 0: S UH/[0% #V0: S0( 0 00J0PU   0P0 $0P 0)0P @/P050CS"\00<000<000<0$ `] 3& /& `00PP0S \㷛0Sr 00 $  B R0\ L` V, `Q& /0 J 00 P@` 0P` J/R  S/R/   C  R: % ` = 3 0S S/R$ 0RS & ~U0sX/ HL!R\0X\!R\ %X00: S h C C `KU0: S P1: S ,T : S!  Sn  Sf u S_ S L0S !GwPL,0SK  [F0(尥 0Z i%Z80 S80p1p!pp "Q TP!P1: S 00Z0S 80 0CS!800 uPR X0|S *%0S !?w0S !wlY%w%$W$8Siomk98%Y6l?O-P@}X[H&dp<868V@,FwP60Pfx0S0 ` PSP 9x4P080540HP|xP0%.(0@xP7AP0\ X5X%HPRP8P H08 00$%43/00000P84 "x4Q 0U0!qxP (kxP 000 000 ez@0D 0 zP0; S @,0(D 2#!H8 01/0TP0P( S/,2PP P0Ys0 CS 01#SwP0 0( ,S* B<"!0 0 Xx8PH0U 03/pu0SHfH0803/p,^PP܂ h`0ld 0 GS * X 0 $03/0  0-Q3  Q Le;$y0 0 -1/ U;P0 0 0 0 `0d 0 `0d P0$ ,!w 0,ؠܐPYZ0     00h0 l 0 h0l   00 R0x0 0013/s S.w S=3wXP\`0N ( (0, PU`00 XP\`= :W몬qw%L@&ڶ$&P&S@&&  HP&$JO-M Mp4Ynx$$H$ Cbp 0 Q 0  s0(0G@-P񟗙==(?(?(?(? >(>(?@>(?(?(?(?(?(?X>(?(?(?(?(?(?(?(?(?x===(?(?====(?=>>4>(?(?L>(?(?d>0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S $:PU RnR oRP0<0,㋸`P  VP8!`P,wPPPPst pmYWR8S;T5PtaP<4 1S}H @0R. P`V@0S0H0S 0  g{P P 4R㓥'F M P3mY`, 0| ,0Sl 8 RS P0SP,P4PD0S $1V<+0P43X(D`娠pXV 0PUc40S0040D0S xލ Ѝ> ϴZ P <3 ,H#VP(T 0`F40P |QP zPPT0ST90P: SzPPP401!P4L  R p PP T0ST!H R 0 T0S$" !pzP4T0S1 !YT 8SQ # WpVF  { <# 0+ <# 0+ $ <# 0,(, <# 0,00 40 0 08 <0 0 0@ D0 0 0 H L0 0 3]P# _P$ wPꪬX&,)N^x}%w%X 1؍S s@-0D9TdP00000Sr0C?o21 `p0 1000C00S8 000-S3 0R2(0pP EP SP *r, (WuUsP xP4 3"3 "3 "3 !00000C0ŁrP=|tz@P4 Pdw`ȍT$32S D#DWSQ\PBa1S bVRX婍=PL2S$ 2"eWQ{h2 0S 000S 0uP 0~PPN000!S 0  0S 000S P^V崷:Ua`0:E100S S L!0`0001 Pʇ P ᡁ P{r r r&@2S{P@`a"ᶹPW2Sw㯹P0"lV XVL@p㜹P= 2S <0"D\ &Xw%}%C,dVPe&T_$&uSUipM&HS}%8}%A-P@M`/P@J@P2 xxBp ^p=X2Q0=q E  -P f Ri Rk R3 0!BSQg 3OPb0: S^00  !^p10 ER!MpSwPePLP PPp FP f@P8LKLLTLKKKKLLKKKKdLKKlLtLp000p0 0p0p0pp pQ |ˑS N@P0: SpGP ᵑ@~Sx&w%SO-M`{|UMlrlPp@ ^pH20!1S U``$ NPj]6 `[A PmP pPP ɛAX|P W{@ /T` |pl}000 00S LNP"0 0>NP 00 6[` 4NP/  Q  T: 'Mp [S0S T* `[`Mp5 `ꪬiw%S,_O-JM MPz Urb@ []p1 PEU A0S U  磛RiP fP hP 3vP00@000 00 0@E MpP0: S(! ⧼ P` ! ㎓0P 0Y/S J>00/ `$CȰPE@D0p/SP/#P0 S: p  ᕪ?PPUꪬ4&w%PA-`@MP$D=z 4 0 bMP  L XMP  zL NMP  pL DMP  fLp޷l30h3PPP P$P( @30P+( P3( P7( P;( P?P(  PP( P P8$@Ѝ(P (PT"/(0S (P(0S (P(0S (P(0S (Pq0S NKPb!0S0S p XP`PPa D1R`PU 0E /R PP(PU  00,0/00b400CSV`V,VhVP0$0u00S tN0s00埧궧 @O'}%n#PTO'@Xv#X$#HJ#&p&#A-@PyXSp` [p 00S VaPLP PP ``P $ 0@Q몬Hw%}%8}%O-MPxSFp` i[p 6@X/ʼ60S ЍfP WP! PP ` pRP dP vP iP00` prPxP ``0`0`$`a [1ES ˵WBu弅PU K$0P S0Sx{3 @[*0/S /)P0.S0S .S0SZ4  0  R @  0P0S$0PpS 0S@ W`P X`?PP0S <8550C SV[\\Z\[$[\\D[0$S P P*S 00$ @ S 00S $ ?RR00R0SW3 $ S  @0SX  P 7 0!0 0C0 BJP 0S'  20S 5S 0S 0SJP0 0~ zX PtI{0SmP h0S n0Sa j0?S] f0STO^0S Z0?S V0SS R d000: S0S@0S 0: SBIP1 0S! S /o" R >P SI 0SVJ P 0S 0?S 0S0S Fꪬ.8P'w%؎S.o..G-P@wHMQ@ap Yp 1 R1 0C @`P OpP vP0pk[IP 1`0S WP /P 0S 0S0`:IP4100S ꪬw%`P'Sp@-PM  7 $ 0LHHPH@IUITD0 00aHP00եCP[3P (tP 30S S! S 3 Ih3 ! l3 00T30S  R 4#6 R #!SR3$3 3 /20S (2 20S 0S'002@T$)0"PI@TB00CS00 $ 0 D $0S60016 R0S 10S<?)0PT<n001 10SQ 10SM(:x1d1POT10S P10S l1 `1 0S  160S 8$ q$@$1 I01/(  (0S0F0S 00q0S_(0S 00O@P`@ ToZW'e:H$@Q'|Q'8Z'Q'HQ'DQ':T$\$:4]'$j0T; 0DS 00S8 0xL@7Q0D0@0 0Q)@0SZ L zPU+a0@S񟗷geee Z``: rRPGPP! 9H@ PPjiiiiiii\jiHj`hP dP fPvP$@``j1 0T0 00; R4 : ᐭP @9A0S #S!s9d2 00 0 -`PXL 0Pp#>. P , ở p ᳟p p9 Gp 0S<0 0@0050C SRl(m(mTl(m(ml(m(ml(mm(l[  ӽ@P0S? 0ˌ$ pNp ,0 R qX  Pp P    3/P00 S .$ pN tpZh000S K몬(_'ZP$w%cP,>؃4_'oSTO-M MPJ^n 50 0 5#5005ހ<:00( P d9 pP  pVTP49Q 8A@6P񟗹o,pop|qp|q|q p|q|qpxpqpq|qq|q|q|q|qpo|q|q|q|q|q|q|q|q|q|q|q|q|q`qhq|q|qq|q|qqqq|q|q|qq|qq|qqq0WS }055050p uUpQ Q 0X(tȟS SSy `׋050505484 ػP  һP8 78ط p|0"S 㮋ꐷ p h0"S hL pY0"S P 06嫋p90z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 U?oOJWPE2%R U%RpUQp0%0;ɄP%5S 0NEP80: S0550GSvDwwwwvsU%R 2' WUz05;Ur8?岯4$04P0VK⹊p`,`vvPP C\$iBVD%dE6wTD0000 00UCPP#2 MCCCCCuc0P` 0S #Pp@KS`0#S &C,De ~o0E?o2? C `V4KPPe,f/z;`vV >`PlDh0KL00CS0 vP Pp PNU0 P00CS0v0 U}>0S:00S:0B2U51k>1S)1S 8D9Pd`d!iBC%lDUx|KP 4T;P! >`0U0w4 />P 0PEUiP@P  f/呷0 WT  Kx8P8_'ZZZ%ZZZ[,vDZ6ZGZ`ZyZ$w%a'H[JS `_'8}%#[Zc*[3lk1[}%mdYWx_'PC-ʆE0 P !`p@X@PdJ PH`00CS`0 hK@T ЍX0 X @H8'8}%#O-`脟蔟褟dM@pP0$`(`,`0`4` ` 0R0p$@DTlUU!Z  ItPcPSPPPPd @"nP tP0 aP` rUdU 0A0p# dU4 RU SU" QU040   pUY [/lUT H  $ @$ ,Cp0 dЍ $$ Cp 88 Cp( 8U 8V  HڱT@DPFPPp`t  `TEP8 Bp@L7PJ7,",`!u ! " 0<`QBV!  sP Q !70P0}TH.9 0S@xKItHIRH'BxX8 DB P P% 7PP%=H`V08c8 p*P0ZS wH  {@ I 0ꀰ倐`pQ,w%p6r~DpDp{Dp q|D(q(q7qFqRq}Dcqqq~qqqS_q}%yaratcidO-0-OaMp$22242222322 pp.$ }Qpb>4 $0QPCn2 0000U1dR0 U%L0 PP1Ip LWEP L0 PP$Ipd2SPAPX0: S0d2232d2oPPS0 |=CPe0SX GT czPGRP 3P@/PA1@P>`hpS@'P6ԂPPPPPPPPPPPPPpPPPPPPPPPPdPHTPP$P PPPxȂPPA@PI00H000k0 ,2q,00SP *;.0d2+042(02%02"0202l[lk@ @GTaߍ02 20202;/`]P 0S Hp; 000P00S Hp- 00/@`P Q tHp 0 0/ .P   R  dHp p0S ZHp0 0㰆)0i2000 0B BqP 000S 3 S;3ŝ)di00 0x ZP 000SX"\2R@RX2i/ܦP P@PX0 : S8 q `P IF/ƦP t( 0bP[a?`PtA(z@p X:x\10D  X40*> X %(>:E!14'S>̂03P7  `703P7`(7 P 0@ tQ S`2S S 2S 2S0 0s  [ >p d2SL @pV X!\1 >\1X! 0 \F02T7,2P700PU%->pP h'9>P@P%zGP AI4U QHh PQXx 3023,2 3(24T\2S(",2QX"\2 !14!8!4P@0+ ^0 \  ` v $!p  ZY0d2S*'0\ P[|PL008 <04EP 40 S8 *"<02#L SXD0 U[#0R,b(H"L2R0;\2QP 0@'$w%X'A*,~~~L''-7P'xSTk'U-T^'`'rdAedAh''&';}>̀'$3_1 SR Q  RQ!R!RS !14!8!04P`CQښ. .a0C 2 0L븲',w%edASt}%в'Ȳ')N,$'0$jDز'zd@')GmO-`؁ؑQ@p Jp%W㰑 0S 0S  p10`VA \P hW0S PQH`V.Z ЍyPmPPP fP Rn0@ Sؚ000000000000000p@`W 0 saP "SP SP ~9Xٕ,`'w%!O-M4$` :P! 9DP㔔唴9p000PPPt$Jp3W00S 0S 0S 4 Pp(4 a X' 0S00P 㹮0S 㳮㰮PY30S ЍzPOPBP4 FPo PwP@*P|<<<<<<ؠ<<<<<<<<Dt<<<<<<<T<l<<<<<<Ƞ00 "P2  P20{00 0bwp@o0` 0P00e D P00^ , 0 cvPV O Q000M00J00G 0mv1 P :000001000-00*000&000"p 00000000P0S[PŒW00S 0 ¡P~!h?