08P=Aj'&<  '=Ajl*P''`'9. 9.=Aj'&P@@<@T 08P=Aj'&<  '=Ajl*P''`'9. 9.=Aj'&P@@<@TU =Aj`'9.@@yA=Aj=Aj=AjQ$f =Aj=Aj=AjRA=Aj=Aj=AjA=Aj=Aj=AjA=Aj=Aj=AjA=Aj=Aj=AjA=Aj=Aj=Aj%A=Aj=Aj=AjEA=Aj=Aj=AjFA=Aj=Aj=AjPmK$=Aj=Aj=AjX`hpx$Q=Aj=Aj=AjpxU$=Aj=Aj=AjQ$=Aj=Aj=Aj (08@HPX`R$l=Aj=Aj=AjhpxKA=Aj=Aj=AjGC=Aj=Aj=AjRA=Aj=Aj=AjSA=Aj=Aj=Ajm=Aj=Aj=Aj\$=Aj=Aj=Aj$=Aj=Aj=Aj$>=Aj=Aj=Aj$=Aj=Aj=Aj$s=Aj=Aj=Aj $=Aj=Aj=AjA=Aj=Aj=Aj'm =Aj=Aj=Aj(0&$=Aj=Aj=Aj8@ $=Aj=Aj=AjHA=Aj=Aj=AjTA=Aj=Aj=AjUA=Aj=Aj=Aj>A=Aj=Aj=Aj?$Q=Aj=Aj=AjX`hpx$=Aj=Aj=Aj $=Aj=Aj=Aj ($=Aj=Aj=Aj08$=Aj=Aj=AjV$=Aj=Aj=AjW$=Aj=Aj=Aj.$=Aj=Aj=Aj/A=Aj=Aj=AjA=Aj=Aj=AjA=Aj=Aj=Aj@A=Aj=Aj=AjAA=Aj=Aj=AjBA=Aj=Aj=AjC1vqpclE<:7# G=C`&^O(uHcO6fH۽e3`|M-hk#BCl)`,L $QowaQnvfy^Bd,^: VofQ ?;H9. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4$4 (@@!!,!,!.#,,@t ,,.#,,NetBSDAPaXUSR&ffffUVSʯ' ,9s 9r[^]UWVSUÚ']P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*twE9ǍvuUWVS'E@@9s{*w;9r[^_]UWVSdé'E u @-M \27ME @E @,t/tu,9s 9rEt E$莚,P$耚 ,9s 9ry!$YED$E D$E @$w$蝖@,PMD$ @D$ D$$1ɉL$V$H[$SWD'5u1ƃ5$tЃtTb$l_[SW'4uYƃ4t|$Tb<$kt(?t<$ktЃ_[UWVSh!h!h,褞 %%1t:PrYxOvh,j 菵XZ3h$h,b h,j fjUEU MsMU HE]uUVS1ۋ (%tVPZYu $(%C܍e[^]USGPh!h,ѝh,h!(`(% CtsPhׁ!h,蝝jOUWVSE tuhށ!^URhc@5-V t5-h!jmu俟"6"M"6"E躟"6"WVSQRP5-h!-E t"6"RPh/! u5-h=!1e[^_]U5-OXUjhc 5-膒 t5-hV!j m1USRj EPSt xU:t Shd!jl]UPEU Ph}! JtPh!EEEPhc5- t5-h!jl1UWVSSuE H1ۃv>PW軤ZYtC(%uދ(%Eh!W蒤ZY1tFEEPhc5-Y t5-h!jk1e[^_]US u Sh΂!jk]UVS1(%tSP ZYtFSh!jlk(%e[^]UWVS ]u} Sh}! } ~Sh!莮1}{EFE} t!v!1UWVS`] u~ uh!Uȹ1Rhc@5-蚍E 5-h!j-hP-DPEU Eu>M9Mt66EE1EEEK>tt,uh!1}}}}}E뺉t9Wuh!j\gU9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4(%5-hă!L "}t}uuu1ۉ]EuM9~VQuh؃!jVfk]lSwEYu h!j8f1}E1҉Uuĉu܋UUMM]]}}Ph c5-p u EX@1}Wu5-h!jeEuPE4(%h#!aCE rh+![^ElU9U|`-h`-hg#őXZCtCPh#译_Xj ǐ^CtCPCPh@!茑 CtC"PSha!s Cts؋C4(%h!S C$Ph!:ZYu~XE\1e[^_]UE-]UE-]Uh!j;dUh-!j,dUhD!jdUhZ!jdUE E EE]}Uhjjjuho!i--Uhjjjuh!h--Uhjjjuh!h --Uhjjjuh!h0-4-Ujjjjuh!ih -$-Ujjjjuh#Ah----(-u(Ujjjjuh!h--(-u(Ujjjjuh̆!g--Ujjjjuh݆!g0@,u j茈UWVSu-1--1->Wr9XuWh!j=SbY_u Sh!jaxxuSh(!]hjjh )%EPuu뺋(-#H t uhB! P(-WPZ_(-t/#=t (-(-tt hr!谤X(-ƒtuh!<t?%t4!t$t (- (-h!j`٢8-e[^_]UVS-uX------;--rgj------X=5-u-E -)EU}t 13A}uke[^]Ë-- t --Uh2*%hg#j`UUh0*%hg#j_UUSË@4URs(PZYts$hg#j_S4K(E%= u!HPhm8@QR @ C !jjjQR Bu@ui8uK ]USQ49s SpZSPEPtqƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h!j_C4WPs(Xe[^_]UWVS]uVh-j>C4uu s(P(诞8jVj>$蛞8؍e[^_]UWVS-}t -- --EUEUEU}uH*- t?11ҋ}9׋u} ytEU -$-E -$- t(jRP5--P Bu@u 5-h!IuSh-Ɖ 19|4 u5-h3!%萝8t5-hg#j]11 -E $- tKEx- |-5-5-QP2p-t-P-T-1ɉ - $-5x-=|-9}u;9uu6E9-u E9-tX-\-|P-T-lX-\-9}u9utT-t%=-u-5-hE!۟XZ-t5-hi!j`\)u}--+EUEU--=- -9}Er }ME EtUR-)P5-8 --- -- t8X-\-P-T-SQRP 0 ujhe$j!; e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh?"j#: - -tjh?"j: jEPi]eƉߋE׉pti-%-Ɖߡ-׋pt)ptZYt puDžp1t5\-5X-5T-5P-5L-5H-5D-5@-h!jd]S,S$Sj9h-l- t7ƃ$ tު"QRPh#!jdS评S蛍$Sj8$`-d- t7ƃ$ tު"QRPh5-5-h- ;-C;-7벍e[^_]USˉ< <-҃Pj h6"SQR]S SuhL#(]UWVStÉ׃=L-t%tPhЉ!h VUh PV| =p-ssVPh؉!ds$s ssssh!H0sxs1--tP莻5-A_1҉-YX1---1U塨-t*Pj-ZtPB5-^1-ZYujUjh( -h,9^2 yj----1-@=uUSUE ---M-Ћ] Ӊ)~-@[]Ã06w $`+%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1-2--@ujjh-h-thʎ!hg#=Y^----`-)--1-2--@ujjh-h-cthʎ!hg#g=XZSjjh-:De[^_]UWVSƉӀ:0B؍}01҉U"<,%]BuʀEt@9uSYthh!hg#|9XZe[^_]US--9--RP'UZYu[H~0`Ph"h,mh+ % 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h?"5 -Eu_Z]tjEP_ Y^uD1Gh?"R u^_FP-Zy }Ou PP x. E uhs!: -| zf% ,Ѓu-h!R~tZYuu h!6X넋-jEP [_bE --9-=}\SRfRZYu[{0[]Ph"h,jh+ %I6-H--tjj-- -u -uΨuً-EH - -8lx #xtދ-PRRe yɍe[^_]U-1----5-T1҉--H-Yu-tjtjUWVSP - t u h!5X 6ƅu  -8u@ -S5-Ë=-X9=-|^SYt= -tj jsPEcUjjjRV;EtGSZyh1e[^_]Ë `,Q`,y ;p,| tX,J X,UhX,PzkXZUWVS u1ۉ߃= -tVI NyVj`XHF `=- -9^-؁}U|WQOZYU=-- -u-tjtj-u  -C1 mCE -9-؁}ULQM5-NZYMUuXx0YPh"h,egh+ %2-H-t -/t1 -- -u- u - KF @t.{w0OYPh"h,fh!=2tt- -}-8= -t=-te[^_]UWVSu VE=- -E-E1ۉ- -X= -t5-11҉UuiEZUU-5-YUt(EEtBD-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu -=-tEu~h,hҏ! -Y^=-u3B=-u -d -=-tJE  -uh,h!XZ -t!=-t9uuu$-Cu -19uu=-=-M  -= -t1ҍe[^_]UWVS];!uh+A"CPXZS h+A"Pdǃ u$t0VPSh"%h,dh!Ju WYXyh;!u7WZy4st0GVPSh"%h,ch !4/WEZǃ=-uVh!h,c -+E e[^_]UWVSu] }9tU= -t VP*VPjzZYy0s0UPh"h,0ch%!.C1e[^_]UWVSQu VJ[= -tW1ۅtW;uRWNZuZW95-u= -t =-u BRUPu xËUF?륃= -tuX؍e[^_]UWVSPu]>!uh!FPY_V u Pbƒ u$r0TPVh"%h,bh7!RuSRUǃ Uyl>!u7RZy4mr0ATPVh"%h,ahO!.-R?Xǃ=-uWh!h,a tE)؍X؍e[^_]UWVSW11 ,yh,>Y^u,P,s= -  -9-؁}U|WQkHZYUu[q0]SPh"h,`h+ %K,-H--tj j = - - -u -uΨu١ -u -1ۉ߉ u- -0 - -u ,@t?p0RPhh!h,`hs!+f% ,1 --f ,9t{t  - - -މe[^_]UWVSW -C{ u)ÃE -:TRPx Y^tE --9-ށ}VRF_ZuZo0QPh"h,&_h+ %*-H-t1-tj tj 5 -- -u -uҨu١-5 -ljD s} us*Ext -M| ths!)YoE --9~P-߁}WREYZ= -- -u-"%-25 -NjM}t/s2PR_Zt-D } +s# - -9|R-؁}tVQEZYM5 -- -u-ux-Me[^_]UWVSQ]utuh!rZXZ} 9EueF95@@,}hX,h:$^XP^w<\u7\t.ˆUPh!8.ZYUtF-!!/B000CL r1e[^_]UEH!-EPhht@j9R x$EfvD@,Efv@@,U=-uE-E ---9~ 1;-~h$='XUWVSSu -}t69-+=-=-=-t1C~ Ku"=-tn-u=-t[uSPEZYtI= -Mtj jqP;jjjWut9-Hh!Y&X؍e[^_]UWVSP]U u h$.&XU19-~BPSYX%KM-uSwP(x?]9tWZu̸1e[^_]UE P-DBuh!%XP<-u -E@-1UEP-DBt-Eh!R%XUWVS-P- -EDJ@t t E@ -޹ -0U?& } $`,%}^@ - P- -8f|y@t t@ -܃tQi18j h -5 -&Ǎ vi8"uh!A^t-u18UBQ@u^t -uօuh$$^"i1ۉj h -5 -Í vh8"unt@ --.j-_t|%1Ƀ/QP_ZYt -M:+@ - FP -@PX.t(@ --;u - --9Et9-}؍e[^_]US1-----xL--- - ;tK,tF -ʃ~--IuA-H -˃~-Iu J  -:;v-l9t-t1[]UVS -11Å t]9@-u 1ۉ@-J@։t -[^]UVSuj8Zu+f0HPh"h,:Vh+ %!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=-ujEH!--Pjh!hА!/ykhX":^tZPdZ[=wJ@ P7Yt:WPsiXZ|3/t 3/D3hА!S&5-jh!SjUM=-tI -QU=-ujEH!-jh@ -UWVSE-1ۃ= -u-9t = -| t8f% ,= -?u1 -B -: u)u ?.u tԍ4-WZu# -uo-tj=t[j-t PTCXPPj0à t9u- --u른e[^_]UWVSSu-Z;-|1ۡ-x-@-9t9u SEWá-ZYUSWjq/ u -t$195-~FPVjB/ u)ϋ-tj&jSS<[t<\t.RiZÅu!h# { uh!-[1C뵉) -= -9-Ё}UtVWZYUu[C0%Ph"h,H3h+ %-H-t-tj2\j 5 - - -u -uΨu١ -5 -lj -= -tj jRPe[^_]US -< u h! XH< u= -u$h4!XJ  -R t8u ӡ -PKXu1 -t=-u P;X9jY -Yu(B0z$Ph"h,1h+ %hK1҉-5-S5 -Bƒ -t+h'h -PR#5 -l1 -R]UWVS -P -M -1ۀx%u}M8Huu -hÑ![s9}n -P - -  -\P - -2<  -= -}  -U8u-ف}|WuZY= - - -O-tj7jm8uCH -B= -du f% ,1 -| u6/ - -9-؁}tVQSZYuVt@0H"Ph"h,/h+ %6-H-j-U5 - - -u- - - -e[^_]UVSVu] 1 - u 1ۉ -U  -< Uu 1w8uA  - -JπwEo?1ɉj h -5 - vE?8"uh!1Zgu@ -늸e[^]UWVS 5 -] -= -}+ -; -a&M 9}y;M)9 ڋEE-}RUu`ZYUu]~>0R Ph"h,-h+ %@-H-t '-tjtj - - -U-uΨDϋ -M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUu'ZYU - - -u-t -M9u}EMELE B19uu)d9|T-ځ}tVuZY45 - - -u-_b -Cw}9|T-ځ}tVu)ZY5 - - -u- -؍e[^_]UWVS] Sװ^|= -tj jsPlCjPjuu1ɉ E -}t9U3 9-ށ}V5 -_Zu[ ;0Ph"h,]*h+ %-H-b-tjGJj5 - - -u -uΨuك= -tjj    -NjEpSP-  9~U-΁}V5 -ZY5 - - -u-= -tjj S6  -Nj󤋅  ?u9Ћ)ȉË ؍x -9<t t tjPjuKro-=}tV5 -Y_5 - - -u-~+ uEthH!TZDžW= -tjj S  -Nj󤋅  -f u1e[^_]UWVS--H-1ۉ]1-+-9U-@-Pmuu PuƃU-PP[Z -3E-1SwYu' --tjtsj-t PۭFZPPjƃ t9]u -u -uuE-G-E  Euh!XE tu RRK x1e[^_]UWVS-E-E=P@,t =L@,uhc!NYm= -t -j- -E= -ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń= -t聺P@,-EP@,L@,-EL@, -u-tjt j`1e[^_]UWVS - -Ht7k X< u'ʣ -B0Z9tSe;SZY1 --P@,-L@,e[^_]US -9 -}Pk -  -EuCk -  -u C -P -k  -ZY]d -j Ph -  tPPh"h,R#h+ %5 - 1 - -1]UUPhs!h, #j `,Q`,y ;p,| tX,J X,UhX,P%XZUWVSօt%ˀ9u RPh!RPh! uqRPh! `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5 - U(h!Ph!h,!jUWVSf@8tXu1P<21҉hW3à 28#)tSWV{ 룍e[^_]UWVS} 5 -fDž<^11҉hPjLà t[n18`18u V11ۉh0"Vf8uFt"SVW yF&18#u511ɉjjP @u08thД!jh$)+jWjfDž= -t fDž9DžjRjp fDž9fDž9 -jSV6 @uL08tJfu ft>(@ufDž= -u#K, -@tftfDžftR@u KfDžCe[^_]UWVSQ}u VWBC[ZÅuzjjAXZu h!!j;s jEPWޟƃ ?tE8thh!j%)/8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMuZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRP蒳Y_}ËBt1UjL$qUWSQ -- -w -ڞw ]]5 -5 -h֕!j|5 -5 -h!jd 5$ -5 -h!jI54 -50 -h!j1 5 -5 -h4!j5 -5 -hJ!j E$h`!j EPP$hy!j  =8 -t>u -1 ujIeY[_]aÃ=8 -tUE Puj  UWVS}u _Ph!jR 3` -B9tT` -e[^_]UWVS$ ]5H -t(V$VK0Y^ugh! j0Pu l2% yWp4$0ZtWVP" u Whϖ!Q5h2%jj0։( y0h!"jju ։ƃ C Wh Vp2%ƒ jjWt2%‰ Vx2%h _Xuh!j [^jh h R(|2%y RFY߉R/ Zt-w1ҁbt#bt!tu h?!1 Њ Јt u hK!jYu Vƅ/ t jZV8 jZVP djjP7& d -0tS SQPR(&,7kPƉ4W8t t10hc!j2  \9s1BFu h!j  1e[^_]UWVS\]ƍ}ZE5x2%(,a&V&0G4<81EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xPI1RPuut5@,9ΉЋt}"Q_85@,VPh!/e[^_]UWVSP] AEH1RPuu虻ƉMt1׋C|1׋ujQ1RP<t2uPhŗ!j"E01RPuu‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =D -EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$hz"5D -1Ãt#EUSjPV Ht h!(XS* X -$ -E1 - -E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu9E E~1҉ t1EUWVRPη9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh!3REЃP2‹EЋ^_9t"ERQuuPh=!jE؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,PuY^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuumPuuh!jMt E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,PuE_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPh!j:E]E]E Eu0 -4 -EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWV蚯PuuSh}!jyE}8LEiEe[^_]UWVS uEP3F VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h!jN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRP衲FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hWj,RW}EEPhEp2%ƒyEqRPh!jcxhWj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPh0!1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em} - - - -EЋU - -ẺEMEPhp2%ǃ yNQWPhA!0FPhp2%ǃ yNQWPhg!jv1eY[^_]aÍL$qUWVSQ9qd -X -,h -l -?1< -@ -1D -H -1h!VW ta#DtNJCl6D -뷃b$1%p -P -C8 -Ct -u5l6 c@ -e5l6kh -R5l6bd -@T -/5l6b< -L -5l6bX -Xl6H -h,h!YXp,)lj80!h,h!OXZ=@ -xh!!=@ -x 8u5P -t hR!jtjj)h!hO+jj[_@u h!jj h!hEjt00h!@P G@ uh!t|j/SFZYÅu@蓁 -׉hOj hOjj$8` -P\ -1urh !jxj\ -؉8hDj803PyP3h)!j#W5\ -OG9=` -=P -tf95` -~W\ -4FX烽(ta1(,,9` - < -_=T -tjC@ -xrP\ -0jX -dh1҉ldPh \ -p2%à t$8:hb!j11ۃ=` -*6, \ -,4@lXRjPjjT($tPhJ!XP :8zJt&Z JZ04z($J 04zh P&1 - -8Y_9t4VZyPh_!jPhx!j 3‰.Ju lxtH'‰`R840Ph! tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP1ډ߭ 2%ܝ0v7ء\ - 40\ - <0[10=t -pݝt{\P{S ݅y+؉Ph!j ǦjPh! \`+EU5X -9Ɖ 9jS{ZY@݅u؉NPh͛!h -ܝp 2%ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP88P PuPh!Y[# 1҉D<5p -d -8Hȉ9r09rÉ014#840Ph !k840Ph !j04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPh`!PDPhx -SW(~LFD\`HP\Phx -W\DHY, X049Ѹ4}u014"80Ph!p1ۉ898r;D\`j\Phx -W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPhʜ!DPhx -SW|$~FL,NY8&D8tx -011҉VPh!K=98~k,0D$Aۉ7<1߭߭ - - - - - -1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP l1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=L -t 1Px -k,8 $98p 9~Љt$DPSh!pPhp2%ÃJQSPh(!j;#tV":t&PhM!j,+ePh_!j, E$) 048<11ۅt9 ks F(tȃ0tBE;Pdr,9u:s (tvRPXYY09us,9uih(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV訁^_Ɖ׋E t1 $DH 9|([ (E9s@(ERPWV0,h!(0  袋9.}*WV0,h+!jM(fk,VW4Z1ɉ0ePHD0,hQ!j (X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Phk!4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWV誉kDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =8 -h!jY^wM t1WVSPE(|2%=DH9}bk,4_$S/G(Zjz0NP4t0$h!jMH=8 -tRP0,h)!jEHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh Ep2% bRPp@8tGpBunE -@,Xe[^_]ÍL$qUQ - -5 -5@,2%EM MuQQ$RPh!MɍaUS]CtS P S tSPSCr s ZS -X]USEPsH) - - -Hu0 -Z[9u -u'  -uh&!jP4BPQ X4CXZ@]UWVSu EEE#@, - - -M11ɅtJA9~ʳ9M}#t -h:!h2%hhI!b}9x4u }9x(u9p$t버t -e[^_]UWVS]uuu SO trNj@thk!h 2%h1GGWX9w(~6Gth!h 2%hhI!wVw 苞G [^WY -@,; -X= -u = -uBGWu -GWtP -WGtG4WPZWX -j@j蟝Vj蕝G _4E UG$W(G,W0wE #@,G8 -tz8GC GtWP { _ Ge[^_]USEM Puh!h2%h4hI!P ʉPHPPP s E]XPs2H - - -1ɉH -H -.1ۉXt -H - -H -P4JH8 -9t!tXYX tAP]UWVSUu }uWVRcËECUt -R -EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=@,Y,A0Éa,ڋyY I4 s RPWSQ|2% RPWSQ2%e[^_]US]C%CSjS]1]UE UMQ1]Uj UU P -PYtHJ -@ -UWVS] -C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdC|${sh ]e[^_]VUWVSuE EEEE% -1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4 - -C4 -= -~ttpRZg{$u{uCuڋ[0n= -~ tRkX - -t$;3uEE EEuCe[^_][؉؍e[^_]UW1 -- -11҉ -_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE@,K,ϋS0c,ʋ{s K4 es RPWVQ|2%9Cu CC17RPWVQ2%uh!pYC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPiY_}UVSӋEU tt RPiY^CSt RP~iY^CS e[^]USËt-w1Ɂbt#bt!thbRh!91 Ȋ ЈS^Z19tPQh! Ћ]Uuu jUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus 辔C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPgY[L(ștșe[_]UWSvh3!hX2%h hD!FÉЊӃttRPIgY[LXștșe[_]UWVSvh3!h2%h"hD!ƉӉȊʃt$uҁTXe[^_]UWVS vhi!h,2%hhD!aƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPaYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j荍ËEEC1CC_Cj`C h1C C$hjREhjCM쉁j`j1MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEmEpdbuZSTEE싀}@u jR^_}E UG(W,}x0xdEtFVtRP_YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u -EE % -S0tK0J4 - -C4-C(tS(P,-C,-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hz!h<2%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhz!h<2%hh!l@]9~ ]B뫋EEPkE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh!}t/EEtP1uuRPhޣ!辧]9]tSuuuh!蟧uu] SY[9t$PRuuh.!su譬1҉U u蛬XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPfMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhz!wtC M苉9t.CM苉p9t$1SQ1RPWVh!蠤C(S,C S$]9UrSPWVhɤ!rWVh!^ ~}t5EtC(S,C S$9Uu9EtPuh! EUjuuWVSuEE؃uju [X }t$EtC(C PWVh0!辣}hG!hL2%hh!EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPecEuuWVRc9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVc9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhN!臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th_!ӸhX,aY^tCpStCHuRPuuEU}t h!ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh!F-6EtM}`d)RPh˥! tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j~E1҉PEMA\Ac\A \1ۉY Y$XZ}t.hj}ËE쉃P^_ u =@,ƉE} t h![1ɉM@,EPjh WVu*hjH}ËEp }쉻PP P jPXZtS Su@,}URjh  t1RPuhj|EEp }}M쉏PP P jPW^_utCHSLC419|} tMh8!Y@Et} t#hm!Zu uuS9u uX SX]=t S͢XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjzƉ_tCtPz^tCtPzFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h|SXZ؍e[^_]UE Puj@, UWVS]FHljL1RPuu P\EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h!@ u~ 1RPuu ZtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuZ€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh! LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t Phצ!XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Phצ!`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt Phצ!XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt Phצ!B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuubOƉ׀}Mt1׋C|1׋URju1RPQtPuh!d Ep 1RPuuMt֋F Ft:_vkk փ~t*uuh! tFVC(S,FC vkBHMQjPjjRt Phצ!XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt Phצ!ZYEP tu}rz}zP4PR:X17-t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]USOPPh+!h,~h,hb!,1@,CtsPhC"h,JjUSSE] t$uh"a"s0ZY¸tr1EEPhvd5 - @u35 -hpE"jv]UWVSPu }t}~^h#"S轮Y_DžtFh+A"S誮_Zt)h!S虮ZYthz!S舮[_t뫿}}uhg#vYZYuUEPhud5 -$ @u65 -hpE"jue[^_]US}tQ,Shzd@5 -֚ @u5 -h}!jqu @u5 -h!XZEu}P1RPWVJRPWV5 -h!6e^_]UWVS}t=E XhT$Sب^_tDžd1ɉhlpdPhwd5 -} @^tltDCSx|xP#Pss ss5 -hF!d N 븋lhprhy!S_Zu+hxd 5 -[^@5 -hj!jxoh$SʧZYxP5 -ހ^_@u h!%= th!h!h,ejtDžd1ۉhlp`dPhwd5 - @u5 -h2!9tXl%NjX󥋽`8X K`t!Tj YTujjXnhp`hjT_Zt̋`1X\11t(X\H X+HXߋWV\X5 -h!Thxd 5 - @'5 -h!*Y[``pp pp5 -h!`px`@`9q j RP5 -蚒Bu@uWV5 -h!EOWV5 -h1!脙hT5 -M=tho!h#fXhX,uZR`e[^_]UWVS] }t5hs4Pr v jhC!j sEPS vjhk!jl10j PsͮƉ׃ 8t sh!ޫ8"u:9sh!pyhϫ!e菫1ɉj Ps i 8t s h!=L8"u!@u h!jkuĉ}ȉM̉UЍ$Vhyd5 -t @u35 -hpE"j kVh!苗XZe[^_]UWVSlj֋ 1҉@,tUPQM(ZYtUBMQh!jjjhh-@,s 5 -l -@u5 -hg#jrj --VWS5 -Le[^_]U05 -hpE"j9jUSS}tE Xh4"SuZYth!SdZYuEEPhwd5 -0 @uE ]UQ}trEPhd@5 - @uE O5 -h5!XZUS I-I-t I-1Ӊȉ[]UWVSӋ}bG-uƍPG-u(PpPP?P*PpPP?PPJE 7 u9tN7k?9[^_]1^G-x@uUWVS։ˋ=pE- tE-11~B? ʋE[^_]UpE-?tE-jh>RP B=vuxE-UWVSQ5HE-Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ P-1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉MpE-tE-ÉEE1RPWV@E)Ɖ1UQh$RXZ}UttE-H9upE-H9u u9rBRWh! e[^_]U塨A,=DE-tvPh!5E-5E-5E-5E-5E-h!͒ 5lE-5hE-5pE-5tE-5xE-h9!袒5I-h`!蒒 Phn!hx!E-E-5A,5E-5E-QRP5E-h!@,h!FtE-pE-5lE-5hE-QRP5xE-h! 5`E-5dE-ho! UWVSQƉ+1ۉjEPV >u#ËE8u8"u w܉1e[^_]US=P!$6"Ph6"Ph6"Ph6"PSh!h,,jĊUWVSEM A,9uh:!5A, hP!jYdًEEUMjؙ]!É]]!Ӊ]uuW豉BuAtVA,A,=PuRD 3P5P$-RD 9A,uNE!5P$-}e[^_]UWVSEUϋE E컚!t!EU@uShm!XZff=Ut+=E-t fuuSh!薦ff=u%Cth!hfLJ_f=Ut1=$ -u Sh!;Y^$ -tSh!XZj(VP? x0XŃ~X E-t\fLJᵃVe[^_]UWVS9I-uI-5I-Y|1XƃbG-e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEF!EEtE!11}=A,EtE-pE-U1҉U܉E1ɉMԹEM]̋ERPSQg;PE؋UEUuuRPJ;RPuuȋE؋UEUuuRP&;RPE؋UEUuuRP;RPuhN!蓍,"uuuuuuuh!o h,jdh@I-蟤 u h!j`h"h@I-=Y[@I-U슀@I-< <$u z Ћ P-DQu<-7j EPh@I- Ɖ׋EEh$%PIEЃEPh!uS tuhZ}"uS t L =A,Ήʋ5dE-11WVSQ9Ɖuh!uS ui dE-ω%dE-Ɖω uEt5`E-1Et `E-1Et `E-1)Et `E-1)׋E؋]؉E]h"SYZÉ]; t,h@I-CZƀ?I-uh@I-h!腋 9uE|E9Ɖ]}.uuuuWVhɲ!Muȋ}u}e[^_]g_USE Puwh! ,H, yh,蕅Y,P,؃ t9@t* ,y h,cZ,P,8 u h!j]1Y]UWVSEM䡘A,E@u h!j]A,EӍEƉωؙ!M!EjuuuBu @uA,A,uhuP< nR5P$-P= 9A,uVjuu5A,螂Bu@tP$-K!Nju5A,R5A,[< 9A,ue[^_]UWVSRáI-u ƀA Mz΍I- S}8PRP9 I- e[^_]UWVSEыEU u1+ˀ `E-1ۉƉ)߉u}};=I-}=I- !EUEUE9I-I-}=@E-t EvI-KiE9t 5I-tމ&ʅu+`E-9UE}M1E܋E9E܋U}t0}t}utsƆj0![!ȃ[^_]UWVS EӋEEhI-@PhI-E 5I-t h!jZEU9E|E9u|I-] }) VRPg75I-31fǂU }u@`E-5I-֋M)}CsKSCPKSs FSjI-Ee[^_]UWVSE}u&bG-ƒ<1IE E#֋EU EUEUE9E-E-ME-19Et\tSMM1ۉ]]9ً]M}3M9MM }ͳ!=@E-]@uEE-˃t I- I-t!=@E->I-1hj2nI-[^u hO!jrXfǀUEI-EU I-I-EUI-I-I-ytbt]t E^I-QHuI-<=@E-/hP!>Y8!gE-=I-I-;I-KxZ 5I-t1;EM |9UE}=@E-t`룅I-E 9I-u;]t~I-HI-1+]9~ Fu%uF PPR3 I- *`E-1RPEU I-+EI-XZEU I-I-EUI-I-!! !!Ѝe[^_]UWVSË@S t+5E-=E-9u9t h!GY]sǹ󥉍1󫍍@u'C! Cu!Rhô!XZߋe[^_]Ã=!x @ u Sh6"h`!wWVڍC$u u* -j!C\XchO!jJe[^_]UWVS=DE-ujjju uA=E-t+5I- #ֿ6"uVWhh!v PVWhx!vVWh!v 1EU RPVWh!vPVWh!lv$%PVWh!DvPVWhи!0v ?PVWh!v%PVWh!u PVWh!u?PVWh!u e[^_]UWVSdEUMċu} ]t'BuUE$1ɉM#1҉UUUUE^G-E̋EEE 6"1҉UUEE-fE9I-~5 I-EE̋EEUE$1E#&E$1҉U#1ɉMMMME=@E-u(}t"uPh'!tuuUEtuS&}t.Efu ukE ]PEPn E8E-}u(E@EċE̋p1u}@ E1E}u E@Eĉ u"E̋p1u} u5`E-1u}E E4E̋@ E1EẼx E-E-)EU}t=@E-`E-1҉EU}uE9Ɖ115I-=I-I-EI-E1E]9]~JE8t6EӋEU9ȉ|$E@1ڋ}w1EE뮡I-I-)9E]| hH!u}=@E-=@E-1ɉ tG@bG-t0fG-1҉EĉUȋE9Ɖ|jG-1EU9Ɖ|1Eċu}EPG-bG-t8fG-1҉EUI19Ή}E9ƉU| 1EĉΉ볋E@Eău;5E-E-Q=PE-Dhg!ָ_1}uEĩEęjhjjjщ¸u!E HE-EuE1uu11}t#I-I-EUI-I-E-E-EU11ҹuuRPQ~$VEĉU);E}EE}]u)։]u}ttI-EI-19}9}tH>tC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾E-19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu h{! E Et}u9}E}}u`E-dE-1RPuuu 9tۃ}u E9uuujjR;#EUEPuh!h!8oh,jdh@I-ku h!j`Bh@I-v[vEHƀ@I-t'?I- t9EEHPh@I-h!n uh@I-EPC uċ}ȋEEă}t6juuWVUċEPE-uD<=@E-1EjuuWVUċEu=PE-tKt$|=PE-us=@E-t Phg#j[P]juuWVUċEt)/juuWVUċEu}t }tPhg#jA}uf} E U u }EfukE } 1E}t Dm:}ta}tE `E-1 I-I-9u19tuugZY I-UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P=A@E- =HE-u=@E-<t I-(h!Ytfu'uEPkE }P@ =HE-9=@E-t h!ZuHE-}ft=@E-h![E̊@EċE̊XEčE@‰xE-p1WVjjjL!E1ɡtE-p1WVjjj_!Ã(Uă?1ɋ5pE-1WVjjjn!^}̊MO_U? ˆWGEĊ_EčG‰xE-p1WVjjj!E(1ɡtE-p1WVjjj!ËUă?1ɋ5pE-1WVjjj!}̊MO_U? ˆW(} I-uKye[^_]UVSáDE-u h!X1ۃ=DE-u Sh_"iY^jjڸE-CXZu҃=DE-u=I-th!軰X1L=I-th޺!u Sh!iY^g I-RP1҉8XZ=DE-tCDE-9I-A=HE-~h!5i5I-j5I-5I-RP 믅<f=\G-th;!^h!h[1G-t=h"h2G-Y=uh!"k Ph&!hXZ h[!{hXhe$胯X=DE-nPhP!RhY[=DE-XG-PPhl!2h j=,E-t>u Sh!hXZ9I-} h!X; I-RP1҉u Sh!gY^jjڸE-XZe[^]UWVS ˋDž! t Dž! @uh!ZYߍ1jhٻ!Sl t 1/9Cu苅9Cus Pj, ;Cuă=HE-t.{ t(s$s sh!fe[^_]UVSPEA,;A,u*=E-u!URhmdP8_ y h" XE-11@uh!B=H$-u111HL$-~ ف`$-@uh?!^EI-01C;I-}. I-I-I-@@uShT!gY[1҉UA,;A,u*=E-u!URhmdPU^ y h"*Xe[^]ËUhPh!h,hj^UWVS|E|xJ-wSh%!h,gj^S JEZuh=!(|ƉjRPu]9u9thO!"VjN^Suu 9t"|thZ!h!UXj^1EEfU}EEEEPЃ<]1E ÉEE|ƉuR~EEE_}t V PSE4:%h!cjJ-fEEEI-I-19E~WtL9u.;u&}JPaRJ-4:%h!tuu u@뤃1\3 9sR@E9E~WtM9rϋU9sэPaRJ-4:%h!c }9sf}wfE@fjJ-}E4:%h!!bY[n}tGaPE4:%hM!b } t}t}u$EEfEEEfEEtJ-uEE]9E@ƒt<u+ExمuuEEZEEu9uufOXEe[^_] `,yUhX,j EgXZáX,PX, UEU 19s f3P]UERPZYUSBHBy;B| X RQfXZ]UWVSQ]u uh !ScF fw4 <%hک!Ph!Sc FPjh!ScFPjh)!Sc Sho%HXZFXt Sh6!5Y_FXt ShA!"XZFXt ShF!Y_Sj `zv(hO!S:cv,ha!S,c v0ht!Scv8h!S cv4h!Sb$v|\us11t\Uh%SWbUB 9~Sh$XZ]e[^_]<UWVSu} EU MahG8lG,p1pd1ld1pPQhO!j@tP]C1w,pC1w8p1w,PQhO!j@URI]0URtPhhX!sQhhf!V'aC S6EXZEE FEe[^_]UVSSPPVu ujVShs$@,@uLnt!t"pn0DPZ!t!PSh!j6.jaTUVS]u VSU~YZu Sha!j5.;/t"Shv!XqXZu E!e[^]Aqe[^]UPh!h,8]jSUVSPh+A"P][^t,PjPuVqV轻t jPZYSSXe[^]UWVS EEu EE}]EEE1҉tK-- %1ɉ xK-K-h!Vut? NtJb$@>%1=K-K-K-|K-xK-뗡l6tK-jWh>%5l6u h!j,PkYYK-Jp,4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP! XZt1h#9}PdZY uċ2jWSh#z$<@uL]kt!t"Gk0M^!t!PSh!j +t%@u=xK-p&xK-_xK-MDž!=K-tDž!tK-t ##P=K-t ^$=K-t !=|K-t c#1ۉXP(h!h%jR*Sh!h !V蠝u h!!j#*j/G P*ZYt|DSh!h$!VItj/C P*ZYt|CXjOUVS]u VSyYZu Sha!j});/t"Shv!lXZu E!e[^]le[^]UPh}tWWVY^ƉuuYYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5K-=K-}t M U JpD1HӉ5K-=K-}tCS}t#RPYYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuh3!hA%h"hD!V}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV+1҃t0119s#h!3+ZRPPH0jjjjXSËPA%F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PCh#z$V}UZYth#z$Vh!( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh#!'^_PDžDžt9t hA!&Y9~Wtht!&XZ.DžDž9|ċ9|<t h!(&Xh5K-h!~]Džy(h!%^_uqh!C]YI;rh!%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhQ!G$Y^Ht2{{ @D0{{@D#Zt⋅9t Phq!#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Wh!"XZHd 1t1\{ChX\Clg{ OtIh!h,mED8ljPh!h,AEt@t)1L@t31#LC LClC XkT,Pxu"xtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtpct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Wh!h,? 9Huh,h'!"XZdѽPhp! dt$h!h, ?OPh!2<7 v$tpPh/!<^_j ;Y@uhM!h}!XZ+1߭ڍP 2%WW$h!;HuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|P;YBu@uM0/Ph$ tu `duCPODž1v 1񉅰 t1 t19u9t h!_ tG ?9|$ tj jh!q$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh!^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@hYu jj.@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV^_Ɖ׉ t19s=Pd/D ]jƉX PYPFZ@HRjPjjt Phצ!N>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ DžA%Dž1p4_<҃D 9sh !5K-hpE" Ft Pt#u?RPY^f*uGɉf1VfN@ tBh2!hpA%hqfFu=@ A)G G p 6p<uGG9rhL!h`A%hhD!4)9rhk!h`A%hՉϋ)1󪊓t@@tf)th}!hA%hh!LP4PRAH‰ljX1OtVjR1RPQytPjh!66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=P-u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh!3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV @Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t Phצ!/^_A |tVC@SDs8{8tGpBuE8P-A,Xe[^_]ÍL$qUQ 0P-,P-5(P-5A,2%EM MuQQ$RPh!MɍaUS]CtS P S tSPSCr s ZS 4P-X]USEPsH) P-$P- P-Hu0[1ɉMA,EPjh WVu*hj莽ËEp }쉻PP P jPXZtS SuA,}URjh  t1RPuhjEEp }}M쉏PP P jPW^_utCHSLC419|} tMh8!=Y@Et} t#hm!<Zu uuS9u u1 X S( X]=t S XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWj"Ɖ_tCtP^tCtPֺFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h~<SXZ؍e[^_]UE PujA, UWVS]FHljL1RPuu 薜EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h!@ u~ 1RPuu tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu*€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh! LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t Phצ!XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Phצ!`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt Phצ!XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt Phצ!B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu訏Ɖ׀}Mt1׋C|1׋URju1RPQtPuh!d Ep 1RPuut֋F Ft:_vkk փ~t*uuh! tFVC(S,FC vkBHMQjPjjRt Phצ!XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt Phצ!ZYEP tu}rz}zP4PR:X17`-t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP  e[^]UWtBRBR t RP1}Y_}ÊtBRtUWRP}Y_}ËBht1UWVSӋEU ΃tt RP|Y^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh!hlH%hhD!UVSuE H$X(1y9)tNp1SQRP詍 e[^]UVSuE H$X(1y9)tNp1SQRPR e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh! E|BD1H)CNjEahE@ EDžpA,pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPh!E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVx‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh!kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVvC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<uP-@ P-$P-E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh!‹EEp E @0E܉F uMMЉF <u v0E@4uPu[E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơ`-`-Nu"h!h|H%hXhD!t5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^Zu6 ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h!j蒚E Xu9utpE MAP9q4u`-`- y(x`-`- `-`-A%AQE@`-`-EY눋E`-W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11E`-`-EUE@(E؃} G,ueu$U ʋMQ؍e[^_]UE 1҉oo1]Ê u@ t utUWVSSÉ։WhV tX1҉jh"PE{ Muʊt< tA1҉ES$SURE ue[^_]UWVSÉ׉WhSI t?1҉8< „u<#tSY9t/PH u tuVhg#SXZ1e[^_]UWVS,E!URu.h+A"PuYXuWh!.XZShVe uWh!S]OPPPPPPhE!VM u 1thW!XSjtN!Ujt SѦX@P_vjVh!ƅM oP YuSKZ ?E ot ⋅4)ȉ1Ɂ11ƃtjhh! S该GGG GGPh"S蚝 Hu GGS9)XE ;ot$PWh!_ ve[^_]UWVS ] 1h+A"u襮ZYuuh[! _X!^t uhu!!WVPh$$Pht%WVh'$PMt h!C1Ƅa2=u7$%Yueao1ɋ0u<1ҍjh"PA tj2WV薤2 9uS]hh8!Pcƃa!+tWuh=!` 1ɋu׍PPh!VuPZ;v.Phh!aPWh!@Aƃaa9tRPPh!謿ƃa>/!7^u 1ɉ]uh!VhVe uVh!- T!j2P2 9~#1ɋ!thF!p;!mZt1sZ9{~c1ɋt Wh!6VhPe uVWh!S j2PG2 s!Yt uhd!1ɋ.th!s]PPPPh!V藮\\\\\]th!rXZ4]`I%t 8t0Rh!=ܟ չ(p SP譟x袹؍e[^_]UWVS]CjPA _Z1uh@I%h0!&[^F9~?{jW ZYu Vh@I%hM!:19~DBh+A"u ѨY_uu h@I%hm!8& z!‰UWWZt uƄsh!hPsh!hPͣ R蛬$RW DžuƋSS9VhQ u RWh!CPPPPh $QGtRWh1! ; ȋC AEVj_4Va^19s~4y FYj Z1e[^_]USRÍEPjhjjj jSiwU tShP!Rjv]USOPh`!h,9Sh!h,)Sh!h,$Sh!h,Sh!h,Sh6!h,$ShY!h,ӥShz!h,åSh!h,賥$Sh!h,蠥Sh!h,营Sh!h,耥$Sh!h,mSh>!h,]ShU!h,M$Shl!h,:Sh!h,*Sh!h,$Sh!h,Sh!h,Sh!h,$Sh!h,ԤSh.!h,Ĥj{USRhP?_ u Shg#j#u]Uuu u腚 @uuhE!j#uUWVS(`؟ԟhW!Rh*rPEܟП119П~7̟hW؟. ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟« ̟u ПԟEܟF`벅u؟hj!jse[^_]UWVSlj։1EEjh$Qg t(jh!Srg tjh"a"S^g u Ejh!SAg uEjh4"S&g t}~Eh!EPhrWh!EPhrW =`-t=!}t!PVh!u }uE4L%Vh!W e[^_]UWVSÉ`hPdzlb1󫋅dhx|h!VhrS`h!ٞ|xh0!跞0tplhg!蘞!u!RPh!ph!TD1҉¸1 RPh!!0Ph! XZ!4t!Ph)!84L%hUSuQ'Yth=a-u8t=a-uQ`- se-1҉e-Hf e-BRPhe-HF e-]Ë ,Q,y ;,| t,J ,Uh,PKXZUWVSS]u he$S_Ztjh"S謠 uh6";/uhe$h"VGXZVlj$Y;}rh,h!"jSVU_Xt@/u /u@C{/uC:tjZߊtWh"h, q &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShƄ$hVnlVZu^NjP ѡp-a5p-kƃt(@he$PPyZYu)5p-CYu*LSh"h,p 7Sh"h,o FhC"PyYZu5p-Z1Sh "h,o p-Ƅ=FVvhPSh2 "h,to:hPS01RPSVH p-;5p-Bơp-Xae[^_]UWVSuS_X؉8/u@1Ҿ1h$PdzXZۋtm;thlu1WP ѡp-Shs^5p-Yt@9uVSBPv uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3a X]]X UWVST=a-thX,hO "|[^a- nVUX=a-E}tPuPuS  uS!EZY~/9jPuSjSh "h "h,jEPSEPS=`-tuuuuh|e$SC uS Y[fft uIU Z5p-aXe[^_]UWVS}E U#ÅuWuu h "=hhWƃ y@Wh!h,jh,Cz0o\ Ph"h,i 1S ѡp-p-0^Nj[Yځ~RQW @u55e-5Le-5He-h "h,fiy0[ Ph "J=a-uURQVU @uG5e-5Le-5He-h "h,iy0~[ Ph7"h,h$j_%WWVQXZe[^_]UEU ]U= B,#tjjh B,h B,葯= F,#tjjh F,h F,mUWVSƉ׉ˉ t;5`-`-rWVh "; D-RPWV" H-s{ S$=a-t [$t9{ u9suh1 "S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh@ "Pb<XZUWVu} 1 tC;5`-`-s.D-RPWVj H-t;x u;pt@$e^_]UWVu} t;5`-`-rWVha ": D-RPWV H-t H$9x u9pu 1pp P$WVh~ "i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3oZYt [u Ft[ 1ۉ؍e[^_]UWVVj/PF_Zu1,VeY/txtEVh "9XZEe^_]UVSu>-F@-9s%)P6SJjj*9tC/vKSh "Q9XZ؍e[^]UWVS}u h "09[ukjYƉ<@-uE5`-G Zu h "8X)`- @-9r @-@-@-uS+y؍e[^_]UWVSu=@-uF5`-)G Xu h "8X`-Lء@-19r C$؃(t@-@-C$@- 1ECCDžuPE  EujjY_t Vh "8XZVV5i_C[ٸ1Xj/VD^Z@PPiC{G C_ Y^Et5uu XZYƅu h& "7_E UCS FC^1E E t)uu ZYt hA "N7XًE U<؍e[^_]US]SmhZ@-@-]UWVS]f{t hR "S8Y^{u&{t he "S7XZ{ t h "S7^_s{ t]WVqZYuh "S7Y^49uWVKXZt-~"ЅtP9uSP h "S{7ZY3@-C$@-Xe[^_]UWVS]E ?