`I%֌vZ D8vZ' ','*w% 4'vDZ% $IO-@MP8@Gf [`(YPUPE10ŴCvPlP,HP8 TP3@ ` H9p@-  >mqp@!0 S < Q <0Z@y m@ PlȤXXؤФXX`@" Hp,2 R Q!  R 1,0Q ,0P0S  (  0@P@e00-SF 800$0@ p0嗲@P?Ѝ$0pw1 4u!?$040P ?000R0Sp c```8pW0Se0S } 00 0@@`p @$@ P@\ m 0 3/p T-c,5w%lAcU$@-,@,x@}v@`'$$O-@M -,@ϰF8 0ʰf`P8p^ p p <~6 R0 8 l,/0P0T 4PP\80DpHP88F U1 vXF0G(G0``0 `IPHPU0 Gpp 5pO005S 0(0,00(00 0H-P,PPx%x}PzW`WNWU 3AWF CW4eP Mp  aWe CWe LWf aG QkꜪT<\<<<d<<<l<<<<<<<<< WWht$  C$ RD -(K L J ~dO {05xN 3Vt V``C `pM nH l$0%c0!0 0  $0S@* xV}I 0 V 0`Pp 00Jp kW {m0G S=hhhhhhhhb/b-[mPH0SI0SO005S* LPO0S U5S5 ( p0 (0S 0C !P X@P!@1p``p! jP|! RPd! 0S1H!3/ 0L`@ PL,`Pi;, ,P1!/ HR #b0 Sp/ PP 0 / 0K0 <pSP$p'@$$'$p$w%! $$, X$($,9dUi*;:& i9 iui m@-P a|s@ '\p@-D@DbPg@(_ ^pp@v'$p@-D@DJPO@(G FXp@^4'$H$"A-|@|p `(P/,,20`/8P@'@@4!0"4)A8L'x$+$|+G-`MC5PuP5P0 Ap) Pw5\x5@P L5HH2<"0@<2P 44Z 6 H⣣p HQ 5P  a@1  p0I0 @ p?0 @9 5080<0@0D00 0000P0 0 80$@0P o 84 HL@P@T@X@\@HPf Hb644424 0400,0( ,00@@0P<p&PPUPh0PP 0/`Ѝ<3$ DBBAA'O-0Mp㬖F(00P6`p0 Dpt6Z0PE `V0S$PvPP@`@0V|P 0SЍuPfPFP RPg 0g@Ppppptpppppp30P0 z0#S /P00 $$00S $ $$00S bpP z0#S (cP $f$0(0Sy  $Z$0(0Sl00i0P ᛪP_;q Z;q U; ;` @fE[w a3C30 @ RI0cS pS< bSBJJPEU ]0P 0U8U U,P 8 80,3/8 RP cW a@|3Zg )3P R00C?o20S^ qXUJ "z0 $0 0R,0$00S XU 0H 'լ0S 0P0 00010S1 0S 00 P 0 0 Q0s  1000,0 0=383P7Z @0 $  32&SR @0 #  3 03  @0 R T 2Pq(00s  2pt0 @0 3Z v,Hw%'S6I`%O-P'M$$ M@`p$PP Bp*6춟p0@DT00SfT T!ql@P XkuP㈦e1p`R 0S* \ AP? a@PP񟗦꨻LL LLLLLLLLL LL@LHt|5pP50S $PX y눥}PX%000P00 0CT 0p P P P*=P% \P p بP  P( x}p qlPpq/x00 000#0 00$000 fP @(qPPd x (P(BY@X ;2 PP(!|P( (s@P `Ht0 0P(`p` qkP 00 00$00 0@Ps@P s@Ps@P s@P hDP X?P H:P!Pf@ 2P Z xP( (p` lP( + /⸸Pm``ᝥ 0V@ ,r0 00p` T!T2P00S4ؠ00 000$00 0 ( 2p00c0Pa0SJ+S'- 29S!S@ 1Z)Y x\r`P'ݍ Ѝ w%'|,Z0$jDS 'zd@h'edAxp@-P@^p@-P@y^p@-P@q^>@-p@-P@g^p@-P@_^p@Ep@-P@V^p@O-nMM0000`4PSP 0~0 P PPG  >R~p> 0 @p@7x>p?a0SH>D$RT$r R  $t ▩t00<4A @0<4x00 <$0q0p N <4 L!H 76`PEB@D4TG`x4lLp(00<@¦Pt< $yṦPt  @< l0< $$r $d8LHᢦP; $0 00  0 <M0K0(0 0,;0@= mv; \;$40t0 0 0 $;&0<0!0 P 0 : 00(0  0*x:$ 00!0 0 j|:(00!0 0 \D:,0\0(0 0 N :0(:@90S  +P8: 000$  Q!00 0 *:00!0 0 x:0\0!0 0  940$0c 0 ` 0 : 00!0 , 0 888匈@0S C.0 hPuhqᱥP0@4j ᪥P@d 8(u$8@ᜥPD40 tᕥPD40D4LT G 70P 0A (000 1 1 7C0h7@+P00(7 000  7F:P嬕P/᧕P l>u0S\ 0T40000PEU UZ ⩧ z⥧0pPQ 4S<4Z H4L$0 %/pm?HL4P4SH$L4R0pl& -p\P C '/pD = 4S@00\S $EH?QHHLX00 $?D5XLH !hP? tk )oPp%;P\nPPT%Tt.p X1: S(%,5 $RU-@P%, mP$  㓤0IPXZs4S04z?080$Xp!x$ ,p = l$0tP$0 r04 xP  sP$,03}p,p40S0X44S@04S x2S 2"0# PrP 0T40S EP 3T#0S T4S`4P P3 2"Fx2ŸS H$L4P*p t0 L4H/0#! 0_pH2 C  s0, :pĞt  z6 0P0P+ ^!L4HϠ0# 4S 04?X 3뼀04$$ST RQ  X  0B,0p XR001R04Qf ;R040 Q$ Qq8*m'w"vFw%',vDZ}%{HSm#&L5H%+$ 3 6c>jXn'|:Mo'cu'% _% _(kL$ _wHL4 Q} QQ040S[R0[ 4S$kP 44崐S04144 0S @4S 0 z0@4,4S $4R#1ѣ1,400 0"Uu +t +0S @p@) P+ 0!dtR3>0]}NP=. XR04ʃ1$4Q :$4#+-T4S 3 -4"d0t%3+w+u+s+`@,\4$H1H4<$L1x000@ ,pbt➢P Z > ⋢P⒢P  4Wp  T4 w 4.8 0D (O-IM⤹i M0p4, ;pP_h9`4pGs04WZ hȤ  ĤYa) 4S<44S $$4R0(*p  hZ,p  4 SP,0S x$0ㄟ $tZ0 0q $0x P$H 1Sh  $$4Pa*`qZUCUDPEU<vbPEUUH|6 (p'8#80( R&0C RI ("(q044s04=0t0 0 0 p6/00!.0u 028PZP ̌p ZPUȌp 刀pp*Pt +@ lUpeA~55w%((5%6(P6c\6{6P((#366((6@($7$0(( 0@ x0@  0PUhPj 0C Sg0400000,00(00$00 0000000000 000000 00x 0p4RE PPH,<PWE ,gp(8; 00 L0%p8; 00|L0 %p 8; 00L0 %p  8; 00L0 %p@ pHR  |0 x; E0 y;z+卙0;0; ; '0cy;0z;(0x;+2(bPtPL0 %PU;"0#10@00 0`K`QH  `   `0 v%P|1K0S PPK0 i%P$ 0  003 \%Pd B0Ss C,``0 H%P4$`@%$㬙P0d!2 (100`[[[[,Q0Q4QPPPP8㓙 d<;SʜT!%>@ goz䛟{ k A::˟c%@ 3UoVz{ k A9I:`"2RgdD' D{ @`30S 0 ' 4@MHIN2 X0弅#pU00 ی@+0@W0 00D+PT2 ppW O P(2 $PG^AQKW$P pjc1{CA{7ZA (H{G@8HIN' T{X({*C#@ T7 X0S3 F <%0T0xPT00P0p+t"#P C0S 1 f bR$t;<000[ Y0 0  |A  ++d2"SS% 0 " $@-C6?8~A@@(0((R7}%5(((6/7(m7r7}%{7x($< pI1 @S= 2R`" B8#<48#8Q``0!TR?LTXd%X0 0 0 d20ҋ "  5  `ⵗ`+0l0hd&?ph&{2{7@{{{{{ {  M 䂟 3P ŠU h2Y0Ph2d@ g P   h}hE 0Y 3# |@0H #$$<0(0"(00 2 0BS2 (S:; 4 0;u*U@P4P0đ#1!(0H0C8C8S ! 0H 8(#8L"(V* 0 z$1币;    0; A* 0@0 0 U|@0H #$$<0(00"(@0 P0W 0 l0 JD0vD0P#<0[^U  x($7877}%((P8(888884  QZU|T@0H #$$<0(00"(@0H 0 H0D )P崀崐0ZP)0  )0CS<`,Tx 0Tx0  Pz Q=| $,) 0#!)0닟P@0f|x0  P/ X0  P& QH)$;)0 f P 0#$$0(#"(!')0 R P )0 H Ph 0 ? P Q Q 0,q(o0 - P s0 # P 0  P 0  P 0  P 0 Ph 0 P D0 P  ( 04 00Sk ES S U|?0H #$$<0(00"(@0P (H"969N9g9999999::9:G::X:f::::: ;Y;%;;;u;;;;;;;<4<<(<(*<)</<SIZ0KUI7PY(DDXD0J0ZD0 I)0K 9+ 0K2  QJY0KUD03 +Y tP UD0 %(D0J C 4 ḛ U\(PDDD0I0YD0 0J#1 K#+ ' U'O-M`PBT0@-S@P.44 @ $t  0p+40SP a`F0pP[P|$ȳPQNpKG3!PN ( fP@`3 pC d0@SL@20S,K@HGG 0< 0p( (Y ~\fZ'F_`P=P`0b 2 R ( (0 S ( (U+ 0 (!(00!0(Xᤔ㡔㞔㛔㘔 㕔p40 p0S X` p0S@P0p@( 0f Vps`lk)<w%S<_k<<<l<<<<=@=t<=O-PAM Ms@`᥊xxWP l垊d7P000-S% @W#P eQ#Pe0@K p0\Z %`F00S@DDA@D`v +/p .6p0StbLPt63 Q\  %#P -00 R'`@Z-00  D0B5S񟗊   P   $ 0 @ P p P  P   P   00S &eP}!e0 0w꤄4P e00i00f`400bd4 ^0S Ld V44  R00Ok&P H ܃ 300S P60$010(0.0,0+ t0C?o2R0S0$0P\P @/v@Da0($}T3@00`FrS; RS iS/ #tS xS$~똒弢+B&0p 0@00@00S ' 0@Tp0S $T$# BR0(0/S @ (0S  0@ 2AX0S (0S p|10l 0pTS 4Lv(0S (l 0@X!&aF$xP+& 0 P9@T[ E)HJ@w%@?,:?R?*t?$?In???:}%a$;8?}%G@b@t@@PM@@:PO-LM)|@pPp/U-p\?,#@DRQ0I < s@@0SR cvP cP SP- TP0(3 LP ,d0@S ,DPht0D003030800H00 30$30,3C 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#044qpy 0P 0PQT)_^JZp3V u`(os`F P% 0SU030#:U %5P|R P l 2| XU P&T6K/r0{+03PvTS0 0S0# G@SPE*X: P 0 0<6SR46SR 0&2RRPh2 01= ֊ 6S |7+P W0`W  0OP *Ẋ!EK/r0)+,6S m/`P X0!Q5PVյ 㖊͵<6S:46S: d1Q0@6D&S|1 0 00Rl! H& R\! $&TRP! 8&RD! 0&@R4! Q,!   @ FN @H@n|0P+k2*w%qk,k|rkk8*]D3*3*kl%kk8}%lll0 _k<lk2l?lellll9*llfk mmm)km̷{5m.mYkA-PHMp`I &p10PEU* *HP h0@ S S+***(+0+d+****8+P+HHIIl1[d1T1 P1 `q< P p 1 !  gqPP \ Lp$@@@(@ @s  (hP P0S PxV `P X\0 0000 Ismw%,%Q9*SOyt }mCt mmG-0HM`p0C,S,C, &p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 *a0@S8..-H.X.h.-------.--..----p.. 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTP \V ДY 000 01HЍP oPPp  [0S  40 `PMHPV qh V 4`Fvt9*,w%%}%kvkx9*SC-Mp`}7ɋPPF! VF :%pSPU 6 `V V 60S aP& tP8p6 R ~9h&   %p<6U@,V`F V"@T ᐋP ዋP):PV 0S A@D 9P`Vu  tP9@PA@3P񟗹311311111111111111110311111111111D31X3l3133311333333314$4zP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03/ $0S=<0S800S3<3P׊P0$0:(U 0S# 0S 0S`V Q PF Z0S 0S 0S`V UUp᥊P `᠊P \ᛊPPEUP6h61 711146 U3 UUU  U4 @U U00`0  : UQaUPJ100000  :P  8 8$0S : z8 {p ,qpG*v@T = 0"600"$0$P @P P`}|%}H>*w%,|}}%}xSxq|~}~)~9~P~G-MbM@Pp g#p10S QđȡPE R ލЍRP fP74p`<MPd YWOJ4nP1 JP/0: S2  S)J H<P0 JN@n` 0 4S00`uZ0S ~]p tJ <PJ <@PJ0@ꂀp>*w%S05C-GMM 0MI@=P<8 =8X@8DX~|=`{`XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxxP0D80l8"=C0 8}PP   +P:?( 0Y{L  }P < <}@P MPL< T(X4d@0P$,TX8D } <P  0S;+,Kh8S <PU KhX }P@ OoB;p ||+;8(p |P P[`T`h.nPdh@,;p[`L  8"ppT[0 e4+ 0 0C 001T0܌ ||  \8T0>0P XPX0Pl ShQ0 jP4:Ty P: h(q`P9 T(X(g< c0kP9 h(e40GDS4,?BmkX:@PH4m@ 1m0@`,rvPP0@P`1p@+30(@0@000,`40 U0(P<P8z,8U0C?o20SP ,R `0 ,0S x,8S=T Ђ,8S ꪬe* eΟeƟܟHJ %/gq8}%}%Ow%vHfxhv, %yn*o]D}%ʠCޠ,  6_ьȌیNmȡӡ p  r* T G-P`<0EqhR1埅P03ރp2S lD PUUZyPH t处 9PB/PE0@ *  pd40pEWQU H4 000`P$ L,[~PE0S#34# 3 P㍃㊃㇃㄃P *UvP303 `pp hZ dy`3P04qP勈4S @SP  ,U{ P 4SqRPl l  PnR8y,`p1<01 1> 11bG01/΅01$1fdb4#(2R$$jp`g Pd Q18C8S ᎁ0}q܁ܑ`㤆V00l  B/o" R P  \=S` 0 0000l ⴇ18C8S+`#RS S=?o20 S Sl ♇18C8S 0 S y` S S SRꋈx&+>iw%%)+A,g }%G%%N_'+'+? ڳγS%clڪ@-@`/P6P1  q px10SAQ\1PI =D1CDP 4P1 nPbP9P0P 00@0c0@ S O POOOOOOOPONVP @ l0 \0  L0  T TT- 㳍?0SG4-+w%BA%5 uS}%A-`P <#R(+w%}%,j}% z+O-MpSvPRD,>P4/ᤒ40PP 00 01P0X00@T/`P@@@$ZpB,40HXH3[p ީ0S v@P [@ǁ#3P0#  -R R -R eB kR R|# QiR eRX#P#sPPPEP IP -Pd 3Q@"PZ`YX`Y`Y`Y`Y`Y`Y`Y`Y`Y`Y`Y`Y`YZ`Y`Y(Z8Z`Y`Y`YhZ`YZ`YZX`YZ`YZZ00~l2lZyX2\H20P^Up0Sm ?SPPi20`^Vd0Sa ?S``]10@^TX0SU ?S@@Q1100FDꔱ<00 \ (0 `0E !1R, S` \0 f 0Z(, ,Az^P D\Y  P0S%   S`0S   Rڰ1\0 1 ,0,$+,%ɍ"w%X= Bj9%`9%e9%, А,ht@P+9}%OUZgtO-@LMPp`@ &p1 UV Pp PgP uP GP000`0St@0T PUP   p !fPP0P 0S UOPf p U  p T % p V p|:PPU k TtP@P 0P@O ,w%S3X=3O-0̔@04$@440(V,@q86 @P @ *[00 $2" 2巔P}1QW ؊륇<\1 <Ѝ *T5( 40S6 T 4P(pU @P t0 0U0 0 0 00 pP ,p %( 40S( ``++++++r 6+ ++++g}%yhhӡ++hi,d+\, +i  + +++t jO-pKM`E`T50 8`0 ` %pPJ5 W_Y  EpP :0(Pu ` 0!0 04QX 000sX%X p2P0 0 P` PPcPPD# A  i ! UNpUaUbPEUffffffffffffff gzU" !0  0 00 0`3T 1 L 0u$300q`o p00: S) 0V0[0S3 Y   8`P<  (mP (x  x9Pt( ({P\!4c`PP (j(,JVG ,_\(,!0>MP5 M |㭩 ]P"  7Pp0S 㙩t Ig0S 㐩T0 0/X0 P@p}2 0SS RQ"$0p0>0S u@P0a { D Tm P Pp`8X,w%S}%ht@kʛ,F7k DNf\O-0MP`P 00@=}P 7}P ;ߍ*. P`?P1\?@0/1012211B "L122p<p5pN-&KĮp\10. 0>p1F0[X18X1ռ`0  F1|!1hQda0  @Pw\1j >0[ >00.+ + X18X1=0YSpVPMP 6PR ?PI 4PꨍpN@P񟗯,nkmkkkmmmfP j@PP񟗞m nkklkkmkkkkkkm=0P1`X <'`F@،p}\1F3\1Kw0000q0\1lH o@ftpclp`0  P_P \1P V0#P\ O0[ 0 @P 0  P;5 684'0 _00X1 ¬pxx »  ׼1S _P o8   . g:0P \A@ @0 Lp  rp 咻( \ X1 Q 0P819:\!p*X1 d ]pDT upP)(< $X11Z MyPPY* 9Y) 9+ ) 0 \1 ⲣPc~ P HS y 0 09ָzpHx  W ?00S L  ,PQ ;~0S(  xX!\10\1808"/0  0X!2sP8"/0 "2X!s"/ p= X1`̺  $P%D宺X!\1 0\1 008 p 137 ᫺ ۭzGPtwht 007 㥶p}0S $孺X0pGW}0ST}0S }0 S X1\!8 0\!' zp}0S &|僺p}0S &Hv /P q  lwttEX1 I 0 S!pT9 _p5 P <1\1A>\10L1_ 00L6 2pwl?s0L1N 00L5 !p(.p _p P \10\1Q|)尷d\1 @0\1y/pP @ ,X1 X40  ̪p` X!\1 $  $$ 4301 ☽p   άK_pݹ 004 ĵp@ѹ|!RX14X11  P+p0v!`0P!  R!绹00|!R00SR\1. AX1 ꐃ吓0 Q01X: K  ⚺X1  !1PU3X1\!( ; W A? =  1R@T 0S 0 @}@ 0S  ᫮ 0S PpP P ( RW  R   001M0 S   0勹PU> QR\1@0@k倷z`1 \Ak- \1$  XՉ ؤf%  w%:,gy) O@_Taھ^A <;p M%P' 4CQavx=Ylɦ B/DC;cKϧ8D2 }%  Q/0@-0t h P ^0EMb@1 0 0$010HX ~1O-0!bM Mb  [ !1 b0 0 30]bݍ Ѝ"m` t(  Hp \ $G{+ 40;x80G`00 80G( G p x8_S0쀟00 0000 @G P0 xP x8#`@#[*vxP0l8 40G PU P0l8 40G P#8WW7>7>0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/6t6\6p@-``A``1M@0``H! D1 0 0 0!  0 \ QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp\ xTddhT8@-M @xTЍ\h  Q/X-M  0 p 0 S 0 0 Ѝ䘧< /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/):*/=7*/4*/1*/".*/+*/(*/%*/"*/////^*/*/*/<*/ */ */*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/*/*/ */*/*/*/W}*/Kz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*//7*/>*/4T*///*/@-@wx@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_RC5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog11.0_RC5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d C"h'+B@5 0<DDJMMO8R 8RZVW^````{HfNANGNPNPjHTS0WX\ __d<xj*pushdnepopdneLp@@e@@@4tq0/P `@@_o(@@4unblock and -DNO_CONV?@pD8dHOC(100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink1 1 1111212.2/2C2ET2Zh2}222#2 2_2^2F2<2>2?23PATH= t2gff<dm<f<s;cz<f<ms<f<l<<r إ8p<%7n<f<v <b    EOF reading here (<<) documentWAAAAAAAAAA?86AAAAAAAAAAAAB BBerAwA|A9AA4p9:H:\}-+?