ƅu h "S27_X9stsF C^ j/u CZYx3WƉWgC$8VP9kfCu fCe[^_]UWVSd=a-thX,h "XZa-E0h!u/b_Xu,Nr0"T Ph "h,auh "55fc E1uE9`-`-ErFuuZYƅt)GE~SFPj63v}ӃEU1E1}E9`-`-EuuPZYDžttj$GPEPPuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP2눃EUUH-Mt@ESjjEP2E D-E9ʋE E̡`-`-EUMԉuС`-`-E؉Uܡ`-`-EU`-ESjj(EP;2C @t,fp0:R Ph "h,_uh# "M3S8VXe[^_]UWVS=a-thX,hQ "4Y[}uXjj5`-5`-zD-jPE H-_Zu hk "2^jjjhe$fHwjjuƃ y,o0fQ Ph "h,^uh "y2xPV AY[y,So0'Q Ph "h,^uh ":2EЍXjSD XZu h "2YSWV y.n0P Ph "h,K^uh "1j(PPV~ xVa-Z"h,Oh,hT"h-h"h,O h,)5`-hW5d`-@ *h#WXZYu  tWh-ch-JTƀ- =-tjjh-}-jjh- 8J,@u&h-h"h,O`- `-D`-@h-u?=a-t5\-h"hX,N h,h"l15`-_X!`-9t!QPh"h,N1ۉ`-tx;`-u$;`-u|=`-9u;`-tRPLPh,"h,Nh`-KPhE"h,M1ɉ `- g T-\-=a-t5X-hQ"hX,MtVf=@e-t/@a-^ = -1 -jh -虸=`-h" ZltuX-~K19|f=@e-tR5X-^9})Ã=a-t#"6"PShv"h,LKx  Ke[^_]UWVSEh- d-`-9| =`-1H h-h P9~ 1t@u=d- 1`-=-t WP*XYWP58J,Mƒ =-ue`-;d-~D=a-tUhX,h"x[XU`-d- - 9uO5 9u?!t#`- 9tr)ׅ@bhkut =a-u d-PRUh"hX,KU d-h,h"@e-ZYftCftfHth,h " h,h""q_X85e-h;"h,J 5Le-5He-hI"h,{J= a-uh"k[ujA`- 1=`-=-tjS)ZYy@jؙRS58J,=@Bu&@u#Z0t< Phb"h,Ij@=a-thX,h{"[_=-u `-@1҉`-d-PY&t`- PVh"& hh`-5`-V h-h5`-u\-X-@ X-e[^_]UWVSÃ=a-FC=TtP=ltIʁlt=Tt1=d-u$=a-thX,h"{XZd-ht=d-0ȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPY^Chs,s(_YC(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC1ʍu1ɉMfEEE'E0VhQ`5-*  @u h^!"jE<u 5-hk!"<u5-h!"h, ~<tP5-h!"h,_Pu󥀽_y-`9O%CSh!"hX,O j 蟟RZ<h!"Xe[^_]UWVSE] h_ Zu h!"j1󪍕 19}J jQh! ujQh!" u#Fuobu 4jVh$ ÅtIjVh!" u'jVh!"y uƅ7fDžjh0uhj P5-ƅp9؍t h""S(Y_uu"-h!S^XZthD""SKY_h!"S>XZhJ""S1Y_u hS""SXZS5Л-5̛-5ț-5-hd""V@tAtif@ffh""S'Y_`f@ffh""S'XZX)/f@ffh""St'Y_"u h#"WZEVh!}Shg#rX4S׃X9uEe[^_] e[^_]UVS ] }t3h"VZYthx$VZYu E'j EPVΓE U:uy 3h$#"Tsh"VZYthx$VZYu E-j EPVyE U:uysh7#"jEPhU5-& t hG#"je[^]UVS ] }t3h"VZYthx$VZYu E'j EPVےE U:uy 3h$#"Tsh"VZYthx$VZYu E-j EPV膒E U:uysh7#"jEPhU5-3 t hU#"je[^]USUBBPJ R Pha#" uEj#"]USh#" XZ]UP}E 0UoEEPhQ5-t h#"j)U}tqjhQ 5-T t h#"jU}t&"t3"PQh&"VSf@Ph&"VS1ۉ؍e[^_]UWVS]}hpVjSzPh '"{vTh'"Y {yj h-'"tXZ,C@tPhB'"\YX,C t PhR'"DXZCȅt Pht'".YX{w j @_CȅtPPh'" S C h:Vh'"C t Ph'"XZhpPjSuj Xu'tPh'"j  W;} } <;u GVh'"WYXujh("DXZjh("/^X>9tR;U }MuRlh("ZY1ɋlhlPh#hAlBXXh?"IXe[^_]UWVS] }uh("^X1C9~D3Ph1("}FZYj X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u @u h^!"j\EtU-<uRh>" <uRh ?"h,w #<u jSRPRh!?"h,Rje[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@U׫PhC?"h,jCUh?"bUWVSÉ֡d-Pd-uhh`-萫Y_`-h?"h?"hWh!Wi_Zu:h?"Ph?"j J- u.h`-Ph?"h?"h\@"h`-Ph6"h?"1X9ډ}Dh-W $h?"_ ԥ-tWPjh-?;9}~ڃ<" u6"P<ؙPh@"h-kYuRh2jHY[j^Ʌ1<$1$jXZh:@"_XZ?e[^_]Ujh-kU=-u h|@"rGXj$USh|@"\Gh2jh2jh2jh2j$hhh|@"襱 xVj"h@"Ph-j PSjh$S(h-$h-SѯS+]UPhB"h,jNUWVSыP-:֍RD{@u1ҊBuT8t9s P-DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `R 1s0s4s8X{Xu1ɉKXCXtP Z1CXe[^]UVSu] EPu36lx9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Sh C"j EPGEEEEPh2("j EP#UfT ȃP-DJu.D=uUROBP U_Ce} t EP+BYuhC" XZe[^_]UWVSS1}11#tAEtSWhC"PAShH"PA @u hX%h"C"5W }YCu}u#h6"(EZuhX%h'C"jEe[^_]UPh,C"Ph@C"PhIC"PhSC"Ph]C"Ph~C"PhC"h,8jU Ph!5K,- t5-PhC"5K,E Pu5K,f - USÅtN @-twRtF -ti 0 Ph-hC"QH@- -u=-u2j -t# 0c Ph-h"% tŋ]UWVSEEEEujj}WjVP @u"e[^_]ËEƒUt PhC"j3P ZtjjWPVu @u ]=0-u5K,uhׁ$r ms6"M;Ms"VvvPhD"IE g"j SX]e[^_] UWVSEE]EEjj}WjPS @u-u YtjjWPuS @t̓=0-uuh!XZv<9t's sss sssh(D"q ՋE荞 kT؋U9u FE1}h-h>D"ZYdTEM9Mt?Sjh! :1;{s֋TM4PhQD"G ,j Xue[^_]J e[^_]UWVS}}} }܃=,-É΃=0-tO=(-u:=(-t }u&}u35K,Rhׁ$Q - 0hX,juVSN}u!Rh! -Y_~7j ,X -~# -~}uڋUe[^_]уtut3]ߋMtu*E r4s6PhO %4]ߋMEtPEPhVD"b sPhW#Ph"^XZM]ߋMtuuEPh]D"6$M] s SQh#SQhK# }uEfD"e[^_]E e[^_]e[^_]Ã=,-t -URh-4K,hkD"UWVS=$-uhD"sjj=PY^Xd 1Dž\ Dž`hj`Ph-\PVSN@u!ڋ\==-jDž`1Dž\YdX@DŽdj`R`PPQV @u!0 Ph-hD"WBuh-hD":XZ&,- 0-uPh-h"%+ e[^_]UWVSWE}u =,-R˃=0-t>=(-u3{=(-tNu%"u25K,Rhׁ$ - .hX,jWSu"Rh! -XY~7j ^ -~" -~uى؍e[^_]it1RE rGK= -tUPh2("YXUt2= -uUPhD"XZUB9|SWh! NuEfD"e[^_]E e[^_]e[^_]UVS]=-t EhD"SCY^uEEY1҉jEPSTEUE 9u%SuhD" =-j8uZ8u̸]1PSEPuVuu @u1t =,-1(-  -u}u}tPjUEPj D"UENY^tF(-  -u}u}tjjMUEzjj D"UEXZe[^]UWVS]=-t 'EE118jjEPEPuu @uuhE"kjSiW u%Suh0E"e =-xjjSuVg|W<8u|1PSEPxPuu9 @u1Ft =,-x|t1p(-  -tpjxUEY^?URV$EPVhME"jduV-pPUEG$tk(-  -tjj|UE~XZEURt趯EPthME"jd]SjPًUE$e[^_]UWVS(K,8-t f-/--SVZYuVh-Ie[^_]É)@E̍EӉljDPh- h$h-uUWVS`Eh-ZEX%1]M;>r2jPRU Utj@uVRPV3hWE"WGjEPjh-RU9 UuE Eu1}u+E9Eu#/tj@uVRPV3hgE"jGQ1EEe[^_]UWVSEUE5,-$ˋ -(- u'@- -h-hwE"[^=0-tu*jtHu!u05K,uhׁ$ *hX,jSuHu"uh!XZ= -~(j Y I~I~uڋEe[^_]1v{9}E0Ph2("hFYXt WhE"TXZE e[^_]`e[^_]UVS]EjjEPuVuu3 @u Be}t ShE"j5 - (-tjIY2=0-u Sh!XZuuuuuhE"e[^]UWVS]uEEU E$E@- -=4-J - (-t}jjEPjuVR @tdMt]QM XtMMMjjEPWuV @tM;Mt Wf _j-PY}e[^_]E }tuh-h F" = t)tu*Sh^F" uShF"Sh2F"ShF"SXZe[^_]UVS]E jjEPuVuu] @ul} t ShE"j\EUEU - (-tj cXP 0-u EPrP5K,Sh%&IuRPh^# uRPhF"e[^]UVS ]EjjEPuVuu @u}t ShE"j臻 - (-tjE=0-u5K,Shׁ$ EU=0-h RP. t P.XuuhF" e[^]UWVS,EE̋}uu<=@-t3EjjEPEPhF"輔E܍Pk((U܉UȉMQMC XۋMЋUuwuM1BH(jjURPVW4 @uCEԋU܋M؃t (9t$9uދẺE1uhE"j  1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhK,uhF"jURUUС - (-t7j(EY(}t GE܃t9]e[^_] =0-uuh!XZv$v vvvvv vv6hF",뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|PhF"莒|<Dž|tW XuJHxjjxPVph @ut9xt ShE"jl%EpujjڍE_X=@-t=19|WhK,ShF"jUR jjUE{G ŋ= - =(-t jQ=0-u Sh!Y[|~+t4Wh8G"G9|~ hg"Zj Xue[^_]; e[^_]ÍL$qUVSQ$A QEjjMQuVRP @u}t ShE"j蠶 - (-tjYd=0-u Sh! XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hBG"eY[^]aUWVS@]=-t Dž S0XuhX%hg#j1hV$R覣Y^18jPS u.w8"uShRG"9t8uShcG"jE9tҀ8úw܉ hV$ji 1PSPVuu @u1t =,-1ǡ(-  -tW EZ)AP<$PUEV tV(-  -tj EvX1P$PًUESJ e[^_]UWVStx|h-9l-$@-Yh@-h)ȉl)ȉ@-u-u|uH1ۋx9t担te$u6"RPhɷ$PPC뿃} t~|PK,xw6"RPhׁ$PP|Pe$xw6"RPhɷ$PPU Dž|K,|K,Ã=4-( =0-th@-h!XZh@-h-hyG" EHv hj#hG"<4X%hG"_X}uC|@0|psPhG"Y^P|p4hG" |p@hG"|0`-XZpt 6"6hh6"h`-趡hhG"h`-袡V$ppu/hWh`-zhhG"h`-f揃V$ƀt2hWh`-ChhG"h`-/V$s2hWh`- hhG"h`-V$ s2hWh`-ӠhhG"h`-迠V$ s2hWh`-蛠hhG"h`-臠V$ s2hWh`-chhG"h`-OV$ s2hWh`-+hhG"h`-V$ s2hWh`-hh "h`-ߟV$s2hWh`-軟hhG"h`-觟V$s2hWh`-胟hhH"h`-oV$s2hWh`-Khhָ$h`-7V$t7Vh3"j VShWh`-hVh`-(h`-|p%Ph H"[|@H t PhH"@_X|p(h%H"+j E }r=8-=@-u }|xXDž1DžtxTpj`SPPWt @pu\t|@9uߋ|@(9uΉdQp ^dtNjp󤋅|@XPwPi Y|XX=@-uTE tN|@XpHv9} |pUE"<=0-uh-h!hXZ|@XPvh.H"P[ X}|ps E z-UEÃ}tP@uj-! Ph-h?H"jXs u|xtjh@-h-|@@uojjPjxt @uD@- -=4-h-hVH"|@@EH{$W%|xt8|@8d uq=8-:t.s j|xtjh@-h-S @- -=4-h-hqH"tx\=8-j|@4p\ _+jjPRpx@Pt @pt*|p`t7|@4`&R; ^K8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXpsRr X1-d1ۋ|;X4,F\s@- -t%xQuujPtC`jjPSxt @jjjjPSxtQ @UjjDžjjVSxt @uI68 u3ʹ XjjVSxt @u jٺ-|c^_9S [DžjjPSxt_ @tgjjٺ-|^u Yuh-hH"5K, KjjPSxt @u jڸ-*S) XZhƀ@-lƀ-e[^_]UWVSƉLH-j=P苧_ZƅTt9sx?u @ƅTGh"V踕Y[.tK,K,8| 8Vs tG=^jh)`#S P` F<=t:K,M  T=$-u hH"s 41Dž81ɉh 1ۉtpƅY1j,Tk_ZƅtF1ۉH1DžL1<1ۅkj=V1[ZÉluhʍ"VZYu09@llhʍ"VZYu D1j,SХZYDt @Dh$VOZYHt;H"Hu$PThH", =-ju10jlPSz-u F0j PV x;3ue[^]UVS@Ë5H-=XL,tjtSvZYuFl6j j5SHFS)$PFSh$P DH-5H-F PhYQ"j@]SSfe[^]USQtP=-uSZ]UVSÉu=-u VSZYe[^]UWVS׉΋]Uu E E!UuUY$t6"[^_]USt<0„!1=-uSZ]UWVSLEӋu>hiQ"V?ZY)ƒ?EljDUh cSPEUDEj URPEU:*u%jjWSRPEP,tEuj>u踐 E9h cSV e[^_]9`L,t3UVSRPjuV`L,e[^]#-t ú-=ԫ-u-UWVSƉӊ>uuVȫ-HtB1-hTq5-VQ=-1҉-hTq5-S29=-~؍e[^_]UWVS,E9- --}]6SPdY^y#---=-u`- -S|{Z=X=&wAKw2iffN6[nRffN6D=,w$==!ffN6=XffN6=KwJ=w$==` ffN6 =%ffN6 ===ffN6wffN6lffN6affN6VffN6KffN6@ffN6 5ffN6 *ffN6 ffN6ffN6 ffN6Eۣ-Eݣ-Eܣ-eẼEfE1E`- 5-mSj5-ιE-e[^_]USEPhht@j脱 1ۅu E]u+hqQ"eaZtP-X$T~-hlQ"5aYtPZy--1ɉ \L,=- -t-0h|Q"`ZtP-[^#~-hwQ"`YtPcZy--=- -P]UPUE -1J$[% (UQ"UQ"lyUQ"UQ"UQ"ۍUQ"эUQ"ǍUQ"뽍UQ"!u,UQ" u -!- -1UVSPhQ"_P_ZYXL,h$_[uT%1ɉ -Ph -[^Ht -Q" t -A7"-Q"-Q"ث-5 %ԫ-!"̫-Q"-!y1------ܫ--~1҉-E -U|$tdN6U"u6"-Uq"u6"-UQ"rī-UQ"`uQ"-UQ"EuQ"-=-t8=t-u/UQ"-U%-=-u1--6"=-u -6"U#-t8uȫ--6"U%-=ԫ-tt8uȫ--6"Uc"^-t8uȫ--$UQ"/-t 8u -6"1҉Ы-EPh6"h6"h--$R"EP5-5-hظ-ܸ-L%$" EP5-5-hи-Ը-Y$a"EP5-5-hȸ-̸-Y$Z}" U&"Uu6"ĸ-$"t -%U# -tހ8tٍU;"Åu6"-6"8t&jjPyPuuVtDER"-U\$Åt =\L,u6"-6":t+-HPjR Pu>uVDEA"Y-U"6uA"-U"Åu6"U!…u6"=ث-u6"É-;u  -e[^]Ë--n--^=-tg=-t =`-uMU= -t=T-u--=X-u--1҉-]1-á-t 1=-ú-----USc=-t =`-ul=X-u<--f-8t-8t=-u-=T-u--!= -t-=-t9-~j CX]6]Uuj5- =-uĸ-8t -Ã=-uUjlXË--q-bUWVSu M1+uAM]-}tue[^_]USÅth($P藺ZYu R"tEPEPS tt<`Ux[% R"Ux<[% R"Ux R"UxR"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U帵($-ȸ-и-|ظ-m1-]UE t \,@t]USuZù¡ܸ-ڡԸ-ڡ̸-=-ttS蘯2Xڡ--]US=4-t-u ]SJX]US]SZ3-t]]]UuZu Y9Ã=XL,tUh)R"Xú-UWVSu}]E Et#jYu7u21ۉ] E.R"jYut$RPyZYtRPjZYuÉE1ɉM EBR" t9Et'hÃu1҉U t EYR"EpR"vOԺ5u Y [1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E ER"e[^_]@-B@@@ 9uUS]t=hL,tjhR"XZhL,]Ã=@L,UWVS-@@ˁ1 }1119މM}Z -9t+9xu"9puUpP5@L,\ UхtjhR"FXZ뛍e[^_]Ë -…t8=-u/US@t^%11Ҁu 0@4@[]UWVS$-$@(@u9t9pu9Hu,@;Ps D15-%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=x-t @tdL,x; @~QMh j ZYMu 1x-0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex-$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@裠Bu@ujhR"[^&-M]艈@@hL,Ft*ThL,=|-1ɉMܻ-@Mt@^%T뾹 )QDP@ià u-u}艰0@4@Et]y*jhR"XZ1K@L,yZ=|-u/@L,x&t"SVTRPdY 1E 1E -ؙ@@^}t-=-uAEEPhg#O-ZYEU艁0@4@=-u2j2X=-t!=8-u+lt-8=-+-98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë -t&US$@(@ ,@1[]ÃÃ=-tCUu/ -,@w B,@$@(@1]ÃÃ=@L,xzU= -t,5@L,Y@L,5l-4 1ɉ l-XZá-4@uƃ0@u -jhR"nXZ;@t-tUWVSu} -Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV-@9@}A@4-t&[^_]UVSjjY[t@-9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US-u1Q@t@h0@4@[ut RPPZYs@t-t]UWVS -t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë-,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1udL,]US-@uǃ0@ǃ4@|9t@@@g0@4@-1ɉ@@$@(@,@jjj@裙Bu@ujhR"XZ]Ujjjuv!Ѓ@UVS-0@4@ut@@9} 0@4@[^]UVS]u 5-q-Yh8@j-@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu -@5-5-pXZ-@u@e[^]UVS-@ t4t&9tPQ P裌 X1ɉ @@uB u @,TZ-t ǀ@P^ 1-j5-*p e[^]Ë-1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1-G*u:Vt3st!dt1k1uUE 0e[^]UVS h6"j訍 hmS"DhĹ-o h-e h-[ h-Q Ĺ--ȹ--------------hHS"0D1[<=:tjh|S"?j FWZPÃ$P\%%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu= -tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU= -u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U庀-E1uN-Ev¸u6Q,E^u =-tL,ED]U庀-E#1uN-E¸u60Q,Eu =-uL,E]UE= -tE]-]USQ]uhS"h@- w?SSZt'؃@PCYu@ShT"(S5Թ-SZt. S YtS5й-j h@-肑"yE@-SEPEXZ@-]U庘-E¸uHM,E]UU 1}Du% ]UWVSSEIuRfPę^X[RVZY1uEV Xt S蕙Y-h@-jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRhX"V:hX"J:ShX"PQOucjhX"V=Oǃ u.hX":ShX"POu0ShX"V O ShX"PNEW~ Ete[^_]UVShX"9P9ZYu3h"V貜ZY1t=hi$V蝜Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPVY[{%=eh+A"VOV} GShVE #jhX"V  1҉p1ShW t t u@hX"W`YZhX"WKYZhX"W6YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UE-U -t@]UWVSSuE 8=$-u ^9uO tu QM跒ZYMuGCQNt WHt _Xu s 艒ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]á-t);4_,t!Ujh@-P-@ UWVS]= -u3-=---uP--Àu-%=ua%=tSSH-%uF -A--9~1!Ph-ZYu(1-K1=-4L-15-=-t1ۉ-UU1;L_,u PS_/EZYKHA$d\%}e,+1-#1=-15--t-8 1ۉ--=@-vx u-x -=@-w1ɉ - -5-GZq1--8\<1-I1-E1-:41-)91=--=@-v6x u0-=@-x Z߀x I-=@-w15-1ۉ--8 u-8 o-oZ-Y1ɉ -=-=h_,y--@-h_,_h_,[} t9s RUVh@-_ Uuω_1-ItVh@--@-XZ-8=-t } -tPao 15 -_.=EPl[¡-u=-@-@-u"z-tމU&U; u C9re_,Ed_,E11ɉM@-9t)9s"RUuVK Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\--tP n Xj-)@P,--)RSP6U-0e_,8uCSm<XuSA -_WA -Wm Y[- -t{}t1-Ph-o-1ҋE7_Z-E%--9-s-u,15--/]1ۉ-Ku5-DY.-=@-v d_,8HuhX"(Zu$1-v-e[^_],e[^_]UVSQM1uu@-EQЀ w[jjjj uuuVtjhY"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1-9-|@-á-t @@@ Ã=|-uUj11ҸXUWVS|-t`_, 0_, -1Dž|Pz@$jjWP薔V`T:QDQh!VǀXZ$fSftxRPybZYx,E%=ufSfthPY5YXhY"%Zud PX~P_,1Ƀx tA _,x t tlphX"h"S|1ɉx =|-u:pl)ыt)Px֢ jjxPhX"SSuWV3Vi Wi XZe[^_]ú9-t9 -t 19-‰USR@-t>BE@-Ri XE=@u$-t t7tut g ]UVS=\L,u=-t =`-ut/--u ujjj5-RPV p-u)=\L,u^5---1ɉ --5---1҉-u H5zY6Y5--e[^]U]UWVSt e9ZƉׅu‰@-D--=-u0t;5@-D-}jjjG 1--ld8e[^_]UWVSQE)ơ-u--ǁt#t1 2ux%-Su5-á-ƒ-- t;x- st jk1j1Ztjh&Y"蹱ZYtV1VJ)Xe[^_]USVá-$N   tw #5x-jCP7tW6%I/f5d-S5h-5l-q1l-?E4x-؋]`--PS5<+u C< u-tPe Z;u 1-S-X5x-jPCP=|-SB1X];!t-tPce XSQ6-Y=|-ui-uh8Y"h6"XZMh8Y"P=|-uY"P迁 &=|-uSD-P覄jhDY"誯]UVS։ˣ-\VuS e[^]UWVSd-ƃ@࿉ÿ"u˩$-/|WX=`-tW_t hJY"s^t uhW$h{!W[1-jjfZYe[^_]UVS- s -7t - -o-t hNY"X-t hYY"X-t heY"X-t hqY"^-t h{Y"[-t hY"YK-tShY"juVntVWCuҡ- shY"th$h!'X1҉-e[^]Uj5L_,"XZá-i…!UEu]UEs,EPhY"VZYUjj蠵UP@-@-XZUVS@5ī-t<>t71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉@-YYu@- ыuUS]t CPX]UPKPEEUWVS<--@-e=-t1-1x-|-l-=-t=-tj轳_@-t x@jBX-\-Yu*:t!u5-YBZujQ_=-t*:t!vu5-&BYujZ1-=-u1-=p-tjhY"1p-:͹t hT"Xt?uh9j::_X Ws^Y=-we{Ã=-Z-$/t.-7iCЃ . jS_Zdteht-x-|-^=-t1ɉ -d=l-ud-u_un`-ƒ@+t2tA!uI1D!-tȡl-=`-uLC1@ ‰d-j@d-]=`-l-  =tSZHOEa<h-1EЍEPEPEP虝l- tDFEĉE=h-u Pw P1_=E@Ƀ}XHNuEЅ:EPhY" 15`-HY=l-S贜l-YuSEЍEPhY"Ch-l-d-Ht!5d-h6"5h-5l-. RߓZt5l-j1ɸ/eu;&7C!$\%*t0@tg!=-7u-%-=t--=-7t%--=t-=-7g=-7tWjhY"j#]Sm^SvRPσH=-7t(3-P_- tA tS u݃=\L,u yhK5h_,jYO =-t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $]%j1ɺ"7 x-19|-}h-1;x-|-|Ϗx-|-X=L-t5\-5X-G^_jx-19|-}h-1;x-|-|mx-|-j1;x-|-|x-1ɉ |-=L-u+;x-|-}5\-5X-YFXZjj5x-1;x-|-|x-1|-_jjQjj5-V=jj5-v1;x-|-|x-1|-=L-;x-|-}ze1;x-|-|x-1|-jj5x-1;x-|-|x-|-=L-u5\-5X-.E_Xjj=L-t5\-5X- EY^1I+x-19|-}-=L-u5\-5X-DXZjj5-K7 x-19|-}-jj5-8tFm謹G5d-1;x-|-|x-1|-d-Y5|-5x-F5d-q=|-y1x-|-t-x-|-d9|d u=t-tx-d1|-t-5t-5x-H_Xx-|-19|, Gx-|-19| G{RPEv=|-y15x-5|-5d-5|-5x-YG\x-1EȍEPhg#=-uEtEPZ9%tP-`-L--H--jYj譧8---1;x-|-|x-1|- - ---1;x-|-|x-1|-x-15-Ѓt+Ѓ$5- t -1;x-|-|x-1|- x-1_5-x1FP薶XdW[`-P-15`--L-1=--H-1-hP"?맃=|-j 4_,Z" =|-z5-6h"Pq u jh'Z"5-P7YtjhBZ"ԝXZj _,W$t5d-jPoPt jhmZ"<;x-|-|x-1|-5x-_vt\,t4uj^;x-|-6"}Y"EȍEPhzZ"t jhZ";x-|-|x-1ɉ |-5x-Zi;x-|-6"}Y"EȍEPhZ":1;x-|-|x-1|-5x-XuMjhZ"@/1;x-|-|x-1|-5x-_u jhZ"V^ u 5d-RP>1;x-|-|x-1ɉ |-5x-ZJjhZ"?|15-V`2_kPYt VVT2d-1`-P臇Zu egjP1d-`-j1ɺ{! =|-u) _,W$t-"j=|- jhZ"[Mj1ɺZ"L_  1?PSq'@0j1ɺZ">^  Sq?@j1ɺZ";4Y u lpSrj1ɺZ"%[Ze4 t u.Sp_eD-j _,W$% j1ɺ["^x-19|-}H-#H- -x-|-`-;x- |-} x-=|-+x-Yx-19|-}H-#H- -x-|-x-`-1ɉ `- a`--=-it Dj1ɺ$iSXZ=-tp-̯UE= -t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u fZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ -EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWM Zt WYO YWEP.XZ}tE)}+} MJx҃u̓@tAu= - = -B$}mu;-}Rj#;k-XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e= - = -B!5-V9}Pj#Rj-XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U--|-r-]gUM U-y1E E["]7]UM U-y1E E/["] ]UWVS|-Et Eju [^xPƉUY9E}jVB XZu WXjjjW4RBu@uSF Wo^_VSW@ EWWMș}9u9tSF 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GEVWhڋ` \1ɉX=l-uOdxEPm0Zt:`xxPhy]"VWhڋ`zt 5-VaX=-SWh5-5-sh-5-J-Xd1ۉ-$1HPTH;--xPlPTPIPTTu PlLXb,?txLRDSHZYƅtVDRR$ΉX9Lt~ ujh]"SMU u C: Xb,t 1҉HXl-t=-tPXh"\U^_t@xP\MY[u(EU--x|---tP!h@XZ{=-tuLn1ۉ`-hP"`U^_t:h5]"`TZYt$`'jP54_,S6 =-t R`d6 Ie[^_]UEu1E5-PzZYEU5-F-Ztjh]"Ӏj茈 h"UWVSSÉ։M}uS_SsYNxuSIZu-uƸe[^_]UU-]UuQ1-jZUU-]aU1-jUVSu1SYtPZ9u]e[^]e[^]UWVS}WeWvWWjtAuu$1҉u#1҉tEe[^_]"e[^_]UWVSËu t׉SW Wr4 u8Sa4 ZY9uujֆXV@e[^_]UWVS]sESEP [^11VEPZYƅtcVEPEP 1WEPZYDžt.WEPyZY u5-Xu3 Xu3 _닅uu_;5-SY^9-u uZ1u[X]e[^_]e[^_]USÃ=-tS$X]1Ҋt%uH%u@suB@Ã=-u*Uh]"-Zt- -]"-á-UWVS jjdхZYEdNyV?X tb P tN)EH9|=MMMju{WPE[WN2 URgLU׋M Ce[^_]Uh ^"ZZu!UWVS]SL$@P _Xe_,8u"CtZ d_,8u:KuKCBBCPKZ;t*tUQMWS&O MUuBBCe[^_]UWVSu9EPwK_lju11EEtHA8e_,t8d_,uUMSPY[MUttEE뮃}ujQXZy1ۅu|VJx$W܃d_,PVe_,Ph^"WSA BUMMQP7ZYUtuRUYUXYFFBu؍e[^_]UWVSRh"~PY[unVXtaW=JƉ$3JT$RUSh ^"Wh$URPA S/ h+A"VhEV/ E h+A"VLZYe[^_]UWVSuu1k>tVI_u I|$W+ XZtu h$Vh%WS@}tjSY^y S9/ ZPX؍e[^_]UhX"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'-<%t-tRPHY^CGjCŚXZutKH݀u=9us8Ft38Ft1 -<%t -tQPSWSHÃCFe[^_]UWVS]S^u1jjjS~9Bu@thVS ~ˍ19= -t)RP芨ZYu FSW_XSjW]ƒ =p-u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=|-!8u"P^h,^":PEyZYUt#^"RUFƉ$FYPFkL$QMWd_,Pe_,PURh5^"MQV=$Wz, tXUVFZUtRhL^"PtG Sh"PbV/, t'YWTY>u V , Z S, X؍e[^_]UWVS}1ۃ=|-u\WEX$S~WhT^"SP<VuPǃ VPIZYu S+ Y1W+ V+ XZ؍e[^_]UVS]h"SI^Zt(hP"SIZYth5]"SIZYƉe[^]UVS]SYuVS aYZu]e[^],~V&~Ze[^]UWVS u=@-h|-ZjXhdZ"Y_?|uC؉E-uEh"VH_ZECHtjhX^"!u[^VuiDƉ<$_DT$RUF}WuURPI;W* V* YtsfGftjEPVj Ht-WZKtcu_E18E h5]"|XBEP;E8E 0h"|Y^WZ;u Sf) X1ۉ؍e[^_]UWVS}u =|-j֐h^"nZY~1E E^"e[^_]sVWS CE4$BE<$BUMT$RU{EWVSURP9$W( V( E@u( t]e[^_]e[^_]U|EPugXY1xE%=@UVS|u=l-u1V[t&V3B$P{VPJQhb,\|PVZYy VjXG1ۃ=l-u j4jRpucpCuC C C$C1҉SSS0S,ub,sXF@C=b,t@ -SvAX؍e[^_]UEt@]UEt@ ]UE@]UWVu Ex ^_]UWVEp } ^_]UE@]UE@]UEU P]UE@]UE@]UEU P]UEU P,]UE@,]UVS]u C0t 9tP Xs0e[^]UE@0]UWVEUu} EUEUEUEU]Qu TQts16utjjWVuuՅ*Qu <u`;jjuuuu襅ƃt=u5<,>u#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=-u2=-Pkd-RPWVcWV4Ɖ׃ - D-uWVcY[uu}-Eu藊t ub EUcuu3uuEUEU9uE-$ uuP&EU ~ÉEf=\-Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ-g} t}uS*(EƉ׃}s}t$ `-_E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U-襅t u`Ɖ1- \-uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=\-t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=L-tM\RPj =$ Mj}!SQ{&uu+z^=D-tMWVuuRPEU$=-t;}t5 u-t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=`-jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=-ukd-9EE}11軁 D-uEU)juuRP蹁EURPǃ[^y=-tLۂւ t u, u-<ͅ u@)蔂-訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ-Ex u5#Å^IJ `-MCEă=\-XmRPSO!Eă J…u =`-~1҉-uȉ}E=\-u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=\-t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=D-t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5HL,=LL,΂Hw t5PL,=TL,e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=L-Ee[^_]3rWVEZYt1ۉ] E^"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE-)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPh_"jW?_"5j PWO‹ 9u6"&`"4-Ze[^_]Ë-;-~~- ,- -‰-US-X-0-H-[]É19f,t @uUP`iYt-t-tܫ-t-UWVSd-UjS EjS }tUuu YXtP5 -} ljE5$-5$- 5 - E -E$-d-XZ1e[^_]UWVSÉ։9d-~ -$-< +t[^_]UWVS׉ˋ5,-V,-Љ[^_]M=-tt*ttt t XÃ=p-u[USjm5-vZY R"t:t1ɺNC=-tmc"t1ɺ*C]Uhuc"讽-PYZt -!hc"艽-PƽYZt -c"jh=U -jh,U$-d-h-h-ނh-Ԃh-ʂ h-轂1-ZU1}]á--U(-1-1,-9(-~" -,-$-1ɉ ,-@1------|---------h-(h-h-h- h-1҉-UWV=|-uu uƉXZ11D- -u=|-u u$ZYt-@=D-tʺ@b PL,TL,D-ut79MM |-M9 HL,LL,U |-@x@-c B-9-H1Ҹ WVY^1 tj uVRP;FVƃ1-)9~1Ҹ G19tD=G1Ҹ --e^_]áD-t-=|-u -DUS(-9,-~$$-<u -Ph-€XZCԡ(-,---]UWVS]u }Eu@0tjxYEe[^_]= -tW~Z= -tw/P'x_uSQ~[ۃ,-~K1S|YuSWV~_ZV$-t2dZYu,-$-DV c_tW,-uVb^ƒt -V$-tcZYt t-t-t-Ӊ؍e[^_]UWVSEUMЃt-} u)}u#=-M-}tuEPjEU RPu ugu=-t[-tR E@-D-ut;UE }EU @-D--u=-tr1ۉ-1D=-uf=-uJ8u u1ɺZYG9{Ft-1k -ك}u E1O - ,- E1~RjEPy ,-1҅~ $-TRPuu&Ã=p-u}u9EEEE55-+5-Ee;5-'EPv_`-9-uY=-u=-uEU --1=-~+9=-~-81ɺGh-w|Ym19}E81ɋUG`-9-|1}uEPh-|XZ(-9,-~Չ19(-~= -   $-<<@B)5,---9`-}1ɋ(- JKݸe[^_]UWVSƉP[=p-t<-+-;-~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19x-~ -t x-)C1[^_]UWVu} =p-uWV1ZY ie^_]á,-l--h-ál-,-h--UU1wR5-ZYUS]1w%SZ1uS5-ZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6@%9tu!ـuJA%u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} -E-=p-uuS-Zt -1--dSPEZYtJHWVM^_-xt -Sh- yWVMZY5-( 1-Sh-xh-k- -Pdyh-x-@}-2 -`-9-}%h-xX--=`-9=-| ,-,-؉ESjEP8tU$ t9r)ډh-w5-] 1=-[^0-t -u"uu} U,- p,-~@9(-|  -|t $-D0tu u. u#uWV11ҸJt1Jutq -ЉERj]S*sƃ  -E9s=)У,-RjSsNj$-,-?4WtVL)-~뫣-m},- -= -u-PapY,- $- M9u3_u(t M:-t E)M Ma_uM -UK_uFM@t>SrZt -E),- -PoSPYtE u1- -t =-uuu} U -+-4g, \-~9|0g,)ș);`-}sd-)WV$U ZYu K= -tw.PmYtu} U؍e[^_]= -t+=p-t"SqZtSarWV WVMUmZYe[^_] UWVS]u }-t4 u ti5-5-1ZYt 1- -t =-uVuR=|-- 5-=-1p-t-_@x-1ۉ|-i뷃= -tH=|- x-- (= -t|-unx--ÀuWV1҉ZY%=u+%=tSl|-5p-=t-_1%ul x-Ax--9Ph-'l[^5p-=t-th-lWV-. 0x-1ɉ |-uVf,SnXZ1jjVM u뾍e[^]UE1҅x f,]=-t&-tUSJZ P+JZ HX[]Ã=-y-U=|-u -1|-jhc"A5ZYá-xW@d-UWV1ɉ -5-=-,9Ɖ}jhc"5-XZe^_]ø- @=-u1---------1҉-----1ɉ -UWVS EE} MEE--t"C 9Ku}9{u E9C֋s--t - 1-ЉpHMH MHxC;4-=-u`-PHE8}-t'Xp9ډ} EӉEEډÈ}tE죴--@B [^_]ÍL$qUWVSQQEU=|-t E]!@u 111]9؋]ع5--tF U9V}}6E9F uE9Fu N^*--1=--~t-uF"HhW$(V(h?"( TEj舦C'j9jWj踭Ej莪by u蚭Xh"Xu>h!:tu R5_UVXtˋURUÉ<$L$QMt5蔻WPURh$MQSk W2 _urVZ5YSS j辩u֬u让jVj8}t&u'hc"'X,j &u& VC-u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jhc"h!SxYXujhd",XZFhW$&S&h?"&A%j 8jUjj }u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuVzjj #j`Ujs7B-jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k -GPw'k -1-'t'-#tUEEPh#d"**YX1ÉUS.w$tX-'^--1--- -tP X1 --mNt jh5_"g-K - ----jh-{/-- -Y[뉉txux ujh:d"5)XZ1]UVS -1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5-sS CKCtP Z1C-e[^]UEt*xu x u]?@ @-]U Pu]jEP-UEYYut@ - -$-(-E,- -tP Z1 --UWVSPEf=-uJ=(-uA=$-u8--1$-(-d-,- -tPr _15 -{u#jPs蓾CsH 1ɉKs {SC;-u RWV UP號ZUte[^_]UQMt-9PtjhGd"&XZP@ UVS]u -1k9$-u$90-u9,-uPa~#4t P'@5u1҉[^]UU19$-uǀ,-ǀ0-=u]UWVSu薾[1(-t:PPVr uE$-(- 1҉(-YS Xue[^_]Ã=-UWVSu h"u - C Suu0-ue[^_]j }WRP` su sʽXh"VZYtVWsPh`d"uUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=-E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP Y1Cu,CZe[^_]USE] =|-t1E Eod"tS_,l-XLt1ۉ] Ed"u=@L,x1ɉM Ed"^S*ál-ZtP XS茫P軦l-S 5l-K]s@=@L,y1ɉM Ed"]J#l-EEPhd"4#XZ]p-s,x$Ujh@BRP-RPd-USEtzE 8.MU u4@E Qh%RYs, }t jhd"}Qh%RC }t jhd"kd-s,as,yd-EEPhe">Ph&e"j ]SS~P|0uD]EPh-e""XZ]ás,x$Ujh@BRP-RPhH-USEtzE 8.MU u4@E Qh-"R<s, }t jhSe"}Qh-"R& }t jhke"kH-s,as,yH-EEPhe">Ph&e"j ]SSv~P|0uD]EPhe" XZ]US] }u!jSŽYZt]EPhe" XZ]US] }u!jS^YZt]EPhe" XZ]UWVSUE t tP(0-^w=|-t1ۉ] Ef"e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5d-WVe[^_]USEU tXtugR%(s,YYR&ás,Zt=s,tP XS|P諢s,YX]] s,EEPh f"QXZ]US] }uC=-tS'-Y,@-h$rrSlrXZE@]%r]UVSE] ,-E(-*,-"tRGYEEPhh"XZ]UEtHw1E Eh"]x-]U}u= -u]g.]Q.]UEu=- M-]UEu*=-~!EEPhh" -XZUEu*=-~!EEPhh"-XZUEu#=-t=-to5Bu @u]]UUE t#u?s,^u2@t+s,!s,PJFEEPhi"@ US E1ɉ - -E 8,t)EPh2#E P }t jh.i"3-E 8,uf@E EPh2#E P{ }tjhFi"XZ7-05-5-hh#j]S]܍EPh`i"u]UVSE] J1 RD+~vQQ r/d~Q wG$ؚ%t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh}i"1CSPh-Y-E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPhi"XZe[^]ø=`-u=- 1=-áh- -+-UWVS }8uMEPhi"Y[1bÉUP$@PƋUXZt=0-t <\u {t C<$ut PW6ZYtFFC؍e[^_]U@uPhi"j*h`-yPRhi"j*h`-a`-UuBPhi"h-0a-UU1t 1BS]UU!t B tB]U}ou<¸d"u1]1=-U-.EEPhi"KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPhi"&j uP yu˅tӉuEPhi"Y[뾅t1҉t؍e[^_]UWVSM-tFPtu)QjP_XD-ZjPEP 15-1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7Z9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh}"zYtP03Z~s,øU =-u[h->ZtL1-EEEEjEPj蛄 M9 -t-_k--;EMMEEE=-t=-t=8-us,=-tuPjEP EufE=-u);>s,9u -&P\Xʃ=-t ƒftըu1ɉ -uu ul 1҉-=-u&u-@-~Fj.Y<1҉-y!j8m\8#_M9 -tu1 -Ujh-O=UQEPPEUUWVS0 u;É4$1|$WVuhpE"WP؍e[^_]US]S ZuSh}"h-T -]ÍL$qUWVSQ Yq AQEU}WRPq1uˉE؉UM܋EuƉeWuuRPtu؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEPCXZUSs,@-t,s,@-Sh@-5s,r 9t -]UEs,]Ã=(-t 1(-s U=s,?-r|s,Ps,M1 -E]UVSP-t -E1$-EPSXZt'u> E$-Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRPvK}Њ}" u؃}yC-^SuXZeY[^_]aTUVS]1)EM}I}"uyA-NQu XZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%(-e[^_]US5à Hw ot tSRX]UWVSu} ,-ouWV"XZE e[^_]$=4-u`~h-WVhs,n-\B1s9- -e[^_]@UEU E 6"E6"}"]UVS]u .uu ]e[^]s,P-ZE }"E}"؍e[^]KUS]tu uR4=YZtg=- -j ZQuj>X؋]UWVS]uE %=-t >t:S$PKfPjjjjSPwf$9twVQ Xnjjb1=-1҃=t- PSWz ÃtW _}t-jh}"[^tP6 ZY>1؍e[^_]US]tP3赲 ZY1]U1}]UWVS|}ue( u [E E-x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$6"E<:N<%<.uFu RPY[ +!@ *u5-蜋_vG9^.1u؍U؉ƋU؍C<6$ԛ% l-1Jk`-RY19- -{9)ISQRPEi[u  u11ERP[_19r -+ -ISQRPh1h-N5-5-P5-PDwS覨 x(t u(5-pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ-wtl-1&t mg#EW!;5-KZtP X@=l---e[^_]U5s,US-=-t¡s,u`-PE1҉-]U5s,*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH --13CP_ 1ɉK^։URkZ9Us&RUjEP!Pk Utܺ1҉S -t -SuWV>ƒx6Ct Pأ 1CZV@$jCVP {1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]-uU5-Z1=-UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Uฬ-9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5-jjWuE)PV5-5-$'e[^_]1----UVS=-t 5-}uuf-1ۃ=Ы-uDSgYuu C-H9RPSjY wyr5-e[^]UWVSPL,ETL,E@u }HL,EܡLL,EHL,LL,PL,TL,=Ы-u e[^_]=-t11-H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v 谝 V誝 ZY1CCC ----e[^_]Uh-XUS]-#t-=-ujh~"XZ]1=--E]Uh-'XUVSu] t1ٸ-t;pX[^]UWVSEUE|E x-p$l-h5d-u-tXsmS芔 Zjj1CCCj y]e[^_]J -C--e[^_]U€u1=-1]UWVS4--EU--E܉UtE؋M܋]MjEPjujuuu $--u}u܉}Mut}9Nju|M܉]E܋URP ZY--9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU--E܋U--,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1-=-u]]USj5L_,#ZYt8jٸ-Xx =-u=-uS1]U=-u ----]xUWVSU EEt :CM@tE3- s+jh!~"Eu jh~"=-=D-=-1ɉ -MMM1ƉӃu]5d-+PXZe n=-=D-jh@~"_XE:jx^@=-@1ۉ-.1EPM-Zx- D- j1-#X=-t =D-TƉ-u}tp-xu }@u}uQ-HEP5d-X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=-}W؃&MxuƉYjZGMEPjEPjuujjE Mt=-t =D-tZ}~TJEu2EUutjEU9u9t5d-RPy =-t =D-tjFXEe[^_]Uh=jG -XZ=-t.Uhfj -XZ=-tUE]Uhj -jjm=-tU}tOhj觥YX=|-ufPj芥h=j~jjuhji 2jj[jjRjjIjj@ jj4XZUWVS-1҉-tijj/jNjjjjޤGjP>Q$hfj¤j- tH=-5-y9=-u95-t-@-h耲-t=<-tj"Xe[^_]UWVS E։ϋ-SRU薣$EuUR u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)u$$@PCuP:s {E C}u1C%u$@PCuP؍e[^_]USs,s,t%CBsy sq Sk 1---]UWVS5s,'Vh+A"Pɝ Z1ɉ -[ÍhV胱 i!tSV2 uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹Ms,s,Ps,-ZY{X=-ts,--1e[^_]UWVS u!b1ۉ-s,s,,TÅ515-hR~"AP>AZYq%STYu蔟Z肟lj4$x$L9QZVha~"PG9tV Xh+A"WW f;?SYSjjщ‰s,s,Ps,- VhP? th=-t,tVXGPj_t u Ƅ@t Vȉ[ uP- u,DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBVZt1---%s,s,t--1e[^_]USs,hl~"SBZYuwhr~"S*ZY¸t_hy~"SZY¸tGh~"SZY¸t/h"SZY¸tjSMIZYxP!JX1]UZu E ‹E2ttHu jh~"jh~"jh~"XZÍL$qUWVSQ -p x tWV虛ƉY[jj1EUXZ-uBEPEPWVNE؉U܃E EtEU}u}ujh~"=Y[=|-tuuuu誗=p-tEUju4P4ESj:jEPuuS"4(eEu S XZEЅu u؋}eY[^_]aUWVS- -]11~1t2s,t AFKމt - -[^_]UWVS- -]11~1trs,t IFK݉t - -[^_]á-á-Ë-tUrIZøUjZujhi"FZYyjPFZYxU-]øURSjEP5-hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tP~ Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3} XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV8M9u"9uu uEZYe[^_]Uju蛗jh-\UE=4-t&uf=|x,tE~"]>8-@]]UVS-1=p-u-1(hjXZhjY[h-^tTjjXZjjݖY[h$"^8-u !15|x,=4-t j[P ֋5-t,t,PV2ZYu8-8@1ۉ8-~"Z8,t@8u݋8tH5-R8-PZY4-@8tSXh+A"5-訐^Xuc5-h!gY[~"S$S5-I& BP5w,P^ZtbShVF Nh$%P#^Zu @׀8 uSY "h"P#ZYt @׀8 uS҅X"8t%8,t8 t@Ћ8tH5-R8-PY^4-t STZ@8-P 1"Pe[^]U-jjדXZUhjēx-XZU!-jh`-e `,Q`,y ;p,| tX,J X,UhX,P赐XZUWVSREƈEj}W5-$ f=x,tk1x-5x,ijW5->ji=x-t.V]"Ph8"貊 Ktjh@-5-# 럍e[^_]USQhO"jj蜒jj蓒| t2Åt4EPZ9u< hU"FjjQjjH]jj:jj1x,j/SmڅtPjRSh,h"UhZ"jC]h,h":hf"j(]USQjhV#5-n< f=\x,t#E tPE Z+u}f= y,t WVh@"WVh" jh-5-@3h`-jjBe[^_]hW"_X UWVSEhVh"F 'jh!5-2jjjjh-jj€(jh-5-3'à yh"X11ft#juƉXPY~G9uAj5-,fjc]jj菇jj膇V Vhk"Kjxf=|x,tj)RPh}"ejh-5-1h`-jjjj jjXZe[^_]UWVSE[hVh" 4jh!5-m1jj跆jj讆h-jj](jh-5-x2q&à yh"_X11st#jƉXPY~T9uNj5-dj5-dj[jjjj$VVhk"}jPwf=|x,tj)RPh}"jh-5-p0h`-jjr~jj謅 jj蠅XZe[^_]US,]S5-}bh!u `-u M e`-Sj5-}h`-jj}]US,]S5-bh!u貈Eu %ESj5-} ]UShSh" S'Ew,[tEw,jhg#5-./ Ux,tUx,5x,t5x,5x,t5x,f=\x,t_x,t$x,f=x,th!hc"uY%y,t%y,,y,D-5y,t5y,jZEy,t$Ey,f=Ly,th!hc"X]Ujh{t 5-*tjQjhzt 5-tUS]Q1uD&jP/XZ]US]CStu RZYt1]UVSEh"PZYtPa^yhd"T[Ph"hP3yaƅulx,u~&$/$/X2Zi/$]/1ɉ $Ph ^"SSj{u*huA"X /X/X1/$h`--à .XPY9u tth,h"XZ댅yh0"xuPh"uPh"h,{ Cƃ`-_-8 u =`-vH@`-e[^]USErjPh-h" uxh-hhP--yh-h"xZY?hSh" t h-/X5|w,5-S ]UVSjPh-h"] h-h-PY[vE"e[^]Hu --5-hhP(,Ãy5-h"wXZ+5-h)"hVMvh5"SVe[^]UEjPh -h" uXh -gh+A"Puz uh -h7"6wXZ)j5w,P f=x,u-E 7UVSjPh-hI" h-h-PY[vEP"e[^]Ƚ-Hu-Rh+A"Pyà uVh7"vXZ@-f=x,tPhh"Php"hVtVh"S e[^]Uh,hӂ"joUWVS}<1ۉ--x-%1u~11Ejh u,hK"u uS=-uh,h"jot&`'FtrE96/ kU DЉEx-뉃a$%nEtPt=l6W|Yvh"Z?95l6jh!V jh!V h#"V言^Zƅh"jHl6h$SZYkh;"SjZYLh#"SUY[Åhȅ"뫡l6-l6-Em=-t hۅ"sl6j/RUYHYZUt -5Rh$h-ݺ EPjhjjjj5l6[x-U P5l6h"RD-teh,"tMl-p-@-=-1vldZRp,E)t8HuR}t hl"KE h|e$RU~YZUt-"l-p-@-hjzhjzhjzhjz 5x-h"j h-/qh-u h"@u h"jhX,_EXZtKth$ h;"h#" Xt 1N11҃=-1x,Ly,=w,1ۉ|x,=D-t ,y,=l-t5x-' Yu.t hņ"j=l-u"5x- Zt5x-h"jDe[^_]U-jh-SU4hjtyEXZu2EZt1-=l-u!ujEyYX=-h-Zu(j O=@-$u+%ZY-jOY-yuhg#\XZ-Y=-LjP@6XY-tP%Y-!URPUXZ=@-uM@EPj5- q jh t 5-h jjBxYX1}UWVSS]=8-uh"WYu h"j"Ch"WZt8/t Pe) Xxv,|v, "Shtv,EP0 ƃ 1=-t6--|-l-1p-=x-u'x-%;/u%-jStY_tt-t t u!hG"Sh"謅XZ h&"螅_jjhv,9u QRP2 v,Euڃ=x-u hx-h/E#P4 @u x-%ht-h*($u4 @u t-=p-y15p-=-u\)j:hx"u( 1҅‰p--uSh{""t%=-u-=-u Sh"jQAj:hc$uZ( D-=l-u3-tp-tR5-yZYl-|-j:h%u' t x,j:h%u' t x,j:hK"u' t Lw,j:h"u' t1Lw,j:hja#u|' t \x,j:h"u\' t lx,j:h&"u<' t |x,j:h_"u' t1|x,j:hA$u& t x,j:hj$u& t1x,j:hz!u& t  y,j:hc$u& t y,j:h"u& t@-j:h#ue& t Ly,=X-u X-hv,=d-u d-`v,h-t Ph!