=w@wDD%D+D1D7D>DHD@n9Ȼ9999DDabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'^'0uF]'1}F]'1FL^'8F^'0Ft^'0F`^'0F8^'0F ^'0F G{ ~ ?*`HT{HL_~HM,HHH Hd?a6bHW\H6H69 N8HY MH0ZRxHLb8Y8E1H`H0}HUXZH5KK KK_  MKKi K _ K 5NN#mK:||?LTAL??L$?ۃ>L?_M?L(@_L@CAN>NAlL@LBZ@BGAL?L$? A`L4A-A2M6M:M>MCM#BM3KM#JM3RM2QM3XM3WM#OxMMN O@@ OO#OM#M"MNNNhMNpN N@NxNNN+MNN LC$LCLC$LCwLMNLM NN M2NMN N@M@)N M MM=NEN@MNUN ]NLLLLNNNNN pM@]]]@\@]@]@]@^@ ^@^@^@^@"^@)] @'^@-^@6^@>^@]]E^J^P^W^_^e^]k^r^x^^^^^^^^@^@^^^^^^^]^^^_ ___!_]'_._6_=_D_\\L_J[[[k[[[[[[\\1\M\`\k\{5\$+`/`4`<`A`G`M`S`Z`_a`e`Y6__k`vq` ۍS_]_g_p_w____$______Y__________ ``'`\\_\\\\\\\\\\] ]]]#])]-]4]H]>]G]N]W]`]i]r]}]]]]]]]]]]]]$+`/`4`<`A`G`M`S`Z`_a`e`Y6__k`vq` ۍS_]_g_p_w____$______Y__________ ``'`$+`/`4`<`A`G`M`S`Z`_a`e`Y6__k`vq` ۍS_]_g_p_w____$______Y__________ ``'` orjky/Pc  * U q Pυ;`tӆ !+#+$&+1+23+4+5#6+8.949;:T;n<=@ALJBC/DVElFGHJLMňN̈O܈PQRS-T6U>VVWp\zacdډefg#h#i#p*q+s+t+u@v+wFxZvЊ݊4Tpŋ݋'>ZrՌی4<_-Il++++΍#0B\lŽ-Jb%@[++n"+5e+ϑۑ.[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]x~w ۍS_]_g_p_w____$______Y__________ ``'`returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readiS$@X$(^$`$@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z--8foJ2Ȅ$Fg $@ &4G\n@H Th| 4X(<Px dx4  ۍS_]_g_p_w____$______Y__________ ``'`$@y/Pc  * U q Pυ;`tӆ !+#+$&+1+23+4+5#6+8.949;:T;n<=@ALJBC/DVElFGHJLMňN̈O܈PQRS-T6U>VVWp\zacdډefg#h#i#p*q+s+t+u@v+wFxZvЊ݊4Tpŋ݋'>ZrՌی4<_-Il++++΍#0B\lŽ-Jb%@[++n"+5e+ϑۑ.$@=$@|$@$@|=ة$,$1$@>t$SFH0eC&SFU0eC,_Hah!IdontNeedEFI6;(s*K>;E|nQn- q+P\|nQn- q+ku|nQn- q+|nQn- q+|nQn- q+'`=rGy=iG};Mt?mWC 3KOOyD<#*=(3Dh&\ M}-*;@Mjy֬L]-чH_n-чH_ZIчHIчH~IчH2IчHۍL6 %?aS'@ )Ѹ*1@ )Ѹ `1x )Ѹ$$$@:$backupstore_gptstore_tbl%$@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus$ printallmaindo_setifpreferencedo_setifcapszi$yiHHHp$z$.HHp$$vX$r$:$7($p$%$p$$$p$p$  $0<@HT`h q0z@z  @ init_current_mediasetmediamodesetmediaoptsetmediasetmediainst{G{:$ {`@:media_statusmedia_constructor_h#5o8$th#5o8$#5h#5h$rhr_$qh\#5$ h h$paddr_match \\ p\T\settunnel p$$print_link_addressessetvlansetvlanifH$,$h#setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanoruxsethidessidsetapbridgesetiffragsetifrts$1p$$T1p$PX$OP@* p$Y$8$$0p$i$@iTA* p$ʪ8$$h@?##X?&invalid major numberinvalid minor numbertoo many fields for formatffs@  K*2x9y@ yyypDM _ 'gz @  4 @U x~n s w|  x    0$jx; REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@S(Bd(Cs(F(I(L(N(O]*S(a(b(c)e)f-)ht)i)k)m)n)o)r)s)u)@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:\@@/@h /p/p /p/p ` //@ / $1м|^t0 Non-system disk Press any key to reboot \ppp\ppp\pppDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYffffg-gWggggg h=hehhhhiUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printw(w4w>wJwPw?ewJwrwwwwwHwXwTwwwx xH!x;xIxYxaxYxuxYxxYxxxxxxxxxyy'y+yGyRyeylyyyyyyyyzyz3z8z^zpzuzzzXzzzzzbitmask_scan&Pvvvvhw.disknames EIMQUY***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]a   : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datakCH\ 1k3j_0+    "#$%      "#$%&'()*+. str_arg_substget_available_cds ۍS_]_g_p_w____$______Y__________ ``'` edit_fs_type_extdf \O DO pO  c 4d r $r 1LO eO uO edit_and_check_label  ۍS_]_g_p_w____$______Y__________ ``'`disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz $ D ľ P ( X H D D x | h P ز p ȷ X disklabel_change_geomy x~ ` outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default ,,,,pm_from_pepm_whole_diskgpt_freegpt_create_new P|hTԣp$<4 Tl@(@ۍ6~ &__ !ۗf-J ۍI\~n s w| >_ŗ x  _ʗ`ӗgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC&SFU0eC,_Hah!IdontNeedEFI6;(s*K>;E|nQn- q+P\|nQn- q+ku|nQn- q+|nQn- q+|nQn- q+'`=rGy=iG};Mt?mWC 3KOOyD<#*=(3Dh&\ M}-*;@Mjy֬L]-чH_n-чH_ZIчHIчH~IчH2IчHۍL6 %?aS'@ )Ѹ*1@ )Ѹ `1x )Ѹ$- ֙4Њ_A ȊX*:J ]kmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newy І Ć P $XdTL4 DPtdDX d mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************EIMQUYcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump205Gdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option3bHczd5ef¯ghiNj1kkίlmدn3Lo߯pqrst:uzvwx z_kyA!B.CèD5E?FDGNH IzJXK_L8MhNnOwPQaSbTUVWXZ1ð4̰6հ|~}(&/-4<AGMS?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%    k\qwe} 3 @?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::!ȥܭ {L|H NČ`'̌<Ԍ܌  ȋԋ`          ( 0 8 @ H L T \ d l  t  |             < x   ,  h 4 | Х XL ,     L 8 0  \l     l 0 8     < x    ,, hhĊ Ȋ̊ ЊԊ ؊܊ XX X X@         $ L .( , x 0 4 \8  @  H P X  \  `  d h p x    0 00 00 $ 0 8 @ L X`dlpx`ȍ̍؍<hl t ptx|, P 94 <@ D L U x xx x x x(8DP`l>!d:!P>!L=!HC!d,,gnts0,$#"rbmn H|tcidHM4SVFPF@FFF ,,yekd4V\MEīȫataddb,eloobpppDG!DG!LG!LG!yara4v||zts, ,HTp̳8D `l   ̴H ش,8\hh (08@DL؛PX\d$4<DhLTd\dht؛ĻԻ̼мԼؼM!ļȼM!dptx8ĽȽнؽ $,48<@DHLPTX\`hpxȾоؾd$8HT`|̿ؿ,@Xh $8L`t(<Pdx,@Th|P!PX0@,X0@t,h,T!T!@T!~ bj%jc2gfhklmoopppqr`uYt#vw+w8xoxfzGz@B.C<JQO[PjSqTc?VnV|XZZ   X (8uD.vtD.8ytt u(||}t|tt G  </dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbinLR'}-+?=###%%%}(X',X'S>a]>e>EVk>elFs>Ii}>L0kl>m>Cyn>f>>p>b>u>>>qڶs>>h#vZVV>x\Z'@=\$@$d -Btf?nvfxfufzgug*u=ghuLg"iPtjgtgoo:oDoYoboؓrj+jeo@qo{ok`,oo oooo߃ $ՃOƓ ... ...}_uHn=  {5{53{5HnO2t80(4 6p$ H$AabCdhlNsuvW:w:z$$$$$, $L$$ $e$ heL L l$ $eL , $l$, $$, $$, $$4  4$4 PaH `$4 p$ $4 ;p$ $d$$$4 p$_'$4 $$_'$, '8$\$X$d$X$p$h$$$$@$$$$$$$p$<$$D %p$% <8p$zz Vp$: vp$:r:4 X$_'$D p$ <p$z rp$< p$ < 7p$ 7< Xvp$ v< p$ 4 P $D #5p$#5D @rp$rD qp$\< op$ oD p$4 h $ $ p$4  $$$ h#p$< "p$ 4 {p$ $4 @ $D *p$D (p$< 8(p$ D 'ʪp$ʪ< @Pp$* P< TAip$* i< T1p$ 4 p$YP  $ DKR,JY,J^KdIllK,Jq,J֊Hz$IwJS^,J|K,J,JK,JOƓ  '@@  0$jx;3iqaahaa.;fwa #m e df o $l~ah6fuf2ta~SLa >vJ9ra7 a!a"a#$a%a&a'a()a*a+a,a-a/a1a1a2 b3b456%m}%w`vvvvvvvvvw w. (prog_root)`@?nbiP+Ȍьیm\4 4U O4 v 4 _ 4 87 @4 6 4 E b4 5 4 d_ H4 b _4 K 4 pi 4 (] J4 _ s4 8/ N4 b z4 @J .4 `M bj4 XP 4 _ rF4 E +4 f 04 f 64 Pf 4 d_ <4 4u E4 hC 4 6 e4 8/ Hf4 tH o4 8@ >4 I W4 `F 4  J4 4^ 4 5 O4 L 4 @q S4 p Y4 PY 4 XP ^4 hk e4 M 4 R m4 d@ 4 Y 4 R 4 XP r4 u 4 `6 w4 n N4 @q 4 8 l4 d@ 4 8 4 o g4 XP 4 c 4 b 4 8/ T4 @q 4 d 4 XP b4 XP 4 XP 4 J _4 H 4 LH 4 ` 4 87 Z4 X i4 d_ 4 P\ 4 Ti 4 r 4 8@ m4  @ 4 Lv 4 O ɍ4 | ύ4 (j ׍4 ^ 4 Z ݍ4 o 4 f $4 87 4 G |=4 s 4 \ 4 m 4 r 4 D r4 6 4 f 34 k i4 06 4 Ti >4 8F 14 84 H4 ] >4 t 4  >4 V #4 G 4 r -B4  @$!=0k= ^} p|  <<v !7p@ <hU >-W tF$V paW |yG $M CN +N c˭4B .ܭC ܭC R R sLQ ?+j #<R h%+IIEFCMPHca`l`LsNhYl%+ !"$'(+-.03569:&]==N/#20ZEe],++D++<++0++@++8++4++*+*+(++++ ++++++++$++tip.record  /etc/phones״vd$)+$<a8++ a4++Ka@++II~a0 ++kZ#d++$laM++-a*+# 4a:VaD++a ++HO#YX=Q%^ a2(+++MJhdr*+yd*+dp*+GNDZCMaN$++\/bin/sh)$b@q@zľ˾Ҿݾ&18?JQ]dpwo ǿοڿK &-@:;+J`ľs1 .?FڿwKo -;]%b%L% |%z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ#%#%#%#%#%#%#%#%""#%#%#%#% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<$( is a directory is not a regular file (use -f to see it) '% '% (J$WaqQ}">zeB ; 7   #2 8 &6 B(JT`!lu9&vf)5e:%6i4 +,--<.O*\e?7uE|//'F@  .B  R vf:D   ) 5?WmkRkRkYcWbkCkc kG ky wb YMYrWca7%\j+b7%@ j+| B7%$j+9^c7%Xj+d7%@j+7%ALj+ (Dx7%( =ep7%Hj+Jdxfh7%j+F`7%Dj+gX7%xi+9dhP7%4j+iH7%,j+  j@7%P 2@J87%!i+Mkk07%HD (7%H K 7%i+L7%i+m7%Tj+ n7%"(j+#:Ko7% kO6% vp6%H P6% ?q6%dj+r6%"j+ @s6%!P FP OP 4b o o o XTX Rr SW Ta UYW elW X X PY QPY RX SX TY UV@W Wpa xhP tP yP <`o =po >|o ?o 3P 0P LP LS ,S R \` _ hq q O SPo T S S S ` t_ S Y O TO uxO O O 3,>Y>v>>>>>?-?B?k?7@O@ A7@1AWAvAA/9 B/B]BmBBxBBBBCCCCCۍ!DnDrD|DDE`EEEEEF$FMFTFbFoFwFFFFFG1B 5HGGGH"HCHv|]HnHyHHHnHHHHIIGLbL~LLLLLLLM|MMM*rN|NN(N%NNNNN O7OfOvOOOOOOaPjjPPP QaQQQQRURZR`RRRSjTTUCU[U`UUUUVaVVVW9WWWW X3XjXXXY(YHYeY{YYYYYYYYYYY'Z7ZHZeZ[[[[[[[[[[[[(\0\8\B\M\_\p\\\\\\\\\\4 ]]]1]D]Y]d]v]]]]]]]]]]]] ^^$^7^K^_^]\n^y^^^^^^^^^^] _!_/_8_M___h_]B_________``"`Cbdbbbbbddee#e2eHezeeeeeffg7ggg kvovtvxv~vvvqNvR|R|V|N|bo/x u /)H 'yd<BHPW:0]ci nt10|&'()*z+.1/ftpy@&yق3}@ |@ 6> # ?` 7@p Q| Ak Bp Cu D ԩ E } F _ G  H > I0 Z   < 0 1uD 1e uD Ɏ׎)8]\>]0\T@>(| C7;?CGKOU X  6  [ ^ k n  x 5|%Z_73  !"#$%& '(&)8*A+K,Q-X-e.l."/ /00W1v2z3456789:;<=>?@[\\]'^2^D_O_X`e{p{|}}9~  -dd-ddTdd:dd:dd  @@`$0 #(#0#8#<#D$P$X$`$d$l%t%|%%%&&&''ď'̏(؏(())) **(*0+<+H+P,\,h,l,t----.../Đ/А/ؐ6;;0 00 1,18<@<L=X=d>p>|?2223339̑7ؑ8:4445(54 <! L" X# d$ p% |& ' ( ) * . Ē+ В, ܒ- / 0 1  2 3 (4 45 @6 L7 X8 d9 p: |; < = > ?  @ē!@Г"@ܓ#@$@%@&@ '@)@$*@0+@<&`H'`X,@h-@x.@/@0@(`1@2@Д3@)`4@5@ 6@7@,8@<9@L:@\*`l;@|<@=@>@?@ `̕!`ܕ+`,`"` #`-`,$`<.`L/`\%`lC|CDDEEFFĖc̖cؖdܖde8e##&& 00@DHLPT\dlt|ėЗ8<@DHPX   @ @\,4<DP\ d l t@|@@@@@``̎Ў؎ @ h33333333ܲ3333\`dhlUTC33$$xHzssy`sx4s336-Th339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[SžHx%Tx%Hx%x% 33UU33UU33UU8}%;9: :y%}%;9: :hz% }%;9: :{%L~%8}%x,LT\d Lpl,xptx   @ 333333333333333333333333333333333333 33 33% Y!Y! 0000000000000000 `*-33333333ti33 %%% (root)`33 $$Cb!b!b!b!b!b!b! h$\$$$$4c!8e!^˨ηg5wG ".};73zyV"EL#ޗGG|">">f ͥZ?/^#ȿkF=v jiZZwmǑ_#i䓮~{&u?EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+Rb.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BHP$ V$ $b̵$̅ gе$Ѕ ttD$D Xy$ %U!%U!(6-U!pU!-U!~X!MSGTXTS628 5040 5065 5082 5104 5107 5112 5120 5127 5135 5143 5146 5149 5152 5156 5168 5177 5190 5219 5234 5778 5812 6495 6783 7491 7547 7621 7717 7892 7915 7938 7944 7953 7975 7979 7983 7986 7989 8094 8297 8536 8977 9415 9450 9465 9477 9483 9495 9544 9564 9604 9621 9638 9653 9700 9738 9786 9868 9992 10128 10169 10207 10244 10279 10289 10338 10488 10494 10499 10503 10523 10633 10653 10659 10673 10685 10696 10733 10767 10791 10893 10930 10952 11051 11106 11164 11175 11191 11243 11411 11618 11789 11853 11905 12177 12727 13256 13688 14026 14359 14472 14487 14496 14656 14827 14977 15141 15164 15188 15203 15278 15418 15595 15750 15762 15842 15943 15989 16015 16085 16096 16105 16118 16144 16159 16175 16188 16243 16254 16269 16473 16706 16735 16750 16819 16893 16966 16996 17034 17088 17507 17533 17562 17666 17772 17957 18069 18184 18288 18975 19234 19374 19410 19580 19621 19757 19780 19817 19862 20113 20209 20263 20362 20373 20410 20447 20474 20483 20517 20524 20549 20576 20611 20625 20639 20668 20682 20699 20708 20730 20748 20765 20776 20795 20821 20839 20862 20879 20894 20909 20927 20954 20981 21003 21042 21060 21092 21320 21394 21437 21483 21630 21786 21830 22109 22136 22495 22679 22831 23012 23159 23317 23338 23386 23396 23404 23415 23426 23436 23443 23458 23470 23508 23538 23577 23630 23688 23709 23716 23735 23756 23763 23786 