|^_`-t Ph:!fY[T-t Ph%PXZ\-t Ph~$:_XhP-h$uw1 @u15P-hL-hc"uW1 @u1ۉL-hH-h ="u71 @u H- -4-8-4-tj,S"?ZYt@-4-؍e[^_]USPh"h,tmShڇ"h,dmjdU=-th-htjDc jtU ,yh,eZuj,P,=p-҃ !UjjHr|-hA" jh -Uh`-jjj Uh -jjj U E E1ɉ |-h?jqEXZjjqEYXuhg#iXZh -8YtnE sujqYXujqXZ=|-uXE M9Hh,cZtU < tU EE9sE @E ,xˡ,P,UE Mtt @8u1]UWVSu--FVtI)~@"t8u\Q ^@P u f^?봈@-[^_]UEP^v-^?<tP@-- ---]UVSEPh " hXZ@t,;t[Ct =-uGw,PPh"gsC <Ƀ*PZVQPh"g 렍e[^]UVS,u]S5-LVS'VS'EԀ€Uԃ=@-t̃Ef=Ly,tMẼeewfEf=x,t %‰USj5-ge[^]UVSuU ]=p-tSRV y@19t - @ z8u h%"E$e[^]Ae[^]UVSPw,EÉ-@t,t68u-Fu#EPPhg#IfSV1%tك 8]tjEP5- Íe[^]UVS!S 9X<uY8C L{ t VWlZYtAEPuWoN YV C Zu h"Xc9s ts tC Ke[^_]UVSáT-H!vd3V:hYT-T-Swt^'`,H`,x&X,PX, T-PT-"~;p,}hX,j eXZf{ u<@T-`,H`,y;p,|X,PX,!hX,j!Pe^X3hg#_Y[{Vh"_T-C ^ZtaP;T-s Vh"_>Vh"u_T-C Y[t'PPfT-$hg#B_ =T-"~1T-hA"8Ze[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>$"t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hx$Sj^_ug@w,; CteE0ƅUB@tUQM]Y9MU~ S"QRhׁ$h,XÃg"h,j oXZe[^_]UPPPh"h,Xw-t@th-Xj7OuUh"h%hqh"^ .UWVSSt Éֺl%"hҌ"h%hh"^u :u!USPaZYUu=-e[^_]VShߌ"k`jNUEuhΑ"h%hh"^@0hݑ"k1UEuhΑ"h%hh"]@0h "\k1UEuhΑ"hԟ%hh"]@0h0"&k1UMuh"h\%jTh"]11f3A@=uUVSEu ]uhΑ"hP%j`uh"hP%jah"1]t0ffPhĒ"SfPh"Sfe[^]Åt$1ɀ8u"UJRPRP 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4%^ZYt4G (uh "yih|$hf#h,{U %E24ݠ%h"h,OUC uh,j Rl_X<sR@8t54V%@WY$WV@VEP辒MU1e#sj@HEP}L susuh1"QuhG"QuhT"Quh_"Quhj"QU$19Ť%t@ uRh" 4Š%hv"uQ[^}tEPh"_QZYh0)uuh"gX,01e[^_]UWVS]uhΑ"h%h{uh"h%hhړ"Y11{ uh"h%hWVhPs u s h2"=ts h?"%gZY1=߶xt uh"fXʍuu-WVhPsD us hX"노"=thPs he"f^e[^_]UWVSSljUQ4 ^t#u uSuWÃu V= ZHW<u uSVW9uSuV u V< XV< b벉؍e[^_]UWVS@]uhΑ"h%h8C@uh"h%h9hړ"X{ uh"h%h:߃uh"h%h;ŋuhє"h%h<뤋1ɿ 9lj}Ph"99|CƁ t!Ph#"d 1jjh V= tS h fUtts h"M_X1jjP9u 9t-uRh2" PRhQ" tu@ku h"Mu h"m󥍵ѶxԶx9t PRh "`3"=` Dže[^_]UiPh"h,LjBUWVS`֍dx1j`Stjjj1uh%Sh9iPA @u hf"jUV Xe[^_]UWVS։ˍ1ffDžf/[^_]USfx uX1I9~+|uD BPX19}|uD AShs"&HXZ]UWVS`Ӎdx1j`Vtjjju h%j8Vh:iPw@ 1@uCPhz"FXZWe[^_]UWSÍ1Dž7h"FGh"6Gh֘"&Gh"G h"Gh7"FhU"Fhu"F h"FYFt VhY$?XZuh"fvCfH"fw  %PPPRh"8?j O>Xy,f\~R1fDžfvhg#>[_FH$ %-fufvfthќ"h؜"i>YXKCS P-19}k<Dyt+@h">_09uj (=[h"=Y1C9}Ë8Ph2("=GXZދQhs"=XZ뛍e[^_]UWVSf,fu. #h"Rt=I[_~tu,fp=.tTjjRà xTxPS"ZY@u SDX9E%=tIS,6h_"S !jjR1à y6hg#r^X.m.y h #=f,f=.u8=.t.=.u...5.5.SLƒ 1Rpȉt.PW ymh!jqxPW ZYjE=\.RRt .YtaRhv"JRXZ2tp)Z4t5.hg#.ZY,ft9tS}X>e[^_]Ë `,Q`,y ;p,|< tX,J X,UhX,Py@ZYUPPhס"h,=jO4.W|$wUWSˉ1҉.M]m 2%h}fU fUm]mURp pSQh},0h"h,=$e[_]g_UWVS]E }܍p(}p4EPSY^tSh֤"趺XZe[^_]UWVSPu} FM% FVFt5RPWà tFM1ۃ8t/h},h"N[XRPh},à tŁftvWZYt#/vh},ZYu}u2}u$h},h"ԹY[}te=.u\VlU[L1҉UtRW(ZY@uT?L8-tRh},ZY@u"~lth},h"f[XuVh},VZYt؍e[^_]UWVS.dt2h},0h},Eppd h},!jjEp` @Euphg#ø_X-xP=.t . .t 5.t2} F=.u:xPh},߹[^@} 1ۃ=.h},h"h,I:,H, yh,2Y,P,0 t+@t( ,y h,1Z,P,Ѓ߃Yt`F_(,h},h#蝷` DždWxPh},Y[^@t1E%=tEjhGPhh},à uA 5.uh},hg#kh},GPhh},ÃtNjOGXW\X\t;X\E@hDžl},X\ptX \TX9и\T<0XPjj`jjPjTjwXP X1ɉX\vRLP)TPS L9th},hg#莵XZDžd:)։1X\=.tX\hoPT?Y^Ephg#XZ=.Džd1X\t~hh .`@ƃ ~KVh .S 9th},뎉X\=.tX\htP`XX=.u`XM=.t#S`Y^th},h",XZ`^du S[z.dtSWLZYd=.um} tgG t^.9GuTxPSY^th},hg#蟳XZDžd$E9Gu.#G%PSY^uSZth},hg#S[^Džd=.tWh},9ZYde[^_]UVS]hVsC u sh8"'Ƅ} t'h},{Zth},hE"軲[^.h},VZYtVhP"١.t jsPZYe[^]US]} th},{Zt h},hE"sh},rZYth},h\"3ZY.t1E ]]i]US]} th},{Zt h},hE"$s$s sh},th},hg"躱ZY.t1E ]]]UPPhq"h,3jF*UPPh"h,o3j&*UWVS|Ӊ΃=,/u\=0/tR|Y_u%=@u"C|hg#ްXZt#h|V* =vQZVS Y_u%=@t=8/u^VSe_ZuQ%=@u?V ^uB?XPShȊ$hS6.=΃=,/=$/|8/uVPܰZYti|h"UhSW)W t=|PhȊ$hW-VW膰t|hʦ"腯_XVSZY=,/S|:^_uS|h֦"BE j/|ZY|tpj/SY_xt@xxV!:_Zt=@/|)~=@/ix)؉t=9|u fDž.Nj|ƄPRPZYkx9Íu fDž.׉ދt󤋅tƄxPR^_|9;x9 ;p=4/hX, Sh"h,/,H,yFh,z'_H=@/=4/uS|ZY=4/u,P,0t- t( ,y h,'Y,P,΃߃Yth,h "軹=</t%=@uSSuZu4=,/C1=0/ PSj|jtS=(/u1#| /PSh"+޸e[^_]UE TET]\7UE MQTU TE]A7UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]6[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]L6[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]5[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]E5[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]4[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]>4[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]3Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]3Z[^_]USU EAHtRSHtG t uF u:] M[]9t=/uyDutJt] M[]%/1 []UWVS(U/ / d/01d@DHLP4TX\x|hlEE8pY[t΋F=/tvhO %j ]SE#jP1@XZtp,Y`9@}@S+Z9H}H/t6,h"vl dP+ 9L,}L`։,D0P Xu jjWF pP:`D FSP:=/t',DFdPj:d  wPPEEPEȋDẼ08jj h6" SQj]SG@u h"jSh˧"XZ=5/FډWVRP"=/t"RPQ e[^_]Ë `,Q`,y ;p,| tX,J X,UhX,PXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpP/tvv Rhݧ"Ã=d/=/tBjj h6"v\vXjURȠ@Uu h"jRWh#à L /AF`VdEUQRuuݧ"=/tէ"RPWQ5Ã|/ x/Et*=/tU]Ã=X/u=T/tF%=@u FaÉ؍e[^_]W|$wUWVSEUEPLEZuE"EC u=l/tECu}EUE؉U܋=/} /ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]j\//X=H/uEԃ}Eԋ@ ẼM AqP=/tvv s hݧ"&=d/F`VdẺUЃ=/tBjj h6" RPj}W@u h"jIWsh# K /AEUЉMMuuRP{ݧ"=/tէ"RPWQwEPvEԋxvs$EPh"N=/u7s,h"3 wsh"  =/twsh;" F%= u9N % 1RPs4%1RPs0h "dVXN\=/t3jj h6"QRj}W踜@Ws(h#| "{(ݧ"=/tէ"QRWPX=/tF(V,=`/tF@VDF4V8[|/ x/Et"=/tMUF=X/u=T/t@uZF%=uE@ Eԋ@ǃ ~ W5/@ 9 뗋,, Sh"0j@$,/x/Ht u hѬ"jh"jܛXZe[^]Ã=/<=(,/UWV,wh9"j薛XZ=//u6~OfEEEPhm50,J y/~uz1=/]xl15/5/~SuOjjj50,xFjWVRP)WV50,x(,"1ɉ /=(, hh"h"j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (,/jjj50,QƉ׃xtEU =/u/] /9É}EjRP50, y%q h̭"0jК(, )}W =/t1e[^_]ÍL$qUWVQ1y(,I/u9h"9jjj50,Sy( h+"0j (,)y11҃=,,~hX"ZjRP50,Z h}"~B/19}oMQRPWVU Uth"j茘XZjfEEEPhm50,c yuVh"0jC'(,1eY^_]aUWVSX,=,t,P v+5/= /X u1=x/=,Oh"WV5B/5B/6RPVhî"hWi5B/5B/hڮ"hVG0WVh"hV,}}t^=/tU5\"+hC"StYZuhZ"S1Z= uh{"ǏYoSZxL/tP YS/Zu%/(,h"j/ Sh"e[^]U5,]Ytu|Z@UWVSQԄ,BxkL,9~-x=1@/1PRYZ~9$9|1muhϲ"j;XZ/xu=,th"j[_@/1ۿ뒉UkLSh@/,ZYUyBԄ,y#kԄ,L,x/Sh@/yY[1Mu=,dh"j葎XZKySh@/h@/)؍@/ `e[^_]UWVS 1ɉMx/pFE1۸@/RUPYZU9t\tuuh"jXZxt 1묃=,uhE"hh"jč[_h@/h/x/P$XYҡx/xtt*IURSh@/P8 u sHuى5=,u h"Mh"jJY[uh@/h@/衚E@/ xtUh/Py밉؋]UB/D/=,u>B/t5=~~ h~Ph)"thPhW"jy@5/Zx%B/B/B/B/1B/B/1 yB/D/T,~B/~UWVS/t h"jfB/=B/T,uB/ yIB/+B/EU EUT,EEuuuuDu})׋E9ƉM}u}WVMZY+u}B/ T,19}dB/ B/B/;B/s5B/PY_B/+B/RP_ZxhB/Ɖ5B/T,B/ B/B/T,B/EU)B/B/1ɉ B/ B/z,h"jwXZ؍e[^_]Ã=P,US=,uh"jvXZyx1ۉB/B/15T,5B/ZY~%B/B/‰B/B/B/1+P,~C9}Ph"jTv yu뙋]ÃUWVuM B/)ȣB/^_]UWVS$]CDž$$ x$|$x $=@/u15xPu Ϸ^_y狳Vh:"0jmvPu蚷ZYud%hC"0j(vۉ15T,5B/u Mƒ B/9|Ru -WQQRu<9uUy%Vhk"0j@u79|$u9x$t h"jtZPu 2ZYyrVh"0jtNjE49}u;0thɷ"뗋9}3t)1;x$|$}Ru ye[^_]Ã=B/t1US5T,5B/ZY~'B/B/‰B/B/B/=u.=x/uB/1$x1B/B//]ÍL$qUWVSQ Q1ɉMM u15B/=B/)9}Ή5B/)ډ tƋB/]؉}܍MQWSRPayƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}B/B/19<B/+B/щ9|gx t%u؉}9}M؉]܋EB/+u}뢸eY[^_]aUWVSU Ӆ~HB/+B/U U  )څ$ 9~؋5B/}5B/)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu Y[u]%8dhC"0jqۉtE1҉P`1h9Ɖl  B/+ B/ } ^ș9hl}hdSpPtPQ5B/u O]hlS} yE] Cpt1;x$|$5B/=/0\t`A9\u\B/)hl} xdptZ;x$|$}L pN;x$|$ap#ƄWVZYp` `D$@$WV:WVsVh"V PsZYVh"j_ U+lt lt)w$V#pZYxDžl=(/tVh!"RjD`뒉l<$8$VO lxDžl0= /u =$/tCi<$8$Vy =$/t#($tA$u($(($$u ($.($($tbYX$5/h"pYZjVYZxPV=YZy+thB"0j_WV@1$H%# PVXZ=$/u ($j$/ , ,t[j $P3VA=,u =,t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSuLu hZ"E18}t}t://E/6SVu譽 9u hx"i//E/ҍCtPR褣 XY Ph Yuhj"j%\XZ>CPVЉUP輳EU 0j\̍<+E e[^_]UVSu] }u1NjjjVұy 7Sh"jh/Vk yShx"0jt\e[^]UVS]u x@PmX=\/t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu l ~ pt1@9uNjt9|$up9x$th"jsZ xPu 蔜ZYySh:"OT$9X$u;t h"jjju $y$Shݻ"0jZp1$1e[^_]US/tPT1ۉ//X/um1 ,yh,iYu9,P,9Є,uu%1S / t뭅u tډӡ/A/u/ @/tϋ/zyP1ZO밣/j5/h/P/ &1]U=D//=H/t/=8/t /@=/u'h 谚 /Yuh"jjXXZ1x\/t9UVSut>uh&"j T XuhA"jXY[FV߼ZH~ 8/u3E ؉C1C=/u//X/1e[^]á/t@=`/t /=@/u4=p/t+UE$u/tjP5/X US=\/t8/1t6{u+uhh"j(WXZ3h"h,  [Ƌ]UWVS]=/u =/u$15/yx5/R/YtHHQf $ܤ%=\/tȋ@PURURpp p0;9xjjuuuu/pph"j6Vph"hϼ"p jW Rph"p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=\/L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPe y$/p'Vh"0jUƄ  ǃ$h /pCPh /rP5/h"- t1/@8e[^_]W|$wUWVS<ÉUMMQEPu}j1 9ƉЍM}Qh"Qh#"j@Sr\ue[^_]g_UWVS\]uCE=T/uPh"VP ue[^_]}W($rT$X$E(j8$Ej<$Uu6"u6"PjRj4$Wh/"Vβ$ w'@$  R%PhA"|$x$hL"VuEPh`$Vj$Pw ShS"u Sh!V4 Vj ?ZYVXe[^_]UWVST]}T$X$uV($pSWVh["aQe[^_]UWVS]u fVfuP茓Zt%t0SRjP}W7VW><Cۉu ]e[^_]&<e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=P/!u%UP/hd"jMXZ1ø1UWVSSu] E}MM1҉l6=/u0K //9-u B/ p,=/u" /Q/u //1Ҁ=/t7tMM}E] ue[^_]`E] ue[^_]UWPq~ZYtU:u W3h"(x:u9p,9}l6@p,W3h"h,賬?e[^_]1UE E EE]锵W|$wUWVSjEPSШƉ׃EU E9Es 11M9ttuj,V|ZY…tUj=Vp|Y_DžUuh "Uj  ZUuh"jJS舕 ju/ /B/1/Boe[^_]UWVSQÍEPS^_u C #ƋE| t@E]S膌 Zu/1 KDe[^_]Uh,h#"4jˠ,t 9tU,Uh,h"4h,hW"4h,h."}4h,h("n4 jeUWVSPuh$SZYh$S5_ZÊEhViYXuVh"0jOJ }t/1e[^_]UWVSlj/E 0^_/t@E /h"P]Y[d/"//111҉U11Ejh`,h8"u uKzX$ %l6B/5l6h "d B/렸1P,덡l68-uxu1/Ej/[D/Q/""Bh/38/$1,=,u(">|1 //=/u  /$/,c`/T5l6=Y1T/ol/` ,G/$8 /l6/#H/EH9~2MxPV XZMuh"jFjWEƋl6/PM/#1/P/GEt/>}15/jP$Y[yRFEMh"SGZY;GCjP[^u}uh"P[Z_uh"S٪Y^,uS(…u_h"S趪ZYtV*^=/tSh"zFtjP8ZYy*h+A"SšXZuSBh"RUTZYt8jh"UR~ UujjRZYMpjP؃jSu1ɉ P,}J/t 88h"/Zt 8/! /!11jh`,h"u u{z$ %1Є,ă뿃l6B/5l6h "t/p/xl6/fl/ T/""Eh/@3d/΀`/ l6l6h,h"(5,h$h, 5,,h$h,Нh,h$~(/$0P/l6ÉѣB/B/19| 5l6h7"%thhN"jV=XL/l6Sh#"+ZYuP, SP,Yyht"j5l6Z\@DH//D/Ph"j<jA/1ۉD/5l6Y5l6*ZtjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh"j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 5/h"6[_Vh'"6hW"|6hy"r6h W6hC"WӟZYuh"W萛[= u h"&6Y덊uh"6ZX<.uuh"5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDh?"j3|tHL@t<uDhb"h,j WDhx"h,Ot@th WD0 1e[^_]UWVS]t K΄u h"4<\u FFu8uju Xuh"j2^_DžoGjQP諣 t2hVP蚄SVh"jd2 W} [띍V֊t\uF8t)FW| Sh"j2YR9Zu%貛W| h"j1$N1GtYuh8"j@s XuhM"j0[^C31CVĕZC 1ɉKECE C=/u//X/1e[^]US/1t6Cu+uhz"j0XZ3h"h,j [Ƌ]UWVSu/t$tS=`/u S1u=p/uSu$t9ut/}FP7Yuh"j/C_Zt/1srCt/1ɉK;W蕔ZC Hǀ?/uC C$c‹@t 9uBSS4z 1ɉ$[:h"ja/XZe[^_]UVSu1ɉ$/u,=`/u1=t/{C |/t[t0CuPFP3D KVPZuɡt/u '$tVZYx 1$e[^]UWVS]=x,tjs{.u{.u Ct:u h"j/Vg[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh"j& TE@jh Xuh "j&Y[0t;u GM1GtAt0yVhT"&O}thE8t`W yuhp"j%Wp bGƒWt+G 9OG}Vuh"j%WUp 1G=/u=//x=/1 h"e[^_]UWVSM=/tPÉֹ=1:t9pt@9u9U}tj:g ZUuh"j$[^1p1ɉH xe[^_]Ã=/u1Ujh k /YZt1h"j$XZ1UWVS}/$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj.f YtGGP+Zt0 $$$CSEC ECECEC1vSjn Yh0"j#XZ\Uh 3 P7{ 1$$CHCUwC3n Sn [^e[^_]UWVSM/4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3[m X]e[^_]Km e[^_]UWVSS=/t51ۋ4t#1ɉ v0Em EP m XZuC u͍e[^_]Ã=/UWVjhGuh /_ZuhN"j"Y^Cy"=/5/,Z@u"5/^Vh"0j"5/X1e^_]1Ã=/u1Ujhg /YZt1h"jp!XZ1Ã=/u1Ujh=g /YZt1h"j3!XZ1UE$$ $]UWVS(}=/$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAjb X11q $$$AQ C AK 1St$//// u+//M!u!9u^9uZtL/5/ t:Ujna Zt+UM܉HUPp K HC $$$3GPh"jhJ"j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=/u1Ujh=d /YZt1h"jXZ1Ã=/tDUVS1/0tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ /=1Et#؋M9Hu9p u M9Hu9xt@$uj(_ X҉UtMux%UЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!Rh XE "Ee[^_];e[^_]UWVSEEE EM}/tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3]g SWg XZ1e[^_]1UWVS]}E= /t";/tPS^ZuSh"j$r^ YuSh"j. hS$ZuSh"j ue[^_]f GFG4W8F VG(W,FVGlFF /F5/e[^_]US/tvC/=$/u{ t s3hXZ, ,tjjssss 3輲=|,t s3YX3e Se /XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=/FhGSPl <9tjww 5,p;Wu;G t ߊh2"*SR5,+{ 9؍t賊hJ"0j SRL yT$X$G9__W1j[ Xjjj5,oG WxNS5,z 9u)T$X$GW/W8hb" ؉h"0j7 Wc Xh"j#ZYe[^_]UWVSQ/uh"jXZohu u Eޅt6u΁Y_tcvj Z ^t;u~ ƉYt#um GZt _E81QV.c XW'c _h "ja[^0^SuYZYtSb u F_Zuh"e[^_]UWVSu} /t=h7V t&3VZYuusVo [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=P-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh2"h SqSyEVh:"h SqSy=VhE"h SqSyVhS"h SoqSce[^_]USSˋ t%RQP mE3 ` 1U1ɉ EeveRu Pl ]URPh^"jUjhoø1҃=/t1UME1҉/1Ҁ<u=Bu} u,J=/t/1҃8]UVS]} ~;uqjh"P| u%=,u ,h"j0ZY1,jjPƺ 9؍e[^]UVSiÅ3h"V|ZY[uh2"S|ZYt)SVh"jh2"h"h"j ,vSVh%"jt/o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVh// x Rh// U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$P%=/t_hK"j ht"h"h"Ń d~ Ph"뮋p3Sc~Rh"땹1jdRPg1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEP]gjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 th"$%$1$P/ L/t5t/=x/ T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh."e[^_]11UWVS}} ?jh"Vu ÅulhS"V/vY^¡/ / u/h["j XZjjPƺ 9tPVh"j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPWdz/@E K<vM E)Sh//} Rh// } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)P(yjjCtP͹<$ ƃ(8$P PZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2 ډe[^]wUWVSu>-u~t2h+A"Vja_Xu$q0]S PVh\"j[,1EPSAZYt/G}vEVWho"jEUt,u1 SWXe[^_]á/t UU RuPV5/(:UVS]u F5/tRPSt tD3j S1ZYu1e[^]US]}t /Y[|x^9|u,;u(^9u;F u%=tnl/芵 ZjjjQ  ׉NX^\19ȉ}{ 9}Dž 1P=  9y+{  ZCjjjP ' NX^\19ȉ}{ 9}Dž 1Pl  9+{  Zrjjj$P VNX^\19ȉ}{ 9}Dž 1P  9+{* ? ZjjjUO NX^\19ȉ 9}Dž 1W  9PPW +^>S _jjjiN ~\vX19}p1҉ u݉19} 1QP 9u#) [@H/hg#oXZ Ye[^_]UE @E E@E]_`UVSutYSC t } uC/@/RA sA SA /H/ u/te[^]UVSu/@/ /؃8t VPjZY/u /u/t e[^]e[^]UVS /1؋tJ9tFjPZY/uԉe[^]UWVS/@/ƍP Y11ɋ /tx?tBA'u9t h" /u/th jVSR19}Vph"p,HQP yP%,H Z J GSXe[^_]UMtA'1 /]UWVSu^Nj7t#vu^Y[Åu jWXZ ׻؍e[^_]USh[C"eZtaujY1"4/tP{ Ã/X؋]UWVSP}U UWRW"ơ/@/$WC1҉S UR C/H/u/t e[^_]Ge[^_]UVSuV[t#sV]ZYu} tC t1ى؍e[^]Uju ZYt@UWVSj8Y1/8u&S;u0h"5,XZ/P/uj=CP$Y_uyjS5_ZDžuSh"5,J Sh"QwK,xWP yP,H YlJ ]@PS3XZKe[^_]UWVS5/P-DCtWjEPVN//] B%:MAEIB%uV)PRh"B%tK//CB%u)BUP/NjU/Xu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^/e[^_]U5/PhS"UWVSQ5///PwÉ5/^=F,t s"uKt;u[%L`1҉jEPSLƉ3` 8uE8t+`8t"`B% tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$%" u "!AuEU Ѹ"t݃} uWVuu WVuuo&MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=/%us Љ UUEU=/&t "wE//S1 VVڋExYtEUe[^_]UWVS(Ɖӡ//EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh!j]S9HjSuk e[^_]US7=/)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HI//SuЉE뭃$9 "tFكPE4EȉU̸"=/#4EEЍpًt(SEȉŨwhf/SEȉUYEȉŨw>/t[5/>t'/H/FxFC7XVԀ~/u#/KhC"V`LZYu$,9r :ƅuh/K;/u>the$V&LZYt /x/4X/ 负XV>t/H/FxފFC9,u /x/C tX/=/u`//@//tP3- X//5, /j5/hK"sj5/hN"a/H/u /u@e[^]UWVS} ]/@/u%Yy /u/tuj;ơ/H/Zu/tut hR" Y4u1-=,u =V,t5/h"XZuÍe[^_]UWVSΆ,hƅdh|"谳Yt ^t>h##WEZYEthL"WEZYEuEE1}}FHπ\ut}tnxP0tB<wV$%NE1>: 6 2 . * &щǍ@0w\9Eu},HyP,H X JF>/,HyPh,H X J }u-,HyP-,H [ J 5,,fBYtfBhB"j(1e[^_]UWVS]u },t,9tx u h,dX//u%Ph!hЇ, /t/Ph!hЇ, t&WVhЇ, x0h $hЇ,ZYxS, Phg#hЇ,,HyP,H X J EЇ,e[^_]e[^_]U/udU/jPYUU 1//@/tuRj u/t /U1/EEEEjEPj =x/t=,tjQjj>j@ U=H/u H/E Puj:UEPu u(UEH/jUS]ISu 0uUIuu 0uUEPu juUuu j}uUS] 6ISu0^ ]UIu u0A UE Puj+ Uu uj UM`%ft9uPU t@Qh %j h/_/á /UWVSPCYuOƋjjPǃ t 37;ZC jjPǃ t s{Xe[^_]USh6"Y/8tN,,蚠/thB sXZ/XjjSP5/$j1]W|$wUWVS ƉӃ=4/uj'k<4/X 4/1ƉU1}m 2%M1EmPP$h"jS2;6u{0ujh#SH.F Se;ZÀ{0u K{.te[^_]g_1,//(/$/US]tvUUt[F~#CtVj RPXjEpSD:~5j Rs jXE@C us YCX C @C[놋]Ã=8/USQjj]Sjjh$,$ @tBEP 8/Zt,jjSPjh$,$ @t8/PATH@=58/ 8/,X8/]á8/US ]t6;u1Ct*p˫Zt/PjEPCp(]UWVS }W1t@/B/PWKsE_XZsnEX;t.Ey"xVYE0& Ph"1Psux ua /u/t[~5jVXZ}xuju} jssYX}yjs_XZxVH^uu<Yu u}Z uqX1/ /u/te[^_]UWVS}u ,tu u1/1E܍]SXZ$P%uwYX=,m=,/%jw~XZ=,K/ ,/4jwNYX=,=,/=/=@/tVW VW=Sz =@/tVW=@/tzjwXZ=,=,/u=/uSZU ?1=/)=@/tuW =@/tuWS趌 =@/tuWfك=@/twww,1ɉ /jwXZ1=//jwY_=/tr/f=@/tKW,SXZTjVW S6Rh"h,"SȋS轋Y S贋f1S XD/ta=ކ,t/t tPtj=e[^_]UWVSE ǃE܍uV 5/ju_1j4Y=,tKt>=,u5tUYUt E܃PuRcXZ=,/u V؊X_V-Zu1/tje[^_]UWVSWE} _,,//HO;t(/sx& P ωʋ7/tx BMP M҅xJ ċH+ ,Qو^ /PS}ZY1//e[^_]UVS](/1js&XZ=,=,/tT,/u0/H0/x1,/뼃u 0/Q0/ 1ɉ ,/MwE5/=/; ut-t)E Ps5/XZ=,/Ro (/5/e[^]UWVSu=/=,u1EP薈E؉E܋^Yt$hPS#P =,/b[E؋E1҉(/]؅6F/=,P/PۧP h "v ,xWPyP,H =_ J=s,xWPYyP,H X J 5,_jsv E Pv =/=,uJ,/t:u0/H0/-1ɉ ,/Hu 0/H0/1҉,/ (/=/EP蝇Xe[^_]UWVS]uVE؉E܋S /jPspN[=,/{tuG/EpWSZYtV1=,/uZ=,uQSC ; t/u P /[_.[/u P/ZYu뇋[g1/V蹆Xe[^_]UWVS]} 31EsZ=,{5//PwPh"Stj RU5,UR h"Xu h"rX,HyP3,H X J 5,X/@/ujShuSPEv~trtu;huu /u/t3jsoWsj/H/u~/tunUu;Rh1ɉ //H/[/e[^_]Rs//H/Zu/t tJ=,tA{t;5//P跣Ph",Ee[^_]je[^_]USD/EE1EEpX=,tlExtc5//P;ZYEP{$"o[EXtj S5, [h"D[5,XjEPaZYtlE//jXEuKt&:EP$"X5,oXԋEt/j5/?/@/Eģ/j EpCXZ1ɉM /t5u Ep-Y[/@/E/jnX /t/t뻡/tEt"EP($$"X5,Z]UWVS}] 1CCC =,EP΁/@/E^y h,"xjWmejWPzu31ɉ //tujujWuE؉s /H/Zu/tEPāXe[^_]UWVSE 1 /8/|/1@/EPȀX1 /E@/PTEXt8s蹜^u&C/hPPSH [u[ċT1ɉEp :[X\EXtC/sMZu\18PjXPSG [븅tB닅P~^PtJH 䋅1ۉ4=,t"=$/u~@4)Љ=,u&fDžhDžp) 5//PĞ_ZPYXuvP1sX,Hy`PX,H =~=WXtN,Hy8Pi^,H {j=W ZYƅu뽋J=뫋J ӋP t:,HyP X,H J s5_뽋EX ,tRSPC t [HyP^,H J 5,?[aXsjh%V+ u 8ԁp)  @@1H))t~8t38@QRhR0fhMfhtM^Z:-rz-uzuXpu CSu1Džp. @t fDžh=@/u Ext2Jhftfwp=X t= tŋh@ft5/@/ju_ZYE@ t4 tDž`y h,"=,fhExt x DžtDžxDž|EP/(1=P/EPtPj /Ãt tO015/jEPj /tSp $h="/tjEP܉Y[t./u/jH/u/PX'/ E/h!XXZ /]SQRuP_5/1=/jEPj /(P/ujjS{ SRuPGr`RuPs ?  1ɉ //t u  A/t!`$dXZ1//t|ȋhft+f9p ! t DPEp W[^}/f/H//1=//@/P/(/L1P/pHPX /u/tjEPKZY=/u EPXh/߈X/u󥋅DuQHPNX(P//|/L/ /jPjX륋/ U/pt+lfjtB/|//h Xi^_$/@$/=~ hO" pZ$PXZ $//@/pMY(P//|/L/h/|[/u󥋅 /Du /t ja_/t=,/u15,/50/ >:-uJt-tuzu8t Dž1ۉ Dž u+1ɉ ,ȇ,,ć,@Dž0/$AK,/ 1"8t4v"8t*l"8 uxPW虐ZY@t I"WKlX뀃 h u tCƒv~ H/PSP6hpE"jUWVSuU F^fftfftdN/$U jS$PJPxk IU yхtvh"XZWkXtkh"WXtZh"F_MtIh"5Shg#/@/vP$P@c/H/tShg#iY[?/tQh",Ph" PSh"~ t-,HyPy,H *Z J*,HyPL,H X J e[^_]UVSu%t"8u%uCVPpZYt؍e[^]UVSu`%t8uVP>ZYuCݍe[^]US,,1ҋ`/tHft fux@ |u[]UWVS}/@/`/t,Pfu9x fu9=,,| PT X҉΍^/t /u/t e[^_]e[^_]UWVSSu/X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPh"uZYUt>:uGFC딃=,,y t ,,u1҉MRM ,,Xe[^_]UWVS/@/`/t!f{usS" XZٍ݉w/t /u/t e[^_]^e[^_]UWVSutA%<`/`/tCVPZYtdߋ} tX/@/V$9fÉ1fCC VCP /H/ u/t=@/؍e[^_]US`%tjP)f@SPXZߋ]U/@/@/ P /H/Zu/t(UWVS] j/uO^_t[EtFxPu蔊ZYy J8t@8t6ffCf1CƋM/9tMEth"QY_tM ju_Zt>HftftfuEEu E u=,,yƀx u91ETtE,,tuDYDžDž\DžXDž`juEP` WeD/Z?/xPW"YZ2E%==D/NEWLȉ`+,$cWbjuƃfx`QWfXZF FfF CfF fCFC,,f~tF\`9\HPh"qZYtuYDž 5D/h"pYZ`9\~88k8]XKWuh"s/@/dTujuY_f~udfF`FDžX t@Et$jXPuh"%5,of`/@/dTujuXZf~udfF~ /./!1 e[^_]UWVS$EE111E11EEh2""zEZtPEbw$Ȭ%1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEE/81`/tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5,^,@h<""[EjWZYt[@ft:,fuu>/P/8ufHu*}"fu}}t˃=,,x t/PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZd]uEԉERuIEe[^_]UVSu /@/ju!Ë@ZYft&fHu sXfCFC fFC FC /u/t e[^](e[^]US ]/@/fEEE,fEu ZEEPSL/H/ u/t ]]UjuTZYtfxup)X1UWVS 1ɉM11uh"vZt(ptvtVuEEлɋE 8ctu ދM Mt4Ph"t}t5h"r/:t/1E /:6"/:h"RPh"'m%jjV^XZu}jV)XZGfEGEEfGfj/VZYEEԡ/}t2EjVEPGEPt]My`uh"XZ/P/0Ih"Ij w h"*wh"/ 8,HP,H /P/0YV_8uVP ZYmIwh "wh"J /P/0/PjEPV1MfHf6"tv"Ph"Y^jV_Zuu hO#aYV`0~ PhL";/P/0 u%h"uh/" uhD"Vh"/P/0_Xt!/P/0E.ha".YEE~uh"넋Ee[^_]UWVSEP[/+,PZ,XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=V,t"E u /xB p\P}눃=/uX\/,8uu@hX"XtVZ^E %E1bP YuVZZP] X VZXu‹E|}u5F< v@ //y[P/Csu2% <w //y[P/8t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mhn"VZYEąM9EЀxupx9uB%EEE9s2>uF9utsEB%tdU9UvsԋUE͈@ĉƃEM9MUPY YPEPt EXZt\uuЀ>-utF<]tm/uu}NtFuc=/Uqxvtu@r t@١/;}u5/S[rxRP\pZYyZ9tt1t9s'@ZxvttE]S@ϡ/;EtP9Uu8/t}G e$$P賝XE9/t@/Džp>t F1ptJxw@tu@o/tSϒYpu{F/uSoZt߀x .u o.uǍx jWt tptWu5/ 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu/skY@uP/DVY/u+,,+,EEt;t}1ɻN)ЉE=F,8<@.<*&}tE<VE)HPhq"f1ۅI~@/H/Cx/P/S։MPBP/SM뻍G1҅~օ)xu u܋E%PV1ɀ} k/+,ыE))// /@} uSZ}EtsŠ% <w2 /x/H /UfAH /U /x/H /U7AH /UԈC뇻11EԀƒ v! /xM/H /CuJ /x/H /ĈU@H /U뫈U@H /U뫻1111ɋE%Et>@u=/uM @1 1E @€}E$P%U5/Q8/^_Uzu LuЉU E PuY[ExU^1 //y?P/5/+5,uuuuVuu%/+,ʉ/)@/uZ0uuuVuƒeuXE)/ Rh"}O#uOQVHPRh"#u EEEPVE)HPRh"襨Qu9u1ۅu"uԡ/+,Pu 1Ҁ}t`]uu E]Etq|wt / /׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tE,@/u D/E/+,E܀;~uE t u SXZE 1Es‰E<}<@~< T$%<:<= {s{u{y{@u{=uy1=/}} t //y<P/e s //y<P// //y<P/ s=/t(/+,M9~xu/H/ uE uE 1* //y@<P/҃}u C< w //y<P/S /x/H /U;H /U ts/E#E PVu R/pd//!V[N /x/H /UV;H /UۈEE t5Uuu߯ZYUtU/+,jPHP UE {~=u}1Eu V[X< u/ /x/H /U:H /UۈEE euu/ZYP/+,jPHP 3މe[^_]UWVSEu ]=&,t1҉/P /,/,/1ɉ / /P/Sp_Xu&/=/u9// //y9P//+,P6//XtAh/W/1҉//Y_ÀtS5/S+5/@_WjW6x//Y[&/1҉/tNFe[^_]Ujju5,z@E5UWVS$EPEߋ5/+5,hREС/H/ZYx/8P/=,VW]Se6/+,Pq55/W֓EԉUS6,/)Љ/// -8/uuh!j5/s/׉Gu}"tj)PV8 /)O/)=/EЍe[^_]UWVS]u =/1}DPS]XZ/=/uc7//=/}=,}t }tA輱;tWh"hЇ,zj%Et"PV)KSh"ϠjWVX+/=/)/e[^_]UWVS]u=/Cv4E%PuuXZ/=/u{6//=/ ,}M  t?9s@UVWQM} MUt <CÍY9s1:UVWQM6 MUS9st{u8u@@9r9sS륍Y9rVSQM SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+//)/I9tKCCG+///x C/4P/ //e[^_]UVSu]S2F /,/,/1/jvW/H/ x/T4P//+,P^1ju PES2Ee[^]UWVSuFPh"s,xWP[_yP—,H Y J19}E 4ZCWhH",xWP_YyPd,H [BJE 4N,xWPYyP,H XC9| J1e[^_]Uh "ݜUh "МUUM 0,t 9PuH]Ë /1-0,B t xt 1z1/ x/UWVS}u ]/@/0,z tj(/0,J B ZB$B x/P/P|/P XtK =x/5/ /u/t e[^_]ke[^_]UWVSQ50,^ /@/{t-WRUZtUD< t< u ,Hg Cx/C/C |/F $9tSz X /u/t e[^_]̚e[^_]UVS0,H /tBu y8 /xxh,蝔hЇ,蓔XZ0,=|/Xx/hS0,pY qu/|/jv8tġ0,xua8#ujjjЅ xtPjj踅 xh."bXu|/0,1p 0,Px/x/1ۉXъt< Y|/t,1ɉ |/ /hK"ș)щ /H|/! H|/)H/3=,t5x/譔5,1XZx/Px/~e[^] /xx/Px/U=~u! /xx/Px/]]U0,/P |/Px/P4,Pj8+0,@1҉P P$P0,YUVSu] /@/h\ VwjjVtt0,@~PwY0,s{uh3+CZ1/|/4, /u/t e[^]馗e[^]UWVSĀu/@/jVY[y Vhe"ڗÍxPSr_ZuE%=upjjjS1 u]jtWSK u"jhs"WfP uSIVhx"jjjS tS(Vh"FSu^9uS h"+u Px/H/ZYu/t蘖e[^_]UVSu]/@/} t5x/VZ/|/4, /u/t e[^]6e[^]US0,/@/CxPuXCtP菺 Y{ t0,St 0,P /P|/Px/@4,/H/Zu/t ]隕]á0,US]0,9t =@/tD@/t h"ʕ]Á=0,@/uU=0,@/u]U}u"0,@~Pt0,1҉PYUE9,uE ,]UWVSU/)i5rO9,t5/u1#,(9tC߉9} }t}tVǁ[,t?iӀu.tiրu,,XZ[^_]UVSu95/=x/2,tPsYjhi"(,[Z1@tI5,r,hTd PUs5,/y;"S,Z@uCt S Yth",X4;/t jj艪[Xjj́jjÁjj躁跁¡|/9t PjZY@uX0, hd5|/5,Y[@+0 hPh0"N¡/9t&Pj{[Z@u0ƾ hPh "5/5,薈ZY@u0藾 h5,'r,jjԀjjˀjj€5/e[^]UWVS]u+/i5rOCShX"/@/19~Qi@tǃu=uFjRZY@utP踽 Ph"ڑ9+/i5rOCSh"赑HJ΃utBƃs /u/t e[^_]e[^_]US]/@/9t P^ Z1ƃ1҉ /u/t ]镐]UWVSTÉ։Mt&uPh"SL =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=/)i5rO ,+9t# ti1;J-R@Ph"jEP^h&'"jEPI URZEUt%‹E0h"jRUURǃE@T=uh"RYXu*tQh"jRΊfhn$jR輊Tu =t̉UQݺ j URP/E@Ut$RǸ@)$D=Ph"/ U:Plj$URUXZKyS苈P Y P G~SEPXZEu EL}tzKyS=P _ P KySP|Y@P|4M}tWhV#Sm iEM0EKySÇP Z P EEE}SQX>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~Wt.[tW.XY"*Ft~uH<-tB<%t<+u:,",i/"//E1MxdtS~JH~?u(UFPQMYZMUt UQW-YZUu뗅uV}-ZtjV -//XJxRt~i90tM΅x29/~*i/t"" ""1ۃ} uVPE؍e[^_]UVSh6" 7X=/tYh%"r,HP ,H YXSn/Z8P/xj/0Y^u h5"褊=P+/i5rO@PhW" 9DiPhV#FXZՋJ ;1e[^]UWVSQ111Uh_"6ZUt$jtptguܿպλǍH~hc" /tyt h"跉UjPYXUt 1t+/i5rO@Ph"t$Ph"XZ1tiHi0i0h"軄,BHBCY_y3R X9H ,z99y9H y:؉؍e[^_]Ã=/u!UjuZYu11á/u!/ /Jxu 1øUE=,t@=x/t7uR+/i5rO@Ph"5,范UWVS=/t.5//NxtS{X1///J/B/uhViPpË//i߉_19~i9uFPb ^//iƄDŽIu/ /u$/tt /@/=N,1ɉfǃ/)؃} ~iE P]Z /u/t؍e[^_]UWVSu]=x/u1x//@/S{S`{jujou$1/}uJ=,}u-=,*SjsSjsSjs=,t u =g8Wj^X}u-W5,{ZY@uL0 hPh0"=SjjsSjbsx}t/{}uuSjzSjzu }uA߃u2au)jpjhi$o thi$he"贄t =,ye[^_]US]U M=,u1t uEM E[]2UWVS}tE1ۉEPu EPǃ u 8D/t/@//E1i/M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉]tgu tUP=x/t =,u;u uEɃ@ ;u uEuEu򡴇,R /u/tÁe[^_]UWVSjjjà ~ jjj=,tQCtN5,wc^9t7cP5,wZY@u0膭 hjPh0"裁1/95/|btPu=/u>SX5E t t&tt M ڋE:F떍e[^_]US1h"-Zt$ltptZu⻀ۻԻ͡/u t8t Phg# .cj.Y[=,u =V,u@t4j/0‰١,/P/YZxuS5,?XZ1]UWVS411Eh"4,Xt)ntput h"!5/Eƃ}t1E̅u4/E̅trH/8uEu=/tO*jjV_ uVh"jVY_t Vh"=/t}/ /=/Ix.}t ?u1҉1E؋Eԅju6EZYtxu M؉}tDE؀u8jPsZYÅt j7Vn =,)uiXE؊u CM؈`/8tu E؃]ȉ1}ܡ//1Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV范 OuA1ɉM܍EPjj @utE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅtt h_"'X6jsjs u7{t1h"Xh#jsh)%1[(hc"js u h"_hJh"js { t&u h"n^hg"cjs T u h"H[hn"h"hr",XjsZYu h"Xhz"js u h"XhCl$h "s h"jsyhy"js h"Cph"s t=jvih]"djv U; uh"h"A_vh"s)h"sF"1I"%1jQ"1L"1O" C"S9tRh"j}W6pWV^w-C yh"jVj[Sɝ Ph"qjVj[SWu uÃ؍e[^_]UWVS}t / =/dPX/u / 0/`1\\9/~jh%`Pà u\/dP_KP^؀;.8t@x/t詁@xPS)ZYy1EЉEԋ\/\u94/E} D/u"e1t:t@u=/h"Sg^_19,XaX,5D/߉S_k,xWPYyPj,H X J EЋUԋ\//\ne[^_]UWVS}uV[1ۡD/te=,u\ujJY=,j5,NjhЇ,"i,jI=,uQ1~jIZ=,u8u{=,uru=,t`=,tWh".jXC+t'=,u1҃=/‰/jPtY[1V4QZutVyXe[^_]UVSU:/@/jRsY[^y$ //e[^]mjP/H/ZYu/tm=f,u11.1=,t ,1ۀ=,t ,jjj =f,tt,t,e[^]e[^]US]/@/jSXZYxjP/H/ZYt She"_m/tljX]Uu}~E pdPeKd1Uu襈 Zu h"lUu u趍 ZYu h"lUVSuV@$VP/؍e[^]UVSEX9,}]ށ}/@/FPb,P,5,,/H/Zu/tk/@/5,,), /u/tke[^]UEuj h("j]U|,),,UE,,P,P/P /P/]US]/@/,9t,P菏 XC,C,C / /u/t ]j]UU/@/B/R~/H/Zu/tjUWVSW ,\ k/@/=,5,G9ui/ta,CPW¡,,J ,+,/,/^^t5;8u1H+pp X@MSNjM󤣐,,X /u/t e[^_]ie[^_]UE/B/,), /u/t]mi]US,,/,[]US,+/,)أ/,[]UU,),,,+U У/]UWVS,ME 11˅t MP~ZMwDGƋ܃}tE0v h3"iFPKE0u _E1t0wLG VYMVu<MM̋3XZ̋EЍe[^_]UWVSD /11EE hP"wE_t/}pt}rt}duܡ/EЋ/E뿋=/?u hV"7hjzE^tt SPcf[Ejh!!CqEZYuE̤$%EP 5,,/X1EEЉEEEÉEjMQjlR HMu6U߉Ӏ\uN}\}uKjQj>R Hu U߃ u Eu}tjPb[X9UUtRUurZYUt@Rh$%qZYt}tc }Eu[}? /_/}] /xFUpUԈ+,E1ۉ]E/u#EJ/xFpUh!!7ZYUu.J/xV }P+,RE^)u\/j5,7k 5,,/1ۉ]3=/u2/#SupZYt*Sh$%pZYtNE,9s}~}tjuh!!k j5,7 k t jh%PEP+E؍e[^_]UWVS1hV#/E[t/@/j~P~/H/ZYu/td/1rErǀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD5wFuD5xFD5EPEPEPh"_Wh"__X0 wI112NЀvSh"%ɍD=vB:u҅t Sh"cP/@/S^u /tW蟭0s PSh"cׁWPEËUR蜇 /H/ u /tb/tbӁS|Y5,\Z,@th"G^XEEe[^_]UWVS,f11}Uh"E^Ut*}St}at}HuMЃMʺË]E`%Eԃ8t@9tE Sh"b/8}Ѕuxt h!]b}uEhD"u躤ZYEЉE1E؉EEȋE@HЃ w7̋}9 ErXk] eډΉ׉u؉}뷅t uh<"IEX 1RShj=A}9Us uh)"}e؉[}uE`%11114EhD"\j hT$\ Et‹u}ehD"\X}j hT$\ YX;EPC PFsCP3hK"P\EE|u}eC 1RPWV@ƉRPha"\ *C 1RPWV?ƉRPha"[ Oj hT$[XZ M؉]܍}WE@ P?FZY@M؋]u0ԋ Phg"HE}tXEtM]tM]WE@ Pz[^y趩0芋 Ph"_EԀx udj0$//tM] EtM]uu h"[Y$E@ 1RPSQ>RPh^#Z 5,XZ,@th"PZXEE̍e[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSnM t#9t9uƉׁvSh""Sh "a^e[^_]UE0 w @8u1]UVS]1tSjZ1tpVhB$S[ ¸tVVh4"S[ ¸t<uh!SE Y^¸t0 vSZe[^]Åt2USņ,t1:ņ,uƆ,AuƆ,[]ÈƆ,U,PPT,PXZ= /tM=6,uDFvP wKvPJ /)vXY$u-"jPh:"3c UWVS}] Fh>"W_ $1ۃ<,u,Ć,RƆ,"RPhV"-Xg"Cuġ,HyPxV,H ^ J 1ۋ,t#c"<Ɔ,t!RPh]"W Cuhg"/W[1Ɔ,:dž,t2,"t RPh"Ć,RPh"jW Cu,HyPU,H YJ vu&hj$W^Zudž,@uK1,tPWĝZYuډe[^_]FuW"Phv"[e[^_]USMU 1Ć,9u ]R@uQ"Ph"ZUVS]Ct&st P~ XCEe[^]~ e[^]UWVSP]1ƍ@uPkXtUPUBX1h/r/5/=/1҉/Ye[^_]UWVSPutf1=/\O /P-udX]}-t@BBt&ctQo:tW؅u1PRY[=/uxu+t =/1롅ttf//덋Wt؅u1=/뗅uSj"Ph"=Yru th"bPh"TjNYUSPXZUu),,uuMe[^_]7e[^_]UVS] C}أ/V,1Ɔ,@uV,jjX/8u=/un,=,u*=n,u:js^tjsYt , =,u=n,u,=,u ,,/=,ut :-u,1<Ɔ,u dž, Ɔ, Ɔ, dž,@uԋ /=n,u>/t /u7;/P//jP耿//XZ=/t6u h"cWH //Pt//////1ۉB9tt 5/ /e[^]U}ujjjjYE/@/jc/Z8tPX /u /u11VUU0 wj jR Hu1//UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh" \à uVh"cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh"[à tuVh"hЇ,Pjh"`1H9ujQh"a[à 1Mjh6"h"D[à M+E@1?1ɉE11ɋU Ph"j MQwPhMQh"Z ÊEEEjMQu Z( t1E1҉RjSe[^_]UME  h"PTP u/=/u/1ɉ //h/h/RppUVSM/t:u>/u1:-uztX/z-uztBu /ͅtɍr8tuPh@"9Yy:u܀y:u.zu /J /2u PhS"]S5/15/e[^]UWVSj,/^_zthi":8->E /1/j/Ytzthz"R/uD8-u @P5/P)Xg/9Zyh"9|EPá/@// /)<}_߉ƋM9sω9s x19r )ЍpkME9s 15/ /u/ttQS[PY/9} h"/B/)أ//ljNx=/tE7u ZEy1ۍ /1u1/ /u/tP1e[^_]Ë,z8U /x@ 6@,J8,z8]ÃxuUSt Pt XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P,JHR P UPUSUJtXxv-u~u C $t hw",B0+B8PCXe[^_]UWVS4,E{=u6E8t h%3=,,/} E=,,/\C/\Gà " / G4,=k/H}t/G u͡4,@4,褴=-} uE( u 耴Eu 9E@EIt9u& u4,,HH FՁt| tfjE)VP &kx\[x /@x 4,,HH /xO H,)Q,X4,U)Ѝe[^_]UWVS@} ,B ]urVȊY wVh"Vh" 4%h"j"S HS蕊Z؅tWh"}xM4%h"jPGSUWVS]S;5,MM E,ZY9,ulP!_H= /9s<wDu 9rMW5/pl ZYt%/= /M܋=/5/ ""S>e[^_]ø6",ztGUS /ttt* "#//54,P /ZY]UE /jZE!FU蜱\uH蒱 u"4,,@8xtjjX;jjh!: OUVS,Xt 1ۉXX=x tjb,1҉P Y,1p84,P0 /xx/Px/0ƃ)c t,~tŁF $ % 4,,PP @\ |td;Z=t R u?&u,@1,@_|u,@踬,@$&t;u,,@ ,@ b,@,@r,@_L=t0 u74,@4,,B0ztjj[Y,1҉P٫jhº%Và ؍e[^]UWVSSá,@tuxt =,,uyGEt7%t,O8uQPEZYu%^_8Et2jw,Y_t XS؅4$PS Rt ,1҉P؍e[^_]UVS,p$ t jj,ubX(x,u{ upV Zuh%"P: uBPV,BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Um,B]US]V9tjS]UWVS 3t u%j 8XpZʡ,@؍e[^_]UWVS,@}t11[Wt%t1MHwRFuv,@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZ虨jE#BW}uG,}u:,@@ t%}t jj,@e[^_]UWVShEӉM,@E1E/EkE+,]jEPZYtujXY>tt-uVƉCY;$/} ;(/~(/}>uQy>u |u &u ۘUtv&uya1ɉK,dj`dB(,@(X4,PZ-,@(u @  1҉P Vy1s,X$,@ ,\H,hP SV,p,@ X P(Xu1 /GD/r5H"0聗jhډMX/HXq{t B%/X+5,T /`X@Džd{1d#kDžd}tmB%uWP-DruJt?:}u詖5袖$/%/jjh$/蓖 1ɉdtDžd B%/t> /x`@`H`B%uKЃ wC /x`@`H`iÃdt@@Ѓ v6t'H/X`XX, Džd /x`"p=d%:t #u)Ph%<[Z…t!Džd[Sh%u<ZY…uH% /x:F p:Džd /xF p%{`@9Ë`uBW`衔`Dd u(}t# /x#F p#Dždcd1ɉdGfxufxt dT,Jwd@ ӈd ӈ{dNj@f@f@dK@º%1҉P:'uAW|º%u1/X\Nj@@%f@/X$eH /JNj@@b%@f@e[^_]UWVSS,1ۅtXC1,0x tjR,1҉P YF8Pv v^S‹FP U8tSj,p迕jh%P`,HUJ@ B J]e[^_]UHu+]UWhPT/l蔘d,`/\}1󫡨,X1pjEPZYE//E,Tjh ”jh%Pc ,B t$Pt=^, hppDžt1ɉxR|T}E,jjtP\ ,pnX,`,dVZl/\//u jlDžp6"u^jI,Džp4"X,`,dXl/\/pu hpp}UWVS ,@1ۉ]}U ,u@$x @40$%j袿jCjj Cu;jiF EjUBjbjUB뻡,xu jF Y1҉V @j]j á,x 14$pCjj_Cj,@A. u,x,u pr[u hL"j腾 ,PS @0CB,Yx u`x,uZh$pnm^ZuGu ,up0pY1҉US@PvjjfHu?8j@,1҉P P,J0HCBHYvB,@-ttjjjCV,@^Xjk ,B0+B8C j f,p0C5, ~ uh$vBlZYt h$CEFu,xjƋE0FEY,xu;,x  jj p0‰EEU表,@Zu UBE밡,xt jj@0FjF ,@Yt-Pv jj u ,@FEM1҉@{j jeC1҉SY^tNjjLX=V,tt3j,@X&}t,@uWd^_Tjj ,u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]𡨇,xn ,u*p0QƉXYtա,pZu1뿋H up$E0FE뢋}9u}} uwj, 4,H4^S ZYuhb"Spj/v1 t h"t ,4,+A8F%F,1x4R@@u} u jj1E1҉j1ɉHEFE F ,@0F[e[^_]UWVSS,@1uG u=V,th",@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡,@tj)pZƉe[^_]UU,1ɉHHPtjjYX,1҉P t/Ht3,@j,Ytrrh"!%,1U11ҋE]FUU Et 9Pt]UM4/tPt9JuB]US]j袷SCU PUPUP X]UWVSEP;B[y h,"u$u;5,~5,ExWbZ=w PWV `jjj˱ uNujjbjjbjjbjjb$jj bSEpuWjduEe[^_]1=0/UWVS}u }t~h@VW@à VW@ZY}t9u9t:WOX19t-y`m04O PVWhz"S(SVWh"D#9,},؍e[^_]UWVS]{tN7Gu 0/} t} t&Wxjw PR+GxPYWF Z1Ce[^_]US4//@/uSw4/SF /H/ u/t ]"]UVSu4/t1u(jS#ZYFxPX6utse[^]UWVSu] 95,}5,9,},9t7S jjSV%9tk8V WM PSh"!؍e[^_]US, @, , ~.CPjj  x9,},P@ X͹ؙ } ,/]UVSu,/ ~;$/|l5,/j V à x9,},9tPMX P%<u~tvh"Sy S4%ZYt vVuQShC"MShs"EF y)KySP-Y P-Ph"S Sv0XZۍe[^]UVS]O^0=@/u'/u/…u uUt/tY<~qtG<e<Xt5<L<:`/u} MԍEPjWQ @}MttRtY1U=,t tGv =,u<9ue MVWNZY@t_Mԅu`/u jWpY[1҉U܉UUUO>v Y DjEPju u}t1/}e[^_]yOe[^_]UWVSu] uh!$sQZYtsh#VQY_uh"; j5, h"VuQ_ZǾ/tl/@//P2 1ۉ/^u /t/t4jW/H/ZYu/t G@u15@/1ۉ].{h"#WPZYth&!WPZYu/p[vtEuEu11j1}h!$3dPZYDžt}N}u N_}1/t@taGwuu%h"WXE=}}uU/t/Ph"mY^PFƃX?vsh^"5,& h"/Zu h" /P XV,Ph" 넍Fuuz/@//@/u1 WJX/t/P,/ Yv }Q DjEPj7 SWGX5/bHU/E/dUWVSh%PŁZYj'V_Zu <)ș19e[^_]á/@/,t,UP* 1,,Z /u /t /u/t'UWVS]߅~91Wu u ~ )Dž~E u F ~) IP8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu/CfKS u>/@/s覘C CC/H/^uV/tM&Ffu9s/@/6CPRvC S)S/H/ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9,u]e[^]e[^]U5,uXZU5,u~XZUPuu EPāE u hx"uPJu( UEPu u UE Pu5, UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V_Ztt~tnh"V3ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h%V}ZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9,u]e[^_]we[^_]U5,uXZUh,MhЇ,CXZU8ruPh"Ph"cUWVSSEPE X85,,/j=RU ZYj=S ZYU))9~߉Ӊ /I /t$<=t xFUp UCɅxUU] Ue[^_]UE1@u,/+/Rpp h"jhT/5T/UWVS]} Mt t9u t113B%ƍCt9tB%u1@t)؉[^_]UWVSS11/tZuA=u܍PEY1/t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE"e[^]h"SP/ZYSv=Z9u;Shg#j'S Y^ƅu+Sh$XZ/<'uh "sXuS)Ph"t e[^]UWVS]} sSt"CtS҉XuEs1Et Whd#!Y_}t5uhd# XZ$,Jy R` ,z9 _F>=u y:Cu}th3j"FPZY,HyP,H X J e[^_]UWVS=l/uh/ h訐l/Y11ۋ/tJG} tE t8tEt.h/9P5l/耐l/%h/XZl/1tfzuh jjh%1zuHh jj h@%BRx.uh jjh%hk"P0ZY1u%UVS|ƉӀ8!uxu :\|fxqpftft!f u&PZ?;*;"|f uPS-[^1PS蕥ZYuNf$%|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!] ]9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$%SV[.Y[SVK._ZYSV>.[^SV-.ZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV+^_xPSZY04]E9uc9u_E98PVҢ^_uWxPS迢ZYuD04MU9u9uE98f9]PV{^_t1PxPSdZYu鋅|9u;xu͋ 3E3U >~u5!uډx!(u;)u{u ?e[^_]UWVSu] h,#3+_Zu!Nu xtP!zUW?Yu URP-DPtÅt S辒Z@tM}th!$6(ZYu }tM1EE8%u!P]X6h"0_Xz001ɉj EPuljыE 9Et:8u5 t/u u6" 9uM/8Mt#y޸$"uPh" EGSW YZ@u'a"| !RPh`$G Etu jW XZMuUVS@Q\/@/X/@/5\27t j=SYZt hSLXZO Ph"j@]SLjSh%"|j h,h!!k(j h=#h"Wƒ $u-"j Ph:"2j,h*"h"!j h=#h$"$e[^]Uq=/t 1/|/N,/1///=4/t jfY,,,Ї,ȇ,tP& 1ȇ,ZUju1ɉ /N,1/,Zxt@Kj*uFE$Eha"VRY[EEE8.u(px*u Eha"VR_ZEEu uh"}f?f}‹}G}HE @,1e[^_]UVS]ss 3sh'"]%tVTRPhR"; S S VPhY"e[^]UWVS uj:u -ZYE u hn"j0@E } h%E P/Y_8j=P_ZqxEPh"W E "t"?"F"uE"t"F"M"uL"t"M"U"uT"t"U"rk]"@u\"@t"]"KDf" ue" t#f"$o" rn" s!o"z"xy"y#z""r"s#""r"s#"}"r"s#"[T"r"s"2+ r"a'" s"">}w t2"&" u""r"r"""@u"@t""y"Àu!"y-"Àu"PI" r" r#"' " r" s#"" r" r#"" r" r"""u"t""~"u"u""^W"u"t""70"u"t" u^"?'"t"^"}wu1 "% "u ""u"u"""u"t1"`%Yt@""J*"@">uM!"*tO)""M!" )""^0"3@*""^0"^0"}w s " r"%=t)wt=u&s"=u{" o"w"Q" r"<}vw s38"#'8" r7" @"r?"r#?"G"rF"s#G"O" rN" s#O"W"rV"s#W"oh`"r_"s#`"F?"s"sj"^}uSg"P%;t3CaP3hn"jd,W 1 11ɻ%;}t SC8t{$(Whw"j ,(PjCPhw"j }(PC$A u,P<W<Y_1Ƀ bt,Pg<EP^<XZe[^_]U4Ph|"h,jU/"=/u$"PRPh "h,jlUWVSQÉ310;#uCj EPS5 8t Shg#j#E8tWShy"je[^_]USÊt%<#u$"S[Zt@/]UE E EE]UWVSÉU}utj VS @t 9E s Y8"u"3O;t)t:EtP-fDB@fO1e[^_]UWSPh"Zud/.j URPà u8"u h"j1ҍe[_]UWSPh"NZuh/.j URPà u8"u h "j1ҍe[_]USÃ=X/t =D/t?\/9t6t2a"tK"K"=ua"QRh)"m  \/1X/D/]UVSƻ%t[PV_ZYuICƒ`/d/Ch/C$/C 1f‰X/te[^]% VhE"jve[^]UVSÉ֋t8uVh^"jURM1YZtVhv"XZH/1EEe[^]UWVS11Dž=p/~ Vh"8XZ1 RPhSܪ =t=p/Vh"q&f}Uu1.=p/Vh"[^v49tVhX,h"yEa6WhS"hX,vWh["hX,F (tl$u ~#EPV.EZY9Qu E e[^_]e[^_]UWVSP]} EEPh!S=Sh!P19~uVWS1F]e[^_]ڟUWVSËȉBffCfBffCCrCrB(ȉC(B,ȉC,B0ȉC0B4ȉC4B8ȉC8B<ȉCu8t/j} tu Sh #< Sh%<_X뿃} tu /Ph #< 벍/Ph%<[^띋$t $PVYPIZ}tEGjPS2 y h"C<XAЃu ƀt/tu1P走$u hpE" e[^_]UE/E /]á/á/UE Puh,'h,j j~UWVS]G8ށu=/t5/h!ͺYX=@/t"=/u5/h #詺1@/XZuu ZYyW蹯Ph#~ t7=/t.j 船X=/tSfP5/h% #Gj辳e[^_]UE Puj' UE Puj UE Puh UE PujjYUWVSx1ۉ/Ph$J;^_yhU #hVum ]t Ƅ1PS:ZYyShd #LY[u%=`uz 9u;u/Shh/f ƃ uSht #뜍xPV:_ZyV끋%= Vh #e= u:u*ShV讒 t ÿ"Sh #0Sv[+SvY0hVu u|h/hg#5XZ|듉e[^_]UEPøZtPRPh # u uh #hh`/襶`/UD/tjXj EUSj0h@%jj H/jj̿]USjvCjj袿jj虿]UWVSÉ֋x CPww wwփt=0~j CX0e[^_]UWVS1=///1///1 Džsuu/h #h #g[^Dž SUYusÅu~3hVs ǃ uVhg#7XZAP~XEtVh#? Euu듋CuOHujsVsUYE >9 C 8H1u"Wh#h,z Dž CC jhPjV Ãt'$Phzd@S& @uSj [WYD P-9rDYt)PH/t4KRWQ u <tPȉj!{ Wz C1ɉK C C1{;/C//XZ{ t%Vw\YZuVh+#!XZ?jz Vz Gz G y GG1CG8{DžaETuDž/Eu/} u:E 5j YtshG#足s _Xtvh$蠳6M 9~=/ 1ۋ9U tE 9}?Cԉ a^ EtPs sshP#…g=\Qs sshi#h,uҋC'BDž 1/C/ 1F0H0~ + /(P ^t5/9F6냽tr/t`6":tV#h#Ph#h,誴/t/?";tg"Ps ssh#h,u͋ p Ph#/Y[0F1҉StPVS sɞsS軞 uU89;//?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs sJY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssIY^} GWssIY^GWs$s IY^G W$CDȉGDs,s(IY^G(W,C@ȉG@s4s0IYYG0W4CHȉGHsDYYMU tEȉEEȉEθ 3U9$| ʉ@1\TtIMًU4U9~ ʉ@EP1ɋE9~f4Kff4HAe[^_]U11ҋM ʃ=u‰]UWVSU ]u:LABLt ߉։U fCS_fCU ȉBȉCB ȉC fBffCf9Juftf=vfCDBY^1e[^_]UWVS]u u#}u}u EP(XV¯_=v1LABLCEȉC ffCRVCP|uu&BY^S~fCe[^_]US0tcQRP~0]Ƀ=d0tf‰Ã=d0tUWVS EӉMԡ80EE@,E؋EBEfEꡠ0KMK d0t EEM MEEE1;@0D0Ef}:}Eؙ}E)9"EхuU}uI=0#=x01}t Ct C{toCd9E@(M9Q$}1uD 9~ txNjCSMEAE@ufFZ[tA 10Ee[^_]UWVSu^8C@Pv#艕C4 C0uTs${(80P!! t#RPWVL )׉s${(C 0z4PssBƃ t)C$S(=\0tCS 9})QȉBffB=0ufBfu*A C$S()C$S(1961C, A~WQVAO 0 d0ufs8SSX0 0 d0ufCSWPC,)BPNB h 5050N5050 =d0t0PP-ZY500X;C$K(}e[^_]UWVSu}uhd# WVq+j WVu uhS,9sR95@0D0rCWVCP t-f%|"f=@u"SRh[$p ShW#`XZe[^_]UEU uRPRP+UWVSLu u]1EE9 u} u}EEu}u}XY=0tB_EBBpOEBtDESR#e[^_]UWVSuE1;E}  @0D099ME 9΋u uÍ1ƅDž EU E0_Zt$CSCECS"Cp/Ct!CS =80RPC  PS@"[^u uu uhP*u u0 P@1ɉ50NP t1҉ 91oGƉtNCSWVB +lCSLCS YWVA +CS P @1t*T @ G&|@ Gv8^ |=0hl=0XT؋|tTىTQAw0CSSC CS؋tTetxXpPD|KtDlDS Cw0AQ Ah2 (FhtDt1ۉxXp OPhl t19|O0#8@OL!ًtxtxp 800H0@Ãx} 80x=809f,{0B0pC9sjh,WF=80 C JPhl t1=0t@I @K 9}#8@#BLpptxbÃxjh,p'FPh`#=0t ht#Yh#˷ZtWC jj0@0 RP Pk^_D0t@0Ɖ =0|L‰ˉы Љ\1ۉЉ\P@)GWWG)GWd|LL1ɉLS C)CS Ch)Ghtp8谽10 e[^_]ÍL$qUWVSQQEUAQ I@QRP2$ƃ 9jj0@4 RPjjWV f,80Hɉf, f,f,f,f,E,=0tE,]E]C WV XZ=0t CpSt+ C(v1ҋ 0I4.xtWV(Y[11tjupEB 80f,UJ 0@4B9s$Ujh,QMBM 80 UB fCB u0C‰UjjȼUfPjjSuu褼YZ8tuu蒼YZ8WVStWV,UMPHPH QR_EWVUU$WVDYZ8u(CWV+fXuuf@uu XZA@fAEeY[^_]aÍL$qUWVSQpQAQ A1~ ^_EC:ff"f@t|"Ph#蹆=0t+=0tC CC C u$h#hYh#TZu1=01_ t貺f@[^$0  0jj ¡,,ƅDž3 Dž1XY=0tB>BBp+BtPR|[^t 0$0 h#qY=0t-5(,jjjj 0$0 h#Zu5,,RPjjPt0=0toh#b5 0=$0 t(jj[[XA!HfAWV#1 0$0XZ=0tj 蓍_ 0$0 tjjRPe$0  0u h#+5$05 0[^f%f=@h#h# ZY5 0=$05(,jjjj 0$0 xRP5,,jjy\jj5$05 0ƅDž WV@@PP WVf@5$05 05$05 0蹷^_8th)#1ɉ 0[@0D0 tCjj RP5 {C9s#Qjj RP2 N019r)#u 5$05 0u"hJ#Ah?"A10XZ謶fH^_f@t 5$05 0hC"u6!@t%hC"5$05 05$05 0)Z[@@fA\5$05 0f@5$05 0Chr#<$u th# =0j XeY[^_]aUWVS}u w wTXZCfEE9ucp0t=0t =0tj jjjw w'up0jh#W  w wNYXG $09O u,,; 0tf%|"f=@u"Rh#w wgE)Puh#ʉ=0us=0tRyNj ˈh#XZ=0t2h#_=0tfE)fCe[^_]Z h#eZHt1ɉ 0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=d0tf‰Ã=d0tÃ=d0tUWRP#Y_}UWVS(}M] U P0T0;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=0tWN#uVu uh#50}̉Euuu u)5 EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=0tlSQu uh## 0\Tumq֋]!qISQuuh;#džZE̋UEU؋}9Ћ}};=0tSQu uh[#胆0uuht#h$럍e[^_]ÍL$qUWVSQ0QEU}9Es9=@0D0Esuuh#"{h0l00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu+ ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuu. K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuu, M])Ӊ h0l00@x1RPuuX, 0R=0tЍeY[^_]aÍL$qUWVSQ8QEUX0\0Ӄ X0\0}9u}9u9=H0L0Esuuh#yP0T0E؉U܋E9EEE@0@Ẹ@00\1ҍMQRPuu) UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuu, K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=<0u ,000 4080EUܣP0T0Suu5(05|0腧=h0P0})E5(0=019}VVdf%ZYf=u Gvdv`YYF`VdvlvhtYYFhVl1tttpMZYYM؉DpTtA u1M/YYM؉Auv<=X0u 0(1E؉Ẻ}EċM9MSuu5(05x0躧rVVif%ZYf=u+=0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡(0`0`0=0`0ЍeY[^_]aUWVS u} 0M]1EuuWVG(  ‹Mt WVh#u1H0L01h0l05X0=\05P0=T01@0=(08#AH40=0态1ǣ801ã<0005,0t C<0 =00 ,0Qhv(0ZYu h#te[^_]á(0tUPmZ1ɉ (01(0UWVS u=0tFVFV zEU0H0AEUSQRP,  w 1҉UtE4PcX30RPuu & 01{{E U 1҉CS1CC E UC SEC$EC( 01E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PRhZY=0u h(#r00d0P00e[^_]UWVu} 0RPWVS% 0t9xu9p tWVhG#re^_]Ã=0tQUS00\;0r 3jX50j50j100ZY]á0@ UWVS$Ɖx@t@VЉ_uDžۏ v vv 0p0vvxNjH0P0@t 1ɋ9}=؋ÉA빋EU RP$ É19r=`0th0tF1ۋ9}&G q1YYQCG W5x0ɣ[X9}W ʉ@~ 09Ht09Xt~zG=0t T <tYv vh^#hRyRV莤t"G=0t 1ɉ ؉L1҉G 10C|W5x0[X"~@)EU 9GG=0t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉ0FV RPRPhS¤Sh#o h#蟛Xv v!ZY=0t@V+EU FV@V z+EU oFV h#>t0gX g؍e[^_]UWVS uE 8t18E 1ۉX0X40tFVFV щ} G$W(ff%f= 0fua(9=X0t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQ 10 t 0#8tU@DNL!Ή!؉HT t0@8] C t`d E x@1҉0P @RPRPhS聡Sh#hl h#^YHE p p^X=00tp0PCSp0 ЃW$0  B=0=0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1P0T0X0\0FV =0tGFDG FHGXGpFDGtFHGd F@VW[X=0=0t =0G\uG`Wd uGhWl tlh #Ch)#ou 1ɉ 021G\G`GdGhGl f!0XZ=0ub0X4 ؙN0ʋF4f0F0V4=0LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPhQ#mA=0t h#KYh #7mZ_XF0=0tV4CSCh~@jjv4v0vHvD wh#@h #lH ZY=0t 0@ 0 4e[^_]UWVS 0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEUH0CBHLY4DEUE9ƉU}:E1EEUH0븍U1E 1ɉ 00 40 (0 ,0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh`0p5|00}=h0t =d0t =d0t50u5|0P =0tE@x 01҉EU= 0t60p,kEd1<SVuPh#h,#J1 0=0=0ExU t1U u E#uh#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE0ËE} u 1s<}%?}u}9t uuu+xYuuh#;jm?1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5H0=L0|UH0L00M]11 19E}eu509|]s1-h1l|]+hlȉ uv<20]1t_}}9u}9to<%?u9tSQh#:j=M]Wx.Y[M]u Wuh%#9MEsE)lj1VEi1`0e[^_]UWVSEP@EUE@ E}juu# t`0t`}9xuPu9puHEuuhv#Ep p{ `0qyEpxu}qy `090u 0u덋=`098tEUMK؍e[^_]UWVSTU1EE\ 0`0111E0x,9}= 0t2kEd1E7uWuPhR#h,mE1= 01ɉM0M;9ظVSXZts]ud0=0tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=d0tf‰Ã=d0tÃ=d0tUWRPY_}UWVS EX8=0t 1Q=0tt1;@0D0slj}1RPk@C^_DžE@4} G0.3Che$PLZY'Mqy u9t#pp pp蠑h:#Qu 10p pZf@fKP@FV RPhC"vv 0049s$;ww Y1҉WWY_8u؋=09s0CS tK  KtRP6PSXY[jjXZe[^_]Ã=d0tUWVSX00D09= 0tA=0))Kkde#VWSPhX#h,11ۉ 0ss XXYC  C7C Ct t%50tk=p0u1^=0tuCS 9RPNXf@RP>XY_8u695$0|_ssدFXZC SCS u95$0|)js s]Ahz#,#h#%O 3ss訦1ƅs{Džݼ ^_=0tBBBpBtVR`ZYu h#["_PsstQDž ss輥VPtVf@Y[5$05 0~VfHXZ:e[^_]UWVS(EP@EU 0E0RVuu EEmƉׁ\TtCЋU!CQC RPh`0S5|00}=h0t =d0t =d0t50u5|0 ExU t U tuh# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUMH0EMB0Åt4}9{u}9{tPHSK0PX#E}tlExU t}G`ǡ0RPuu ӉE1EЋE̋Uǃ0040Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 50505050W=d0t0PP-zXZ50"0h`0zR0e[^_]Ã=d0tUWVS\U1E 1u0X,9] = 0t/kEd1VSuPh#h,p*1ۉ 00u1EE1ɉM0MU;9WVWVQEu} 0tCECECXCpECtECd EEP$D%EXftbWVYZt=0WVh#!WV^YZt!=0WVh>#& SEP襛XZ0Ѕ9xu39pu.JZHX0Rjh#EPLjh#$tC CC Cu jhf#jhr#EP躴`WVPhz#E?Ee[^_]UWVS0 0|jj'P1󪋅h_X=0xX$=0uh#*G^uh#)[=0t؋1ɉ$0h 50505050+T=d0t0PPvXZ50t0XHXI$~6#9)#~$tl<hNjH`ltW,Ћ9G0sVh#$^_n=0tVh#Y[h#EZC=0uՋB,t|Fl$1~H`F|@ltË#XLS5 0 |^_u h #| 00h 50505050Q=d0t0PP/tY[500Z0tt DžPLDžHLPP1󪋅lPP TCHX$~@=X0u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPh* #1hDž\L1 0׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtxH0ttx1tX,9t= 0t4ktd1=VStPhM #h,!1 0tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh`0F5|0|=h0t =d0t #=d0t50|5|0r =0u-|xU tU tthu #[^=h0th`0(H0Y=0t =0uh0 0 0 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505x0kC 0𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh0E=0tth #XZX0ph5050 =d0t5050*n_X0\8 uǀ\T5050KY^=0th #PE_Zu)5050CY^u90u 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505x0Aj50HXZΉlߋpËlቅlpplp8T<DT9ƉD} TD0Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh # CVtuPU u PU u P1ɉ`T9lpDH08lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P6 =0`t'W3VslsQs th!#(h;!#PX<ZYtej PSh 50505050A =d0t0PP-d_X50 0^1ۉ0=0tP|x\|P8 uT|PTxU u |PTHU u HhRP h_!#\P@;ZYtw\S| HU uHڋ|xU tT |GThRPUh`0c;010=0u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPhw!#,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPh!#OXZlAu농U u PXRP8 txh!#P8Y[taU u P|xU t |G\XRP轾h`080t j SV虐  =0ts h!# Dh;!#Pu7_Zts󥋅ƀƀh 5050踽5050<=d0t0PP<_Y[50&0Z10e[^_]UVS1;] s8Sh7% ^X1E0Ph"# FZYuj  XÍe[^]á0!UVS1ۍsrT =0t40,hP"# YX"!"#t8"#P.Zty=0uɡ0t4象01ɉ Lh P50x5050;=d0t0PP]XZ500X150Kt00=0t hh"#R[h"#-Yti=0uۡ0 h P50趻5050:=d0t0PP:]XZ50$0X10jWjWYXuj]Zuj]Xe[^]UE( 0E 0]á( 0á$ 0UE Puh,wh,j $j=UWVS]8ށu= 0t5( 0h! YX=0t"= 0u5( 0h #h 10XZuu ZYyWxPh#=  t7= 0t.j G X= 0tP5( 0h% # j}e[^_]UE Puj' UE Puj UE Puh UE PujjUWVSx1ۉ$ 0Ph$ ^_yhU #hVu@ ]t Ƅ1PS輊ZYyShd #LY[u%=`uz 9u;u$ 0Shh 0%ƃ uSht #뜍xPV?_ZyV끋%= Vh #e= u:u*ShVm t ÿ"Sh #0SK [+S? Y0hVp u|h 0hg#5XZ|듉e[^_]UEPZtPRPh # u uh #hh0d0U塄0tjXj USj0h`%jK 0jj]USj5jjajjX]Åt3USӃ=0tPh!YXSh"#XZ]USu=T=Tu =Tt=Tt=8 uIl0t=u 1111d0\0 `0h01<=T=Tu = 8u1ہ=l0묃[]UE0 0t,\Tu ǀ\8 Tu ǀ\ 8=0t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"hB##'[=d0t ha##)Y=h0t0PPQXZh 5050 =d0t5050QY[0\8 u0ǃ\T1\T0uSChEZx##= V 0΋0ѡ0ƉϋKdC40RPWV肬 000 =0TC,HEƉ׋Eǁ\TtC!C1uCRPh0'=0=h0t0PP^PY[0ph5050薮 =d0t5050&PXZ 0\8 u ǁ\T50Q50u tc=0u##EKh##D=00shX9s΋9tRP+0Ph##h050*h0 0[^ 0t[h 5050蟭5050,=d0t0PP#OZY50 00X0e[^_]UWVS]u 0x00xPSk~Y_y!0PSh/$#f=0t(jS |0_ZyT0PShB$#5%= tSh!wh#p u1Q=0t x0=0t"hU$#/_jSo x0ZYyShe$#1ɉ 00 0u Shw$#XZ10 0$00001000010h he0h hKǣ0h h50h h0  ʅ ʅˆt h~$#VSY_¡0t"ujV% _ZyVhe"j{^|0=0u%RRjPVM8@t00t:0 0 0PDPj5|0S7@u Sh$#Y^Tu Sh$#h~$tV_Zt%h$#VZYtVSh$# `LuSh%#C\uSh'%#+50V4uShS%#uShz%#f^_uSh%#܍X1‰11p~u 1ۉ0}Tu%HSQRP DžTӃ~ ƅtBtѥPD1D1É1P1RPWV OډSWRP\ h%#Z1ۅ~;srPƉρ}Tt!1׋ t101t ;r5Ch%#h &#h*&#hC&#hh&#h&#h&#950h&#@^_=KÅt0\Tu [t1ۡ0!0=0tth&#[u h&#YY0 h P50試5050%=d0t0PP-HXZ500_1ۃ=0t0Ph/'#Y^0=h0uNtJt2=0*$#=0td#Ph;'#XZ=0u h`'#X08<P0T0C,@01=D0C0k NKt鉅 ׉ ЉNj׉   =0=00=0x=0t h'#^h'#[01҉XǀP1ɉh P50o5050#=d0t0PPE^_500[=05=0t h'#Yh'#ZX0PP #0ǂL1XǂP1\h0RC h 5050s5050"$=d0t0PPD[^500Y0 tyPh(#h # Hu^0  h P505050 "=d0t0PPlDXZ50V0_0vuh3(#ghX(#`[^Hu\01ɉh P50e5050!=d0t0PPCXZ500X0@_X50?00^0(=0tx<Phq)#JY[=0ăx0(=0uh:#ZHuqh(#2_=0th 50505050$=d0t0PP=[^50m00Y 08<qH։9u9RPh)#q0BHЉ8< =0uh:#. ZHuqh(#%2X=0th 5050&5050K=d0t0PP<_X5000^ 0@DqL։9u9RPh)#0BLЉ@D =0uh:#U [Huqh(#L1Y=0th 5050M5050r=d0t0PP;XZ5000_0=00PH҉8<PL҉@D1500=00=0?,=0t h)#i[h*#I Y00ǀ, 04ǀ(<PH҉8<PL҉@Dh P505050=d0t0PP|:XZ50f00X=0OL9=0t h *#lXhI*#L _00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S50袗5050=d0t0PP&9[^5000Y =0tv0=0uhh P5035050X=d0t0PP8XZ0ph5050h05x0 50Sh{‰L^_u Shn*#1׉1ɉ509)~09~NjLWF8HLNd t1RPS5|0 t>t Dž)h*#h#^Zu1ۉ0j'=h0tHWSS6 0WA8HLId t1RPS5x0 =d0t WSS6 0@0 P0T011Sh£H0XYu Sh*#1׉^,jS0_ZuSh*#}=0 @0D0 ȉڃ9 sA0001ɉ 0 0jP1ã0j500…ˆt0Ph*#"Sh 0_Zu!Sh+#[^10jZ7&0 0=0u*t!h$#P+ZYu X0 0>hSP5<05|0ƃ (0,000<0=LBALt[=X0hG+#h:#Y_jjjjjS6:=<0fGW69fG@0CJtejPhf+#k =0uh #BZu9h#8)X=0tC=<0fGW8fG@0_fCff=v]h+#Y=0uh+#Zu8h+#(X=0tfC=<0fGWZ8fG@0_fCffuih+#Y=0uh:#lZuDh(#b(_=0tjjjjjS8=<0fGW7fG@0f{f9}zD3<:uƃu}EEUEURP50u uɓ 09u0E ;}|v0EUtJ9tFRPؙUEЉEe]EUSQRPM RPhk-#RPh# Fyj Xe[^_]UWVS}u EUEUEE0ؙMʋEeEUMuuuVW~ 9Eu0UMG"why-# X19]~KؙEURP50VW- 09tؙEURPh# 0E e[^_]e[^_]UWVSQƉӋJt,B=0-#9u6"s sRh-#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=d0t VWWj) 0VEA8HLId t1RPW5x0=d0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t1@ 09{ u9st7S5x0D 0uWVs5|0Cs{ ECe[^_]UVS 050 0t+NdEU  t19S u9CtCt[ 0uh-#uu uS$SPC 0 0X 0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh.#9{@uRs s8 Rhg#XZ=0th-#Yh-#Zu 1]UWVE5 00x=d0t50p5 0 * e^_] 0ÍL$qUWVSQQ9@0 D0s RPh.#H50 01ۍ}WSQRP'{ U Ƹ8,;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE $)uu1_Z=P 0u <vuE !]e[^_]P 0U1EEƃE9Eu E9EEUEUEUEUEUEUEUEݼ ]uuMURPZSm)lj$SWwG/ 9raEUEUE Et@EUEUE3 EC"RPMURPcZC1ɉ P 01҉P 01P 0E EtF?N)Eu ]e[^_]FUWVS]\TUH} FE 8uh`÷} XE u h@.#h`SPق =0t hg.#_L=h01@J =d0uE PP1$Y^E \=d0uPP#XZ1fEfffE@9uރ=d0tE PP#_XE \Ǎ=d0tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P UWVS}u=010x0y |0h0P^_=0=0=0t h.#v[h.#VY=0u׋0 0=0ux șRQ\| 00h S50050S2=d0t SS XZ5000x0Xh 05x05<0h`05x05|0ݻ$01t- 0t%FS5x0{s讻S註ϡ009t )Ph.##1=0=0=00=0t h.#^h /#[u 1ɉ 0=00ƀ1҉PTXh P50}050S=d0t SS(^_5000x0r[=0u h#/##Y=0tshI/#0h 5050}050S4=d0t SSXZ5000x0_=0tqhb/#150h 5050|050S=d0t SSY[5000x0hZ=0t"D 0 @ 0kdPQSh|/#/5|0 Xx0Ee[^_] e[^_]ÍL$qUWVSQ(E11҃}50~8]9 P0T0)ӉMЉ]ԡH0E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋ 0QF EURPh`05|00=h0t =d0t =d0t50S5|0 {U tU tuh#XZ=0EUؿEЋEU H0{U tEC`؋Uu؍  0EU9Uuu500=400MLU9P8u+KIjH`URSPU)S$) )Q h 5050Ky050So=d0t SS^_500h`0 0EY[E]9]yV11ҍeY[^_]aUWVSu 0!Ut 9rt8R}t-jcXu h/#s1rBЍe[^_]USM 0#AUY9u ЋR9uX[]USEU 01!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY0L 0t9ZtjSPL 0 L 0M]XM ]$HX H 0t}9xtju50eH 0 H 0UMHU M$PH e[^_]ÅtUWVS E uV8 %<}EEH89~kًEuC%E4`%ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]Rh%h/#UU ME@`t+tDuTɃu:< %ЃPh%h/#oUSE MUR`t't6u?Ƀu)3  Rh%h/#]USE MUR`t't2uAɃ)u+5 Rh%h/#舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tVv _uVh!je `1ɉPhd@u F tGRhedAu 腺 @u!8tuh!HBXZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(hVF$) ƹ ߋSh!V$ CPhD!V C Ph!V CPh!V CPh(!V CC,$C,Ph;!Vη C0PhP!V迷 tPR X}!uhzd@u 5 @RhedAu  @uuh_!j诓 41}󫍅PuA^_@4ȋ9荚9t(Ћ}1ۉ1E1ɉ [Eƀ*P贉j PEPܹ1e[^_]UWVS4}jhPjW贔tGjPjVWV>t u$U ʋMQ؍e[^_]UWVSu] 1PV@ZY1ɉ%= j/V_ZxrPRV)Ph/#h0WjPq ‹ 19}e WPZY u$PV}?ZYyA =@uuuÉ1ɉ PS?[Xuk%=@u/h/#h0VV#ÉD= jnq XZy.hh Gq à 1҉PSСZYt-Sq Y 1ۉ 9u 9t0P_Zq8T8PRPS۳ s>PhFSش yL]8S-q Y h/#j$W苺jjW#p Ãy}tW\fMZt8PhF|@S] y&hF SK^_PtPިY}}Wt9P誨XZtP苨Xiutߋu0PX_t PKYt}ZxSo 룅taX؍e[^_]Ƀ=d0tf‰Ã=d0tÍL$qUWVSQ0EЋAEqy AEĠ0Eס0X0]؉E܍EPuuWV3` UMUȉM̉E9މEsMp1Mȋ])jj`SQb ǡT 0U4ڃr h/#迯_W!ʈEċxlEHX0!9tPRPh 0#uT 0u< =0t h(#F^h:#2[u 1ɉ 01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=d0tUWRP+SY_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth/0#tX0@0RPWV1d UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hF0#ˬ,=0t h(#Yh:#Zu 101)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X5d0u  0QrRP3 E@ `0M ȐȔh P50e$5050[^=d0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=0tP@P @ƉuOEXuh0#1҉0YX5d00@0RPWVqS E@ `ChSlEUE Eu h0#蛩0H0ș9M}sE E>EPuuunL0;B0u Exth0#PX0@0RPuu[ UBEPT@PChSls}EgUBXEU}GWEU G8W<50#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tE$""# E1$"#00}}{rT 9RPYXJ0ws$%1҉Ut4Vh0#=0h#Xt4Vh1#賨=0Fh#YRt4h/1#kj٫t4+XZf%f=tC0ڔڐVPh_1#5=0h#XEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=d0%JXF^9t(ߔߐVh1#蒧E`QB9uР08BufJEf9uwh #@_uS h #/Yu(h #Zu10}t0ؔؐ,F_X01ɉؐؔ0{rT uDVh1#ʦXZ=0t h#^h#YsS50,XZ0t4*EEPjjujH0Z09u Extuh1#1j蟩@E܋E=0tP@P @u4puSQRPX EP˔ƣT 0X1}9}~h0X01uE)ù`1j@@P讘_X1U9} MȉыU @ۍzEE܍Hhhu EPUEk[^1E9E~+u܍Lphu EPUEVhg#htQDhdv$v tQhV:#W>,jVjhdv$v W 6lQPl/SoX1e[^_]UWVS ƉUMjQRPtuh9#V_XfUt+tuuh:#VSMo^111 tuB t@uمtr} }uWuRJtjjh:#V~jjh:#VjSjjjjjV pfuuh:#V~uuh:#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh:#V ~#1ۉESPuuRRh:#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SKmX렍e[^_]UWVSu} hjhY[u)Vh%;#3XZÉEEU(,E$E U$0418%jhSPVTuhVSyh:;#Sb<RPcZY@uhF;#B$D%=u?$Phd@gw @uhR;#S&^_$uhi;#M, ((Phd@w @uh;#뭋, (h;#S딋Eu ǃ$$, (uO1҉MRQWV)  ‹MtQh;#SV (,u(,EU싋$1҉MRQuu* Ɖ׸9ЋM|RVh;#StRVQuuh;#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP1 Xh <#SSi 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@t @u%h-<#SXZuShL<#S E]1 ]US]jSYZuh<#jS YZuh<#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|PtijWRX uYjuWUu!@uuZYjuPUu@v0sh=#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h=#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh=#S{ZY8$E܉E1EuuWV!  tuWVh=#SBHEPuuuu Ɖ׋EU tuuuh=#뷋]9ً]}eY[^_]aUWVSu 1ۉ^hV$5l66 _X1td1SщU@%MYZMtUBuSh(>#u} D%H%  VhV$j.6 XZ똉e[^_]US1L%@%uhD>#t`u܋]UWVS ]} Wh6"Sn 1D%H%E؋E!ЋM#M t:6";tg"UWPS7W@%S7UҋE!U!E`uE Et;uuhR>#juVr6";tg"WPSV7WVSN7؍e[^_]UWVS]} tEU E U uhY>#S_X S^u E@P;E sPu hh>#S؋E pVSZYEtu h>#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u h>#Sn Ee[^_]USP] ;u:j EP5l6 U:u1҅u5l6hP!u Ћ]UEUitstau+u PJ uPZYUg@Rh>#P UE ft*u 5l64ZYt5l6h>#uA US] ;u#5l6NY1҅uh?#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h?#PY[E1eRP6 $RPn[ZR@8Zfu%S5l63ZYQh+?#P\ ֋]UWVSu }jj h6"WVj]S yEWVuhD?#p}t Sh#kpZYj oXe[^_]UWVSQ]M tu E𿊴!E𿚦!QhL?#S'M $j$YXZM uWhg?#S 9jVQjjuuS U 1ɅuWh?#SKV3]‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth?#2jS,Y^ujjjjSbEUE Eu h?#SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h?#PP @9E}}EU u h @#'EUjjjS@ $uDWY_u h$@#jPjuujjS9 uVl[hI@#SZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u hi@#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9p,tE %1҉Ue[^],(hA#)$hA#k$1RP,( RPhA# hA#賲jSm uhA#蚲XrX CRPhA#iks,s(hB#s4s0hB#$C8Ph"hxVi-Vh/B#!ksPhAB#k 1e[^]UU E$E8E U]UWVS_Zu5W^,tUSb[LEPVZYPEPV @'Et M 9 p,uPhd EPVh%jBuV e[^_]UWVƉj(jARZYt*0xUM PH 1҉PPUP1ɉHH H$e^_]Åt!USÃx$t p TVZSMVX]UWVS }t>VEUFV E܉UEUEUEUE9E EM|vuahC#WE UEUEԉU؋E9EEM}6u&uuuu uuuuhC#W(1FM]3M 3] t?uuuE Uà hC#WEXZ맋M܋]3M3] ut.u}t#uuuuu hkC#WEFE F E$F$ku}tRB#}w+M %B#}w M %B#w %RQhC#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRP щΉE؉UMWVuu>  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuuh EUE Et6EЋUEȉUWVRP> Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw UyhC# %uhC#urXZ~thC#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuut M؋])ӉM]MЋ]9]u 9M9ME}uuSQhD#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu  ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uhC#u+GxpF)^N^ 9MEu h.D#~t hRD#FV E؉U܉ȉ+EUEUE9E؋E܋U} h}D#E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yu#S) e$1RPuu EUSvXt E;AtIhUI#SXZqy U19кE}Y9}uT9uuOU Ut(U19ЋU}9MuuWV  ‹Mu}t 1}hI#Si[^uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,SY@tJup(x,S@t$uűMq1uh5I#S>Eԍe[^_]UWVS@]u }(,EUEhI#WV6 t(qtsu&jsEPjjS@uvE95p,th%j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE EuuuhI#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuhI#SjSEZYtE̋EЋ@E Et hJ#fEЋ@ EjS^_u h<#?jSzZYu h-J#!x G EG$EjSG jS9 tu hOJ#S^XPH UMċM9Mu"M9Mu}u hfJ#SY[1p GPGT<9s/jh0%V+ tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuhJ#4E؋U+EU9E̋M| hJ#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUhJ#SXZE9E؋E܋M u}uU4}u h K#SYX UMH0xhJ#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh'K#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhHK#S_X}ffuS7Y^@,hfK#À}|hJ#SXZje[^_]UWVS]1uuuuu11hK#uu 1 btENtoat%itClh%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9p,uEU t th%jZYWVRPuSe[^_]UWVS EЋu} jj h6"RPj]S yEWVuhK#jJ}t Sh#VJZYj nIXe[^_]UWVStƉPZt 9St[RhK#V *{ RhL#I$1s3щ¸L#$1s sщ¸A#Whg#hV (Wh"htS SVSUuhhT%VC SVhK#YIGPh"hS Sh\M#:I$jmSj$G8P7ShM#IhM#IG0W4 uhK#X1RPhP?Pލe[^_]Ë `,Q`,y ;p,| tX,J X,UhX,PNXZUWVS֋U} $,%E+L#` u>h8#7HX ׋󫋃V6h2L#GXE8#e[^_]GhBL#GX8Sh"htS Sh1ۍujVk%W謿 uu wu7 uRCu1jSk%Vq u%u vu7 uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPShO#WD 4 uEyƒt t9h!^5XZu&h7#諬S.X,VS}_XX,tVD+^SkZ1ɉ  Xe[^_]UWVS]} U"1,hlS#R$W6  @$t&Ftiu5l6Dž,9=p,tE %1ۉ]e[^_]1(,$($jSZYt,uhpS#sV*ZYu+C xu"mt s sFYXj Zu*vXe[^_]UWVSE @80ƅ77Ph$"u t 7u1Cu X0u: ^t hV#0p jVhT'L Ttg81ƅ9T'@󥍅8PhV#jPSS0PhV#jPuV9 VShV#j Sn[t hf#j T˅t_S zuR(,Ws')ZY,u1(zu%B  u /4TX0@dy!ȋ0Bd ȋ0Gdj0P j0,P 1e[^_]UWVSƉ`d$1jvShv tj<uh%hU#j Sh'iP @u hW#j `#te[^_]UE]ZUE]IUWSD<1 󫍝hDžDžxDž DžDžDž $Dž(,Dž0@4Dž8DžLi@DžPW#DžTiDžXW#Dž\!iDž`W#$󫍅Pu u e[_]UWVƍU1Eȃ^_]À= 0UWVSà 06C jjhWRPthh6"W WhW#2CV_Zt@п )׃ t3v9tCu.CPhW#Y^g1Wh!XZCtRCjjhVQPthh6"V  VhU#Y^GtCtJCjjhVRPthh6"V VhW#/XZC1RPhW#hSAShOV#e[^_]UWVSVu)_uh%hV#jK ƍEPh[t hf#j/ juV0?Nj] t>sVl#ZYu+C xu"t s s>YXj ZunXe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h,%hU#u0^uh,%hV#jP sP3Gs Ws;h $uq t.P Eh6#uT E tZu EYLEPh"u }Chs@Pu @qhX#u~ XZt V} YhX#u~ XZt Q_ XMEPh"u6 E Mu {hE EEEM؍CU`EPu u @Muh,%h!X#fEftft5fu6t2C t Wh0X#j }tC(UhPX#C0ut3hlX#jq t C0sHtS4KL9sщ}t:s@shu  us@s`u  @u;4(81t/sl`}t$CU[s@s`uc  @uEsd6CptSuZY@u s\hX#s8sXu+  @u s\hg#te[^_]UWVSPuz Zu1iu | _tQVZ Yt=Wc EWu -} MuS1 VB [^PQSM} uV' ZSz X؍e[^_]UPEPh#u ƒ 1tEUWVSu\Ph(X#V t\Mfnj4Zu\VXtd$1jRVVhiS @tt}f1RPh(X#u  1e[^_]US]uu S? @t ]]1]UWVSu um{ [^u %P҉ Y9Es%?V܉ Ƌ}M)1Ze[^_]UWVSu u{ [^u %Pk Y;Erw%?Vu Ƌ}M)1Ze[^_]UEPhj"u ƒ Eu!%UWVS8uEPhX#V uh~$hP%hhX#hX#V7z _ZtPӈ ƹ}[E]ShiV5}ĉjS PhX#u z ƃ S_ Yt=EUu؅yكۉM]! EjEP虆 XZuVhX#u 6z V He[^_]UWVS1Rhiu4 @t|j7RPhX#hSSހ>tVhY#EVt j7RPhX#hS;tSh(Y#S\ e[^_]UWVS]hX#Sx Y^tVP Zth8Y#h@%jVhX#V ƍUܹRhiS3@u hZY#j e[^_]UWh%1󫍅hPhiR3 t|}UWVS\PhY#u uh~$h%h0hY#dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPh#VU uh~$h@%hhY#UuS1^Xu hY#j CPS趃 ZYu h@%hY#PhX#u Nw uh@%hZ#jB SG1e[^]UVSSu] EPSV @uh%h!X#j hZ#V?v ZYuh"Z#h%hhY#X#Eu6#PRSv He[^]UVSSu] EPSV @uh %h!X#j Eu h6X#jM hX#Vu ZYuh"Z#h %hhY#PhX#S6v He[^]UWVS}h.b#Wbu [^uPà pY@vh,Z#VjZu hAZ#j VPh.b#W@u hZZ#j xtdPhiWp0 thqZ#뮉`SX`e[^_]UWVS}h_#Wt ZYu+rP pVYXuh~Z#DVSh_#WE@u hZ#j 1҉Uu]EPhiW/ @u hZ#j SX1e[^_]UVSÉЉʉƃ ι"u6"QuRPShZ#" e[^]UWVSu1jS,Vhxi P@uhZ# UЉUPXۋUu hZ#j/ U]Vhxi Wj @uh[#ڋE9E~E1}~ Whg#y FXZ;u} j Yj ~ SjUVSPuVZt"ÍEPu V @u Sh[#j @PUWVS$ƉUЉh^#Pr [ZtP@ ƹY1@]Shvi V.j Sa Ph^#u s à VЛ HZe[^_]UWVS0]EPh-[#Sr uh~$h%hfhY#rMԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EP~ XZtVh^#u ,r V He[^_]UVSuV[th $V@q ZYuh"Z#h%hhY#P ^fx PS+ZYu hY#j PX1e[^]US]EPh3[#S u ]&juS,ƒ 1Buh%hg#膈XZ]Uh<[#N1US]dPh$S uh~$h\%hhY#d|lPhiS+ @u hs[#X1]US]dPh$S4 uh~$hP%hhY#4d|lPhiS>+ @u h[#艇X1]U1EEpPhiu+ t hqZ#j 1UhZ#uGo ZYuh"Z#h0%hhY#PhX#u o HɃ0 v+BwBÍBwBU]UWU1ERhiuG* @u hZ#j] 1}W|$wUWSÉЄtGjj h6"QPj]Sҏ S z6"t"PSh[# h!"