23808 23828 23850 23881 23918 23940 23954 24000 24029 24063 24103 24138 24166 24214 24223 24232 24237 24246 24255 24272 24276 24281 24287 24291 24329 24338 24365 24385 24408 24427 24454 24476 24508 24524 24529 24539 24562 24584 24601 24618 24631 24640 24649 24655 24682 24689 24713 24734 24758 24771 24790 24815 24838 24854 24860 24872 24902 24910 24950 24961 24972 24983 25000 25017 25031 25048 25264 25568 26016 26232 26496 26768 26820 26856 26892 26943 26960 26998 27012 27019 27036 27039 27044 27053 27065 27076 27085 27106 27148 27186 27202 27233 27258 27293 27349 27389 27410 27430 27471 27500 27548 27781 27816 28023 28042 28079 28140 28178 28217 28373 28388 28434 28482 28505 28541 28551 28561 28572 28577 28640 28688 28732 28793 28826 28927 28945 29084 29106 29229 29243 29253 29276 29381 29437 29553 29584 29589 29615 29654 29664 29707 29717 29733 29748 29766 29789 29819 29840 29866 30063 30106 30110 30116 30122 30127 30138 30152 30181 30213 30225 30272 30322 30362 30389 30405 30414 30457 30463 30471 30475 30495 30512 30524 30555 30811 30860 31436 31463 31495 31523 31575 31581 31587 31592 31613 31629 31651 31680 31821 31955 31968 32104 32106 32108 32110 32127 32140 32158 32185 32189 32195 32200 32208 32214 32254 32256 32266 32281 32298 32332 32364 32402 32431 32460 32482 32525 32551 32595 32731 32805 32807 32887 32933 32981 33086 33188 33227 33294 33301 33362 33426 33430 33437 33559 33628 33916 34054 34195 34276 34323 34329 34352 34398 34401 34427 34470 34535 34597 34667 34735 34828 35047 35072 35076 35112 35130 35158 35200 35244 35308 35358 35434 35456 35508 35552 35591 35625 35655 35686 35711 35720 35732 35740 35751 35763 35782 35806 35855 35872 35896 35939 36261 36264 36278 36291 36303 36310 36321 36328 36335 36344 36354 36371 36387 36437 36445 36453 36463 36474 36492 36509 36530 36552 36561 36571 36598 36604 36614 36633 36649 36667 36687 36696 36707 36714 36731 36750 36771 36781 36798 36804 36820 36835 36850 36871 36893 36912 36922 36927 36932 36950 36969 36988 36994 37013 37033 37053 37071 37076 37082 37099 37115 37136 37149 37157 37177 37201 37218 37226 37237 37258 37264 37276 37298 37312 37321 37342 37360 37369 37403 37426 37453 37485 37508 37528 37539 37571 37587 37598 37611 37634 37656 38164 38194 38225 38253 38267 38468 38690 38857 38944 38961 38979 38996 39025 39072 39083 39102 39124 39203 39395 39423 39541 39563 39704 39723 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_RC5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_RC5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_RC5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_RC5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_RC5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_RC5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_RC5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS628 5040 5078 5095 5110 5113 5116 5121 5129 5137 5145 5148 5151 5160 5172 5184 5193 5202 5228 5239 5775 5802 6368 6668 7309 7356 7469 7562 7596 7615 7633 7641 7650 7675 7679 7683 7686 7689 7811 7996 8224 8744 9095 9124 9137 9150 9155 9175 9194 9215 9274 9291 9305 9327 9372 9398 9439 9517 9635 9749 9803 9832 9864 9903 9909 9942 10065 10072 10076 10084 10108 10190 10196 10203 10215 10229 10238 10271 10290 10302 10412 10474 10493 10612 10663 10715 10727 10746 10798 11002 11210 11401 11461 11510 11777 12236 12902 13325 13647 14072 14204 14236 14248 14426 14623 14784 14918 14938 14971 14985 15054 15167 15339 15474 15494 15606 15698 15721 15744 15803 15818 15839 15854 15875 15895 15920 15934 15958 15970 15988 16198 16448 16469 16485 16538 16606 16679 16716 16742 16818 17275 17301 17323 17430 17537 17738 17811 17895 17995 18490 18728 18879 18913 19048 19092 19231 19272 19317 19364 19608 19741 19803 19897 19902 19936 19970 19985 20013 20046 20053 20078 20096 20122 20129 20144 20159 20179 20219 20236 20256 20277 20299 20314 20334 20356 20371 20384 20398 20410 20422 20436 20459 20482 20500 20543 20594 20631 20816 20879 20915 20964 21055 21185 21238 21498 21545 21906 22056 22225 22365 22485 22617 22657 22704 22714 22722 22732 22740 22751 22762 22776 22801 22843 22876 22909 22944 22998 23023 23042 23064 23069 23075 23105 23122 23149 23167 23188 23210 23229 23239 23269 23295 23322 23371 23399 23426 23479 23489 23499 23505 23515 23524 23544 23548 23553 23559 23563 23598 23607 23638 23655 23682 23703 23723 23742 23768 23781 23789 23805 23836 23867 23888 23914 23927 23935 23946 23952 23976 23986 23998 24016 24027 24047 24063 24089 24111 24127 24139 24159 24185 24191 24221 24235 24249 24272 24291 24310 24328 24346 24569 24875 25293 25494 25734 25918 25996 26051 26118 26158 26181 26215 26226 26234 26257 26260 26263 26269 26280 26292 26305 26335 26379 26392 26405 26442 26456 26467 26478 26489 26506 26517 26564 26587 26636 26877 26910 27165 27186 27219 27272 27298 27325 27481 27487 27530 27550 27569 27598 27605 27612 27619 27624 27673 27711 27745 27802 27830 27875 27892 27993 27998 28075 28089 28099 28123 28246 28327 28437 28465 28470 28486 28515 28523 28564 28571 28585 28598 28606 28625 28658 28678 28698 28914 28945 28950 28957 28964 28968 28982 28994 29009 29042 29055 