¸g"Xe[_]g_UWVSP k uh%h[#j jLh,__Z6"t[#jmh,CZY¸[#u6"WPSh[#h,=h,t VW?Xjmh,ZY¸[#u6"SSSSSPShg\#h,a$VՖ jUEU P]UEU P]UEU P]UEU P]UE1҉T,T,1]UE1҉\,\,1]UE1҉d,d,1]UE1҉l,l,1]UE1҉Pt,t,1]US]Sh,YZt =CЃ v؃߃Av h,! Z>u ,1]UE1҃t` 0]UUp,t H9t@]UWVS81ۉ]܉]E䀖500EЉ]ԍEPj ZY@MЋ]u h]#EU׉uȉ}̋}50ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEP3S[@tEЋU ЉEhf#j uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP Y[=0u4]늋U9ыUjSZjuXjEPj? ZY@UE]9u]9u9}~ 9UȋU}h|!"jm UWVSÉHPZtP_D 1D1V9"LY@u h %hU#&RPHSƃ uh %h]#j R1RPh^#hWWVh^#p jVW3WhiL@u Wh^#t Ph^#%XZjVWWh~iL@tt Ph^#Y_j pHZ@uh %h^# u =`,j:RPh^#hW{?tWhL_#oW | j:h^#hW5?tWh^_#)W| tHSW?YXjVWDž@WhiLuhk_#XZjS#jVTWuDžd1hlWhiL; @t|h_Xu h_#l@1dWhiL @@u h_#@lh_#@Rz = 0t%oΡ!w%Rh_#Y_HS XZ= 0u0= 0u'DjHSDP jV`VFV 0-{k?PL@uRd#= 0t]#Pj hC$_# 0%X the#g"X thΡ!g"oX th_#g"MX tRPh_# hC$_# 0j_ the#g"^ thΡ!g"Y th`#g"Zj 5X,X%SV65p,tjHSVv e[^_]UWVS]S^t EPu S @u Wh[#j u a Sa Y a Etuh%h`#jz EPLEZt hf#j u1EVtRUWZYU}tRUuZYURh#SF tFE= 0tFtj= 0tFu[= 0tFtL= 0uE= 0u+Hu)}tj oXhX,v轇ZY U6"= 0tj <XSQ uI uQj{UWVS,ÉUP(^uhV#@hc#Sb ZYucU̹ Rh8i(S @u 8t h&c#j jhc#u1 uh,%h3c#j Eܣ 0 0u VhPc#j e[^_]UVS։PޮVSPhbc#jw UWVS]U hzc#Sa ^_uh$h@%h2hc#‹ 0ށ؃E u %ERUo NjURp WP͢tDPEV:ZYUu s"9ERE ËE É 0X1e[^_]UVSP]U Chc#S` ZYu  WPVo Svo VP/Ãt7EPS5 0bƣ0Sg1Fu|"U 0e[^]UVSP]U hd#S_` ZYuh$h %hhc#Pn Sn VP葡Ãt7EPS5 0įƣ0S1Fu|"U 0e[^]UWVSS]U h($S_ ^_uh$h%hhc# Ƌ 0%EV n V)n WPƃt1Pu赮ZYuc#EM É 01e[^_]US]U hEPhc#S] uh~$h%hhc#] 0%˃ uˁEU ى 01]Uh,hc#^XZUWVS]h($S^ ^_u3hd#Sn^ ZYu"hc#S]^ ^_uhzc#SL^ ZYtP 0 00!‰ 0d$1󫉕tVh7iS @u h+d#j e[^_]US] uPhg#E tP茫Yt Ph8d#XZEP辫YtPShׁ$ V$܋Et PhAd#XZ]UWVSuV[u hV#/VYu1P4Z@u h%hU#p 81jS8P8Ph8i(4@`%1󫍅`PhiVT @uh%hNd#je tWph^d#X%Ht#t8uP9u Q:XVhhd#XuShod#( _XjPY^u h!!j \8Ph8i(4 @uh&c#HʨPhd#h$HH9Tt$h#h$Tj)j P4Z,H%(h^d#%_1ҋ0t` %xtO(9u 09t4#HɋL g"u6"QPhׁ$2 ,딅u hT%^j /YjmZti 119X~M%9u>uW~Phd# hd#hd#4j F뫃 u]e[^_] e[^_]UWVSӉϋuu*W 04W Zt2tVWPZ u3~ 1ɉ [u1Vi ZV` s Xe[^_]UVSu]}t Kjm NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uBpW f Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP-Ɖ׉‰ 9иr E8t8"uo;sC| C 9s} "WV! Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtPq X1e[_]UWVSÉUMU1}E;E t[ztMUj8^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1@}u -E@} uE@ } u"PRV [^uPRV ZYu덅LPhj"E 0 tu 112L 17 uuK_tHhV$HPH,ZYu Dž,[%E@0tj/S Y_0t @0`1DžTXDž\@PTP,SRǃu.@xuP0 kTtHu@xPS.YZHu.fDžtt0u_SXDž,uTtt,1҃0u$SZDž,T(j DP0o,D (t8t,v ,v "SAX%Dž,(S(X(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(P_,fCNj ֋$B$@tP^(S7_ S LEHVUE [@2Ex0$,S ZYu,Sh%he#j聼 @PV^ Vv uh%hY#jS SEpE06R uSz h%hZ#j$ Sz XE}G }xG }G1e[^_]UWVSu]}t W Zv W$ Yu #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAuiy }uE$EXExtHu E؋Exu[}t1}t.Es}ue[^_]UWVSQu}uAEX$Cu S{0u3PE 0rO YZun?-uGPRUpYZUu{(WR[YZuA{ Cu CuHPE 0O YZtPE 0O YZu^CwH$%Pb -w7/ w7m XZ1u(7 _uCPh9e#j ȋK 11PE 2Z@tEF EFC4FCF1 Ue[^_]Ujj$ZYt$%U PUPUP UPUPUjjWZYt%U PUPUP UPUWVSu] FtVuVVPkX1;}t$jXt0TQ1҉FNG1 VuVVP$XFue[^_]UVSuj(jY[t2%EC1҉SCCuu SB @u SX1C؍e[^]UVSj,jFY[tDÉ%E CEC1҉S$C$C(uuuMU @u S_X1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79rGM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVu EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u jZt$pSuCCC]e[^]e[^]UWVShQe#u#J hXe#uJ tÅu'j`h %h_e# VX SzX Y[@8Fthee#^F1󫍅Nv󤍝tJvr󤀽uCU9 t he#j |t uhe#jPB jS: PhJiu @t1 he#`Xe[^_]Uh,he#mXZUWVS, = 0 ƅƅF1RhKiu3 @PXujP Y_VjWhQRP qpujP XZpVjRhVpQP h[%W $,h[%RZY,j#tRVRSPh f#e[^_]UjhIiup @u h'f#j" 1US]D,9t@tu<0@5<0貓 X ujjS茉<0 u D,D,]UWVS ]UUEt ;0uKL-f|JxuEuE} tˆUPu ZYUtC}t:=P-‰EHffUtSUBf<fuhCf#E9r^hvf# E9rhZf#X1_EtE L-WtU0 L-fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uSL-f|PxtN=P-119} fLOu0t ,@t@ޅtt SVhf#SPh! %h#Y19};Ph2("qGXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9sd1LuÍKكt :M؍AMPZtfP׋Me[^_]UWVSQUU} uj[UuhU#RZu hV#j jPV: u} ]e[^_]UWl$1E|Ru ul}UWVS,E u:[u h%hV#j6Y@uh%hU#j9 P+Z@u h%hf#ݍF1jR s<^_C xyDž@Rhi @uh%hf#ZZYq:u]S 0PjjhVPR u+t"%tf#VPhC" 0Xe[^_]UWVSu FPZu8+u1h%j裬 \`%1juSߝt \vSh iR @u(81t8/thf#dYXpe[^_]UEU = 0uRP*ZYE Ef#UVS] t4sVu9ZYtC P;UuPVZYft1e[^]Uh,hf#eXZUWVSSÉ։M1S>_u}uJhg#j1 jh*g#P uWP-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh%h#g#j EPh/g#Sj u)EfEVh9iSƒ 1Bu h7g#j蚪 e[^]UVS ]u1ɉ@uh%hU#jf EPhag#S t,juVG E؀8t-EPh/g#S u)EfEVh9iS=ƒ 1Bu h7g#j e[^]UUE9@t-EMfuu Cg#tURPhJg#* ËPt<qg#Pt2vg#Pg#Pt|g#Pt !øg#ËtI'vg#t?g#t2qg#g#t|g#t !øg#UWVSljӉʋuFEE9s]19tc  ^w@v|USh#WK 1UvAE9s:2UFPh2(")ȉMPZM UuRWc u9utD7...}e[^_]l1e[^_]UVS ]uVhiS @u hg#j EPhg#S uh~$h%hhg#E߉EVhiS uEhg#TXE1e[^]UWVS$]uӹ!1j EPhp$S?uh%hh#j4 EVhiS @u hh#j> 1e[^_]UVS ]EPh)h#S uh~$h%hhg#uVhiS @uhg#E؉EVhiS @u hg#j躦 1e[^]UWVSxhSh=m#u@uht%h8h#jJ DžDžDžDžDžShKh#]_Zu?Dž1ɉDžDžDžDžjShSh#茙 u ؉8 P-DytRx:uL҃0jWVhV$Pt;9u8tMh\h#j jRVjPdƒu;t 1҉Ŕ@|Phi8uƒ 1Bu h|h#jƤ e[^_]UVS0]juVh+m#Sо@u hh%hh#VE Zu Vhh#jM Uf@fEލEPhiS4 @u hh#jJ 1e[^]Uh,hh#5^XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phri#jF hi#[P\P <fDžLVhiS @t%fNthi#= 0t hi#XfDžLVhiS @t%fNthi#= 0t hi#KXfDžL VhiS @t0Nf=) Phi#_X= 0t hi#YfDžLIVhiS9 @t0Nf=) Phi#XZ= 0t hi#X1|󫍅|Phi8S @t}u(j $PhiS@)_hi#UEEEEĉEEEԉEEEEE|Phi8S^@uhC/#Xr}uMu u uuBEH~HEP-DJtx:t~&jPhKh# uWhi#^_EyhKh#Y111Pt՘hXZGj,tDYyhKh#>Xhi#1Y4t8hj#XZ hc" Xj "_PhiS= @PhiS! @jh`%PN u ftePhj#[^Vf"fP0 Phj#a ft Ph%j#FZYj ^Xe[^_]U81EE1҉UUUUUUUUEPhi8uF @u h|h#j\ 1UWU1Rhiu @u hh#j# 1}UVS]EPh2m#SZ uh~$h%hNhg#uVhiS @u h.j#j 1e[^]UWVSÉUPhg#&SǸ) 6 9|j<')X$j<))_ j-[/UEPh2("EZYUJt)Dj>Xe[^_]UWVSƍt1fDžfDžRhiV y hk#j艝 h' 1p)֍H(@!P }_9p}p' Džp h k#h˝$h%k#h)k#hj#hh#hk#pph.k#(G(\G!PO(!W Y`0t `0Ea0tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P h`0Sld`VPPpphWk#G"`G!\ƃ0`*w/wNtA2FltU0W= 0FQSPhk#hk#Ql= 0=Gj#@j#= 0$YdPhg#XZjQ"d9 ʃl6"yg#lRPhF"CV$빀= 0FPFPFPhk#hk#UF1d^1ɉll9d&j>=[S= 0FFPhk#WKStRTRPhk#RPhk# l대= 0FPhk#XZlF=Ptlbhk#hg#bY[= 0FPhk#DFPhk#1^ fdV\Oj#t5X\PQhׁ$\K {!XdˉX\lT\lkj#XtWlTj#Ptaj#Ptqg#Pt!PQhׁ$UlX {!렊dزT<\t=PuEFu:hk#hg#XZ= 0%FPFPhk# t#= 0l@l#hk#hg#Y[= 0FPhl#xXZ1D dD ҃L ll\6"ltpj#dRP\Q4%hl#CuhEl#hg#[X= 0FPhk#FPhk#^V l\lOj#Xt5dlPQhׁ$wlK {!dNjXfld\ Td\kj#tR\Tj#taj#tqg#t!PQhׁ$\K {!lXkT؃dPhk#ZYkl= 0.N= 0'$%uj#}j#tsj#ti[j#`j#Yj#Rj#Kj#Dj#=j#6j#/j#(j#!j#j#j# ~j#j#F)`j ɿ)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEhJl#@XE1e[^_]UPEPhUl#uf uh~$h%hhg#ME\UPEPhi#u uh~$h%hhg#MEUVSjjj"j y h^l#@\1ɺxBhPS\s y hxl#?ZuufiuSFt Xe[^]UpPhiu< ulhl#?Xl$Eu hl#j EE1UPEPhi#u& uh~$h%hAhg#MIE@u hl#jȑ 1UPEPh`$uͲ uh~$h%h4hg#?M E@u hl#jo 11 ,USE UUXt=EEEE1҃UjURP` 뺋]UE Puj US]S赲PhSm#jHI S0P0~ UuUE Puj蒲膲jI UE Pujpd Ã=0tMUEE EjjEPEPjEPޮƒEBuhdm#XÃUSPs jh%p jSp uShm#6jPsqZ@uShm#j]UWVSd@u~Q1}=0tC&;Et7EE jEPjjjV@uuShm#O 1ۉ]]]]]E}W]SjyVSjpcÃjhm#ZYum#n#1uuuujEPjn E!1}jhn#h"S EPh~&$ό h~&$hmn#j G ju6hn#r[jjj#2 jWjjVj_1ɉ ,jEPj1 u 8tihn#Z+U9uU,Rh o#jWjHjVj> *t Ѓu,t$hn#BjSn = ,k = ,tjWjjVj ,SӃ  LEEEEEPl Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh ,聫thD"u?0Zu h!!j觌 jjSPjh ,Cu‹E0]USdPho#h,謻h,ho#ZFShp#h,荻 jAUE E ]UWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9t%(  9\$ tl% P%11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t%/ $ 9L$tl% P%11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]% $09tul% EP%11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t% $9L$tl% P%11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]% $9tul% EP%11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]% $9tul% EP%11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]% $9tul% EP%11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t%9T$l%uwy|$y|$L$ ˋL$ ˉ$4$19t%9L$tq#$9T$tq# P%11 [^_]Uhw jjh@,uή1҅tPUWVS jEPg Eu_X1E9}2uSP軿ZYt!SP訿ZY tG1EEe[^_]UVSQË0tRVh#r#EP{VER:yZe[^]UWVSQ1:nuzouP yX1҉UhV$Pt ZYt98nuxouSPZYu}SPߤZYuE1V}Ee[^_]U^PPPh)r#h,薵jMUWVSÉϋu ,PQ- ZYu Whr#1}uHt*hP!V蒰ZY41z!Uu1u4h$,P^_u*!~u M }jP`e ZYt1ih#Vjhr#W譼 uU jZP,Pt t% 9|\ 뭋QRS4 u0 0u1Bhr#Wj Vhr#Et"a"Et"Etz!Et6V$%u0P,P ZY@tjj@v^_,t#jhr#SI uhr#VY[0?!tShr#Sh#hV褮0 ,Dž@hV$,PXZ9 PWmvXZڄtVB L<-u.1j=VtY^t$S@ #S4Q ,t1ɉL=0t>}uhr#赮_17=0u卅$P试 Y@uNhd"7/XA=0u}t2ҋ4h$fGXZ9j yX=0t=VVt t6huA".X t 蓛XP膛=0tj}t0$c j c j(~ @u hr#d._,,W3hȊ$h,RGP,R  8tV,Rh # . ;u8uWVWhs#-j諷 t 襚[P蘚Y}u, Ex](b jj  WS$` ~)t}u2hX,,P:XZj P$` ~j,P# @uh",X,Ѓu ƀt&qttPnPVhpE"H}0 00SVw Y_@uVh#s#,XZ e[^_]UWVSj Ph.s#q;11to&tZ&t =0t>&F#tg"QPhׁ$ !ǃ 끍W"#tg"WPRhAs#踪udtj#tg"PhVs#航x t 0hg# h"]XZ=0KtSp+F=0u=0KtSp#tg"QRPhds# =0hg"hg#sds`sTsPhvs#ԩslshs\sXhs#辩0=0~chSjjhP!ju.t%j S}^_tShs#R h)%X Y'?"t#Phg#)XZ 6"He[^_]US] 1t-tPu˴ZYu01=0]UWVSEt48nuxou 0PPSX1uh">)X1Y,u@B uPn_uh!!)S[^ljxj,S|ZYt X1e[^_]UTPhu#h,Ԫj苡UWVS]!11tE1҉p6p,111ɉplhv#u uT 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh~$P ,@uLƵt!t"谵0脗Z!t!PSh!jvu j衛UVS]u VS YZu Sha!juu ;/t"Shv!蘸XZu E!e[^]選e[^]UMPhcv#h,xj/UWVS]E1ɉ#11d111lhhv#u u HuLf$M,9tQG.C|g$@&UC| C|C|C|5l6 CpZDžlL5l6CtXDžh.5l6CxX5l6Xjuh&5l6[u h!js Pq[X5l6XDždC|p,P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPW%!Y^@uRWh#jr xPW!YZ@tECp'xPW YZ@tǃluECpECtuE%CxdupVV覐@$XZK|ǃe[^_]UWVS SVdPhWu u hWdSht$w ,@uSVh!jr f@tKRPh|&hSqShv#>0j貗USP]jEPS"U :9uySu h!jCq ]US]SfZt@ h$"SZY]US]SkZt@ h1$SsZY]USP]jEPSn!U 9t :uy Sh!jp ]UVS]u VS YZu Sha!jp ;/t"Shv!ܳXZu E!e[^]ųe[^]Uhw#jQp UHh3w#hDw#haw#hw#hw#Phw#h,蔟 jHUVSQÉj EPS  U:uVShx#jo e[^]UWVSuEE@t"0 1VFe[^_]PF_u h"jo VP ZYuj譕]e[^_]颉UWVSQ]E10u1,hvx#u u艁 2F$@&=H0tD0뷃=D0uH0c뛁K뒺al6C8K t L0hK\cPDl6jC@K@2K&gl6@Pq s4K ,Il6C(KK@KEPuh@ &5l6Vƃu h!jn Et L0tctKtK@tKsK t=H0D0 s=D0gH0c@tKt1҉,,sc sKsC  sC sh$"VS@0Y_Eth$VSC$KXZEth:x#VSC KY_Eth@x#VSC$KXZEthIx#VSCJ (ujuu SY@e[^]US]CEEiEPjEPI ƒ Jujuu s芗 ]UVSu 1҉uuuVu~C9 0u7VJu/^˅t)v 迧0踧0Sh &hy#Qe[^]UEH؋U PEf]UU otzȉEEȉEE1EjxPjEPjjhuA w/0Ph &hpE"賓HxUWVS]u uu uQ fMA1CCS1CC 0@ 0ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh E$&1t<16 1Ƀ 1Ƀ 1ɅtuRh!jQ 1ɋuЋ} t1M蓑8"t$M tM9uM9t Suh!맋E9ƉU}7=|0tuuWVSuh:!臔uuWVSuh:!?9u؋E}<=|0tuuWVSuhj!FuuWVSuhj!jP e[^_]g_UVS`)=0tPh|#h,  h|#Ph|#h,h,h! XZ=0&ttsh"h, j`v=|0u UPNvUWV=L,uHH׉=40t&ɉ HffJ=L,u f@ffB^_]UWVSƉ˃=0t/=x0t 1}mQd080Pul, Pסd0RPSu50~5 9t S0'qPWVh4#{j"aue[^_]ÅtUWRP#Y_}Ã=x0UWVSSƉˋ d0=0tSu 80Q+ S׉ș։ЉEMRPSu504 9t 袎0vpPWVhZ#9{j$te[^_]Ã=x02W|$wUWVS#Å=0u0BB400 d0 ;h0l0ؙ=0;|*90_1)։ؙ50pؙQ Y&JtRz!9t !9t ҋ1҉ؙ=d0Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ 0A Id t150)X=40t050PPV 0xU th#z {X0H xU t@\M؋]ȋM؃=40t050PP 0A Id t15000JH,1X9M؋}ruuh#x 0\E1ҍMQRPuuy lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuu K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK0500_\T0@xRPuu Ã=40tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋuo%ClRPuu Ã=40t]Su,XZ1EtttpY_DpTtF u1EY_Fu @ߋu%CP0H050EЋUpXe[^_]g_UWVSQEӃ=$01}=L,tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Sh†#h,w ]W|$wUWVSLEUȋ 0A Id t150yY=40t050PP 0xU th#1҉U؉U܃xh#豻 _1E؉E0X`u؋}܉ tu}}zU tStX~KM< Ʌ0@8EU܋0J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh#h,Jv Nt% tSt1\uWEah##Í Í ? # ShM#h,u 0$~?0EE1uԋEЋUEUClM 0EH00EHesE@E=L,nKdu؋} t1RPWV }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRPr EыEȉEEeƉϋMUeuuRP$ Eȋ}EЉEeЉƉϋRPWV^ }f E9C0u'=40050PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋0 09A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 0A Id t150$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1󫡀0=L,t@fxfDžAlx;G ‰|fDž ,=L,t,0@40u 1ۉ,0@DJL!ȉ!؉ pZ4JdQyt@f fDžAk -F ‰P(,iKL04H8C s(H1 0t ǃ^F=p0s0Kd t1RP߭ڍ2%VV$h͉#U 0 ؙy8PۅI43%WW$q,h#U 0A0= @ 00=0u\Tu kУ0jjjhj50j£0u090uhB#0 j&N 01=x0Lh0l09|RPh]#T h0l050 d0H&[t?t  Lș)FOu뺸2=$0t?jj5(0S$=d0STb d0uPؙVpjV uؙ=d0VY00Xlj=40t PRXZ0x0\=p0~ hu#e XDž=p0~ 0A,XÉƉ׋ǁ\TtA!A1׋AId t1RPhK#jjzQff,ftRhht@P^K DžPu ftp0=x0tu1'1=01w,10;x, hX,. 01҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h#ȗ (_01=00CU C )C50$~N`Cp=L,u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=$0uCh|{lN`Cd9sh#O %P[00P t+)lj1ɉ1xU u@\€ 0H xU u@\€ 0H ?xU u@`¡0@`0$~%0Bl50F0=L,~!{809rKd1VT~U uVT~U t PFXƋP1~FKd1111f30@8P!tx 0)D4)Љ09s?zU tR`ك 20B$C1ҋ9r)0H`艅 00BY89&zU tR`A`0$~%0Bl50F0=L,Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rN050$.Nh񉍸Flx1Dž1҉)D40;xsxU t@` 0@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹0B0;0u^=40t0s4PP 0@00Z4Jd150000H41[0Z0 } 0؋50=40t500P504 0X050ދvxx 0\t4Tu艥%Flw%CPO붡00𙋝ڋÉƉ߁TtAЋ!A1׋AId t10Y\Tt=p0]s80){0ƉK`Cx1񉅰69s)9s06%Cl뀡009rߋ 0A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==x0j.EX܋ 0𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1$u6"WVRh#F9]=p0D0P,t,=x0t hC"EX1j DX1b~j DX=x0tjtx|m_u=0th#v5004=L,0FF4+=_w h/#j 0X󥋅`1=40tR50蘾[^0=t0t ǃ\8 50x\d0RP SMY=40t00r4PP蔽 0X4HdLH t1500Z;0sE=40t0r4PP8 0@00Z4Jd150X5050 0@4P50eY[^_]aÃUWVSu]tVR _uVh!jA `1ɉPhd@u "4 tGRhedAu a; @u!U8tuh!$XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(hVF$Ҫ ƹ ߋSh!V7 CPhD!V8 C Ph!V8 CPh!V8 CPh(!V8 CC,$C,Ph;!V8 C0PhP!V8 tP X}!uhzd@u : @RhedAu 9 @uuh_!j 41}󫍅Pu^_@4ȋ9i9t(Ћ}1ۉ1E1ɉ [Eƀ*P j PEP:1e[^_]UWVS4}jhPjWtGjPjVWV u$U ʋMQ؍e[^_]UVS]u VS#c YZu Sha!j ;/t"Shv!&VXZu E!e[^]Ve[^]ÅtUWRPY_}UWVSuuuu É֋EU)jj`RP Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8C 0$0f|uPjj h&h[#j~ B $01uME@Ztjj h&h#^UB0$0@ $01u $00$0fK 0X(0$019։rWVh&h#j 0$01ҍMQRPWV ؉Eء$$0RPuuA ]؋K1ӋE؋@(1҉¸ڋ $0 t1E؉Uu $0$$0RPWV ,؋EÃ=L0t X0ߋuEfEf%f=u0CCdu $0E؋Uou%#e[^_]g_ÍC(u(UWVSQU=0$0f to$09reSUXtX $01V 0_9r)u $8u@)t%1ɸAuV"[1uˉ8كsh&hƌ#j  0$0 $01V $0aV"0$0fH ZYesf@ 00؍e[^_]UWVSj8PFE <$0E8$050F[_tVhތ#0C!؉t Sh#jQ 09s QSh1#whVh^#j$ v hVh#9t SVh#ס,=,f uft Wh#u @$0 05$0$$0F$0$0أ $0sË f)É$$0$$010x$1ۡ009׃}SQRPh+#j $ t$$)D81lj 1=0 w 0 i;0s001 1XOt t \Nj)‰ 9sCÉ$11  D1ȋ 0$500 $0 $01($0,ƻd10 0$0 (01ɉ ,08tDž111 004080S<0 @0D0N1=H0L0\0`0d0-fP0" fR0T0 f,fX0,PDSR XZ,t hW#Shh0 0Y^t&S7Zv ho#\jShx09* 0"0100L0 $0\05 0$00+01 v1ҍN11WVSQ D19sȋ)Ë H‹ )9s؅u\0f00Q£0$0Xҋu h#1 0d0\00f(0f fӡ0|119 t4tu )HtHKC H9u )fC tfCfCF@< 00=0$Ɖ505050$)й1PVuh#, 0 5(0P0P h#, $0@$0@$1jjjhjPj £D$1u hB# @$11=0up50=09| WVh#RR 0&^St1޸ =0~ h4#r [Dž =0~/ H 001RPhK#jjD* ff,ft0Rhht@P($ DžPu2ft0=0tu1ɉ$1҉1 1$$9 hX,gX=L0td0t$]0$fZ0$ 010 D$1$0 $050$05@$1)֋$ 00ȋ $01501SX$0@$01׋$0H9$u^ 00+0$)ȍX9s@$0@)‰э@$01ۋ$~9s ƃ@$0C$_9sك@$0C׋$0$08 $01h@$0(0@$01߉$0)Ѱ_$t;0$0D0 $01h@$0~@$0 $01^1T1@$0@ u렡0$0| $01h@$0 $0F[;5($0s"1;=$$0s,谄$0G=0'$=L0td0t$~==0gj.&Y܋$ 001ҹ$u6"RP Qh#f'9[=0B$$0t,=0t hC"'Z1j &X1$~j %X=0l=L08\0u `0"',/,V1fDžT$fV8\`d4 flfDžn$0Ɖ׉1҃ $((ˉ$ʃvd0uh&hc#XU| 11EET$Euh&h# $0$0Sk _uh&h#PSO $Yt $01h&h#'91҉C0D1;$019 r )$1 $01$} $0CX0=$0  $09 9GPh&hG#{d0tЉtF 9rh&h# 0‹ȋ$ $0GB 9s11ɉ %1\,hX,Oh,E%1 &1*XZe[^_]W|$wUWSøth&2h#YXZ5X&1h5#G5P&1hN#7H(2t Phd# _XX&1t?P&19} hu#[()2%MMEuQQ$h# j P&1Z1<(2H(2EE(&1ۃH~- &1]PP$N< 2%RR$S0&1QQ$SEWW$S h,PP$Sh#!<<(2%1%1!]%1%1Ezu3%ٞzu3%=P&1\$=X&1$h#e[_]g_1UjjXZ1=P&1PU=`,u =P&1ujhuPX&1ZY9`&1~`&1<(2ueUSá%1%1xFأ%1%1%13%w3%r\,y1]Y]W|$wUWVS&1X&1ff'1T&1&1=&19=&1u ; &1&1f'1f&1]f&11Ej]Sjj5((2W yh#[jh'2jjh&15((2> y<(2t h9#z_EjSjj5((2 y hV#j h&1j{ [^&1T&1f'1<(2 s$ &1ɡ&1ȉ '1'1s'1 &1'2}f&1Bf&1&14fpjh(2jVP5,(2? Ã9t:y hr#tYSVh&2hy#`)h,AZ1`,X&1% X&1 `(2X&1@X&1%1 &1%1%1 %1u%1 &1 &1 &1%1Av.}fE fEm]mE%1%1 3%58&1=<&1 %1%1%1@&1U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}%1 %1%1 &1%1H 3%؉ %1%1 %1%1E%1%1=ɚ;~ %1%1-ʚ;%1H&1rW 8&1<&1 %1%1 %1%1@&1%1%1=ɚ;~ %1%1-ʚ;%1<(2t ;<(2te[^_]g_UWVS<ÉUM<(2tUUEčs}uyMăA}9}fE؍t E;T&1uJ1&1&1u5}t4<(2u+JEPuh# Ѝe[^_]W|$wUWVSEU܉M7C]<(2MQURuh#t hĔ# XWhʔ#<(2Y_t,%E 2%RR$PhҔ#=(2t"uC,e[^_]g_p(e[^_]g_US<%=d02u6"kSPhe#h,jUWVSƉPo ¡32_tEtPh#E 329U|} Vh#jK tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ 321҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsZ< PVh&# S2 PVh4#K BhPSjWPVhB## S^PCPVhQ# hX,Xe[^]Ãt"¸y#7t_#tURZøl#USљRPQhShX,S ] `,yUhX,j XZáX,PX, UWVSDuhX,e[^_]ÉÉh#1 `&aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h32EPjQU:U1ˉuK: VPhg#j.h32h32h$+ XZT532VPh$ G 0=32UWVS @<tPh# Y[C&tRh!Phȟ# ^_PhΟ# XZCH<$`&h6"C Phן#f C@& Scssh#8 C! &<t&<t&COS C #CPh #CZYPfwk$&h#h#X1Zh&#h3#hA#h!_3hF#^!hN#Y Ph0#tXZ뢍A9shU#oO EԍsfCfhw:ffEPEPEPEPEPEPhb#jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPh# thhh$h62x 62UVSE UMYt @ȅu˅t6t1R )˅t8u3jSZYt%uj$hPh62 VSh#hh62mVPRh#hh62DσVQPRh#hh62zVSQPRh#hh62Y 62e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uhj$h62[^vth#YEPjjhVPP] t hh$VXZSVh*$hh62|62e[^_]UVSMQ42Q42يۊ@&BZ@&XÃ@.)օ~=42uC42[^]UWVS uE Eԃ=4,tL1ɉ 4,hh525[_u(j.h52I_Zth@Ph52w 52uhhj$h62Q F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP [^uԍEPmZY6e[^_]VPFPh#hh6262e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPh#hh62t62]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV }yE Eg#e[^_].tEEԉE E;"e[^_] EEԉEE E!e[^_]UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]Syh8#)EuhĦ#= Xe[^_]P^Xu jj jjVWjSlyhӦ#݋EEhĦ#:= XE9^CU!‹M9A}tSyM9,sxEt  Cy;8,t8,PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h"h"h#`,H`,$yhX,j ^XZX,PX, }e[^_].UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ#~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(USHPh#h,Sh8#h,ShY#h,$Shg#h,Sh#h,Sh#h,$Sh#h,Shէ#h,Sh#h,u$j)UVSƃ=72u @ h;lu\1ɉXSi9dsW`aXZuh!\PY_t X\X;lrt\h!hׁ$hWEPt72t裗WPh#|t芗WPhA# lSZh`PhedAV 1ۅ9usCaPTh!h/$hWEPt72t-ږWPh#tWPhA# CiVߟ Xe[^_]UWVSV1}jj}Wjh&— uTEEPajjWPh&蘗 t S[!h$S茫 ZYtQh$je[^_]ÍL$qUWVSQpqAlA EAEAEjjj h#0 Y1iPEZuh!!Suj E y h#j E9tSPh # tt/u?EEު#Ɖ!aEEЪ#!LE@Eת#!7}uEPEP諟 _XEު"tEE6"A#SYE܃}ƒ}E ˆwtRExurWJZ9EsEh9#hB#h!h!SuhK#uhR#k$EX1EЉEԉEȉẺEM}ltp9CECECEEEUEŰEEEEUEUԀwbEU }E]EݝxM؉WQRP PuSuhl#u؉sEܵx 03%PP$EM)ș WVRPǔ PEU WVRP譔 Phw#jj h6"RPj}WJq @u h"jj h6"EU RPjEPq @tjj h6"EM)ș RPjuVp @tWuSuh#sEܵx 03%WW$VEPh#,*}MЋ] }tajj h6"SQj]Slp @jj h6"EȋU RPjuV?p @VSh# MЉ]ԋu؉uEȋU WVRP9 PWVMЋ]SQ& Phë#}"Mȋ] }jj h6"SQj]So @Tjj h6"EЋU RPjuVuo @'jj h6"EȋU+EU RPj}WBo @WVShګ#M]u؉uEȋU+EU WVRP5 PuEЋU WVRP PuWVM]SQ Ph#W}MMȋ] }m]m]jj h6"SQj]Sjn @jj h6"EЋU RPjuV=n @jj h6"EȋU+EU RPj}W n @Eu 03%QQ$WVSuh?#uhE#|M]u؉Eu 03%RR$EȋU+EU WVRPސ PEЋU WVRPĐ PWVM]SQ豐 Puh?#uh_#5$uXeY[^_]aU Ph|#h,jwUWVSƉUσ=D;2u'jhD;2b @;2ZYuh#ic[@;2Xi D;2}u)VUP[ZYUub`VUP2ZYUu9Rhh@72苟ƒ @72uPhg#j蓵 K k1e[^_]UVSƻ@,tPVZYt%Vh#503X3 OC St8tPRhϬ#z Rhڬ#zZYuj 3h2C22묍e[^]Uj蒷X=3t%03fPftjh?"P jh<2;N UWVS=353ÉDžu¿#RWh#503503fPhPh,5$y'1=u2Sh#503EL-fDHfn,f?trfauH3Sh$#503 (fptfqt#1҉3503hG#m Y[C1u2Sh#503 &SSh_#503e[^_]Ã=u2tO=3tFUVS53331ɉ 31U533u1҉u2[^]1u2U[2jtZ=3uj}X3t|3jbjh`<2 L UWVSxEUtk1ut=tuP-DSt1@֋]څu$EE%@ P-t L-fBuӃ}tgh 3"[ƋE]tC1ۊ43t8u9s&H 3 CuݍHȋ])=~ E봉EE} %Uй 1]1 3trtl$t\uF8PuQ@@x0~-H8tWDЉ\C8tu\:u;81ɉLЋEǸ 2:[tL\t$ HWыu)@,-x$uvXP-DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2P-DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5P-D^tS@0uU tZBGOu)~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP EE503h##yh EXZ‹Ee[^_]USEU t~M譣$@,03tRQhׁ$Pm_"PhU#h X3ZY/t!h2h?#50301X3 B]R]UVS]53u92twE 3u13@,8t 9XtSha#jM @u=2th2PhϬ#s Phڬ#sZYu253e[^]U}u膢X3]ø}#]U}uaX3]ø=$]fU}u<X3]ø#]AU}th@2h#503 X3U}th2h#503 X3U}t诡h2hή#503z X3UWVS1}uEE PPEu THt}6h#E PEP uh#E PEP t}E pXE Pu !3 3t!w#tVWjVjjhRSySuX X3e[^_]U帥!}uc"]U}u ǖhί#hׯ#h#5031X3UWVSE]uu1҅‰uTpuCE xh!WOZYu u0Hhc"W2ZYu1t/c"* u븥!PVh#503e[^_]Uh#h3u uIX3U}u͕X3=3t03E E#]BZ ]Uh8#h3u uX3UVSE] u1=33u{!yt Ksh!V#ZYtBhc"VZYu 134V۾^shG#503 맣33노c"Phh#503 =3t53h~#503 503h#5Y 3Y[t1҉,3X3e[^]Uh#h3u uX3Uh#h3u uX3Uh#h,3u uX3=,3t13Uhİ#h3u uMX3UVSE] t~ Ɠ1=x3x3u=sh!VxZYux3hc"VXZYu1x39s>l2^hsh`;2t3`;2x3 A l2t3c"8u "QPRh #503x3X3e[^]át3t8u503hհ#bW 1x3ZYƋ l2!Uh/#h3u uX3Uh8#h\3u uX3UVSE] u Nuosh!V!ZYu3 u2_hc"VZYu1ɉ 3 u2HV軻Zy$shT#503 1=33 u2t ! 1c" u2PQhn#503m1=3X3e[^]UEu\X3Huh#E PEP tЋE phı#{aYZu9=X3uJ=3t503h#U XZE phñ#=aZYu2212USUE X3u c2Pt ]鐐pYtePq Z@u Sh˱#8H@ض=2t"h2hܱ#503)1ɉ X3 503h#T XZ]]]UEt~X3=Huh#E PEPM tӋE ph#%`ZYu 2USSEu觏X3Huhz#E PEP tu2hOjE[Xjh<2;3 XYE tE ;u1ɉ u2jju 蚯à uu=u2tڋtSh#S_[Zu 2E =u2u=3t331ҋtu23tuj(XZ1ɉ u2]UEu}X3}Ht}6h"#E PEP追 uh,#E PEP褽 t}E ph4#v^ZYu!E ph<#_^ZYu 2UWVSUU] 3E=3t5331ҋE _¡u2t@u253ujΗZY1ۉu2EM9t EPȮXe[^_]UWVS}u <jj耗 iÉXZS)v CYujjPh"Ϩà u~&$j/SI _ZڅtPhRW! =3t6503S N 03HQPY^y Pj Y^ J }~j5H3h ^"WS  jWS Sh#@X3j蝹~Py. Z9uWjo[^WjcZYt1 h#@XX3e[^_]UWVSPEEu蛈X3%Hh۲#E PEP EwɋE ph#X^_t 503h#L Y[}h#Ar Zu ]E XSh#_XS1 t뙃}h#q Xu ]E X Sh#XSy1 t-U}u"E X Sh#WSG1 3/e[^_]UX3}tF=2t =2u#í=2u03E E #K h2hF#5031X3 UX3}t׆=2u#<=2u03E E#JK h2h\#503x1X3 UEuvX3{Huhq#E PEP tӋE ph#VYZu9=X3u<=3t503h#J XZE ph#ZVZYu 2UEuمX3{Huhq#E PEP# tӋE phݳ#UYZu9=X3u<=3t503h#J XZE phܳ#UZYu 2UWVSu huSȶ 9}1hE4SF 9~hh$S GShg#?UY[Hu jNZ2e[^_]UEu资X3/Huh#E PEP tu uh6"- UEuiX3/Huh#E PEP賳 tu uh# UEuX3[Ht}6hs"E PEP_ uh#E PEPD t}E pph#T USE3u螃X323Hu h*#SYE ph5#SXZ3]USE3PvAX323Hu hC#xSYE phM#eSXZ3]USE3uX323Hu hZ#SYE ph_# SXZ3]UE} tu萂X3=3thg#RXU} t}uTX3Ã=3t jjXZj`Y=3t jjuXZj豲Ujjj螲UWSREEuX3=uE Xhl#k Xu]Sh#RSk1 e[_]UVSEu0Hu YXh$#JZu2212USPE] uzX3=2u03E EB#fu@j EPs xM9tsh)#503茳 3333 03 uM EG#]> RPhb#QE]US3}uFyX33h#I3X]USEu y=u2u503h#= XZH~}~hƶ#E PEP3 u밃=3t503hѶ#E= Y[j E pku2s2P%u2 u s2c2kPks2Bs2ks2,Hs2tz,y h,Zu!503h #(,P,< u$u2k9s2uP{{uPKoC닡,P,8 t ,yh,Y t@) ,yh,dZ ,P,8 u503h/#u2ks21X3]UWVEu DwhHuh#E PEP蕦 tjE pƉXZutWVE ph[#503а9X3e^_]UEt~ vsHuh#E PEP tjE poEUYYBu@t)EP)P6PE phd#5034M;MUX3UEU u#vX3]Hu Ej#]aFBE Eo#]NFUS] h!jSu`tsshw#503袯]UWVSVEuu.Huh#E PEP t݋E p[u X3zh# |Yt8uՀ!RUÉ4$|<$谩WURP踦Wh$SoWVSo(Sq 1X3S藙V葙 e[^_]UWVSEt~tX3Huh#E PEP th#F{Yt8uՀ!SBǍ@$|GWS@P=333EU313333jjhw#M qVhr#c=3EU333(V菘Ze[^_]UWVS]} t s7h#V襜ZYt.h$V蔜ZYth#V胜Y[t뷻wGZttu2tu25u25u2h#503'1X3e[^_]UWVSPU} uRUyZUuUE #03Ee[^_]֬Ë@t P艗1ɉKXWħCZ=3ttP3h#503藬e[^_]USEU X3t tt<]r,t8Cu6"PRj h#5036jrr 1X3]UVSu X3}t e[^] rvxXuvh#503ͫ,Ct P耖1҉SY3h#503覫1X3 e[^]US3}uqX3<=2u03E E)#]6 3hV#A3X]USEU 3Hv4qX3P=2u03E E[#]5 3Hu h#JAYrh#:AXZ3]USMU 3AvpX3Y=2u03E E#](5 3BuPh¸#@XZrPhʸ#@ 3]UWVS @Eu} t.pX3AHhƶ#E PEPu tЋ5u2} 19~j ks2Pw t*Cu%wh#503褩X3 h@h`2P5 1ؿks2X 9XrP-DP@tC`2<$t<\CFC P-K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP`2)PE 4VCE 43߿iu6CDžؿ9}~)`2)PE 4VE 4(ƃF;ru20oXu 503hu#u!503h#2 X3^X~ t=3u 503h#΃=3t:503h`2g2 03HQPYYy Pj RYX J j 6R)u2P5u2V =3t3~t-03HQPy;P| J PjީXZh@Ph`2軞qu2Eu2E 9XCؿt G9}ce[^_]USËt Ph1XCt PV1ɉKXCt PC1CZ]USd[2jyX=3t>OPh#jd]S0~!03fJftPSR-V jh>2^ USdjlyX=3t>(OPh6#jd]SΡ~!03fJftPSRU jh>2 UWVSƉӋ:j:WwYZuWhP#V豦 :W耠PәYZtj%WvYZtWhY#V{WC uf{P Huf{tCPh#VI h"V;XZe[^_]UWVS ERUѩZEE0U;OwuCuRSDi uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P1s_stVY1Ct P1CZe[^_]UWVSljӋu3u<MP^wEPMQSW螪jFw>yFE8 u@Euhd#蚷 XZ,HEHwuE1e[^_]Å8UWVSH%Pt=P-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u h}#js ljjh#Pg uW1ɉK fCPjh#Wf uWC fCjh#Wf u WC _t36v CvCF C FfC (Wuh#輵 Ef: j/RUs^ZEUu R蛜8)ЉUHQM!ƋMQURP&{ uEubCYj@VrZYt_{ u1҉2Mq@P2j:Epr t@PMAYE@E@tu[uvVj]RUGrYZEtH:UttWuVh˺#)PERVNMVu WuVh#tEx:u-u%p/Uj:VqYZUt>t3 3ׄtK3Gpj EPVݮ >tU:u PvWuVh# /fC*C tt5p2u5t2t6"VњCZ{u${ t$P豚CX1e[^_]USZKJy ;J| t Y RP1XZ]UWVSP1ۉDžfDž1jh#Pc jPG#CZY@tt8tt8uVh-#覲 uDž8tj;PU [_Åth>#P芍ZYtChF#SyY_t>hN#Sh_ZuhV#6 [gVSh#Dž DžsDžVÉj@Pno t1҉2@PYj:;o^_@P輘[H8?u1;u11ۃ/j/S~ ZY9u$uHsjh$Sޔ cu)uR31ۅ%pu'j3u911ۃ=3Džt*1;t%h#SQ\ZY11u @11ɉ>t+h#V \_Z1ɉ=2=3t jjvXZ=2+EhPW藓1 t1ɉ31҉3QPp33YZu u*!#Hu9z uWh# u Pj踾Pj艾Y_t ;1$j/S>l_Zu Jx;hh%RQ1ɉ 2Pj=2u/; =X3h,hѻ#$ XZt>ut>uGt>t݃t3hSS蛑hh$SZhVSvZ$hh#Sd1 tL531ɉ 3=`2t hh# hho#S Wj;53Fd2uj/Vy [ZtP1ɉ=`2t WjWjXZX3-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh>2 ZYu PG#Y[@S]^K<$7Zffu0t#;th#SZYt h#3t$?t?u+u =d2uh8#荪 W衑Y,,d2t <,j/P+w _Zt@,P[Z PHYd2 t 8uth^#c1=3=333DžtDžx=`2t0 tRPZYu33D3#,h+A"PA^_44u ,4Pחt$PwY[u/tx3353=3 t14Pu1҉$WVPy,Ph#=3u=u2<u2-,Ph#503茔 33 03 u503j } [^RPhʽ#QThSh=2 2=2p8-/@dj VPV 9pd8/Pdx*u,j pPR pd83 3Gh)#R#d+tXH ׉dR(s^_Džh8HR`yYtxa#dtd軁2k#dt]}#dth~#b Xr#d`ujh#< ^_p@9#d't#dƅu #dutPpYVZt<oZu&J3 3h#U _t 8uh-#ڡ8>2P8>2~ hX# ^}31uQu2P7ZYu SnXh#ڗ XtSхtXSnXOtSnXt rn_t ]n[uRh#DžDžDžDžDžDž 9d2u h"P/ZYu Dž8X,\ 8|uQjj VY[ h!@P4 ^_88u @Ph#Dž0)8633 !At9Nj}3uNuE3 3!F9=3X503h# XZAu t=3=39u 9t Ph#裕  h[C" h!P^_88u Ph7#Dž0)h?jU_ZhjTY[<2t9u2tK<2tPk^u2tЁ~=}<2P{[<21ɉ 3 $33@tPjWTXZDžjT_4P5<25<2 u h,#10jP5<2fƃ <29u hN#踐8"ty-誐"<2R)Pha# ( u @;t+h"ֈY[t$hs#At@ uƅ=2u 2șu<21jPXZ؉|tL𙋍|9Ή| ||=3S|19=<2|19lj||Nj4PWj5<29ǃ1 3$3|)ډ|8<2@DžftS7. uQ諎tڃ#tՋ9 PhX" [^4Pj_h)u뮃=,3039 3$3|#3R>WYU)Y=2tYjPsXZ++y @B19|@B)R%X맋VN1u%Y4P5<25<2J ujP$#h"5<2萅^_th#V ft=3u 4P~[t`h#( =,3u׋ 3$319}ċ0339|03 \뛸#PjO8$UY0=)xu tjSXZtx1ɉ08R18 $Pi[ _Z@u*tPj$'g$h#503){ 1; 3$3|3 3y )jEHX33 3$39؉|1= 3=$31@u @u"PjNNY[㋅Pj 2=2u 2EU 1oEd2t%h"S蓀ZYt;|tS0b1ɉ d2[E~E@EE@E\=3uE]ËE@tjj褺XZUWVS$} j h#uVnuE1ɉMMuqÉEP{Dj>=X3t ujOY|[2Խ!ȅ!Ѓ„tt jZx[2K!ȅ!Ѓ„tt jXF(#e[^_]UVSu=[2uh#W} X3[11ۉ|[2hԽj<ÍE PV5[205[2h" 5[2Bu2 hg#Vr^ZPƋ|[2Y!ȅ„t tjYSjk<XZe[^]UWVSDžXP3V2V2jjV2P[2 yh#C  u2tjXRjhPH V2<t <=2=253=3u 3h#WÉ53_~It,=3t#X3-wQ503h*#b Y[=h[2h"503g =3X3-v+2hQ#Z=3=2=253=3u 3h#xÉ53_~It,=3t#X3-wM503h*# [^9h[2h"503f =3X3-vtP2h#Y=3u9 =L3t 5[2P503hV#y# #uh#S1o_ZX3$ w=t503h#,V2<t <flpRPdPRRRP`P\Phb#h W2Fj , \`dtk=V2X3$ lpRPRRRPhk#h W2i #V21fV2 Ћ Ћ ȣV2lp ffV29V2YlpRPdPPPPPPPPPPPPPPPPS`P\Ph>#h W2h \t-503h#x 5[2$ [2 \u`u dt 503hm#붺V21fV2V2@ulp ffV2jhV2hV2 503h#F503h}#6h#Sk[^^1ɉlX3-w 503h*#ERpRRRPh#h W2Ig t503h#0 XZ:u:u:u˿V2V2󥋅pffV2jV2PhV25[2YXy/[2=L3wPh X[21P3>=V2%hV2j5[2&[_Zy h'# ^V2=3<<V2<V2PV2PV2PV2PV2PV2PhW#Ã=3^=3Q1҉3V2V2=3t fV2[2tPK _jjV2P) [2 y"h# ^ 3=3u#jXRjhP@ @uh#$V2PhV25[2: y%h#, Y5[2 [2x u2tjXPjh5[2@ DžhV21󫍅hPR5[2 @h#x=2,2=2 2t$=2=2\tV2<u1ɉj j WhStPtPG 53=3u 3WS\hG#aÉ53~5t=3t27h[2h"503^ =3u Iu<t=3V2PV2PjV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2PV2Pjjhn#HÃX1st 3<uBDžXjXPjj5[2 > 5[2 [2X1=&503h#e[^_]UWVSD}[2=P3tWPHjjP* ƃ HPj5[2  @-[2EfEjEP M]ġ3ZZ<ډEUjEP M+M̋EZ[+Ey@Biy1QjEPV l8tl8#th#V2EEPEP5[2 à ty5[2 [2VjS @t?}uEjEPjjSf< W5[2lOY[Quh#o X5[2) [2Z1(6l8\(l8#Nh#j 뽍e[^_]UWVSu1ɉ |[2hj/E[_t=3u@B2K2=3WK2@B253332thPBUPR UBC2 V2V2 󥍺V2V2󥡌[2<<[2[2@@[22DD22HH2u2LLu2p3PPp3l3TTl3h3XXh3d3\\d3jh43`UPjQj`Ph43WQjh 3U썂qPAQ$jqPh 3+Q`3U쉂`3hh 3PPhPh 3P$hh 2UˆRPhÈSh 2Puj,|[2 t1|[2EEe[^_]e[^_]UWVSQ}j/Wu9 [^t#9u jh$jW5[XZ/jhe$ [Y^y Wh#S nhWh@>2PA>2ƀ@>2. d1.F9t@BUUjh@>2ZXZx9U0t8u-Ou503h%# XZ10jh@>2ZYXy@>2F<.u1F@F0볍e[^_]UWVSu[2u/hL#k X=$[2t X31Ee[^_]<fDžƅfPftjjWPt hn# Xhh#5[2W5[20 [2Ã(t hn# X=$[2t X3jZ<Xt(t#fVfthWP jYu=X3(ujtZjlXe[^_]US E1ۉ]hr#ue_ZYt Er##=l3t#E2u=2t=2ۃ92u%hQ#kYt!503h# PjSxXZjOX=3u)503h#h [Xj,XX3 92uh W2h#ZYt}jSWx[Xjh@[2^ ZY!hj(Y[E33 uuuh`$ Hu.RPh# tԋEPj(XZjxXbj $_XE@E33 uuEu Ph`$# Huv [2j1$1$vE$j"(XZjY1ۉ [2uu h#503OTRPh# sjhV2' Y[hj'XZ1ɉ [2hr#u ][Z¡3tt =u2tSjtjUXEt1=3P9X=u2t(MEu Ph`$ Hu\j[뼋Eu(Eu Ph`$ Hu/=u2tjY1=3PZ=u2tCjX=u2tqj]g 1ҡ[2~j1$X=3u06u=$[2tX3 h# XjD8Xj9Yj1[=$[2t X3EPj3&XZ]UWVS1X`3pt3V!1\ 3$333,3H=3t}u=3tTuu u E 8-u}tuh#503Q u h##503Q ʡ292u:1ɉdDžhDžlDžL!jhV2s [^u#jPLtXZ뺃=u2 j9Xh?j$XZhvj$Y[hh"u )Z^_uDžT,1,3E 8|u]jj $Y[lE Xh+A"S( ^_TTuSh# XZi1=,3Džd)h+A"u P[^TTu u h7#Džd)Tfzt T@xRP~2ZYxE%=tu h.#503P EЋUԣ33?jhV2 ^_o53=3 h#uXZYth#uXZY2twCTfxu TjWVP T@jWVPjEyu h# Y[X5353h# 6DžLw#}tEuuh`$a H 2LZ\\uOuhg#^_뽡tU2t9u2tKpU2tPE9Yu2tЁ~=}tU2PHZpU2j)"_l@ujj !Y^l=3t=,3t =3y 31ۡ28\fxt \PTfyt T@S525tU2 pU2F uu h2"o XZ^8  3$3P ta\`RPP)G @\@ @ 3$3TXRPFPY^@uzt[pt95 3$3|@03#.503&_pt3pt륋\`RPj mF @uu!P\@ @u 3$3pt 039 3$3|03 T@ @t,ʸ#s\Xu h2" XZ\@ @t"`\`IhE# XGjXdtdTR^1T\P B1ɉ\ $Z[zhPjXZDžh=u2u X3c[2xP X[2\t\PA^1\j[X31; 3$3}jYh@u l@u"hPj\XZ㋅lPj J^_[2xP [[2du \u)TtꋅdTRY؋\P@XH,31҉33 3$3e[^_]UWVS1,4(03PT3Q#1= 3=$3L33,3 \3hr#uRZYDDu =3uVu=3t}t}u&E 8-u}tuh#503/I 뺋E Ph##503I ɋDtE uPu 1ۉ8Dž<Dž@1=T3uDHjhV2譲 ZYt=u2tzjXh?j/Y[hvj!^_<}tWE jPK[^E j/P ) ZYX8tNX8 tDE Ph# [^X3. E h"PQ_ZE 8|uuU $t,e$%E 9u jh$E jP[J^_/ jPLJY[n=l3t %X8 uW@X8 u"E hPe _ZyE PhX#6=l3t 뽃=l3tE P}YE D2uJugtWjjiXZ29u(ju/^_33X3=ujPiY[@ujhV2蹰 $_ZbDu}u-k33 tRPh# ͋E8t8Puh`$ Heh+A"^00uuhg#Y[ȃ}E h"PO_ZuDž(X,15,35\3E 8|uXjj v_Z@E h!@P Y[((u E @Ph#A15,35\3Dž8)=E uPEY[((uE Ph7#: XZDž8)(fzt (@xRP\'^_@tE%=t1ۉ,3\3lU2t9u2tKhU2tP/Yu2tЁ~=}lU2PD?ZhU2j|X=3t=,3t =3y3$1$2Dt@33 t/(f{t (IjRPQ-:52lU2 hU2(fxt (P0ft 0@$VSW u03T8 u 3$3hi#` ^ڃD3 3 (jjjP轎 11y4E Ph# Y[1,RP<[Zt׃ t;533(|jjjPU 떃  3$3$ 3$304RP<XZ tl(,RPj Y< @tz(@ @unz04RP;^_tA UL@L Hu (,RPS; @uq$u{PT9ȉ03#503sYPT3ډPT 3$3띃 3$3PT 0395 3$3|03 0@ @tJʸ#Q4Q8 u 3$3 hi#达 Y݋(@ @tUQ,E PhX"蔾 XZjX8t8(R^1(0P71ɉ0 $T[Lu 3$3y3`LPh~#503,@ 503h# XZ뾋D$ u=\3uj6 _苅8=)ju)[^X\Bu@j`S ^_X\lp1tE SP ZY@XPA.$L+‹E $Ph#503H?`jhV2; ZYt$X31; 3$3}4jX Y*hj^_=u20P+[벋<@u @@u"h#W@ZYEt ue[^_]o2ø"=3t#Ph'#5037 ,t$=3t~ tPg2PS92 SQ%YE ]e[^_]; QMZƒMuQWhV#5037KSu QWhr#ދ}u#Uj PMQ.MMEPjUR rPj h#5036릍e[^_]UVS@2 u2d3$t!uItJuBd3H31d3P@2,8!, u @ ud3tJt d31&d3H3 tGtBB@"u\uXu@!@B؀"@tՈButB u2@2: u2@2d3tHt d31d31H3[^]US@2`2 u2@u21ɉ d3u21ۉX1u2{P5u2/XZtu2@ڋ]UVS 03=3t,SP薿 $^Z8tPhd#5034 503jh@h`2h,\)y}uB503h#t.=3t 03Hy Pj 7Y[ J Rx=u2?u20ZÃu 503hu#+u 503h#x t =3u503h#蝾 [^1ɉ 3j 3uV}+u20P5u2S =3t3{t-03HQPy;P| J Pj86XZ{ 9qhhjhj e[^]UEt]1]US]u h#j SZu Sh#j @]U=,u ,03fPftP] Z9,ÍL$qUWVSQ@3 ,3 jP +|33_[+ 3y @B2%ڽ߭ݕ 3$3=319}a؞v3߭ٽf f٭߽٭؉ʃ" u6"1"WPSQh #hP\-ٽf f݅٭۝٭Q~:Qֺ6"t"RPh#)PP,Ãօt Ph(")PP,Ã<RPh'#)PP,؉1ɋ9ϋ}'t' @Ńu4 &%%y)Džkdd%1 P%1҉ RPh2#)PP2+8 3$319݅33t53=39H)߭߭ٽf f٭۝٭hF#)PP)à t!Wh(")VP)Ã<RPhN#)PP)Ë+p3t3Ɖ׃x39}19},hX#)PPL)à h?")PP)؃ u03fJftPVR eY[^_]aUSy=1; 3$3}6=3t%03fPftjh?"P jX,=]UWVEE왉U1E}ujEPj e^_]U0E E1EԉE؉E܉EEEPEPu,4ƒ xEÍL$qUWVSQ@@u5jh|3 p3|333h3l3XZjP 33 3$3+p3t3_Xx39}39=h3l3sBp3󥋵5h3=l31w~s9؋}gWPhd#hS&03fJftPSR jjj-jh3ʔ =,3uhjjujjj =,3l%_hA"P> 3Y[tPhg#hP%x3319߭y2%ݝ݅ 2%߭ٽf f٭۝٭y1d~dVh#)P=P%Nj(3~-3t P-Z)Å~:ùdh6")Sh &Ph#)P=P$ǃ119ʉst @u4 &SQh#)P=PY$+|33+ 3y @B2%ڽ߭ 3$319ظw ȉ߭2%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4 &%11d PVSh#)PP"á339lj 3$3)ލ 9lj݅99Ћ}h#VQ!à +33߭߭ٽf f٭۝٭?~~h#rtPh("VQC!Ãh$VQ0!à <ЙRPh#)PP Ãuh?")PP à 03fPftSVP eY[^_]aUS65j(5X]á3@ `t1US3HyPMYu1ZJ,ƒ uɍPv"u|33HyPZuJ"\u%3HyPZuJCC3uh #7 Y333HyPZu ZJ, „t@Pv8\u"3HyPDYu JCC3uq,=3th3P+,ZYuC ߸ ]UWVSQƉUh3P[_tHj.VG[_1ۅt6uPZYÅu#)Wh3V7 u1ۀ31ۉ؍e[^_]À=_2tUWVSh+A"h_2"3^_u"28th_2h&#' Y[1$hSq_ZyƅEj.S~[^pu Džp6"1btH uuzG uҋp2uSpEƅt1;4 3*%u_3uGE uh37} h3P/*ZYtE thW#P*[_tB3fPfttRPZYx|?th6#4 h_#w$xAE85h3}X 3fPfttRP[_x"|?th6#,4 h#"4 E8h3}z=3t53PYt u 3Hy t u503h#Jɋu2u503h#Xks2s2s23HyPLZu@JP-DB@uGG9u uu2u3s2c2=3HyPYuJkPks2Bs2ks2s23HyPZuJ< u6u2ks29s2u@u2 {u@u2KZCh3h#F2 _X3@tR[503h-# XZ53Y 503h#ۍe[^_]1US]P-uhS#S ZYu2DB@tCjh#SJ u 2UhX#S ZYu 28ht$S ZYu 2hd#Sq ZYu 2]USZKJy ;J|< t Y RPZY]UWVS3=3u 3h#i^tIhi#h[2ZYƺ9¸} [2.uh[2Vhn#503jh#h[2 53tjhq#h[2 uSt 2 212j h}#h2 t\h2h?#503 Bt 1212t*j h#h[2<$ u503h#莦 ^_222222[2'hV#Y1u<2u 1҉2@u21[23e[^_]U塈[2tPX1[2322=2u12[2122|2tPY1҉|2=3u1u2U[2j X=3t%03fPftjh?"P jh3Ʉ UVS]*0jX=3tf[2t-fPftjP 5[21[2 [2x jP 5[2w [2 13jrX=3t>[2t-fPftjP1 5[2F1[2 1ɉ 31|3jPZt Sh#j *0e[^]UWVS]3=u2t =3u$u 1ۉd3`3Pu7=d3uEd3d3Pd3@1ɉ d3=`3h52V} /thh$VW hh#VDV_yVh#f XZ1pP =3Xأ353,313,3} t1=3P襼X!EEt!jjRPPhI#[C"ҡX3-cvt[2} t1=3P;X=353,3h+A"V`3V^ =`3uuh6#M+ ^6#5`3hh`3+ u5`3 1ۉ`3j h`3ZYu`3e[^_]UVSQQMq3=3u 3=2ut9503hV#s Ph#YZuBj h[2^Zuj UR@P) M te5P-DN@tVu=X3u=2u1ɉ 2t=3u503h[2۠ 03 XZz3eY[^]UWVSQ4MY=3}=X3}=3u 3=2u}503h#^ fPh# ^_j h[2ZYtj.h[2^_th[26Y[2uKjh#V u7Vh#503"f[220h[2h#503[2 1}VZtVh #503 EPh##V tEEP"_uu 3u\]3gu=X3u=2u1ɉ 2t+=3u"503h[2 03 XZE3EX3eY[^_]Uuh0#j2h 3 u hJ#jw 3UWVSP}u jjh"jWhx#V ƒu&Wh#V ƒ uWh#V ƒ USjQEe[^_]Uhh209 ZYu2UWVS253X3=3u 3hN"荩_uSj h[2wZYtA8thUWS$]؍U1EEEEPSh[%u ƒ1uu Xe[_]UWVSu] }VuS u1N tuL#tZ#fN lSZHˀ; uLUJ9uD ,y h,Y,H , t@u҅tl#ff t1҉e[^_]UVSQuh`2H[á03?vPh# j~uh#P4 Cƃ`2 1҉UUR@)Ra2Ph,yh#uh#503 ju219u2 U e[^]UWVSD]} Sj j VhRuW+ t&hh!Rj h!Vh2tzW9Vt vuvvS @uT8jjjhSvv thh!S x8Sh# Y[4jjSܺ ƃ u(PPhg#h#苆 PjS螺 @uPPh#fDž=3~"jPz 3XZuWS| @8$}u8A^PPh׾#΅ >jP +‹Y_+y@Biy1fDžRjP uY8u=3~{8#tLVjSS ƒ 1BPPh!nu< tQDžPPhhSx @uM; e[^_]UVS]u SXu ]e[^] ߷ UWVS]} KyCS8Xu?C u8@t48ufc 8#tt P0e[^_]UWVSu }EÃu3F u,@t(k8uff Z8#tt L[^_]US] h=#SYZ¸t,h[%SYZt;uEuh5#O XZ]US]SZu ShY#j ]U u h#j US] SuE ZY@u Sh#j ]UEu h#jm P¬Zu h#j UWVShuE ]E1҉UUUt PEXt SE_=2tIEt P71ɉM[hW#nEEZt P1EXhո#PGE[_EPEPEPVy$X35c2 ZEUc203t\RVh#P1ɉMEPjP]Sh,}yh@"uh#503X31Vh)#Pz Sj=x3tTRUAÉ4$7|<$WURPWh\t#SWVSE(tP_]uh#}[^t^}u-h#& Yu]SES1XZuh#1ËuV1 tts;}u-h#IJ _u]SESR1[^E8uh5#< YPh#蹘ËuV1 EtPh#茘_Zuu|23^ux35u29~Lks2Ph# ZYu0h@hѾ#h`2hWu205u2jWC212Et P-1EX]tS<_1Et P1ɉM[]tSZ1EtPXe[^_]UEuX3=3t%52hB#503X3gHhv#E PEP6 EPw=x3tl2uE P t2U u#Jt3t8u hm#j RPQrZY=x3t"=3t5t3h#503 3j h=$h222j h#h2`2j h#h@2r 2$j hW!h2T2j hy %h292=3tjjE p UWVS0u=3uue[^_];]ȹ 1SjhV蚢 u}uVh&# S跣 1E0ES蝣 XZEče[^_]UWVS,EPu EPsB Uȃ u> ỦEЋE0ufEjEP谑 3EUXZ1ۃ=3~yjEP茑 E+E‹E__+Ey@Biy1RjEP u8t8#tu<_z1҉jEPVɭ u ^ yO8EA8#7ËU9} )‰UEuEX؍e[^_]UE]UE@(]UPEx$tEjURjj0 1USju轮 [Zxj0jxZYu S耯 Y11҉P$]UVSPuEj0jBZYt,0@$jjVۮ jEPhhV5 ؍e[^]US]t&S13 sGs?S91]UWVS(]=3~jEP聏 3EU_XEE E̋C t 9EsẺEЋs})C C)E}1u)EEЃ}uW3; u=o 8a 8#S C(I 8u5C}9{r:T}|D@^uC, 8#uPZYCEЉC{uMEЉC 1{UfE؃=3~;jEPB E+E‹EY^+Ey@Biy1n 1҉VjEPY u Q 8tG 8#t= C(9ϣ53Phd#503} <C(<1EЍe[^_]UWVSQ} ]{uhuCZC{({,CS 9Sts C)9G1s sSjjEPlu{(uS{,t{uEKSBCEC9Cu3pVsZYu  C(1E&Cs} {s}MC Ee[^_]UWVSSu] }VuS u-~,tuL#tZ#1ɉN(YSZHˀ; u9UJ9u1VjjEPXt} ut#1ɉN(t1҉e[^_]UE Pu~ j9 UE Pu~ XZ=h3u h3UE Pu XZ=h3u h3UWVSSƉ׉ˉʁv )…tRUWV tUu8؍e[^_]W|$wUWVS|xˋ7GEGEhE_u h#hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}u}tp}tj}u^Wuu EE)PEW|= u h#\XI1ɅMEEU1EEEEu4}uh#8_XEE$$ &U:tJ1u9u}uh,#[^}hI#h3YEEUBUHEjjj[E ]U tt hc#OBUHEU:t h}#+BUHExU2uBUHEXFE7U2BUHEU  BUHEujEu U:u$ Eu U:u BU"u u NEHEj8h#jEP=u dh#7TjEP-?E_ZwV$d &Eȅtu}%)Nh#YEEZh#h#h#uh#+MȉXZu~+Mȉt] QtuuEtUx 9tth'#'[}UM}uEP_[EEE8v9U];t hO# EUu}ugw}u Eh?#U];t hr#EU}x1h# v EPe^Yuu|XZ}tuEUVEUe[^_]g_W|$wUWVS\EUMhhEZYtu h#U1󫾄 & }Ej8h#jjjj5,R5 t(h#uS 1}}djjjE 1uu11}u/ڋEw=EU]E}uKhuuĢ y h0"qtvPEuu蝴EMș׋EEM jEP菓ZYdKM)ىMڋEt;M9u41MU]E}tJjEPAEZYvh#Ah$Fu{Su EEEPYt%h#0u?S9 PPPPEPEPEPEPh#hS ,ڋEth$n_EUuSXZ]EUSe[^_]g_UWVSEU܉M=,t h#3 Y1҉,jjjuBu11@tGjEPu諠  uu h%# th%#X1M1SQM]uuh?#F E1EUM]Ή)׉u}u܋} ߃1 tL}xA19ʉ}u}u}1 tiE1-PhN#j]S` LLD.ShU#hX,Q uh" $e[^_]UWVSǍxPWb^Zyh![1E%1=uUЋ]ulSYlu h!!2=l3t1h[#TځvRhQlWٞ tht l)u)Ӄu hc#Z/w ht#h[#pPSG VXe[^_]UWVSÃ=p3jP膞 XZyShj!d[_PVZYtV* Sh#0 %1=u ThSP$PCǡ ,9},)ǍW5,OZYu5,W= Y_t3 l3uSh#(jPVU t@uSh#tSh#ljjjV=t3u[=l3uThh P; ǃ uj* j XZuPhj![_g=l3t1ɍP3Sjj1ɉUV藝 t h#YtWz Zt h#|Xt3u,u#u P1_Sh#n[^jjW8 ƃ u Wh#xPVZYtWh4#Vߜ 9u9t2RPhY#V蠜 P$1S1V耜 DVu jP舛 ZY@uShj!c=t35,Shׁ$hR =v ,)A5,=t3u:hh R ƃ uRh#h, Ix蓛 _=t3uV胛 Y@u h#ZS/Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RP F 5'35'3h #j: ؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh3M t Džh3)ȋDPS4F hY[< u5'35'3h#Ph1hn))=w(SXZDžh3Phh3S 5'35'3h#1_1ss C1C1҃u\#u~nu '34(3@ fL03L0354(3_1+(3='3u8#uxnu '3M 1M I t(3'3t]Ut @uKf (3-t(31ɉ 8(3=L03;G L03'3t1BJM pЍe[^_]U(3@ t=<(3t/=@03t@HyPWYuԋJ5(3P7 XZ1UWVS|u=(3uQH038u==<(3t h#j蓠 (3,'3 #'3X,'3! (3(3tQHyPZt@ J5(3PW7 5(3h(3h(3ź ÃYB(3=,u 1~1P[=@,3tdh@,3Eh@,35'3腃 t $!&\039p03r\03kP5`03`03XZ=p03k 5`031031503{u5'3sO Y[ =l03uuu =03z 03t503CPj V\ u03H @))Ӊ03SPV1r Ij503503h03;jjh?"h03j503503h03Fj503503h03\ jjh?"h03Aj503503h03) 5'3sN 03<03@='3X,uX=,u[h|Q"Zt8tP" ,X9TPhht@j趹 uVft,,<=,u ,t 11<tR<@PPlHt%tv$@P 1DžHP u?F;5,r5'3h:$M ^_5'3j$ 5'3j 1.WlYtKW褰ǍZ;,r5'3h:$BM ^X15'3Hj@ĔtfWЮYtZPh"&跓_ZNj,'3t;,r5'3h:$L XZ1@HЉ0,Ph#5'3 ,B 90uH@)< F;5,r5'3h:$L Y^5'3j$_ 5'3j R '3@ @¸:tPzP5'3hpE"j胑 '3 03u45'3503j503-=03t5'3j XZjh03g^_1ɉ 03jjh?"h03rjh03,@=035'3503j503萒=035'3j / XZ=03r03=03BHPj WY ƅt*034)0303H85'3503jW=03t5'3j Y_803403'3 03u45'3503j503薑=03t5'3j 9 XZjѵ \039p03r\03kP5`039`03^_=p03k 5`03CFPYFG=p03%=03CH@u. d03t$P9Qs@'3R5'3Ph#j 503j1ɉ@9^Z"1ɉ 03031҉HLC0tZT03uH 9Hu;Ptj0Wh03CP QT03pP @9u9t)HL1LH9L}jjQh03T03PHσ)HLL'Hj@$YZ"L HjHWh039Q tUAQ )HLLHj@YZ T03QNu9AuAQ 똋 03j)ȋ5T03PQh03~CP T03P @@DjH+@P@Ph038 t03󥸤0303030303t󥡜0303Cxt45'3503j503&=03t5'3j XZsF uq=03u~uhh Pm F @t"503503Cpsk ;03t Cp jh?"CpKk Ht1 h03=h031h03[=03h{uhh sul C @t503503sj ;03tshg#ja jh?"sj Hփ=03ujjh6"h03o\03󥸤0303030303\=0303Hw{503=,t 1x0303039IFTu@1*jjTPkH<9Hs B@9u[0QPV8 0uՋ@9s3<jp$(Pht03.<jjVht03 )H*t03󥸤0303t0303t03t󥡄03t035'3h!5'3蔸 $'3 03u45'3503j503=03t5'3j c [^?Cv1s l03ue[^_]U塀3txt1҉P x{u@jjh6"h03US];] ttCtE8t1:"u#C@؍e[^]USP|Yt@Uv‹EBu Sh$#j ]UWVS Ek<`,Ex19~BURE@u9 2u19)VD PRckE:32`3&3Ƀ5<3aX؋]#]US]E U$(#&1Ƀ=3i3 3 w35k3_h'`$h3腭YZ3t=3t h &Z(3 -#53`X؋]Q]Uh蕸31U1 13j P1U1 13jOd1UhhM#h3nE Uhhb#h3GE Uhhw#h3 E Uhh#h3E UE.tgzEEPjjpǻ UE.tgzEEPjjo褻 UE.tgzEEPjjf聻 UE 0\_Ph#jjc`UE.tgzEEPjjhW UE jUE jީUE jĩUE j誩wUWVS]h#7^1th=#PZY{19~'C8ufP tfP AՍe[^_]UU ]UBU ]U'U ]UaU ]Uj`U Uj`U Uj`U U>U ]U@3,P1RP)U@3,P@1RP)U@3,jh)U@3,jh@})Ujj\1UjjL1Ujj<1Ujj,1%,Uh#b Uh#b 1Uh#b U@1]UT3j1U=1]Uj/1U_21]U{01]U+1]UVSu] h6#C Zwt @t2E0f~ufFsHPh܂$h"e[^]Ee[^]#UEU ttu(X33  3]/]UEU ttu( 3 `3  3]]UVSE 0ڸ{uh޸#_ h#_ XZjSh޸#趞 jSh#詞 1e[^]U:3=:3uh޸#o_ h#e_ XZ%jh:3h޸#T jh:3h#C 1U3=3uh޸#_ h#_ XZ%jh3h޸# jh3h# 1U3[=3uh޸#^ h#^ XZ%jh3h޸#蒝 jh3h#聝 1Uh'`$h3(ZYu;3dhh;3h6"hy$1Uh'`$h3ڥZYu3dhh3h6"h+$1Uh'`$h}3茥ZYu3dIhh3h6"h#1U5@3Zujj5@3F US] @3)thmjXZ0ƀxj3Pjj35@39Sd ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} }PfуP19~Pfz fSC9uh#QuR's7h$QuR'CuDSu0Kx9tF( Fat~UCuBEs;?})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{th#uQs$Cujjs uC}S)Psrsse[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @] "U1 13j-B1U1 13jB1U3 1]U`31]Uĕ31]U`3v1]Uh 31U`3E1]Uhک31U`31]Uĕ31]U3 1]Uĕ31]U3 1]U`31]U3qr1]U3W1]U 3 <1]U`3 !1]UX3e1]UE uU]US] @3)thmjձXZ*ƀxj3Pjj35@3(]UWVS ]u t/{u)P/vPѫ t6vWߩC 1ɉMCU9~Y}C48Zt>vP芫ZYt/{u&MVU7MQURP{GE뜍e[^_]FUS]Ct>P~C ZtsPOs 1C s_s{1CZY]UWVSP`,1AƉE1U9}HQG t5fu.O)ljPD PR?ktadt\<-u(=tK=tB-wH=Rt/=Su8t4+=03E9s$ X>t 03|h,j XZCbZCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKsuXxufufCVt%z `~x~Ha (aS9USB CfC> =S=VYv1P-DB'h,j} V^z s9tC Zt sPqE_Xs?UYtF t!u S_Zt Cx~fF ft\uMssC ^tsPEs 1ɉK sTs1C03XZu W_XF u|sgsC Yt sPDXZsmTXCt2Pr1s_$uCD0tPqC1҉T0YEC9E|ӋC4tu S_Xs1ɉKC ^t9P1C Z+uuSu5M6re[^_]UU03U fP]UU1x903~03]UWVSP.503039=  MRPmY_Mu1103603034uj,t-t)903r!DP Zt;03s ,,؋]U513h11303ZU513XU513XUS]uTu PpSPjQ]US]u+u PpSPj(]UE Puj UGuPhg# UuPhg# US ]uuPpSuuu jPQ$]Uh6"uuu uUWVS}513`!513=!XZun},u4u(PoWPjj,w ǃE}t'E8tE$9}u/Y|EE$|9}AE6}Et)~%E8tPZU$D9EeE} u)@E }y$uw[Ej P3LZYtE@M}})ȻEE9~)Ήuu uWQM513R4ÃMu$u uWQh6#513S11MJS 6XMtV5M6L7ZYMM513PSɇ513ZPSjjS f$SkE @PE@PWMQ5133P,S蘈 P513gSP513%u#u(PmU,Ru$u uuP$t6S9eXtSVv6V S?FWPSe[^_]Uh6"u$u uuuuu u/$US]uuPlSuuu jP+$]Uh6"uuu uUS]u1uPlSuuu jP$]Uh6"uuu uUS]uu PKlSPj]Uh6"uXZUS513B513a؋]Ujn US]S hX"\P[ 5m =D3t7S3PhAc$5D3w 5D3TQ5D3n1D3=3t8SPhSc$53Gw 53Q53m1ɉ 3=13uh,hjc$ XZ]UWVS h+A"PWw _Zuoh~RjP<Ph"h,v Sqa jcm h"S޷ _Z؉Ph"GY[#&tCVhS uW7{$W t ;u뵋Ct{ tዅh"R= ZY€:=uZh"S ZYhc$SlZYWSsm ;V@lXe[^_]UEPE 4UWVS 1ɉJ P" ^5 Zp j hc$V uՃ{ uC W# h$W2 VW2 WujƋ;7P} yC9C u=CPW$\_ZuQ YaCPs[_ZtۉC{ CPYGC V=Y^e[^_]Ã=3u U塤3t uPQ XZjj UhX";YYtPX Zt h$X Yhijh~YZ hZjXUWVS 1ɉM܍}1T3j1j1[_]߉jjP:O =T3u:SZxEPj b_X}cjh[^1=T3^ej@3PhZY~>jhːj@3Pqhyjh訐Y^=3ES Zujh肐_XS^u@31ɉ$Hu^&e@3Phg#jXj@3)t]S9WZ4}EEjP]X^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EPvZYu S=\YG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4lUB19t4UWQZYmUBS[_S[^ujS'[Yhj]jYj%uBj]SZYu1h#1 aSSjj^aEPXe[^_]UWVShPVghhg$V0hVWg$hh.$W0V[u1EWJZt/SSSSSSSSSSSh"h 4jj赍Y[ WV`XZ뷍e[^_]UVShPV>ghhg$V%0hVSg$hh.$S0St VSXZe[^]UWVS}11u܉5T3jj蹃_ZyzjVPJ p]@3$*u u^)uYjhc蘌Y[7u>tPZt@3$PX@3$S菚_XEScSQY^S^Zg$g$S_5M6_jj5M6؅5M6Y5M6_EPj }tNhj_jZju7jSY^u)h#. g$g$MZSXe[^_]UWVS}11EܣT3ejj݁ZYxjSPH xpu@3*u$tPV_XEV\][u4EPj ZY}t!hj`jju vV Xe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8PpY$}1ۉ889E SpZ9$PuS,t O]1<%rA <%t)P-< u"DB@CC8uj PPSy P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uP-DP@tC8u$C<^1ۉD3h[C"hg$g D3ZYt$SyPhh$5D3ig 5D36A'=3t#w0YPhd"hׁ$j[u#w0YPhh$h,g j] 1]UVSƉ5M6Rj5M6V5M6YhsPjj{ hWP?hBPjjJVhg#? h$RCPjB'Y5M6 @jPSR)R5M6 $uh,hGnZYt'5M6tPSs5M6OPS|jjS}SW؍e[^]UWVSӉVjHVj(P$P8@  3h3hpt$P[ =,h,hbt(+[ ud=,u[jh%j h,hf@$Z=,t"1҉,h,hbt(Z ,D3tP>X3tPu>X t %13@Whh$vh$uj j jjhi$ jj,H $ 󥁍 Pj(b (?D3t#u hh$Pc 5D3XZ1D33t#u h"Pc 53,Z13h%3l^_uhh$slZYu s Xe s h`3XEt28t(P _tSPhh$ S3 3hh$ jj31ۉ381󫋍$88Dž1 EDž1ɉ zs8/hg$E _=D3t r0TPhh$5D34b jj PJ 9 X8󥋅 ,014,PjjXPh , 8uE 1ۉ#XhVS h0"# ^Ƅu PV$. u1t@ ?uzD3tPWv 5D3: 8uE h"P[ ZYt f W00QR C 1xh$ D3xt SP` XZSj0 ƒt=$E (: D3^_tP9[1ɉ 3 ƒuh8u $t"=thM Z1e[^_]UShhjhjjjjj jjh ,h4y.h,hh$ D3Y[t Phh$ XZjU jP SL ]UWVSEPuhV`Z }uCxPVjY[tE 1҉Sth+A"V^ _XuA h+A"V XZ1ɉtu6D3tVh &&h i$P&^ 둿tt txW=@E X1lSJN pY@ltJG9r7tuvQzHE 1ɉ^dWQEE XZtNp1F1}uSTSq Xu5D3t,Rh &&h#i$PO] }tS; ZSSe[^_] UWVS0u 1EEEPVEP躠 ] 1EԉE܅unVh6i$E܍t0SE)Ph!V hgi$S"X ƒE9E؀8'uE؋E؀x*h$u͝ ^_]EԊp<'uMCj'S-^_E؃}u S;aY؉E؋Eԍ4VuCE_ZOShRi$j, j 벍Jg<%u<@T)IB*E6j/V< ZYDžuV EXuV E̍GE/X}u`_HEu M܋}ԍYtqUĀx .tx uuWc uˋU;2tEԋEԍRUuBEZYUWVE)Phji$E܍DPB y;2tVEXu XoE܋M1ۉ]Shht@jP f}ufEf}ufEPEt|e s+M6EjP5M6r5M6L6Et55M6iFj5M65M68,MM6EڋEEEfmEPuuًU܍Edh,^I tE@ Eu ڋEE]^S4ESAXZ;M6hsPjj{tS9M6ut h?"Xuz,QL_E@;M6u=D3th5D3P hh,P j< hn$j+UpW WWPhn$hn$VU =93th93ho$VT =3th3ho$VT hYk$jTjgV<=83sh83h83h:3h!o$j5hAo$h33[Y hh33h33jjFj jh e[^_]UWVS ƉˋEPh'`$#K_Z6"uup$u ƅ0hn$jPvD thn$UYV"RPSS[ĕ3t`3RVSWhp$PIÃthn$zPPXZ1e[^_]UEE 3]US]S0VZ1ɉM3؋]USPEEPjEZYt=3`3=`3/ua3hSPhȊ$hh3< 1]US]= 13ujXE]EPj 蓯EZYtt33`3=`3/ua3SPhȊ$hh3< `3=`3/ua3赲SPhȊ$hh3; 1]U _ZExN1jSEp(SuVSuVt~tg`PR^[^tEPPR蒡ZYtU64A8t,*A8u"E@t$RPp^^_uh~$EPm9Y[tEXt p$l(h,`d04t:$VS]_Zt'EPV4Ph{r$hS+ \EpFjhr$>ZY@蕒莒hr$hr$S,Vhr$W,Whr$S$WپPh}DSgS蹾 ?Phr$  t0?u'hr$[_thr$PڔZYuJXRh%P'+ tjj h6",4,0RPj$W޵ SR3P- tHLDJ@tSPWVhr$hFP* 蟽 ;31󫍝DžƅDž;3DžDžShQVZ ;3Džf=t#fyf<3f=NE1f=FX!щ11Ҋ<3<3t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VY^ ?j!jAj.jj h6",4,0RPj#R9 (PW#RVhs$hS' Ijj h6",4,0RPj$Wݲ WVh#hSY' 0E@8@}~P# $uJ< uuƄ$jj h6",4,0RPjWH SWVhs$hFP& 4be[^_]UVSPjjuVjjh&&@tbu XtSjjVSjh&&@u S1Y2h$SZYt PuU ^Zu S [ h$j1e[^]U EEE EEhqEPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEA w1h u$w$ ^Zuh$w 2ZYth&&32[^G,աuh&&3b2ZYt\tBJ@u xt@w3@3$t)tVP҉[Xt@3$1ҍ1ɉ9@3PS1YZtXP,40S<ƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx h֏$P; h@3PPh!Vg; h@3PVW(R,[XT`%a9lhGPPh_SVAh֏$S: hwSch!S: hwSD(uYh s$V: hVhwS  PhV$S à ƅG1ɋÅthz!S/ZYu!PhV$j4 à uh #S.ZYth"S.ZYth#S.ZYtht$S.ZYth!S.ZYtt hh$s$ hhV$V hSV ƅGw PV菛à {whg#j[j9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hnj6Su E)s$4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=T35M6舎|h, 5M6QT3 Iuujj_AXZ1Ҁt,DžfDžDž.Dž=v Dž1ۉ11119tD5fDŽ5DŽ5.H5=fDŽ=DŽ=.BC8[ty1t1DŽ[fDŽDŽ.DŽBt1DŽYfDŽDŽ.DŽBhjjjjjjjjjRPjÃ4uDžhuhg#j赤DžPS茐tuiu5hjjjjjjjjjPj菚ƃ4t@DžPV!ZY^Hy VAXS8_u?t6hShPh,T@3,Džc=T3yuT3Dž<1ۉT39i8511ɉ9=T3t9i853t(~SW(YZoڋ3@3ƀy1҉LPTXjSPEhCP@3"P.jShX3!5@3,, 0$4(804$ u1҉DHPWHDFP$@3()l,, 0$4(804 uȉ1DH$=T3 pH DH9jj h6"RPjV jj h6"@3$P@ RPjP D38t$@3VHDPhos$RQ @3$pơ@3$0˟RRVP@3Pjj:5Dž1ɉ$Pj ^_u65@3h`u1Z%$P1$Xu@PT3P5@3 P^@3$JZDH-1ۉ,048DHƂ(@348<=T353`3Y3tu 3h£3a1X@KyuƆy$tP,40W$͋e[^_]UMw1vB ]UWVSDž1@3*)Pht$hS{ ~$t+hg/^Sh"t$h( juh$m@3Ph$hS h$Shs$蟏ǃ((h$Sh_jlE0pf11ۉR袊YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuRXZ=T3CLS軋SRVǃSRjj\ 1jjB6u$`&&v=IC`,tPh;t$hV VhAt$P[ C`,tPhPt$hV CXtPhWt$jW WVyC\tPh^t$jWi WVTST!t;$t=#VPhet$PZ[ CH@~$s$GCX,tS\tPh~t$hV Vht$P[ #z$s$ht$PZ XZt$s$ht$PZ _Xt$s$ht$PZ Y^t$t$s${Tus$PPlZ XZs$t$d1]~$s$NKPQh`$hǃ-1ɍPY1e[^_]á@3*;UWVS ƅhu$Јh!h #2Phu$j$=D3t"@3X SPh5u$5D3G u6hD3Zt PhPu$ޟ ^_jj 3Y[hlu$W*$@3[^1҉D)kSPBZY;PdV( P,P( Vhu$W#TP,P$B$T\L1PL9Ph!HPHZYHuuRS*( V,TXhi蜖TRjPZ*Pn(P V^P1Shu$W" PAVZYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH6"DžHt$M"CP w$&&=11DžPj#M""DžP#z$uM" DžP~$h$HZY҃6"uhLP  t$PLhu$Sy؃RPhv$W8!RPh-v$hRv$-X11DžPt$11DžPt$<@h$HZY@w$XhEw$؂hYk$jWj\1e[^_]øUWVSEx14&&hNw$S SGuht$hNw$S SFjPR^_z!h]w$轶 CC%#C ~$CDC!how$蔶 C C$%#C(~$C4DC8w$hw$k C_4EG8EċUȉGM3l)hp ZtgP h9x .tW Pl;xPh@L3E~@tA3t,9|qP5A3_Zupۡ YA31P5A3q_ZtãA3 1ۉ,E%=utA3@ F<=@tA3@ /)Ph$l5 A3A3<$L3@L3PK A3CA3YƆ@L3A3uFA3fVh/jRPe[^_]UWVSh"/_ujV [^P躥 ÉYh"PX ZYthhPWR =whh$W/ =whVW =wjW _ZuS [ SX1e[^_]UWVShɀh$詀hՀhmx$蕀hh$聀V|53hx SjW53h'&h'&]hSjW53(SfZt PSV< SVlVCjh53C53536jjh.|$轭Ã(xj VP+S腮e[^_]UWVS։ϋ1׋B˃1t.0uKB1t"T3 񈈀T3ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu hx$P=~ u h$W)~ 19tNi sQWV] uΊa<w ~[BjjPbǃ :1ɉPhd@W u u WZ`RhedAW|W`9< RFaPu hx$W| jjW{ǃF s9"hhC3W?@u WXjhx$hC3x u܁=C3usjOh(C3P2ƅ_ OusƄW|u h$s{ CRPh#P{ $1u2jau h$s{ CPP CtC @C wF-1e[^_]UWVSEEuu(&4(& (&K31'&ƃT3@&u1T3@9uT3jzT3jzT3jzT3jzT3j{zƣT3=T3WËT3$U9s}ËT3RUvZ9s}ËT3RU]Y9s}VMZ9rVh6"hdx$jj@ T3EEe[^_]tU|EPuuXY1uE%;E Uh@uÀ=(3tuUh(3hx$j赙 t1T3h3hz$hȊ$hh3 h`3hz$hȊ$hh3w (h3sZ1Uhu.UQ K3 K3u0EEE jjEPhK3jEPK3K3USh$yhyjj h{o#ih{o#'ihx$j蜘 S SpXZ]UVSP]u EPVEPH9 E u Vhx$j- SSPhy$jFu!e[^]UPEEPjmdEZYtM3Hgh`3PhȊ$hh3 gh`3PhȊ$hh3 (1US 8Ph$; [X1u?9t3h0!SZY¸thu#SZY]U ZE\URuh`3PVSuhz$j袌¸$KEtVSs V=à E)ËE9th{$h'&hE h{$ Ee[^_]UWVS EUˋujQcEY_tG URjuSPQÃtPESXZEEe[^_]ue[^_]USj$uZYtD1ۉ]XEPjhjjj EPSiU Vt;M rj$S뱋]UEPM UٶXUEPM UXUWVS 1҉<Piƅ( PhK{$Vi t#hXjhZ{$hv{$3j i{$!h5jh{$hv{$j {$Ph3z Wj&U  Hvw= 13uj<_1,Dž,Džjhh$piPj(Tu1 h3h,W] 6"=,u.h,h'`$ZY6"u=,up$WVRh{$h0VS\ = 13ujLXDžjhh$hWj'*T-= 3+=`3=3h{$W W h3WhȊ$Sxg Wh`3h 3h{$jZ$VSh$jAWh$j.W VSS Y^DžWj)TSXZX=X3tZ=3tQ=3tHh{$W W h3WhȊ$Sf WhX3h3h{$2;e[^_]USڸstjS" ZYuSh|$jJ ]US13tjS ZYuSh"|$j ]USS1$tse1EEPj%!REZYtt`Huȃul"he$ifX t&jk he$ifYXKuh:|$jThXZ1]Ã=A3uiUA3!I3U|$:ġ3_|$+3P#3$ 3r!ȡ3]USE] tPeYSjQdXZ3E]UWVS18Z^1Dž@DžDDž<jjZt3^t=3ut3h7$%VZYt"hz|$VZYth|$VtZYu?=?M3F?M3h`SjPjP Vt3h`SjPnjPSW t3u"QX} t{uh|$j芀YX}tuVh|$hoƒVh|$hXƒ W| W$XZt-t3Vhg#hw`jj%A=3t=3tVh|$j CT3u1 3e[^_]UVS]u Stt uh}$OX}$$2u }$jjPVSfe[^]UWVShhz$[3_Zt Ph}$g [^31?M31۸`,P/t 8tT3u uA؄t 3Dž`,{53/z;iT3\3u1uSZYH0353j5M65M6EF5M6h333P53h&}$ja^13Pj ZJtuT33uf3ƅ1N1tσ0u@/u(Ht!ȿ1T3uƇT3Bƅ뼀t/3'tju^_T3t33u9uh]j{c 0VR535353Ph-}$hc] jjY[}u%T3h:}$j|XZT3tkhS}$h|^_Hu%h-p]jMY[th}$j|XZh}$j{|h}$jo|T3{T3dh$}LRPX urh ~$_LxRPW uT|9u;xt8h~$?h/~$(Q^_th9~$j{h/~$hz~$Mԙth:|$jTy{Y[juXZ1e[^_]UWVS,{t0u1#W3"PYZtWhg#h[ ك1ujh XZe[^_]UWVS1hy$KPhg#P ytQPXHh~$JPhg#P xh~$JPhg#P y6륋tP4Xuhg#h4ZjjMg_xP謉hw# à t8^yS h!P XZ1ɉu|Sx WRuhg#h4 ZjjRh"W ZYu$u t*Whg#V ShW u<=uDžS V _Xtq[^uʉZYtCh1Yj^_u2蕉Y[tjh3XZ1 jh4A6+؍e[^_]UWS]S 1E CM [_]Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlP&‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s Is$AXZCE]0UWVS]1;3s8klCxdF@0 ttW} X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@s蝽XCEe[^_]銽UVSjhPjuht)uu P @u0S 0Z1 SބXe[^]UWS] 1Sh|duw t#S;S t%iSR3船ZYt3мX1e[_]Uu hzd@u)UVSujhPjV莤t(ju jPV+Sy 201e[^]Uu hedAuUU EHJ Ju BklsM9N@uLM9NP q"uEMt0<t(΢t h6"5u3h$v՞tstZ~ tS4C8u%uh u hG_hPRdY[P5u35Č3P31RPssfoRP5u3%5Č3P31RPs$s ?oRP5 u35u3h$v=΢5Č3C S$CS P31SQRPnRP5u3몋P auC( PFP5u3au CH@L؃PFP5u3 buCH@LPsFP5t3auCHpX5t3uCHp\5t35u3h$qsCHP`u&hFP5t35u3h$v轜OEERhO %jP* hEURjPà P5t35u3h$vrS迭kfx5t35u3h$v@CH@Hth $v'XZCH@Hth$vY_CH@Hth$vXZCH@Hth$$vߛY_CH@Hth0$vǛXZCH@H th8$v诛Y_CH@H@th@$v藛XZCH@HE E$FEe[^_]oru%CHP5t35u3h$vGI+{jPMQKQWsPRdk B(0MDMQP5u3h$v0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4G8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhG SPXZ1e[^]UWVSu jFHP]SjSSjjjjj 8GP-E܃,11t]DS@uu@tA^Ht҈Uth"WZYUu CcL'/t C/jWjWS舷 FHHL1e[^_]UVS u vDhO %j ]S菻 j SSjjjjhpF0SvFDVHB`1e[^]UWVS jj%躥[^9hAC chACC chAC C, c E1҅tuB )&tME4}GF cu/UDEjh/MEZYU}B}$w"uuh-AF cX}$thN$h(&hhY$ jjjjhvbhjj jjj%SjM7ƃ4xu PT-V8Sܨe[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj ^_x 1҉j4)&UG cdUBXYu؍{sh@h?Ch?C h?ǃsjjjjhchjjjjj SjM6ƃDxu P ,V`7S訧1e[^_]UWVS] ;G(S119tuklKI0΃@jj h6"GOOgRPj!WC jj h6" A1҉SQыcRPj'PC 8uth>jPPV̳E@ tP>jPPV|6"u h}>Xpn>0]>'QWMQVRPpjjAGČ3,jB*>SPh#j -P_ Č3jC>SPh#j :P= Č30j-=SPh#j GP jD=h= ߿YÃsv3Z£v3~ް-T1~CVƄ5T -߉TPh$jPhu3t j.#=hu3P5v35v3GP:P-Phƀ$hh u3& Dh$BXe[^_]UWVS] @3$DV誱Y_TV{$ C8@@8 QPVRL ]B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjh7kh fjj7jjjjF (ƃ4PV4V(E)PB89B4<ZPufLW WPF8PP8 WRPQLP $AƃtPSWhm$XP PWhp$XP WMSGVAP3d1h 1$ t xDž8Dž<1hK#jxP t";tXShp$\P  X\jEPjjFj j\\ ;XtPiXxPEP誝^_uXG[ Lx }E:Kt<`~pLMQaPWRL (Љ,ЉEUĉ8<Džd1ɉhEP Z@uEDžd1hPTT048<}LLj1RPL@1RPdPEP 8,Ãu9= v3u v3WsX؍e[^_]UWVS}u = v3ue[^_]0j4jdoá$v3jWCP言jVCP蜀$v3 e[^_]á(v3uqUS(v3 v3t( v3XSRPh$js+SPs΋$v3t$v3SCS)sZ1(v3]UutPhg#u uk)UVSu TuPSh$j=1e[^]Uuh@UuhUuhUuZUuZUuZ1= v3UPUWVS È@4jjjjhWs8PRx  {thCPV~ ht$V YXCLthh2$VGV1UVVWh6"tPQ贚 jQ6 t0uR*&ЀtRZ뢀tjVRO VRZYt{t1ht$xXe[^_]UVS19tklqFLu@u19t$klq~,t@9sklA[^]`[^]UWVS<Ɖ@3t/)t&jh$h<$ DžjjPPjh0,t@t?ƒ u'@,Pjtg[_@t ,h,j*"@3Phg#h=,91h$h<$-ZY@3t )uVU{_uǀtPPU, S(o tҋNA4jjjjhVq8PSx 5,,4*&hK$hS WVSh_$j&(WnYh$jXZe[^_]UWVS|jP@5_Zx-ǍxPWeY^x t W5ZghVW4 =uW5Xf}u1fIҁ󤉃EfǃU1e[^_]UShEdjjEP]Sh$c- @t2hC#SZYu Lz3h$SʋZYuLz3]U E]遏UWVS41ɉMԉM؉Mܡ@3f([@3$u|jjjPPÃu1@3jjHDjjPtϋ@3$KC19};DH} DH@3$}ЃEȃ=Hz3uajj]Sjjh(,qy1ucHz3Zuh,hÂ$= ^_jjSPjh(,p1ۉ]Hz3u9}MkT UWuGZYÅt FuMŨup@3840h3}$h3EPEPEPuDxtuuuh3}$h'15Pz3EPEPEPuID~Hz3wL3MhhBCSEȉUjheRPe&Pusss shԂ$h(hMĉ Pz3hPz3j,/ Pz3u/EEԋEE؋EE܅t+EPEPEPu,BPUԋPU؋@ Eܡ@3$tuuuR@3,jhP@3$tIytCf(u9PH[Ht'@3$P@31҉$Yhh^X]9_~GL Hz3AEȾe1Puqqq qSh҂$hhEX$뱍EPj-EZYDHz3DPz3se[^_]ƃUWVS5Lz3t/uujP܀ ShthjKXZe[^_]UVSE X(uNpƋ0VPsjh荖Sà uhijj ؍e[^]ðUE1Ҁ=Lz3t]]UE} t=Lz3t[1]U Bh$芌h$j EjjEPEPjh0,l$@tEU th.$jXZøøUWVS,uEE1H3L3uFVEUFVEUURURVЃ tԋ Pz3EUA @3;\`|.}t1hj[_uCP@^N t9Ӊ}ډȉH3L3 H3 L3EEЋEE̋E E11}E,E1ɉMԊ MˀuMJ}uE9tEԋMu}t>MJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhojLYZ|tTPz3t&@t 9t9Pz3t@u%}*h j YZ-OOBOu5(O~% E tSE (k$~ v$ tk$~ v t $$ E uWk$E fUu)8t$EU @3;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjZuWhg#h$vVe[^_]UWS0]}ȹ 1E1EEE =Lz3ujjS@ jP4E܍EPjS@e[_]UWVSM 1@3f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh$j]UWVS4}=Lz3PklUVE 0G_ZYE UlVSClP.%11CC,C0CLCPCT @3$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉCVY,9YPQZt C:C;h3h3h3* 1@,Ct@t!1C F {uʃ5M6_jj5M6胅5M6lY5M6v_hLjjhGhj&jFjjjPjÃLPSbS e[^_]UWVSQƉhw$6h!Plm uA=D3thw$Ph$5D3l hw$Ph$ /OuPh$Ph׆$` _XVh$Sl S#c  ]thw$h:$Sj hw$Ph0$Sj hw$lPB D3ZYtuVhJ$P$l 5D3Eujh!VZt VVX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝ}1ɉM] u]u]܉uu9uu~ u >}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á3"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV- t4EUuuWV );uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV);uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWV);uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]shX$j ]][QUWVS]} j/WIG ZYƃti)PCDPWn ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDP7UEvPEDPu ]UVS]=3u %3K$9C |`539s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h}[nЃu"9uǂǂ1J Z$1ɉƀJ C@]th$1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVSz31ۃ<@,&t9jSV1FFXZSF w*&ӉӉƃ"ue[^]Ã=z3uU{3]ø{3UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrVZ 0}t.1HR}t PRh$PRh$WV^ R}t PRhx$PRhx$ԍe[^_]US]uhר$h0+&hh$h sJMX]]=MUWVSÃ=z3ujz3u1$h+&h{XuhV$h+&hh$a {\uho$h+&h߃{`uh$h+&hȃ{duh$h+&hjCDPVR u h$Vo XZ{4uD1ttʋ5P-DNuT4@׀{4ujhK!C4P, ؊LD tB:u JN Phň$WS h!WZ ƃiWh׈$jsiPh$VaisXs\s`h $VMi,Psdh!$V/isTh2$V!i19aW 4@,&PwP7Ph=$VhG P u"OQPW RPhU$VhH9~h:$h?"VzhZYZhYk$j^hVO PPVhd$ht$jÃ(V Xe[^_]UWVSÃ=3u 3{s1ɸ9|,@89@|1ҁ{v@1҉[^_]UWVSE Eu}hj>[ZtAǀǀjhPju*@uSBY1RC,PhedAM x0u<;|1ҋ9Ћ}SZB XZ뙅~1E uZ CCCs {$s{ECTCd_19G t C <u:?C <yG1ɉPPPG1RPtA8t$h+&jg{XuhV$h+&jhh$=Z {\uho$h+&ji{`uh$h+&jj΃{duh$h+&jk뺉EE E=@8 CP1RP sjhs]UWVS@E PEԉU؋E @E̋E @ EE @EċE @EȋE p@ EjjuujjjjUE u}h}EUE܉UEP@EUӃE9؋}|StNtIEƉ׃RPWV)׉u}+u}EU)EUM]M܉]9M̋E} ẺE܋EEEUẺUЋ}9׋u} uԋ}؉ủ}ڋMԋ]M]9ȉ} +EUЉE܉U=3u 3E119~lMUԋUċJ}uw u9f4Gw.t*u #utu Uz(u}t0@;3}th|]XÉuẺE܉E|E H(1t E @$1}t#EȀ8tjPkMPdH kUƄEM@ P$@ ]9؉Ӌu| +EUӋEH X$FUf*e[^_]1UWVSPEE3u111t_}u@+&u1A:u 7:uNj;+&uRuuu jjuЃu)뛉uh@+&uuu jju+&e[^_]UWVS] ߋuE;Utf1Myt]J8{ sStWVPщC u5EuV2P4CZuEPDCuEjP4CXe[^_]UWVSml@|3@+&9@|3l|3j0_11,&tЄtF;GutT53P03^t7;t `5&{t `;&{t @|31҉S9Ye[^_]US1ۡ3;3stCP8X]UWVS119t u9}֍W8t1B@ۉ[^_]UE p 1]UE @<1]UWVSu] K4t+@Xt QRZYuFfH f~t1EFf` EfF{4FE~19M~)x ufP }ufP AҋKfWJt Ѓ9tЃfGJ1;x$s0Ws4RP` VC8u fL  fd GǍe[^_]UE @1]UE 1҉P1]UE @1]UE @1]UE @1]UEPE ]US]E UuhHPR0Yu hZ@EE g#CE]k%UWVSu} ]=\}3@1X}3jt\}3PPZY9X}3}X}3jST}3PPZY9X}3}X}3h/P}3P`PZY9X}3}X}3h L}3P@jjjhjhjjj j VSj赼ƃ4t WPWG=XZV葽S-e[^_]UWVS} SDV:ZYu1#G @Pw:*ZYtW JO GЉ41x 4ȍUĹ ]{ u0SPH,0^}1ɉ<@EWjR<(XZL1<9}D .@>hvjjhjjjAjjjRVhcE4URPuDV,}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH'4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WVF)׉<@8ڋE"C t @]fCEf@ DP9Xe[^_]UWVSEMt]X$[ EXUjS%EZYtI ,Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3葥C S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}p豿Ƌ0覿VPjhKNtY}yS}ttURURSЃ u1pdƋ0YVPjhXUSqQYt }WSЉXZe[^_]UWVSPuh1҉UU:ÍU.WVhׁ$jjjMQR9|ڃRjjhO$E1e[^_]UWVSl}1E EEURj,1[_|ËEPRHEU@3PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuuP31ҋ}9=P3׋u}EURPjEPQEƒ01EUEUEUEUhjjh0hxhj6jjjuSj9ƃ4u Sp%ZkEPVϩVSW%}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpW]1 ƅhWWjjjjpf t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj,CY[tUÍ}UE;P s WRPQL hjjh0hxhj6jjjuSj(4uSa#ZwURPE踧EPS=#}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU@3PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|]@3tf(ttuhV$h(-&hh$< xF5T3t\Up~3hjjhhhRjFjjjuPh}3@ƃ45p~3n Y20GEp:|7-xwjj h6"jh0jUR込,jj h6"jhjMQ蠼MQURW|xu@3PjhM@h$ϸ@3$0薷E@3$p~EEEEEU׉ u11MQMQSЃ UtEfEEEĹf@ @ @f@@=3w@ f@*@,hvjjjjjjjjjQRhwǃ4t PI@,EPW WIEt11!UMQWSPL UuG;{ r"E EtEuEȅtօt1hjHY_uD3zPhn$ SZujhQ_XO:jS[^Jsjhs$@3@u ǀ@>U1]1EEPV軡XZ}y1Q1҉u1Hùxt%| q1@ 4SJ-|GEE;xrB;Us E11ۃ}t E;]sP:,C_PYVe5p~3XZ}e[^_]UWVS0EDž}uEm3jSZYt jS^_uY15jS_Zu[^ƅ1;33} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h6" WVjWthq讲ƃ 3袲WVPh$V̲ V ƅ3mP XZ00@ _w%tDž111=uбhoıjj h6"E,}H,DRPjV@E$hpeRjP#ES3Yx3Ɖ<$n3T2 ‰$SP{B SE3[Xf S^B $ 3f <$S=B WV39r$h$h,&hh$Z4 u蓰Z1hjjjjjjjjjP:Ã4tPS֜_X19s <19t4*@YڅttV Z tS菧Xe[^_]UWVSljfDžv/ƅujhe$xY^yhhe$S$ yrt&i8t_WPhȊ$hS( hWSB$ =Džp!j/S- _Zt-xv9tH9s8/t@QT YyߍxPW{ YZ%=pu<>hQW iƄ/u%iQPhׁ$hS' %hQSC# =@uW ZuhWP # =hSQ Y_1Ҁ;/u 1Ҁ{‰hS/p<$/ZlhЃpDl=w4uhh$Se =whWSO =v %;?V _y ;VY:V ZV:X1e[^_]USÍEPS YZx7Et.jSXZxj `PSS t SeY1$SZ`Z=vf u]UWVSEUP ^ƃ}t11ɉMV Zt{fx vX jhn$S1 uSuhȊ$EPum @u hj"3 3Et}tESWuh$ju[zV XEEe[^_]Ujh+Fj UWVS hΊ$11tY+ڸ׊$xuڸ$wu#WSN XZuWS: Y^1yah$|hPS WS蕧 1u h$VPSh$jSh$j67hS h݊$S迚hPPWP' u'h$S莚PPh$jh$ÚhPSHSh$jatPh$h$j=uhϊ$ShPWh'$SPWh$j,hT$ShPWh3$SəPWh$j,hϊ$S譙PhF$jMhu$S芙PhF$j*hS$ÙhPWHhT$SQPWh$jU(hΊ$艙hPWhϊ$Sythd$S PhF$j hc$.hPWhd$S輘p14,PhȊ$hW! vtpWh$j~C utjh,}CXZte[^_]UEt~3fP]USE@k @-&t!@-&ShWE 08Cx~3 ]UWVSh豧ƍPhW@j@1jh($a_ZRhW@P 11!tVk @-&@-&u Dž"BVPe-ZYu=t~3DŽ Gjjjjh jjjjjj!Sh艝Ã4tj誧PSS^PXe[^_]U~x~3tPPRRRh4$jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡP31RPSQRPhK#j]S ]СČ3EԃЃ7P藥URjPX9jPPh~3S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj 肑XZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A iB}lj /&fG G5GG G, G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PRXZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQPA!YZuk{8ueEC8EC4FV SVCEpxP@EUH3L319| EU)AQ1.