29110 29168 29204 29222 29240 29258 29295 29301 29309 29313 29334 29351 29362 29384 29562 29606 30308 30332 30366 30385 30430 30437 30444 30448 30472 30483 30488 30551 30672 30795 30808 30942 30944 30946 30948 30958 30967 30980 31007 31011 31017 31022 31031 31036 31063 31065 31078 31090 31105 31133 31177 31224 31240 31262 31273 31306 31326 31375 31475 31529 31531 31596 31645 31694 31798 31896 31937 32028 32035 32096 32160 32165 32171 32280 32339 32590 32731 32858 32926 32963 32970 32997 33043 33046 33067 33112 33163 33222 33291 33338 33443 33586 33611 33615 33649 33666 33690 33742 33793 33865 33931 34029 34046 34077 34113 34147 34171 34195 34228 34248 34258 34266 34274 34284 34295 34309 34335 34383 34406 34426 34467 34766 34769 34783 34795 34802 34821 34835 34842 34849 34858 34868 34885 34901 34949 34957 34965 34975 34986 35004 35021 35040 35060 35067 35084 35101 35108 35121 35156 35173 35192 35212 35222 35238 35251 35269 35289 35310 35320 35340 35360 35373 35392 35405 35429 35452 35465 35476 35481 35488 35506 35525 35544 35552 35571 35591 35616 35634 35641 35648 35661 35670 35691 35704 35712 35732 35760 35777 35783 35794 35825 35833 35846 35868 35890 35899 35920 35938 35945 35968 35987 36014 36032 36052 36065 36080 36101 36115 36122 36136 36151 36170 36715 36748 36776 36805 36813 36850 37162 37339 37416 37433 37451 37466 37488 37538 37548 37565 37587 37646 37804 37828 37958 37983 38109 38127 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_RC5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_RC5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_RC5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_RC5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_RC5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_RC5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_RC5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Annuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS628 5040 5076 5093 5108 5112 5116 5121 5132 5138 5144 5147 5150 5153 5157 5169 5181 5191 5221 5233 5663 5690 6266 6626 7311 7372 7450 7545 7585 7607 7625 7631 7640 7666 7670 7674 7677 7680 7802 7987 8215 8744 9162 9191 9204 9217 9224 9244 9263 9286 9329 9349 9368 9391 9435 9464 9505 9571 9683 9797 9851 9880 9912 9951 9957 9990 10068 10074 10078 10083 10124 10261 10271 10279 10298 10312 10321 10353 10394 10407 10532 10590 10609 10728 10784 10836 10847 10863 10902 11152 11324 11496 11551 11586 11836 12240 12539 12807 13168 13348 13667 13687 13700 13889 14033 14229 14363 14383 14416 14435 14536 14691 14879 15066 15086 15165 15263 15301 15324 15414 15435 15458 15477 15501 15531 15575 15608 15631 15643 15661 15929 16248 16279 16314 16378 16453 16523 16554 16584 16676 17167 17197 17214 17354 17495 17692 17811 17958 18125 18683 18979 19160 19205 19368 19422 19557 19593 19653 19703 19994 20103 20160 20257 20262 20297 20332 20347 20371 20404 20409 20434 20450 20473 20480 20497 20512 20531 20563 20567 20587 20605 20617 20630 20648 20672 20690 20709 20736 20763 20775 20796 20826 20856 20881 20914 20949 20987 21240 21309 21364 21425 21543 21702 21756 22017 22068 22444 22599 22743 22883 22991 23176 23206 23249 23259 23267 23277 23289 23310 23319 23325 23357 23398 23434 23472 23509 23557 23581 23593 23607 23615 23623 23651 23668 23697 23718 23741 23750 23769 23781 23825 23863 23890 23934 23962 23989 24042 24053 24064 24071 24081 24090 24124 24128 24133 24139 24143 24178 24188 24218 24241 24270 24292 24314 24336 24363 24375 24387 24406 24440 24473 24494 24518 24531 24543 24556 24562 24588 24598 24609 24633 24643 24663 24683 24700 24726 24750 24763 24783 24817 24824 24853 24876 24899 24915 24930 24945 24960 24974 25162 25467 25898 26089 26324 26512 26554 26604 26658 26706 26728 26769 26780 26788 26812 26816 26820 26829 26840 26851 26866 26897 26943 26956 26969 26999 27013 27025 27037 27049 27067 27090 27135 27158 27218 27470 27497 27759 27777 27804 27853 27883 27914 28046 28053 28102 28125 28149 28178 28186 28196 28204 28209 28262 28311 28351 28417 28450 28494 28517 28618 28623 28700 28714 28724 28748 28871 28952 29062 29090 29095 29111 29140 29148 29189 29197 29211 29224 29232 29251 29284 29304 29324 29540 29571 29591 29597 29604 29608 29623 29642 29668 29677 29689 29743 29801 29836 29855 29872 29884 29919 29925 29933 29937 29958 29975 29986 30011 30189 30243 30934 30953 30988 31018 31064 31070 31077 31081 31105 31121 31127 31202 31352 31471 31484 31552 31554 31556 31558 31568 31581 31598 31625 31629 31635 31640 31649 31654 31681 31683 31696 31708 31723 31751 31795 31842 31858 31880 31891 31924 31944 31993 32093 32147 32149 32225 32280 32330 32429 32524 32572 32662 32669 32730 32794 32799 32805 32908 32960 33206 33367 33522 33593 33646 33653 33680 33730 33733 33754 33800 33855 33914 33983 34030 34135 34278 34303 34307 34341 34358 34396 34449 34489 34565 34630 34724 34745 34783 34823 34859 34883 34906 34945 34975 34982 34991 34999 35007 35021 35037 35065 35117 35134 35155 35199 35541 35545 35560 35571 35579 35598 35610 35617 35624 35633 35643 35660 35676 35730 35738 35746 35756 35767 35785 35802 35818 35836 35843 35861 35878 35885 35895 35926 35945 35964 35984 35994 36013 36026 36046 36066 36087 36097 36116 36135 36145 36162 36176 36199 36223 36236 36246 36251 36255 36273 36292 36311 36316 36335 36355 36380 36395 36399 36406 36416 36425 36446 36460 36468 36488 36514 36531 36539 36550 36581 36586 36599 36621 36636 36645 36666 36684 36693 36737 36761 36788 36803 36820 36834 36865 36889 36920 36927 36941 36956 36975 37520 37553 37581 37610 37618 37655 37967 38144 38221 38238 38256 38271 38293 38343 38353 38370 38392 38451 38609 38633 38763 38788 38914 38932 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_RC5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_RC5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_RC5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_RC5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_RC5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_RC5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_RC5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisMSGTXTS628 5040 5081 5097 5115 5119 5123 5133 5142 5148 5154 5157 5160 5169 5179 5192 5200 5211 5236 5248 5757 5789 6281 6570 7115 7161 7265 7351 7387 7402 7420 7428 7436 7463 7467 7471 7474 7477 7588 7773 8001 8477 8811 8840 8855 8870 8878 8892 8910 8931 8982 8998 9008 9028 9074 9104 9157 9214 9325 9446 9490 9523 9562 9596 9603 9636 9713 9719 9726 9733 9762 9874 9880 9891 9908 9925 9934 9963 9975 9985 10086 10148 10168 10288 10325 10381 10395 10416 10453 10663 10838 10987 11022 11074 11291 11605 12129 12491 12781 13174 13309 13322 13333 13479 13658 13789 13923 13943 13976 13995 14078 14193 14334 14459 14473 14581 14674 14703 14723 14799 14816 14834 14850 14869 14889 14906 14918 14944 14956 14974 15175 15414 15441 15458 15514 15576 15636 15667 15691 15750 16096 16126 16143 16251 16361 16501 16575 16651 16729 17221 17441 17552 17583 17710 17746 17874 17901 17941 17987 18203 18327 18395 18495 18500 18536 18572 18586 18609 18642 18646 18671 18690 18716 18721 18736 18751 18770 18795 18807 18829 18846 18859 18871 18889 18913 18928 18945 18958 18969 18980 19000 19029 19058 19082 19117 19152 19179 19366 19415 19447 19495 19592 19725 19771 19963 19993 20315 20444 20584 20724 20841 20976 21020 21063 21071 21081 21093 21105 21113 21124 21151 21185 21221 21252 21287 21323 21370 21390 21407 21425 21430 21437 21463 21479 21500 21517 21534 21552 21569 21582 21613 21638 21669 21700 21735 21762 21815 21825 21835 21841 21850 21858 21873 21877 21882 21888 21892 21927 21937 21966 21982 22008 22025 22044 22065 22081 22094 22099 22107 22122 22148 22167 22195 22213 22224 22230 22236 22257 22267 22278 22296 22318 22335 22348 22369 22389 22409 22420 22433 22455 22462 22487 22502 22522 22534 22551 22568 22588 22607 22784 23068 23378 23558 23769 23957 24023 24070 24125 24169 24189 24218 24230 24236 24252 24256 24260 24268 24278 24290 24305 24324 24360 24371 24382 24421 24433 24443 24453 24463 24479 24497 24546 24567 24612 24856 24882 25136 25151 25177 25234 25268 25303 25445 25462 25511 25532 25548 25577 25582 25587 25593 25598 25637 25672 25702 25757 25790 25836 25850 25929 25934 25988 26002 26012 26036 26122 26170 26276 26310 26317 26332 26359 26368 26407 26414 26436 26455 26471 26489 26521 26540 26557 26714 26745 26752 26761 26769 26776 26790 26808 26827 26837 26849 26890 26935 26964 26985 27008 27027 27065 27071 27079 27083 27104 27121 27130 27149 27295 27337 27847 27855 27879 27897 27941 27946 27951 27955 27986 27999 28008 28054 28180 28271 28283 28347 28349 28351 28353 28363 28377 28392 28419 28423 28429 28434 28443 28448 28475 28477 28492 28503 28518 28546 28590 28637 28653 28675 28686 28719 28739 28788 28888 28942 28944 29012 29052 29097 29172 29238 29273 29354 29361 29422 29486 29493 29499 29598 29654 29930 30054 30165 30227 30265 30273 30295 30344 30347 30368 30413 30468 30527 30596 30643 30748 30891 30916 30920 30954 30970 30995 31043 31079 31140 31194 31275 31297 31336 31373 31405 31429 31456 31482 31496 31504 31514 31522 31536 31549 31561 31585 31626 31652 31669 31698 32022 32025 32039 32051 32057 32073 32085 32092 32099 32108 32118 32135 32151 32194 32202 32210 32220 32231 32249 32266 32279 32305 32312 32320 32337 32345 32362 32386 32405 32424 32443 32453 32464 32478 32496 32516 32536 32545 32568 32588 32599 32614 32626 32645 32664 32675 32685 32690 32696 32714 32733 32752 32759 32778 32798 32823 32840 32846 32854 32864 32876 32897 32913 32921 32941 32961 32983 32991 33002 33025 33032 33046 33068 33085 33094 33115 33133 33142 33173 33189 33216 33235 33255 33273 33294 33308 33328 33335 33354 33369 33388 33933 33966 33994 34023 34031 34068 34380 34557 34634 34651 34669 34684 34706 34756 34766 34783 34805 34864 35022 35046 35176 35201 35327 35345 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_RC5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_RC5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_RC5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_RC5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_RC5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_RC5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_RC5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..