&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQiUUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{yк 9ʺsbkEl}GËSEUu}+u}uuWVö)9uE}u}u}EU)SE};xM] uuSQηы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQmыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 8$hV' hVWӡ 3p8~ PhE$hV hVW蜡 kt3 88hL$hV hVVV 3؃PVhV$hg1UWVS ƉӋ}ɉt,h bQPSh$hS# tWShi$V茹6jj h6"EU  RPjWVgWShw$VT,e[^_]UWVSEkE <E8XP@8H$2&|thxuhh bYP"Sh$pθ@xu!h"PN XZ+jjjjhQWRЃ tQWRPLt tt 8thhua_2‹ Y^tASRPh$hS~ @jى$N҉t5hh#W hRW hh)%W؞ $@j1S"@1uDHM] 1ɍe[^_]_;ƅsh$W` S0pƃ 1z tcSVP3Ph$se[^_]UWVSX1ɉt @@33t=$txuP1$XytƃyjhՐ$_X=33|uÐ Dž813ktƒ8B1;8 8.T8 RPhȊ$hWs 531҅t8t%FWPk ZYu Ɔyԋą3ƀy1LPTXƀ);3ǀ,ǀ<jWP hW3"Ps =3u/31҉3h˰3aljY t_3tByu/39u3ы9u􋐀뺃G534@k<Љǹ1󫋅PB vsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB v$CsC C8RPL u;H ruكtЋSO_Wk<<󫋅PB vCsC C8b]1fD @9s=3t12&󥍅Pg^2&󥍅P6[=3tcDžDžDž31҉3&󥍅PY=3t1$3&󥍅PX1B iTB }r3yFHfGe[^_]UU J E]UWVS0EЉUĉ1ۋ9}qGE̋GE11ҋũ<tw9tMBu9uSuhɷ$jEP. 53tFURP6 YZtEЉChjXZe[^_]UWVS31:uJ Jt @ =u_k 3]ȋủ33BMȋu1k 93u93u93t Bu1҉333e[^]UVSMU193u3r93u;t = u1[^]UWVSGDž31|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ.| Fhvjjjjjj |}@Pjj|Ph.Ã4u1}?PS@$S/ |9ṣ3k<}Ee[^_]US<] EjP3ZxD1k8|<u$MȉH%ƃ4u 3{1=3EeSVV& =3uP@3tG$t>3t5xt$ha/j޿Y^tjjXZǃ=3 ؍e[^_]U=ȡ3tuh$jPM UVSuu1r$ugjjjVyÃtjjHDjjFPt$@3KS;DH} DHe[^]UEx8th"hx3&hm h$詰 @UWVSQ} E@E19u~aEX=uu8u?G8.=tu8u/Gx=ouWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$9$zuubPrYtWWZtNjE@ u WV_XWPV tjVSZE@ t VP{ZYVdXjjSƃx3 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw jt3&RjP8x u0h"h3&h h$= R1t4Q,1t9E t @11tt:[]UVSQMp@19|h$h4&hhA$w 9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=3uUhJ7XUS]=3u1;3s k<3[]Ã=3uU3]á3UWVSSÃ=3ut=;t635319t$USF P ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}hД$R詛 ZYuj ju\C,S0hה$V聛 Y_uj ju\C4S8hݔ$VY _Zu0j(uc Y^ƅj)Pc _ZFh$V ZYuEh$V Y_u j(uh$Vݚ _Zuj`u@Sn Oh$V蹚 Y^u>hg"EP8 XZt(7&>ttVP膚 YZuG C<e[^_]USPQRh$EPjo2~-h?"uOEjh4&Po t2u{[1Eh"EP蠜 XY:tjME+[h?"jgOEZYuu{X]UWVS1jhPjEpQcÍPhd@Ss @SBEP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh'$P ƅEpPh.$jb2t1EE@@Ep0Et(pv0v,h?$j+2Vz1ɉH0X,t(Eps8s4s0s,hX$j1vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCPn ^_;t' Ps0s,hz$j1s@\PV+ ZYt$Vs0s,h$j0q{ YZ;# uj jS9K u7thh$P`A hSPKA  h`L#Sl ZYuDG8PW<G4hnL#S ZYu)+hhQL#S݈ ZYu).!j h4&Sԇ tډhje[Xj`RF@Pv F,V0F4V8؃ u+t)FQ RP ZYuƅuw, G :]iX19ȋW>i_1E uN& G1ɉOOO_O _$UWG@jhRjPPƋ_,tjP4tKRPPs0s,V0t'8t"P% PXZ@8u ǃC4S8)G W$q1ɉSh|dVes iRy_ZugYSh|dV s u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSP:t BuV.Z1e[^_]UΙ3t 1=ȡ3]USÉIQHQH QH QH QH QH QHQHQHQ0hN#RSw ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk7&W uu wu,s uRCu1jSk7&V u%u vur uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPhO#Vr4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUU ]UMEPЃ< u1tE0]UE1҉UeU ]U EEEEEEEPU EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EPNU sZu tX5$PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuuEE Eu}tE}}5E؋EؙRPuuEU@3DH~1ERPWVuuRPEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWVv)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUUR_U UEUUE1҉UP0UURU UEUUEUUP0UURrU ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRd $Rh{dЀ3Ib jhPjR>@ue[^_]UEP0RPNUWVS]E EC0E1xp@u@3Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSZ yуtu G{0Ea;hhZYohSZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tNwtw A,<vy 3CFU,U9u 3@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU Pm5 1]UWVSUE}u NtGtRutG_tvpS%5 GPhO %vS_ FD64t(vtvPSZ e[^_]USR] = 3uj EPuKq ƒ =w uE8tt h X1kD3İ3u]U U1vEEUEPU E7ZÅt*UVS14LFZuSLXe[^]UWVSQu>xp19|h$h:&hxhz$"h ]9|@89@|ue[^_]UWVS0uU=@3]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E th$h:&hhz$5f hj"F^_`;&u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP @ǃEPu?^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]= 3uF1Ҹ; 3s)=w9t kD3B1=w kD3[]Ã=3u ^3UWVSƉ $41󫋅 EU RPVh$h4PZ E jhPjV0xShydPS @u VCX1V8jSurU e[^_]UWVSlu] E EE$EEPSV EP)ډzXE8t%E8h—$h\:&h hz$c 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPh$%uPu$T "}tPh̏$Pht$uu9X ؍e[^_]UWVS8Ɖ˹1jhPjV.1ɉDž11؉1u51 RPhS =|=ZbƋ!!Љu9tEXH!ƹnEXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW P Pسx rt6t%F,dDž $t tW9,sAu1hji>^Zt1ɉF1*1҉; X1u1fǃUe[^_]UVS0E E th$h:&hhz$] hj=^Xu1E u, CEUY~11ɉKKCSǃ?ǃjh>RP@ECǃ1҉K0SUE^@uSAhރ{ u_C$9S }NURjSPL t;M܅t43t,31@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[chEXQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:ԗ$29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPSi&yPhd@~I @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh"h:&hhz$vX  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhPYx30J12XuWV)׋1҉!!S9uE9u=H!؍SsS:ș[9-9!7X؍e[^_]UWVS]Euh$h:&h .1uEE}lj1Ʌuh%h:&hhz$U s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{1Ҿ33tBt D9u3{u}s{ u}u}u}v}t 3M1;})ωxMH PC u h!kE UP_b XZ܍e[^_]UWVSE }Ĺ }Put&3u{}1ɉt3t_31 h-$h:&hhz$?T D9t Gu]u1ۉ]]]]E1u)ED$}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj1EZYEfǀUƀEEE1҉RPtpu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttPt5W 4Y_E0Z}w1u}RPWV)׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tP4W 4XZ0}9ugucE,9EE}Ohj/Y_uEc3}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP\)׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tP82WW }UD4_XE\FhjjP 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P0W 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUEؤ3jVSUE uaduVh@+&suuuus+&C,u*E̋U19}'SjRPuus+&C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H331@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}h(]QEEM1H1EUȉƉSQRP)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t E$E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh"h:&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$EΘ$]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP*S DXZEt uDEt ]TE9u/Eu;hjjP3 E̋UЉEU1҉}ttBuh"hp:&hl8EM]M]։u1}9΋}})щ hz$yE E}uEgEe[^_]UWVS]uh3$h;&hk hz$#E Es0h9tSME M9u㋶0u͋EtP^C,t PY`11d)FZus(X]e[^_](UWVS}G,t PXjhPjwÃt7WjR4$YXtRVSVz(S#ZWXe[^_]UWVS\E0hG_E0h"jP]SV9 jPSSj S Ǎ@^>w̋E0h"jP]S"9 jPSSjj S՛ ƍ@[=wʡ@3EHDEU}~ E1ɉMRWuuvSVRPeމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ@304}81HDEU}~ E1E}u?9}/jh>uuV=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]@3480h3}$h]}WuVEPS$xuuuh3}$hZWVEPS>tuuuSЃSWe[^_]Ujj @ j j PeUS P_? $6"PSh$h,c: j1 U=(,u (,3fPftPZ9(,UWVEE왉U1E}ujEPj? e^_]U0E E1EԉE؉E܉EEEPEPuA ƒ xEÍL$qUWVSQ@@u5jh3 333333XZjPr 3333+33_X39}933s73󥋅331=3uhrjjE(t!j$jjV =3u`hA"P)L 3Y[tPhg#hP3 x3319߭y2%ݝ݅ 2%߭ٽf f٭۝٭y1d~dVh#)P=P.3 Nj3~-3t P; Z)Å~:ùdh6")Sh@=&Ph#)P=P2 ǃ119ʉst @u4(>&SQh#)P=Pj2 +33+ 3y @B2%ڽ߭ 3319ظw ȉ߭2%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4(>&%11d PVSh#)PP0 339lj33)ލ 9lj݅99Ћ}h#VQ/ à +33߭߭ٽf f٭۝٭?~~h#rtPh("VQS/ Ãh$VQ@/ à <ЙRPh#)PP/ Ãuh?")PP. à 3fPftSVP eY[^_]aUSFC j8C X]UWVSPu ]Ett v9s C 71;uuߋuE9s$;ut:GFFPh$jW.. ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=P-DWtDOt uxu[B 1!tjjEPͲ  FCE덉뉉؍e[^_]UWVSujuZYt&Vu PW9uA 7؍e[^_]UVSu huà @tuuS/S؍e[^]U|EPuǯ ZYtM EUQ1UWVSEE 0Vj S- DžuVjS ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U u Y[nuW!^Z@tߋEdujSG ZY@u( VPW @u뮁}Eu j4PE- j-PEP% ؍e[^_]UVS]s C(2s  StP KSstPtVPV~ t vXVYЋtVPV~ t vZVXsu҉]e[^]UWVS] u 1;uCNVjSF uU= h>&h@$f~6= 7h>&hR$GJGH))րx u@'˅iuh>&hd$;[^T1ɉ PWuEpQ(@h>&;< Z8< 8#u1Xe[^_]UVShVp  u h`>&Q;Zu SX PVS 1e[^]UWVS]} uPh>&hp$;  sVFFtNMEUE UEPEPs  @u1; 8 t; 89tht>&h$}:^_S[VtPSV1ɉC F0s {u0Shjs C*.@uht>&h$:XZu s]e[^_]l@ue[^_]US]j$o Yt:XU P UP1҉PPP1ɉHPP 1҉P]UWVSpljӉ΋EftPh>&hp$~9 EjEPEPSCà jjP PjS @tpjjS t^PjSo @tLVSW t:Phjp ,@u0h>&h$8h>&8Yh>&8SmXZe[^_]UEM M]UEM M1]UVS]uhU YtSh[ jP,@uh>&h$8XZhU Yt1Sh= jP+@uh>&h$7XZe[^]UVS]t P:X틃1t:P_,Bǃ* @؉Ƌu4P,ǃ- uȍe[^]UVSlM uEPUZt%ÍEP, $VSy @u SX؍e[^]UWVS} ~7 7N11;] },E4V+ ZHw̍CWPE e[^_]UWVSUu }u 7 ZZt<v }D&7Ep V) YƒwCljt)1E@EȉC,ub Ex txj(Zu h@&M3XYǃ,f@S(P1.1;,s$k(рyus1(D@.u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuPi t[뼃 S Vh$~2 e[^_]UVSÃHt1HL~tU HXPF 1LXPt1PT~t PYP 1TZ`t1`d~t `XP 1dXt/tV1I,X 1҉Yt/tVH,X` 1Xt/tVH,X' 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVQkXZe[^]US]E ftPh?&hp$/ jP} t(@t 0 h?&/YE u1҉U E].(ShjPe#@uE ?&E$]I/]US]E ftPh?&hp$7/ j|P t@/ v|y / 7`x |ZxYZt>1҉Shj"@u;E ?&E$]x.h?&n.XE E]']UVSĀptQPhhxVj@u h@&.XV Sh՛$- e[^]USË4%uXh$S諔XZ{PtS0Ytp%tSLt$Ju"PS`XZ]UWVSÉ׉΃t t% $t1PSۮS]jS|Au$t"PSXZe[^_]UWVSÉ֋8 Ph $,1ɺhXZu$VS诓Sjj$1ɉK 4%ujL%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh7$+RPXZlu]Ãx tkUSË%u6S_% Y u=uSmZ S.YuSX]US]SǖYuj#XZIpQpcvPh?$ +j#Shjdj"]UVS]E ftPh?&hp$* |)RxP0 uh?&k*X;|t xD8t|x苐hX,N H 1tf `,yhX,j  Y^X,PX, Shj@uDE ?&E$e[^])jaXZu Ee[^])"e[^]UVSjhi$NZYuhi$hk")[^"VPZY@u VhU$(ZYSXe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V,Zu}V,Xt%e[^_]UWVSE48ځ` u %t8tf% tW*Yt ߉%@ tWl+Zt 翉%` t떁1u ځ u@\e[^_]US];(%P6(jjjj4]UVSS]4@tp%@uft0t0VY%t1҃w@?&R Vh]$&SvSZ%tw4@?&Vha$W&[^8%th{$e&jN Shj4u^%@tTS,-1ɉMjEP,@u hA&"&Z,ǃ,Xe[^]UVS]h|!"&48с^t:t0t~ u h$V莌YXvj\XZe[^] @48]e[^]6UWVSD]u Ctt,PCQPhj@EP藖@uh@&E%EYE{ VEPW3buVWh$$ {EtSj@VCxP VWh$$3'`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQh$#11҉[Y^{ tHEU  Ѓ t3 Z@uh@&#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S &_u Sh$"Y[ % ڋFEj EPju{ }PWh$"M1҉1;,sYk(jQMuv Mt5j EPjQ?PMAPuh $#" MQ~G럋 S3Z@uC Ph $*"Y_ t{ uS\2%ZtSdX{ tSQ_t>{ u8u %҃RS虡ZY@uC Ph/$!Y_t { uSZt]e[^_]e[^_]UWVS(]} uS$ESẺ{Ls$S$ ({ }u }s uJS貣Yt?Vh?$ SSdSǤj3ooE Z$]e[^_]酇Vhl$f h$So11҉ 9C$u/S#Z@%W! 8E@&e[^_]G jjSn"SH#@u ! 8t h@& _1EE A]e[^_]2"}{ tC uPh}$Ph$Y^{PtRStCQEЍ}ԉƉщUS苢CtZU9uPEPu t{ t911҉{ t411ɉh"S3SGES6]e[^_]e[^_]US]C Pt$ZYts$sLP ]]n UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u hx@&xZjjAS @u hx@&]X]e[^_]US]C][]3UWVS ׉΋U K 9}!E4UQMu YZMUtB;u t9{ ;u u{ t|EUh$SvjjM%tuuS %tS貞ZSKSX+9t'C jjM$S [e[^_]UWVSS] 84%@tjE1҃ t6HjEP, @h$@&h$_tm>ht$h$hϝ$@t+XRDAtxUh$hȝ$hϝ$ Uh$hߝ$hϝ$ 1Uh$h$hϝ$p 11h$h $hϝ$Kt [h$h$hϝ$<J@ulh'$?Y_jjj KPh/$3<3u534%u dW3XZe[^_]USS]E uPh?&hp$ jEP,R uh?&j4YuZ8t$h?&hd$vj,,ǃ, _w$jPh?&h~$j6U8tu h$mYuSRXZ]US]E U{ u)C щ‰ { t][]~[]UWVS ]]} utSEtXZu @ w{ tC Ph$О$^_CStP }tQSSh[1pEPjEPu Euh`@&YASuxXZu ~ WEtKYXt3{ tC Phٞ$XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh$11ɉtY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhhA@uhL@&h$)1XZh$%Y^1hP觸F1׃ u VhT$XZu 87t 8 tt VhT$^_\XPS+ǃuhL@&r[ttlHp VW ZYu VjS ϋFVt=PVF PtZYt%Vh#jj 7u7W1FtPV2VP~ t11ɉ3Vh$WtPtStPS| e[^_]US]E ftPh@&hp$a SӡZ@uD- 87u ]] 8 t  8Vt 8tE@&]]UWVSD}U uMtNˉUMPV ZYUtOMv_ 7 }E 8@&EpE"e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Phi$UfW(W>8uHUPVG*P  Utn uG>j u G>T tGjt G*ˉe[^_]UWVS,}E EЋEE܋EE؋hӟ$S ^ZuEE ݟ$+h$S ZYu,EЋ@0ST ^@E] EЉEe[^_]h$S_ ZYEh$SG [^u EЃHo1E9}E4 Y\FS3EZE1ҋE9}?E؋ UQM Ɖ$MQux )KEƍ@E UB 뺋E@uh $uI1p,E 1E111EEM̍EPhD&h"$uuMtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEcp,E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQMz ZYtUBM9]uuVju EvjEPEp 6 uot0tR~ uvڍN U9U~!E4UQM ZYtUBM9]uuVuQu @u414E@t# UE%  9]u%}uUMhjQt8EE̅x ލW u9u~E4RU ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉EЋUԉ/tP9]u>t9[E4tY[tEX]9][tSu؋M܉^XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJuj| ȋuFZK>s*S>+Ee[^_]UWVSu} lhЧ$hPVqà t1=whlehЧ$hh$ < 8thЧ$hg# XZhh[u hdA&r huPY1l>u?G Ph$( tXZ{>u[C Phc$ XZ1hDPWhohnRPhnR  =nwHƄn ƄoPRhhЧ$V׆@u-hdA&hM$~ YXhtjWhà phth!$/ Xϋpe[^_]á3tU3P3U3]UE@]UWVS]u }uh$hA&hG}t}uhƨ$hA&hHh$~ tu "t 9ptIC ujYuTHtAJHt6BXCpf@up MH1҉PfxCM1 K뽉Cȍe[^_]UEM uh$hA&hh$ u t 9Jt BH@MUWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVS$Ǎ]SjEPGPShEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uh$hA&huh$hA&hh$" }ʚ;vh$hA&h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;vF [^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuh$hA&h|h$n B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuh$hA&hh$ U PH@LUEuh$hA&hh$ @L11UEuh$hA&hh$ U P0UP4UP8UP<1UWVS(]}1Eܙ6E@uh$h|A&hYh$2 1҉ỦUЉUԉU1;s4s,C0 I>v :  DFu EPj @u11EEEE1;s4sjEPC04O @tF1e[^_]USjPj[ZtÍ@Pj<ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt RקKXVXs@1s@sDCMYC t6HtJKHPڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]gUWVS]uCh$hpA&hh$ 3t,3H33C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t0zLu%1t]UWVS\u~>u Vv 7EEEE1]MuF EMQUE UJHOuԊEEjPS PF Ph $F>PSV}(u V*N>׉e[^_]USEtS1jS[ ]UE t E] A ]USEtSS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWSv s jWV^ wmj:V ZYDžt?EPjhjjj jGP C8 }t UC8jVCP P-  DJu <:tFu}Wjhjjj EPV_ C0E t/it.u#Wjhjjj j@P, C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPx ZYt[u{ 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjURWPVsu ju`(C*WtE4%@u1t(SsZ@uh$AS SwC@SvfCDCCHSu @t CPCHC pS_uCL1s@CX_XnƅRe[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[ ؃4[^_]酊 US]SvqZ@u:jhj @tjhj @؋];UVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQ衈 Zuh8D&LÉEhg"EP: ZYtfPn Xuh8D&S2[_LUj@PV Uuh8D&SUR q7SXe[^_]UWVSSƉϋ]jh©$RUL UuA}H} L @ð`jhƩ$R u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/QE Y_DžuuVs _ZumVhͩ$2@EEPjj jjj ju }tuh$2Y[:t SP[ZuuV  ZYt/1tE0Xe[^_]UWVSÉUQM YM<9"u"OAIQMjϫXZMt3t 9usi 7QS蘫Y[1҉U}u9tEtCE9KEp9us ZY)9EuuuV uыE}t?W胁 XtkVQ;_uFXu8WW _Xul(E@EV: Zu/ EBU$VY^UMuh@D&u?8 D8NjuDpjCPu uh@D&~VY[41҉TMe[^_]UWVS]s n{X1;s s WF,XsN1s s{$X1;s(s WF,Ys$&1C(C$Ze[^_]UWVS`ljUċ] E1= $ B&E @Z t uh $;@,tPXj11Xu 1 uu1ۉhLD&8Y VZtjى@[@t 8thi$Pl ZY1ۉ^@PYt UuBjٺZuhLD&h=$t.u hJ$ u t$ jٺ$_u hg$1 u<hS} <P[^J>hΔ"S ZYudžEPjjjjjjS襦 }Shu$ZJEPjhjjjjSڹ F }Sh$8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt Sh$fjSuuuuuQujSuuuuuxQ볁111otq;tlj/S Y_M̅tU@j/P^ _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjS5 }}Shê$ )‰U썄jYu h$R9  T uh$oj,S _ZDžtxu Sh $V9u:K j@Yu hP" t%Ɔ EPjhjjjjSx E, }t h'$_ )‰UčEPS _ZHUu-X 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS١ }!Sh[$ ~LHL+j,Sԡ _Zt S3 P U$UwYUShw$RP 1ɉWкY}Eu Ƈh5h\$S ^Zu Ƈhh$S ZYu Ƈhhj#S Y^u ƇhSj\E^ZPlӶEZYuhLD&^lSPpY[{u Ɔ 1kh#"S! _Zu Ɔ Nh5%S ZYu Ɔ  1h$S Y_th$S _Zu Ɔ Sh$pt$ jٺ@[u h$1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuuJjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuJLjSuuuuuI*jSuuuuuIjSu,^j=S ZYu h$@Ej hѫ$S up}u11҃uM#EEEUIj hݫ$S= u}u:1ۉjh$S u0}u 1ɉM1jh$S t@jh $S t,jh$S tjh$S }u'jP%XZWEEąuh$OE@MEM̍UE@u E "M1ҍE@tE WB#XEPRU,2EPU̍BP2EPU̍B8P 2WURP%$1ɉjh3$S{ }u'jP$Y[BM1ҍE@EW{"Z61ɉMURPEb1URE̍PRR1EPE̍P8RB1WEPPH$$1ɉjh<$S tjhF$S uB}EPjjjjDjju }`uhK$j hZ$SG }uߋEj/u5 _ZDžtSujz Hu_Sujg HuOƆEPjhjjjjGPb }t uhg$uh$11Ƀ}^ٍUE`j/Sb Y[uEjP JM JM ٍUEsj/S _ZuEj Pu  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P   JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" _ 8Sh$ q $eSl $Y[ hLD&> 4%tu h$fF@u ShƬ$  s d X @I : + uh֬$V EEẺUЋ4%t%E̋UЉ1tt h$E̋UЀPt @_t1j/S讔 _ZDžtGڍEY@uSh$ 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą h0$ EH$MH(MąuhV$}tdƅu Shs$r EPjjjjjjS膒 }t Sh$C FÅtMh$k1uLƅtFj:S豒 ZYt8URjhjjjj@PE 1}̃}t'h$j=Sk _ZE1ɉMt@Eh#SZYu)u h$p0hh$S詯Y_1utčph׭$SyYZu( sPu h$UphN#S@YZu(:u h$ph!SYZu(u h$ph$SήYZu πEh $S貮YZu @)h!"S薮YZu  hQ$SzYZu h!"S^YZt-h,$SMYZu h$S1YZuh$SYZuh$SYZuyh$SYZu`h$SͭYZu Gh$S购YZu@.h'"S蛭YZu hD$SYZu h=$ScYZu h $SGYZu @h6$S+YZu @hI$SYZu h$SYZumhP$SڬYZuThV$SYZu;h_$S訬YZu"h|"S菬YZ t Sh%$7}tuSh6$XZ1E s!t@uhS$Xs }u hn$XuSh$urBthQ#S߫ZYtSd Xu 1E}u.j,EċE@PR迾 uBhLD&#V>G1EMċ 9sM9 t>{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t u ZEủ)1 E}t5E- }t }EEHh$`" SX^ud}ShĮ$@dMA2Džt @h$S ZYUĉMȅt"h$S ZYthig$S ZYuEċU ẺUE%E̋EȉEЋE̋UЉh$SK ZYu\u h$30uQWj HRh$PQWj Hu؉߅ h$W Y[th $W _Z@   jٺ[u h*$ nbV@JEPjjjjjjSщ }Sh1$tzEPjjjjjjS虉 }ShJ$QtEEPjjjjjjSd }Shd$PYuh|$XZjE@P(C i(,P,k4EfFFE̅tHEEFEFEFF}u!1}F1uFj/W Y[Åt/uWjA HtJWh$1}_X/uWj HtWh$}̉XZuf~jCEPjjxjjjjSF }CShg$FY[-e[^_]UWVSEu} EEEE1ۉE싀D&tM܉UVP觿 ZYUMtCnuFE샸D&uu u EZ"DEEEE} D&EEe[^_]E8%uu E$e[^_]e[^_]UWVS]}1p,} t]%E苃%`E?EPhD&RuutAjj5l6PًU E=ƒu$E8E%"$t!$뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t R褟ZP蛟X1t 8t RyXPpXEtu7jVu| F;$0@%8tjjVi txTuxTjP僻DtVr,DX@ڞHXLtVE,LH讞P_TtV,TP肞XY\tV,\XV(KXZ]e[^_]:e[^_]UWVS0uhdj赙ZYuh\D&X9Áǀǀǀǀǀ@ `hL&P 48Y_tt %t 43 03up03@43jjj? tPd 03 43Xjjj tPd 03 43!D_ 03 43ЃhF+P P荩 =v1 1ɉ} !8%j,j@_Zu hlD&!Y ǃDj,jʗH_Zu hlD&Y ǃLj,j螗P_Zu hlD&Y ǃThhM&W辨 =vhlD&h$XZPPZYh"PL Y_t u-PP1҉xW/ ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0VA9u0hlD&hpE" ut=w@ƄS0V!91 1} 11PP}YZh"PP ZYt u t:RO YD9t֊ t uʀx\tH@߅tC%䟉1h# YZ} uj`@Pd u>ju PVq d`cU ZuhlD&_G`hp$V ZYu;}uP/ Y_$h" YZuA}uP޵ _ZutDž}tuh$蟵 ZYtOPPًU mDžY1ɉLu}tSV裼 XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSǃEE1fUfQMbZUu8؋Msۍ;ƸE9EsOƋE)Ɖr=89s "@G19r)SEЉ‹E9s )։1e[^_]UWVSSU uJTuhK$hK&h~Tuh$hK&hh_$ YLGL9t)cCu)U QM<W<ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjV+ à tSV S ۍe[^]UWVS8}1}عEX}ى‰+E pE؉U EPW_ZuUBtt U Btu VSZYe[^_]UE UU E]rUS]h(L&Pm hK&ØS\ ]US]S$ Y1t S Z]UWVSuhx$hK&hh_$G Ɖ׉j<|QS" CPqtS8jh_$/ jjSԘ ǃ t:jWS˜ ƃ }tG9Et G99EuWS W* e[^_]US]t"jjSt tu S@T06 ]US] UHSu蟖 ZY9tS蝵 X1ۉ؋]UE PTuhd$hK&hh_$9 2PuUWVSSEuhw$hlK&h;h_$ ӉϋBTx t*tSu贔 YXu-4STZt׍CPF^t1sCT9FTuwFt ;CtulSV* ZYu_FttCttC8PF8P ZYt>CPFPZYu+֋CT@$uFx9Cxu񺃳$ٺ$%t$Fts5cٺ$%t$vSj7Y[@u 8uw롨tCtt&Sj6_Z@to۳ 8t h$زYVj6_Z@u!蹳 8th$趲Sj6 Sj6ZY@u苳 8th$舲X1VuM Vu ؍e[^_]UWVSP}tDjjS趕 ƃ t)jVS褕 E 9~TuVS V uӍe[^_]UVS E uhx$hK&hPTuhd$hK&hh_$荨 2uh$hK&h߃}uFƈPV> XZt1SVg uhٳ$j uV̝ ىSne[^]UWVS8uhL&]S‘ h(L&EP贑 h(L&}W覑 u WV[8$thtK&h$_X14SVZYujEPjEPe[^_]SVZYt1xjjS! à jSEP ECT x t8hS_tC8PsTt<ZY@u h$AXS;U t0C9t ;E SEP赐 Y_ CT8ESP薐 XZC|twG|tڍEjuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWuW W <Et(SP ZYt`HT9KTu 8PC8PY_ 1ɉt8SEP SEP 9t htK&SXZ]PV(;_@uܯ 8Vt h$ٮ[jjW= à jSW' EC S9;U tSWa SEP u~CTt 48%u=t=ٺ${Sj2ZY@u 8t 8t h`K&XSY]';E ASV豑 SW趏 9t蹮 htK&赭SXZjjuV à uUWVSSljӉMЙ1Ʌxtؙ)ѸFE)عy11X[^_]UEuh!$hL&j;h,$֣ Ptt /1UEuh!$hL&jQh,$萣 Ptt 袭 /1UUuh!$hL&j}h,$J Jttt8` /1)z 1zuz uzu 1zUEuh!$hL&hh,$ڢ Pttt- / xjhL&P 1UUuh!$hL&hh,$u B<t<tt>菬 /1z'1zuz uzu 1z1U幀U E]UWVSu] }uhW$hXL&h{uhc$hXL&h|h,$ϡ Fu#<u;FuFPh,#WS1 @u612WSPFDPhÃVWSPFP Ã؍e[^_]UWVS}] uhk$hPL&huhw$hPL&hh,$" GS8t)R78s<t<t1&vvRS Q e[^_]UWVS(uuh!$htL&h$FE<t<FVU1TF1 G!)JO9ta B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1s /^1ۀ=83uV}ع1E׈E83S}W=WV&th$htL&h'h,$f 83؍e[^_]UVS]C<t<tf /g S؉U Y=83t1583S6Z;E th$hdL&hnh,$Ϟ 83Ǎe[^]UEU uh!$hDL&huh$hDL&hh,$脞 fPUWVEu uh!$h8L&huh$h8L&hh,$; fe^_]US`M&tPh´$ XZ]UWVSD1}]SZ@j0S1uuuu}WS1;5 A&s/$A&H>v ˧  DF1;5A&s/A&H>v 蒧  DFWSuk 1҉u uSjE0EP_vƃ SlYEt 8 0e[^_]UVSuEPu V| uVj肭 ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWhʴ$Vu 1Íe[^_]UWVSU} u19s$@u9s8uhд$hM&hC؀xth$hM&hh$% u1X9s%UjKQPŗ t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`P}XZ- `S X4%@t _t^Fh"y Yu'$PhE$S @< PhM$S @uWhY$S @dlhhT$WY YZu@htDžphxDjVYZuGDžphc$W YZWȘ Z|6hk$W ZYuDžph$W ZYh"W謜 ZYh$W藜 ZYhZ$W肜 ZYhs!Wm ZYhО$WX ZYuh$WC ZYpDžp Džp_t@F Phx$SY @p,M&tPh$S2 @84t pNdX"tB$Rh$S @VLT%t #Ju$Ph$S @ZvHh$S @BFPPh$Sq @(v$hɵ$SY @VʨPhԵ$S=@~Pt?vtFQPhhtR@ttRhݵ$S @~xu=4%@J1hL&tPo tXY#FxPh$S @uRz u RuARToX,QXtPZYX9Tth$S̐ ZY@jjtPɃ ƒ ttqXjjP誃 X9u-BTX Phg#So @XjR뛉Xh$hg#SD @Xu^jPSj; @Dh$W" ZYu-dXB$"hT$W ZYh$WϘ ZYh"W躘 ZYhs!W襘 ZYh$W萘 ZYthZ$W Y_twpulelxOpu VZ;puh/hxDpjVpY_"B$"Ph$S9 @Wh $S# @V2uZ%u6u_%u*Ph$S @ut:u%uȞ@t>(WtY%uPh'$S @ubh5$S_Z@Npubll@lq PVh/$ST@d/$h@pt!pNVhb$S 1huvh@Lt㋍hqPPVh/$SN"@urpt)ptptVS,ZYpujlt l@u1d lqPVhb$SS@db$QNppuA 8tV _yhpHpDVhb$S\!@WpCPhg#S @tXd 0uSe S蟔Y^u hM&蜛Z#_tFP`P u,hM&lX_Džp؍e[^_]UVSË2;tPSd e[^]UWVSQ} utu=GL$t "Hts!}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt WhZt!CE}tc$EE@t]jW[^t WYuu"Ep}tk$Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9n :jhG$S uSS菎 \ZY9rhX,oc X1e[^]UWVSEE} u |UƃuhL&Y[jhL$W臑 uu Ee[^_]E1҉UWPE PhQ$EPFƃuuhL&hpE"a jEPV @u . 8thL&h"&1ɉM^_EuƒutSPċ ZY} -];уM I+ѻ}hg"EP ZY;tjhƩ$S ujh©$Sh uu1;}1u1;} uJulz [EPjjjjjjSR }tG,9uSv 賊 ZYEPjjjjjjSwR }u9G,nFul d!ukX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x ѐ VuQ9uu躐 "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms J 7뎉ߋM_.MIE)M܋E9,}v M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2M&M&Csy7Ku-y)‹ P-DAt/rumr^s ‹ P-DA@t t\tFx+B P-DAt/t U蚎 Uu=k膎 t#wr 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSlYZ@Whg#S| @}uSj= _Z@u$p hG"S| @u@ s=Vu hV}^P~n sVu SA> _ s Vu SF=  u諌 V* t.Vu PhV@Vhg#S?sh=#S,ZYsE1D0t<0u FuM )tSP蒒 Y_@u|u } 9K;} u@tPhO %Sj I ^Z@u3tPh"S{ @G루tffPhO %t&ffPh"Sz @c t PhO %@tPh"Sz t%7ǧPhg#Sz @sWj.VWjv tcVhg#SKz @tQ?tGuUWVC*P U[҃VSYm_Zu VSm[^tRXZR YtPt~rVS荌_Zu VSZYtXG /1 8 ؍e[^_]UWVS(E̋A tӉ΀ytu xVx}WY@$1FCt}ЉF tCUfCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtZ_ZF tU tUԋECTt14~t  h r$EtņCTZYuՃe[^_]UWVS8t F1Dž@jB UPP|f fDž ˉhPhiUp~d UJ>r*hPhip>d ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9)Zu)CT@fCXP5_u tt uC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 TupVXZtHHt'CstHHt󥃅  t'CXsXtHH)fSPM @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP&X@OHuWiSY1CPWPXZ$jjVSjLPW@uy 8 넋H؉@D@9DDx9@sx DD9@r׉F u]dERuGu:Xu hhW&gwX?$R$j DVW h@V C@u vl 8tˋC@RhqB@PQ @f@u fBuhI$MkXjEp VdV4S VhlBsqQ @tbDžDDPhpBsMQ @t>uSU ^_u1XZ]]V@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu g 뻋@À{>v P Sh$>c e[^]UWVSÉ։h,j9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRi^@u Ph$XbY[.Gw*hH Ph$)b %th, Pj8XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSjWAjPSV9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhPƃ tt)߅tPjVPYY9qQS  C{fCWVY^g0Q COt/t+V}N Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ Ph$EXE3 e[^_]UVS~\jhPF\ uFX 8u!5l,h$WY[ ShY&hpE"W 1Sh$jpK@uhY&h$sWXZ1e[^]UWVSE}uh$hdY&hh$N Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P& Z J(H J>r*󤋅uK%t9 t/hQQ@PPPB PhJ$8B>u1DhQPB*PP Rh`$RhX&.SXe[^_]UWVS$Ɖ1iu1ht$Rf,Xfth$SPà 1GiPV Rh$ARh$SP6ÃuS 8t8iW VhpE"uR!w hX& Vh$hR 1`64%@u"j5S,Y^@uƅS$Zu hX&QX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP<$Ztlje[^_]UWVS$ϋEE Eh$RJ ZYu}]ƅPgF $#XۋuhY&PYuQVhRSV+<@t-PDnP XZuEY&e[^_]P1j6j4a@uƅw x, "j@,Ph@hW9uxmWPh "amWPh "SVhκ$N$v "t)$u) mPWVh$`N(lPWSVh$6N ]e[^_]F*UWVS] Y&tPh"< XZE1E;s31;Et k, 9t@v 6h$e< PV脹G,1;uts 3h$?< PS^F,܍e[^_]UWVSEvpE E] P1}tEukSPh*$u> @tBE^PkPh$u> @t E9sT;] us< v!N Juj dU ZY@u؍CT9UbN "uj.U ZY@te[^_]UWVS]u }~EHt t4PWhV)@uxVhg#S Ut"/N QSj T ZY@tǃ7jPhg#Sj= @tE)uSjhT [^@uM 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE6",EPhMԋU܋E Y[E$EU1҉Uw|MUu fX1E}UċM1uGEEPSsEPCPfEPC8PYSu谖 tEE99w< v L YЍBEȉD9EMK "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu !Xu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPVԡEPFPǡEPF8P躡Vu ]E@PEPjMԋU܋E Y^u1҉UU9u XEEPW-EPGP EPG8PWuj ]뤋E؋E%u3E @hu$uЋE Ph$PHE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlSePu h$u@ujuMH^Z@t'a1Pu h/$u訡@u-S1PXePu hA$u}@ujuMZY@t,E#pVePu hS$u8@@ ؉PdPu hh$u@ut Ex,u@GhElPhhS>Su h$u贠$@ut 1;j@E,Ph@hSSu h$ud$@up;s VeC,X鋇@1ۋ;Ds Vu,Vdt%F$;BuFhuP]uPSh$?v$]uPSh$?E苀4E%t*FHT$hT$WЦjE8~HuJFt.Fhu(VJ9Hu~<t>t FH$FH˼$>u FHҼ$FHټ$~0uF8F4bWh< v4jE77Wh v8jE7(Whv0jE7v8v4Sh߼$>$E䋀~@uH%u>ViRUSh $>vvhUR7 @Uu Rh#$>Y[^hE䋀t=W[2Zu[E苀8E%t]h{$F>jE,7 >vHW<7juWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj 6(tl%ub  CiP61V}@ t;{t5{<t/s$'[PF Ph6$C=1ɺVjj51s p1C Cs`CCCC 1CCECHt V0Y1ɉKdChuṾXZs1CC C$Zue[^_]^e[^_]W|$wUWVStEUM]EEu\PK?_EPT%P$uY&Ht :tRQE PhV$;1ۉ]EPLt @v@}GLih诇 Eu>ZYEE1}m52%EPT%P$uY&Ht :tSS$RQE Phs$;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@EPWS u{4%t Shо$5[^jWS t jP&ZYF MmFuWS uh$h<wPh*PBPZ uhx  X\`\u TT1ҋTX#DT9 tj`9r7HPh Ph$ \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Ph $)XZn o`< uBHvWdVh3$WdVhJ$`  uWdVhf$uWdVhv$1CLDžXXX\Dpt;jXdhZYtWdVh$.XXuDžX`m\@6@t:j6dth-ZY@uWdVh$WdVh$!dhƃ tPh Ph$e(V; h4%u$h$hCiPh0謢hh sPjhCPu CP+WdVh$;C@FC$CD1CPh Ph^$ e[^_]UWVSEˋu$v%64>PSE Ph$ e[^_]Í1ɉMw )؉E1MMىuEe[^_]FUWVS ƉUMBEϋttb9tYtO8tJ9xTuEC><wPC*PEPϏ u%C PF Ph$euMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE 0Y&E$e[^_]|)WPS- nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉgfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftu;PE Ph$#(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPhpY&hp$ cCubh$RS u#>t=G PhpY&hpE"_WsPRWt^\ue[^_]UWVSE 0xjPuq* uEY&e[^_]ËOwvx:Pw Sh8$<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhHY&hp$ t @`jVP u hHY&YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,swsos g \SVtttt:uj@苃t$P载ǃ tP蟽ǃY1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_hOe ƉE1Em52%RR$C Ph[$ShVjN(e[^_]g_UVS]ShjVt~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF Ph$yVR1Cdh$V|V GunC t{@;GusP5PF Ph$%t VXE@hu5jZt9^duFh1Fd뮉e[^_]UVPuu,jy^uEh0Z& YE1҉@uUWVS]} SE^uh Z& %t Et09Pt jPoXZjWSk ƅu&j4Xt^FFF`EF EFE0pE7*N }WPh*$jQM0 E0h* X#C$Mt!PWQ Sh$@ Vj豕@u, 8th Z&h$ Y[FtVZ1Ft1E@F0Epe[^_]UWVSQ]tdue%u=t-htGdt jPXZj3ZY^wHSr j3vZXZ1GdEw$jVS t'W(9P uW,9Pu PC Ph$! 5w8w0G,PG(PVSu ] 8t둋AhAdjVSh ƅu Sh $K ]}tEW$9Pt jP(YXwdGhj3YXZ?uwHSq3 e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mutut |RP*EZYhPaXuC KUjWuR Ã}Ut} tuMUj4XۋUuEZ&e[^_] ECCC 1ɉK BCZ;C t/C 67;'VPh*$jC P }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+~ PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHPX]]y]UWU@Euu, Y_}UWVSQƉ uXӸ([&ljU [&9r 9EsҸ8[&ljU0[&~9M9 uZ[^_]UWVShPLufJ}xvw #htAEH@‹EEhЍHdfhdZh$$hPh藁Ëh  8thZ&h:$XZh?w8j@Zh_uhZ&^Lhǀ@hP @uhShS =wPƄ ƄPPhh$$hT@u$hZ&hQ$h1҉Y[hCjydwZXETE`\fu `\\@)ЉDW 7RP*RuM UuU]UWSU v% 11}}u1Z&M[_]UWVSUt΀yv  u1y tËAdr@t$tt @$u@h$uX؋U-ÅtF PSYFP}WWCPYFd@t KthT' u} WC8P}Y_XC9@VCXPhYZY؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV"LXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfv Ef9EEEM) u k@w ¸ w w w ?w xK9~%U "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGd((*1ۃ t%jPG@P1n ut #wdۉ؍e[^_]UWVSu }WVuw)WVu(pttSHIH9JHs؍e[^_]UVS]CtP蕠V SjjV]e[^]UWVSuFhPF Ph$,Vj@u3O 81t)E 8t; 8t1 8t hZ&.XF@t>jVC@Pl ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjSu'ƒ ujjS0n ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGdEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UVSEt0t.ttju CPPe t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j|ZuhZ&YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCdUSǃt_{ u Pu uƍS@ C t@sdKQPuR@u{ s{ u @t{ u j.EPC G{@u RURY^@s@t~{ 1UĊ  L @uj.EPC@Pj+ tJSRPh*$j.ChPV jC@Pu t @`C`KdK`C`uKd hxZ&SXZ1ۉ؍e[^_]UWVS EEE EEU}uM M܋M$MM(M؅uE苀t2RP EY[EujZEԋEt?jWC@P b u(EC`}}StP뽃}}WSjVWueP|@u 1C$C {4s(EC`1E@CEX}CPt Nju T'CdEt CdtS` ttSX{@t4E胠4uSuu!uSuu}uLSYMCAe[^_]UUjPR 1t!hRu h$uItUE1҅t%tHd((uH`ۉ]UVS]u!uu1҃jPS, t8Hu@`tFP^jRPStk1ɉJHB1Hd@ @$ǀ>jPj3w=uhc$SUXZЍe[^]UWVS]C$t1jjSP u苃%uuS^u묉%u^f{(uGC>Pu<{*Vh[&W] tVh[&W] u  VEuU1Ejj@VSHƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV V8FHtV FHE88V 1ZMjG@PRUY\ U܋Mt?uRG`t%tEGhPG Ph$VC sj.FhPRjx$ 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]9jjjVVd1SjjX$e[^_]US]-XE]UWVSQEv E 81ۅEjG@PE@PZ tGd(1E@`G`}u!GdtGhPuG Ph$IG` ttGd uCtWZOd }u/GdOdt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE Pu[ǀZ@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F s$ SEZ11BCZ؍e[^_]UVSÉփhPC Ph$zVSt VPZY hZ&Xe[^]US ]Sj.ڋEXZ]UWVS Et_uVjXZ؅tt8;Cdt,~ PjCPPCP@SF PtjR $če[^_]UWVSEttBu[0tFd%=u1҉vt Pu 0Y_6ϋEu@EtE #1B*Et E @ tt^tTCƅtDGPEPh9WRV =EPFP_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_h& ƉE1Em52%RR$C PhJ$Sh2gVj(e[^_]g_UU t,t9PuƀRhmjjUUу1t3wt-tRh[&h$ UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQP藘 t t0u5CPE Ph$1ɉKd EEt9sEsxF URV4RP% t tlVdtRNh$t $QPF Ph$aVja@uX 81tN 8t h[&KZ1F$F fdEt9sE6NEtXMPF$Pvu t t1F0PC Ph$ NtHVujuPECPEЋCL }ffMM9Msk KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuh9jWjEH}t?E Ph$HEESjE0#hk$u<e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S0 u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$PlOvǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPj E _X1EE 9CEuh$j uV茾 CPVh $u+ @ursXsTVh$u+@tuuVh'$u+@tCtPVh3$u+@tC`PC`^E'!uE6"g!t 6"Au#M" u6"bA#@u6"6"y-"uRWVQuVhB$u+ @&sdVhV$u+@ C1C;s WJF,Z拀H1C;Ls WJF,XCPECLE}EfE9Es SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhW_PB PEPu2XG UU)U-sx1t8Fd%u'~ t!GFhPWEPhe$u)@6ċ<e[^_]UVSu Ft%tF9CuuVCxPusݍe[^]UVS]Sjjf1҅t#09XuƀلtKj3%Y^u=t hk$S5XZe[^]UWVS] 31<t0h$xNj 󥊅zp 0h$%11Ҁ+u8B,CdtG{$tA1ɉڋ8u.ڋ8ChP0h$Z1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0h.$ֿ *?)t49$8xdt⋅4t4^u0h`$eY[+(뗋4t=4O8xPc4j40 8Y4jj48jj4 Z8@`y *t[j@t/*tJj4>^_@u80h$耾Y[$*0h$XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRh@[&hp$趽 jWV^ u h@[&|YWSXZe[^_]US]jjS u"C Ph$μSh)hS]É]]xUWVSPu} UUjWC P, Utۀ8$u%UPCPC Ph'$OCjV UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]Sh)hj7Sh2gj" ShEej ]ú ^&Jt f9tUWVSEU MftEv0f9su 1&f9u}tMf9)M [^_]UWVSEu} tRU w  'fɋ] ] +39s "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸuѸ3URj uQЉƃuEfǀ<X GfEfwEă Ph4$WY[f>ff}fuEfǀ< 1҉1ЉЃEu.Ef}w ]&PhI$j ]S- 1:BUP_XۋUuhD]&賹XߋMDڸuf}f9<t >Mčq RVh]$PeS联Ef]f<A 18f}uVhr$Ƹ}ȃlT'Y[Eċ4%tj貱XZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPVUt1ǀ( Kf1ɉHGEe[^_]UWVShEw EdEEEE@|tXdÀuXdBEAE1ɉMM}qEf9UrZ9]s#v E Ph$職XZ0u<}])Ӎ{}ff}ftftfu f9s# E Ph$_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSP& UtGF΅uE4%@u+j EPjEPCtPE Ph$f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPsuSVPE Ph$(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw#i E Ph$tZYEܹEȉEUʉU9s'& uuE Ph $qEX|ۍEjPSs uCduCdcd{4u EC$U9S tKdS C E}}uuE PhE$g f}t2}O`MQ9rG`E̅tMqduV9rAdE}E؉E};aV}9GhUGhMjhPu~ǀ(EfEĉ{(u 1ECEEe[^_]UWVSljUMu w@ Phm$G 1҉u1ɋUYt" E1ɉKhKdK`ǃu uVj舓XZƃ>VuMUZYuC;u}tG Ph$[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]X 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQh$蕱~(WQh$ EPjSuuAtBf}u;8σ G=DQwWF,1RPSh$;~,WSh$諱 e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@$}tQuЋE؃ Ph$u18ujjE؋ EPjT$[&8u ǃ82$EPj s@s<Qtf}uʁXsXS`1CdChǃJ8u ǃ8:$8u ǃ8A$8u ǃ8H$8u ǃ8P${`tts|C`t}t8sLCDCLCHCPCFd rFV t#tFhPF Ph$般 1F$upFhPF Ph$葬 Vd s"1F$F VjjF٤-NtHN rVXV蓮YHE؍p C`;u PVh$MuVh$,KdSh tRQPVh$u/)uVh,$u RVh|$ujE0XZ}uA}t;WVh $hsHsDhWE0& @u Wh#$诫_XE؋_|tACdƒ t ujC@Ps? tKd Cd uVh<$h8u E0 E؋4u$}؋t%uj謣Y[XZ믍e[^_]g_W|$wUWVS,(h1Džh#fDžBDž<"#K8Qff@98tB9rIpr@uHtHu f$8,nt104tj g0\ZYHu" t\10fDž$H8% t#j@wP?(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P Ph$ DP4BnFDFLVHVP1ɉNDNHt h $SXZP3c SjjMw0%t11҉SY2~Dt h$SPXZu Sh$M1ZYe[^]US]?S Rh $P* ؋]US]C Ph2$XZ؋]US]?S Rhd$PŐ ؋][US]ShjƉC Ph$蟑؋]US]?S Rh$PJSh`je1҉؋]UWVSƋu5ht$苐f,XfthWP2 8PV Rh$EhWP6 Z4%@"PPR @ {TWjpj u +)CTSXWjKZY@KhtD1+9}F Phw$Y_DsDjbCD_Zu h\&UY#Nj󤋅CH_1҉tjhj|P蠗P6~ sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6h$'| PVFG,1;uts 3h$| PS F,܍e[^_]UE@|tPd(t1]USEu1X|tuu Sp u؋]UVSEt0t-uvX|tuu S( u1ۉ؍e[^]1UWVS} 7G@4j.DSFPj4wSh$`)}tE@<"jWu胚< u hh]&iG8@Pj48PNj<% tj<01ɉ,0,;(⋍(tx}HlaDP< Ph@$<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Ph]$648sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhPsjjS襂u"C Ph$]~ShS詉FSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPMv u EU S蛀Zt~8 1pp@1x xx$3@u Shl\&hpE"h}:SY(h$SXZP3YXt jjV|P蛅t j3XZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uE$uSrZYwLWw4WwPhy$ye YX؃t w t u F17tA9MuuUM7PhN %e XZUM΃`Ѝe[^_]Uh,h}$_jY^ 33t9W|$wUWVS31B31x,% @5f@6 s f3.s f3P s1f3f p3f 335 1s33 ut/33 33 3f31=,Of33ff3f3=3tjVEȣ3Eȣ3ZY,XT3 5X3U1E3]5\3`3jhT355ƃ x9u h$XVS53hR$b @6Hujh,j 33󥸤33 3u3󥺼335|,=,u؉}mrq,E؉ 33 33E33=ɚ;~ 33-ʚ;333 3%we[^_]g_UWVS4ƉU)'ht$a Y>^ hx$ǨFfVRVRPWSPh$a j.]SFPjIuj.h!S[ Sh$Oa j.SFPjuj.h!S[ S7F^(ZU)ڃ<,wJ<w1tR<CSPSPh$<+h$"<:tI<<tG<T@8PhN$P $^&<uT@<w*$^&h$Bh$;h$4hЙ#-h#&Ph'$,T@t <uhi#hg$~^ Ph}$]K Y[THLh$8K T@Z<t%w uh$<uh$h$K _h$Ph$J [^T@8Ph$J THmh.$h;$hF$hU$he$h$hs$h$vh$lh$jj.STPjuj.h!SD Sh$J j.STPjߔuj.h!SlD Sh$h$I hg"I T@f8fZYfw2$^&h$h$h$h$h@$h.$}9Huh8$nhE$hO$TI S1ɋHU t Sh#h\$&uj.VSjݓhf$H [hp$H hg"H T@fHfZYfw-$^&h$!h$h$h$ h$h@$H XA6t-T@<m4_&h"Ph#NH ^_@6 A6uhX,$ [g v狝t݃{)!C2t!#t1 h$3th$G C Yh$G C HC SRRPC Ph$G HAǃxPh$kG XZ h$]G XCPh$MG Y^19~gVHAYZuVh$(G XZCj.RPjuj.h!RrA PVh$F F땋L 9؋33t9~B6 4t493 =3P? UWVS]u#p6tP3^1ۉp6t6SM t6@$ +p6YuYY U1҉l65P-t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE,]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=p6tQu Wn[^u<5t6Pi)YtHWP6[D3XZh5)^1u?qW Dž)Etw}xjjju< !jh@PE xDž1ɉ1ދ9rqhQulƒ ?tufZsV 0S0fV 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^uM[Ɖ‰,1i<#au SZYNFS;/XDž,K1j=h%S Ɗt F:uFHX)ىMQRPu[Ë tK}t u-XWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt u6Xx-FS _<ljljƉlj )PVQ SR ,Ymt un^)؍P9s&PS:)ZYuS,UR XË Dže[^_]UPjujM UEUh6tP7 1҉h6Y1`6l6d61UWVS1=`6uE `6=h6uYh_`$`60oA h6^_u=`P5h6ZY[t?Duz1=d6p6t=l6ul6h6u@ @uP7 1h6`6P`6@Zu 1Uh_`$PAڋ P-f\Yf:u#t =d6t|0\Ld6E|0\u d6N1ɍt:uf:Y\tAߍP5h6Y^u'h6tB @R6 1h6ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu!/O l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh!6h%6uƒ1uEUWVS} uHu7uuW1ɋUà =%6u u1Ɖ>1e[^_]UPEPhh!6h%6uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙa"߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס&6EС\&6E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU<7 $URj^W(7 $WjMV7 $Vj<$S7 ZE] Ee[^_]UVS@ÉjjjQjRP tN9tLtHVP轰 ZY@u:TB j@]S0L h?"Shr$P,=&6t 1e[^]UWVSSÃ=D&6tO1t l&6<!jwơl&6!p&6)Y9sRUwD&6Z9Uu)@uÅu,&6!1ɉ1ƅtÉ5,&6(&61e[^_]USX?,&69(&6r,&6É,&6 4t1[]À=&6UVSh6"h6"h6"h$,h6"h?"h[!h$,, g!=&6tM"%=&6t$[C"=&6tQC"QRPh$Ӌ5,G#=&6t$W#=&6tg$jB"=&6tY!$=&6t*%SQRP֋,U㡠&6h6"h?"Ph$Ӌ, Uh6"h?"Ph$Ӌ,Ux&6ih6"h?"Ph$Ӌ, U|&6Ah6"h?"Ph$Ӌ,Up&6h6"h6"Ph$Ӌ, U㡨,h6"h#Ph $h6"h6"h6"h%$, e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS&6&6&6k(0hPb&@P 1ۉ^,&6~0XY1;&6s6U1h@b&GP KGU C(XYk(|0&6&69subC[^]á &6uÀ=&6>UWVS< 0DžDžDžjjPh&6jSu@u &6 &6P&61 @H&6hShi$ tƄ181ƅGhz$ Xtpr uʊt͍B<9;$@`&&6R&6F&6:&6.&6"&6,&6B9H,@,&6&6,H,&6J9@,,H,&6J9~}@,u&6l&6c&6Z&6Q&6H&6?&66&6-ƅU hI"Rh$P,C&6n3q: 0=&6t h$ Y,9,},=,‰|&6 &6 &6s5&6&6&6)I &6x&6H t&6tH &6 ,p&6Xl&6 h&6Ɖ5d&65`&6#&6tA `&65`&6)\&6=&6t*1҉j Ph!! h`b&hL&6 joH&6D&6@&6h`b&h0&6 11$&6&6}ã &6u&&6 1t&61e[^_]1À=&6u1á$&6u $&6UWVS@É;H&6;@&6jIn¡@&6_9u739u0P,nY;@&6u;D&6)D&6@&6jVS} 19Z;P p&6PPh0&6 =p&6XZVS( Y_@u:7 j@}W0S h?"Whr$P,=&6tC 95p&6u"tX p&6PPh0&6S XZe[^_]UWVSEЉʋl&6!Ë &6)){ MA L>D=&6tMjRPl M95`&6sxu@)lj|| >;d&6Fs"J| u| | DT>| T 9Ss$EExSWs ED CSWn ;sss{uISC PD XZ=&6uE@,t p&6EX,p&6؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC &6‰ى[^_]UWVS¡l&6!9t> &6)su܋tu 9t)D @!u܋D UEPhL&6& @ZYe[^_]UWVSQӋl&6!‹ &6)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋l&6!9_C E؋ &6E)puЋ|&6Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w a&w)a&w4a&1;SsS |C@C;Fu ;u1ɉHt SFP XZN]H9t9sxt PFP Y_SV XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPhL&6 PhL&6D =&6t KZ{ SC $&6$&6e[^_]UWVS9p&6tp&69kjjh0&6x ǃ t؋_ jWh0&6_ EWh0&6 $&6=$&6;H&6r;@&6rw1ɉ Åuj}먋 h&61ÅuP=D&6@u1jZhNjl&6!‰)[9tP:hD&6Y9uō3@&6t]EPh0&6- XZt>G 9r7 39s0jWh0&6 EWh0&6 $&6=$&6}뾉؍e[^_]UWVSÉU &6EC1t}9xts@Ƌuzơd&6EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=,H9s?MjB,@Pr( Mu e[^_]C(S,z{,f P{<t[FL-01=,H9s H-29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E ,HuVQM t uMQ< ZU9ufG}uf 1e[^_]UVSË@9r{uC&6C&6KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC&6C&6[^]èu'B P-fAf'f` ЃðUS1u4 x&Z ZYuCC u1]UUE ft҉Ux&]1]UWVS É1=,H9s33C8C,EL-EH-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhm$V` u 1ɺjht$VC u1ɺmS j@B@Pr  u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3KP-9)BC9S9{uC&6C&6S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC&6C&6{uC&6C&68Dz@U׉DRO^fE11=,H9}"uQMBZYMt UGjE@$E@PEp n u j}G W$JO$f4PY{uC&6C&6EH9G8:>x]49r{uC&6C&6<]t<-u{uC&6C&6=ȋUC9r{uC&6C&6S9sH9s8=ux]u {C~8-P9x]x-t  -f9=,f9~0{uC &6C&6f9UG1=,H9|f9jE@4E@PEp0 u MA0Q4f8fpBQ4EV~{uC &6C&61E, U%Gu48-u@-U;Cr{uC P8]u &6C&6{ Ex8tC @tEH,E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF P-f tNt L- t< H-ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC&6C&6Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC &6C&6{ &6щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6JP-DJt%9~{uC &6C&6PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC &6C&6 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC&6C&62SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $w&^[m\p{|;{r{uC&6C&6S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u&6C&6 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC&6C&6Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx P-Dyu@<,t<{uC C&6&6}{uC &6}~{u9C 0@}t{tE&6C&6+uN+ue&6C&6-&6C&6C &6C&6+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJP-DJt%9~{uC &6C&6PSY9s8}u @48}t#@9r{uC &6C&6 {9s9r։v!?t{u#P9sPP-DPt o1e[^_]UWVS} U0E tEp9) W [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}Eu]:}*DžhO*1>11h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h$NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVSa uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tPP-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡP-f}UfMQPf_tIf}tAf}uf})E@P-Buf}_uڻzf}P-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY P-E@Af}_ fE@Af}_ 8uY8EP-DBuf}_f}u7EP-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} P-1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h$NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVP uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRUJ UuEEf u@EuLft:f} upucp(fE}Rf}tTP-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRUG tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} P-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRUB UuEEf u@EuLft:f} upucp(fE}Rf}tTP-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU8? tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} P-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h$NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV7 uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=,lt1ۉ]tMEAEWe YE}M9M) N,F4EF8EtwF}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$ɀU6DžDžDžDžDžUE@fE@fMIL$D$ bD$D$$jt$ ?D$D$ 4$FEDžDžDžUE@MIMI Ɖ ȉ } Dž UE$襹D$D$Ɖ$Q D$:4$g Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%Kwҋ,VV9s%u9sF?V?4 r9i_oJdNN9sVu鋽D$ TD$D$$ܐV9sNu鋽E@D$ ?D$D$$h^V9sNu鋽*N9sVu鋽dNN9sVudNN9sVu=Exi @\Wዕt9dNN9sVudNN9sVu ydNV9sFu鋽Dž6pSdNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ 8D$D$ $^ȄLN9sVu鋽AD$AD$AD$D$ 9D$D$ $όlBD$D$hBD$D$ 9멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ :D$D$ $NjdAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ :D$D$ $N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ ?D$D$ $ N9sVuA D$A D$AD$ qD$D$$苉{V9sNu7@D$ ?D$D$ $N9sVuD$ ?D$D$ $讈N9sVuZD$D$D$D$ D$T$U$t"N9sVuEDžDžDžD$D$ D$D$ D$L$U$5ttN9sVu*})mUE@D$ hD$D$$EDžDžDžDž DžUyzUWVSt. sU11 rEEEEEEEEEH>U DEED$ED$$:U}ĉ|$T$E$ ƃtdE$腐 ƃt'D$ED$$::1҃ډJ MD$|$E$蝑 ) M 8D$ED$$9 8t[^_] UWVSP Dž/devDž/XtyDžyXXD$$:t-ƍD$D$FtH4$~ 4$A;D$D$ D$D$z$O@Dž|pT;0ƅpD$D$<$9ƅtgL$D$<$=uD$<$=tg$4:nC. P [^_] 8u)΃wΉ<$ ;uD$D$<$8`9EE ut|$E$Ut#ED$D$ $EtED$D$gt $| 1P [^_]KfDžUVS -ED$ED$ E D$ED$E$tK+ ƃt?uE$8E$c8[^]ËEUE$e8[^]þ[^]UVS P ÕL . ;l D$D$L$pz t@l $| ǃl L$7ǃLƃl 1 [^]֕ 0ǃl L$7ǃLƃl t袕 0ǃl L$`7ǃLƃl d UWVS<4 yuD$/4$V D$@4$ 6ƃ%D$T$$5۔ 4$6Ƅ=D$D$D$D$ D$D$ D$$Gh tVuw: ul<[^_]Àl uM, Ɖt$D$ D$D$4$j= ?l UVS uL 3D$/4$wT "Lt$l $ #+ l D$D$L$w BD$ D$D$L$x !Ѓl D$YD$L$s1[^]YLRD$D$%@4$3LD$t$l $y + Ɖt$D$ D$D$4$}=0 ?)qn${tƃL Y 8#t 0z 04$ƃt̑ UE$]fffUWVS ƍE@ E։υEE y ]]U ] }ED$D$ $D$&ЉM;MM }$UM T$L$ U$D$}&ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSP ID$T$|$$|$D$$nD$,H*)R)L$L$|$}<$cnteEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8# `}܉E؉UȋP-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,}L-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$]茀 1E܍ 'D$D$EЉ$]轃 t#tWuՉD$EЉ$]Z u݋FV }؉WF2}S1}؉}+E܍,}̉D$EЉ$] tu}܍BcD$EЉ$̃ K,D$EЉ$]覃 Hu݋E܍L}ȉD$EЉ$]o u݋}Љ<$]  |?sE܍LD$EЉ$]& uE}u8}DGt.E܍D$EЉ$] u1ۋEЉ t.u}.E}Q} auD$EЉ$]U usu̅u#D$EЉ$] uݸUWVSd éƋ'<'wwEVN)щȉMEED$$_t_FMȉFD$F$_t:F]؉F>FDF 1[^_]ÿ'E {UWVS虾 քD$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PdD$LD$T> f\$XD$Xtt$T=qw 9XD$Lt$Xtt$T=qw 9XtD|$P\$XL$HD$TD$dU ID$Tb\$XL$Hr^hT$X)Ћ$‹RD$\T$`F3WWD$|t$xt$X$1X\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$`$$`D$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$i0lPT$|@A$D$\T$`AQ T$TeD$T! f\$XL$XD$|)ЉD$|$)ى$iidtсqw 9XLg;$rD$DD$|PT$|X$A$D$\T$`AQ gD$T\$XL$HƉL$HD$|;$rD$DaD$|^PT$|X$P$T$dL$hPH gD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$iE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$K^^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$X^D$|PT$|t$Xp$B$\$dt$hZr D$XgD$Pa fD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$Pj $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PID$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$PXD$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$PVh WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<XEuFt7>t ] 1uUT$$]G:tFuɿ [^_]UWVS蓑 Wt: >t M1uU T$$9tFu̿[^_]UWVS, qWpt:l>t M1uU T$$y9tFu̿[^_]UWVS Ő WE $ƋE%EEbUuUT$$…plU>t M1uUT$$8t1FűuUEEu54$I4E [^_]ËUt }1]uЋu9t!$U/N D$UT$4$ E0E렃}tE1҉UWVS荏 Uu Ex}u 4t+D$4$7uE)E@ [^_]Ëp t 1[^_]Ét$jD$$UWVS HUE D$E$PX D$ED$4$^NjE8tBX 8"tn¸p uOt$ E D$fD$$҉[^_]X 8"u썇v뱋p t[^_]ÍvҋE D$RD$$UVS KTuF$12F $&24$2[^]UWVSʍ TE 1t 8u$W)E]M $NjExlD$4$H-MA XEU PMbEED$<$EDž?nED$=<$ HE u M D$<$Z5uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE gp t&}G$0<$x01ɉME[^_]É|$jD$$$F0̉<$<0E$10뷐UWVS8ދ #RuU D$D$4$ uD$:4$ DžD$7D$4$ hF$I $'D$$<[D$D$|$ D$D$j4$3$&AD$D$|$ D$D$4$}3I|$$ƅ>d~kD$E D$ ED$D$4$_tWD$D$zd@ $y9  $D$$ZL |$$ƅOD$E D$ ED$D$$$[OD$E$6>PtD$$V}$m-$_--S 8[^_]À>/uEt$D$<$t'D$<$^R 8E D$t$E$9 }8[^_]ËE D$D$E$9 E D$D$D$ ED$D$j$1BE D$t$E$? gR E D$D$E$9 Dž1D$ D$E D$E$=Dž1`Q E D$D$E$8 10$UjQ t$ gD$E D$E$<<$1D$E$;D$/4$8!P E D$;D$E$7 DžDžkP E D$P E D$US(] âLEEED$D$ED$ ED$D$E$.x E([]øUS( 6LEE>ED$D$ED$ ED$D$E$.x E([]øUS(腅 KD$ D$$?D$D$D$D$D$ D$D$D$D$ $.x D$([]øUS QKED$D$ ED$ED$$x E[]øUS賄 JE$4U薄 JU\t \]Í\]UWVS` åJ}|$E D$E$w5 9s [^_]>N ?|$ t$;D$$\[^_]UWVS 4J}|$E D$E$ 9s [^_]M ?|$ t$;D$$\[^_]US 考 IE$t []ÉEɴT$$\EUS : IE D$E$t []ÉEɴT$$\EUVS 1Iu4$t[^]ÅtEt$ܴT$$\EUWVS蛂 Hu} |$4$`"t[^_]ÅttE|$ t$ <$2~F [^_]D$$^2ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVSX8| BE}C11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<]E E;EriEE؅jEU9s UEUȃE9sv ED#UȅtEDDEX[^_]ËU#EE%ju}čE܉ƉEEU$T$?uẼƉE wt  ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EtUE9U9v UD#Eȃv UDEȅUDzwMaEEEE}πFI:k=b*}wű]u@MEU$T$]jMʉM}uEMũ~uYbO? wűEЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?zw<@lfEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEfCE%#jxE%#joEUEwù}FG8U}1 =FEt'E;Es ]ĈEEU̍Z]u܉ʉME}EMEsEЋU t1҉EU<@PGE̋EixủEFEE;Es U=EũE,UD$EUD$ T$ED$E D$E$]fffffUVSu <uED$ ED$E D$4$*D$ED$4$U[^]UWVS4ru ÷;UEzlj(aED$/<$ t<|$swD$ED$ ED$ED$4$/4[^_]ËE BAE|$ED$ED$ D$ED$ ED$ED$4$u> 8upED$ |$ED$ED$9D$ED$ ED$ED$4$|MO> 8u 7EL2> 8t ED$|$GD$ED$ ED$ED$4$= = USs 9EU M]]] ]][] USEU M]]]] ]][]fffUWVStNs Ó9D$L$<$X$ t$eD$<$ 1 Dt$D$$| ũED$ BD$D$$'rt; UWVSp &7D$ED$$st{NjE88/tbD$/4$ …tL)JBU=wsG|wdD$}|$M$P Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSo 6}UtlƍxD$4$ tD%=`u'7$U tĄ[^_]v9 O1Ą[^_]\9 1UWVS/o t5}U)tlƍxD$4$Q tD%= u'BA$U tĄ[^_]8 O1Ą[^_]8 1US(n 4EEED$D$ED$ ED$D$E$#x E([]øUEM tP8u ߉P81]à ]UWVS m :4}tc$>UT$U T$$.ƅt/tV$ uDt$D$<$}Ɖ [^_]ÍD$$|u [^_]U 7m 3U T$UT$M6$]U EtUT$U T$$]ø]US l 3E D$E$=u$ED$ED$M6$ []øUVS l 2uED$E D$4$=uED$ED$4$H [^]øUWVSL/l t2E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$IEPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$<E$蕍1L[^_]€,6Eԋ U2bL[^_]UVS4j )1uЉt$E $莤ED$t$E$y4[^]U j 0U T$UT$M6$D]UWVSoj ô0uEE}ED$E D$4$;t}EE u[^_][^_]UWVS4j T0M68ủt$E$豣E D$t$<$4[^_]UWVSi 0EE}M60E D$ED$4$ ;t}EE u[^_]?[^_]UWVS4ai æ/uED$E D$4$:t%}̉|$E$ED$|$4$4[^_]UWVS4i G/M60E D$ED$4$Q:t%}̉|$E$艢ED$|$4$w4[^_]UWVSHh .MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$;nE9u܋EUȉT$D$ $MJ9M $51H[^_]€,6}ԋ Uy'H[^_]UVS4g -uЉt$E $.ED$t$E$4[^]U @g -U T$UT$M6$u]UWVSg T-uEE}ED$E D$4$Z8t}EE u[^_][^_]UWVS4f ,M68ủt$E$QE D$t$<$4[^_]UWVSff ë,EE}M60E D$ED$4$7t}EE u[^_]p[^_]UWVS4f F,uED$E D$4$U7t%}̉|$E$荟ED$|$4$ 4[^_]UWVS4e +M60E D$ED$4$6t%}̉|$E$)ED$|$4$4[^_]UVS ?e Ä+EM thP8t P8M6@:t1 [^]ÁP8qID$D$S6@<$/HH8붸 [^]UEt @:]ø]UVS d *M6t^d,,T$XT$$3M6tE$\1M6$$<M6 [^]Í]$ u뎍g$ $1fffUWVS0c &*u6zETz~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$ωU9UX9UF?MP- DQEmML$D$4$H44$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$3mFM9ED$FD$4$X3EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$2xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$2}tE9} uD$ FD$FD$4$dFD$FD$4$1D$ ML$D$4$dFE[^_]UWVS0] Q#E}GDEEM698GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]ɁMEE9G~0W,10[^_]Ã]1^E:<$]o}1UZ ff~~ tωv$uE@,8@4F uf~n$O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$buĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$euE@,RD 9YUR, rfVAtωp$UHN HF 9u͋tp9dl9h0\d$xy DžxEP$vty DžtEL$Qy DžEԉH$,y Dž4$y Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$u}O, I4F uf~0r$4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$mu}O, 9I4F uf~k$ob O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$uXM6}9Gx E@,@1fF9x4dff`FF tƉv$OuE@,@4F vxfFXl)\N HF 9<$:u,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$uEH,@D gE@,pfFE^*LN HF 9-$utE@,8@1fF9t4PffXFF tƉv$uE@,@4F otfFMh&LN HF 9;$u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$cuEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$Au3M6}9GG800D$E$_f1UWVS|.@ sUu}} ,6M  M,6 ,6  $( Q,6,048<@DHLP ,,},6TX\`dhlptxE% TT} V,6|UUUUUUUUEE % ||}$€,6M MMMMM M$M(Mċ,UȋU$ UU}(,6]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$t}-T|$E$tt} |D$E $Ot}$UT$E$$!t}(EM̉L$E($syU$9 HU$T$ U T$UT$UT$UT$UT$ U T$UT$M6$w]U$9 U$T$ U T$UT$UT$UT$UT$ U T$UT$M6$]USY9 EM6t0ÁtZD`N6tuXN6 %BH[]US9 AUE t0ÁtZD`N6tuXN6 %BH[]UWVS8 Eu] %tFDU`N6^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]^1[^_]Ã9}ufXN6 Y[^_]U7 UT$M6$]UVS7 Et=PHӁ`N66u @D [^]ÉցXN6;1uڸ[^]UWVS<,7 qU Etzu<[^_]ËB$E@DE̋E@HEfEE@LfEEẺED$E@|$Ex|U B$&U BMADBEȃvgDE9tKuU M$ 8@MąɋU  AxDE9uU <$U %`N61t MAHALQDUEfEfEE}}ȉ|$A|$|$E$a1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$ E9p֋UăE9PD$E$9[<[^_]ËMA|tBfXN6 U $@EH|U U4 UT$M6$_]UWVS4 }M60t=Gt6G$&|$4$D$4$XZ1[^_]ø[^_]UWVS4 _u} t=Gt6G$v&|$4$D$4$Y1[^_]ø[^_]UVS3 EM tlPHց1`N66u7PDQAP|tA\Rtu1[^]ÉցXN6;3u뭸[^]U"3 kUT$M6$J]2 Fǀt UWVS82 (uM6E8`,…2N6E̋2M6E؋2M6EЋ2M6EG M6EG$M6E܋GTM6EȋGXM6EԋG\M6EG`M6GlM6EGmM6EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"FM61ҋ2‰T$$PV M6VM64$4$ 8[^_]N6EM6EM6EM6EM6EM6EM6EM6EM6EM6M6EM6EUWVS0 }D$4$nƅEdž3E Fdž2dž2dž2dž2dž2t 3ǃt džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $e3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$褢FD$D$D$D$ D$D$4$aF4$a4$D$D$D$D$ D$D$4$F tjD$$J4$$4$t4$4$6KHHM6t 3t4$#4$B[^_]Ë2t$d2$-h29tDžu拆3$4$1[^_]ËRhD맍]$B DžUWVSw- ü}2t$2d2$g29tƅu拇2$g"<$Ca3$U3$GM698t<$5[^_]<$[^_]UWVS, u +9uǃ8 >ǃ< <ǃ@ ^ǃD vǃL #ǃ :ǃ$ 'ǃ( #ǃ, #ǃ0 #ǃP -ǃH -ǃX _ǃl |ǃ oǃL -ǃT -ǃp <ǃt >ǃx *ǃ| !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$IT$ D$D$E$j 1 Tp=u[^_]US)+ nM1Tp =u[]UWVS,* = EƍME$+FF(9u݋uD$$8CuxuBAD$$$3T$$ǃL !ǃ8 +ǃt !ǃ< ,ǃ !ǃ@ -ǃ !ǃD .ǃ %ǃL 0ǃ %ǃ  `ǃ %ǃ aǃ ǃ$ fǃ ǃ( gǃ %ǃ, hǃ &ǃ0 iǃ$ %ǃ4 jǃL %ǃ8 kǃt %ǃ< lǃ %ǃ@ mǃ <%ǃD nǃ< %ǃP qǃ #ǃH oǃ #ǃX sǃ %ǃ\ tǃ $%ǃ` uǃ 4%ǃd vǃ, ,%ǃh wǃT %ǃl xǃD ǃ ~ǃ #ǃL pǃd #ǃT rǃ| d"ǃp yǃ e"ǃt zǃ ǃx {ǃ `"ǃ| |ǃ ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$IL$ D$T$$D Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>L $<t $^ $v $#s $:a $'O $#= $#+ $# $-< $- $_ $|T $oD $p $rd $y| $zw ${e $|S $}A UUS % i ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0$ EU܉MM672EE4E fEE$ƒ=4M4%y 4 44fǃ EDPf~M䋑f8>@E fWfcftf.MlU܅M6Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yf  B6f1҉Ѓ0[^_]ËE44%y 4EDPf y4D$ D$D$$ 4449)‹4L$ T$U؋MȉD$E$4;4U}dž4…f 4xp4fǃ +E$/t3E$=E0U$)4fǃ E܅U90tE@ U؋4 E44B%y 44D$ D$E‰T$E$]y4%y 4 494114M%y 4;4$fǃ Mԋ4D$ T$U؋ED$E$U؋M ~4y 4 49411x 4Wy 4 494B6ff @}AEE܅U$t-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃ &E܅{M6Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef` ,D$ D$!D$ =$* $dU: {Efǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX 'uM6MV8у$33`,EEtM6E(V8t@N<)tE11iE}uDX[^_]ËFF$J Ut p@뮃$<UVS, qƍD$4$ oD$4$ 4$I vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0 4Uu :uʈ2tU$LUF@fu2ML$ MD$T$<$2MEPJ(N$JN 3\t$ JD$D$$OFT}$˳ D$D$$OFXV ~$M69M6NTM6 M62P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$UE܋U؉$Mԉ $E܅t2džx2EtEJdžx2dž|2UtE.dž|2E؃0[^_]ËHt1@@Dǀ@l@hǀǀǀ<HHpF$B(KE`U܋ED$<$ U|E>U܋ED$<$ Uu p2EU܋ED$<$ Up22@@ ,F@f`L$ D$d=D$<$2E41E$D$E$ u džx2EED$E$ u x2|$E$ x2Et ED$E$ u dž|2EtD$E$v u |2|$E$Q r|2c~ LSMt|$E$ u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$+ uDx2dž|2džt2džx2$蛳dž|2EEdžt2džx2dž|2E&U $M6D$E$]US EM6H$ M6H M6HT M6HX M6Hl M62 p2 t2 x2 |2 2$C[]U ]MM6tJXM61]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS @ }}ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]葨QPf9uǀFF [^_]ËEFf\Nu]ED$$]SMME$ ]UMtbf@f@@ f@@f@@]\]X ]]UU9uU]P=$ҳ$],D$ D$D$0=$g $轻]|=$y$蠻UWVS W ÜƉ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS Eu^9t)fxf8u@$9u׋~1$]蔮9> $]|4$t[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS }fǃ $,Pf9uǀ2ǃ ǃ ǃ Lk2@tL$H =w4D$T$$ N2D9u[^_]Í|=$荰$贸US q ²E EM6t+2UT$$UPE []ø []U XUM ~*M6t2t 1]É1]UWVS  M6te3339}}<31 [^_]à D$$V‹t!3333뱸빋33D$BD$$n 33]\33o'U  4EM6t%2UT$$1ɋUE]ø]U MM6tJTM61]ø]UWVSi î}<$9ƃuOG @tIX 8u?M63t-M6D$M6$qǀ3[^_]UWVS  /EUM62E EE$3= %y   fǃ LNfu f9q fmffjMUU$K E$mE@ @ME@ M  %y   LNf   yt鋓  9f y [^_]ËE$qt3E$8=DEMR [^_]ÃUfB   9| <  9f [^_]Ë %y  ; fǃ Eu-E$E@ @aσufF M6Q)=  Ef` [^_]ÿ,D$ D$ D$=$[ $豲UWVS$h íuM6M~V8у$?p33`,M MEtM6BEGF8V<v11‹FHP,UD$UT$PT$ PT$UT$$A[]ø[]UVS; ÀM60E D$ED$4$tCEt?VF,ED$ED$FD$ FD$ED$4$0A[^]øUVS uED$E D$4$tCEt?VF,ED$ED$FD$ FD$ED$4$@[^]øUS3 xEEt>HP,UD$U T$PT$ PT$UT$$H@[]ø[]fffUS M63t`3$o[]1[]UWVS Ⱦudž243@fu|$$. t%F@f|$$ 43`3<3h3@3l3D3p3H3t3L3x3P3|3T33X33\3383d3Fl83Fm4322<32D32H32L32P32T3222@3%2fdž2432<32D32H32L32P32222324832@3%g2`33@fuT$D$$ [^_]dž3M6M61 [^_]ø|$$ UVS 8M6$LtHlM6 PmM61[^]UVS M63ugM6N6ǀ2233t9@fuT$D$$լ [^]q1 [^]UVS OM63ugM6N6ǀ23tE`33@fuT$D$$7 [^]1 [^]UVS l ñM63ucM63tW2u<23@fuT$D$$襫 [^]Í291 [^]UVS ]C=w"DtM6X ÃM63M63M6Q8udQ82u=`33@fuT$D$$S [^_]Í2pvt׋Q81 [^_]USi îM63u`,1[]US0 uM63u`,1[]OUVS 8M6332222`3d3ǀ2223@fuT$D$$ [^] 3m1 [^]UVS ! fM6332222`3d3ǀ2N63@fuT$D$$% [^] 3m1 [^]UWVSN Ó} MM63322l3UujU22l3N63@fuT$D$$?[^_]ÁU 3P1[^_]ø[^_]UA D$M6$]U ^D$M6$]UWVS /u$, 33|$ D$D$F$Y2VT$I|$ D$PT$$2VT$|$ D$PT$$_F@:udž3[^_]Ë2VT$|$ D$P<T$$M68M68 w+3<$舆31҉31 US :[] װM63USm òM6$1[]USA ÆM63t-3@fuT$$ []1[]US .M63t53@fuT$D$$H []1 [] կM63ts31f M63tu31@ M63tUs3E1]ø UM63tUu3E1]1U !M6U31]UVS M6@@fuUT$D$ht@$ t Efu5  PwtU$Ѓ[^]Ëǀ3[^]UftM6M6UWVS, W, ( }M6@@fu|$D$ht@$@ 4UM6fM6M6;Pu9HtL$MԉT$U؉$NMԋUM6;Pu9HtL$T$$jN43@fuT$$ 3@fuT$D$$蘞蛶$$P,[^_]EfEfM6;tǂ3U9ǁ3M6M6PEEEEEE  D$}܉|$$觧 ǃ( *:XD$$ $ ǃ, US %, t[]Í:XD$$蘤 $ ǃ, []US ׫, u[]Ë$ D$$J ǃ, []US$J Ï( t$[]ÍPEEEEEE  D$ED$$l ǃ( $[]US$ ( $[]ÍED$D$$  9Et( $[]D$  D$$ 1UWVS4R ×M63;3@fT$$ , ( yM6B$kD$D$ HQT$PT$@$ģ S6@|UqIE؉D$D$ $Uԋ@t A:zUԋ}؉|$D$$|$D$Uԋ@X$p@$[v D$ D$D$@$蒡ǀ343@fuT$D$$K4[^_] S6@|qIM"E܉D$D$$ݣ  9E( M6R뒸$ D$$ ǃ, ( |14[^_]qIMvUԋM؉L$D$8$Uԋ@YD$  D$$ CUWVS,s øEEEE uԉt$}|$$(KEEEED$|$$JD$$;LM63tD$t$$J,[^_] M63trUS ʦM63u-3@fuT$$+| []øUS - rM63@fuT$D$$蕗 []US #M643@fuT$${ []>US ץE U S6RtI|t7qIT$D$$M6ǀ3@$r 1 []ËxtqIT$D$$_M6ǀ3@$:r 뵸 []UWVS EM62tt_ [^_]S6@tǂ2qIT$D$$@$q [^_]S6@@ttǂ2S6@jǂ2U 8M62$]ffUS]E  }t J;}R ;~1[]ÃUWVS Σ}tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$茈G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀh íR433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$~UЋM;4ED$ EF,D$D$3$蒭ED>$~EENjE94~WD>D$E$E!эP$U? D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$&D$M2$EE[^_]ErUWVS8 bƉU̍R4EԉuЋ4M8<$F ƀ?tqE4EEEEE'E$0}M9ErIUU)ր?Et7E܉D$ t$|$E؉$+{Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U辄 U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $Uc UIuE)muuzEfUWVS,# hEօE93}ʅDP-?@tDG@uM$U MɋUM4M׍MMu܉ƉUE$xUt7)ր?t.ED$ t$|$E$xEyĸ,[^_]Ëu܋U)׉|$$4…tٍNDvu4]Xʉ1,[^_]ø1ɍBA1US Ew"doD$$]3[]øUS ӘM6t3tUT$$\[]øUS J ÏM6t&3tU T$UT$$( []øUS DM6t3tUT$$[]øUS M6t&3tU T$UT$$ []øUSp õM6t3tUT$$\[]øUS, qU M6t*3t ML$ T$UT$$<[]øUVS M60toƆ43u'3tU$~3$|[^]Ë2Ppt%T$$<D$2$[^]øUS D ÉUM6t$3tD$T$$ []øU @UM6t~;3TR4]1]US M6t3t$V[]øUS} •M6t"3t$Ut nY[]øUWVS 4 yM60Ɔ43uj33~BE14u_uE;3|Ճ}tO3$&z [^_]Ë2Ptt&T$$OD$2$. [^_]øUV UM6MMM ] US/ tM6t3t$Y[]øUWVS 5M60E E4ED$ D$MML$$ttiP$ULiDžtUU UED$ UT$ML$<$st&E$U%Ɖ<$q [^_]þUS( mEt3t$S[]øUWVS 3u3t$"3~#14$p;3|ߋ4$pd3ǃddž3D$0$/l4t`2PtD@@X~:Ɔ3o$g/2@PX3@$41[^_]Ɔ3UWVS u3t$3~#14$o93ߋ4$o[^_]UWVS]r3Y3KE ~443 u} })u}}11]]9t0z9u}9u]1~39114uu;3|ى[^_]B,B\4u u )lj<)} t7ƉL|G1[^_]ÿUVS utNFX32@@T%D$4$ E D$FX$1[^]øUWVS k ðEExD$D$<$pƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM`N6 u)1MfT$|$E $pE 01f%и [^_]øzUWVS~ ÎEEuE $oƒw]}E(1M149rEtfEt1[^_]ÉEE $]o,} E9tl$6otEHE 103EE1MM9rMEtfEtЪW‹EHE 1uu1U7U9rUEtfEtE%}`N6t]ft  ؉EP1u 9r[^_]ÉE'[EGfmHfmBЪEfmEH>UVSD yUE ӁttH@[^]Í €,6ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVS utv4$uVȉ‹9u F0$iF,$iM69pt]9p tJ9pt2t$Gu$gi4$_i1[^_]@u@ 9pu@9p uUF4$i>9UtU?$9Uu~X24H90t…#ȋH90utJ$h2UWVSe êlj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$9UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS| Ɖ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u=uAuIu 1[^_]S6@@8tf@ۃf@t4$t4$뭸[^_]US5 ~MU M6t%t X@t @@f%f1[]ø[]U 2UM6M u]]]U UM6M u]]UVS ؆E M62Uu0ÁE% úډ1[^]ø[^]US5 ~MM6t;U u4PX2P@P@[[8u1[] щH@[]Uֿ M6U]QU踿 M6U]UVS虿 ޅM60tFFX2@Ttf@4$4$S6@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]g]UEU Mu]3]USEUu2U Á ӺEڋE1[]ø[]USEM t;Uu4PX2P@P@[[8u1[] щH@[]UEt@@]ø]UU E]UU E]_UVSܽ !utFFX2@Ttf@4$64$"S6@@8tf@U 1[^]m S6PT1 t t t@t̀t(t t8t ttLt 1譼 S6PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS 蒻 ׁu4$y D$t$M6$N [^]UVS U Úu 4$y D$t$E$ [^]UWVS  auE M6:x1u 9t <uЉD$t$<$ [^_]É4$,y UWVS 軺 }M60E D$ED$4$t<$x D$|$4$\ [^_]UWVS a æu}ED$E D$4$貋t<$x D$|$4$ [^_]UWVS Q}uM6E D$ED$$URt/Ux0u 9t<uƉt$|$$ [^_]ÉU<$w ƋUt$|$$h UWVS s ø}uED$E D$E$t1x5u 9t <fuƉt$|$E$ [^_]É<$iw UVS >u Ex2u 9t<uЉD$t$E$ [^]É4$w fffffffUWVSD葸 ~}EUċEG,4@4E@U |c pE EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$蟾uD[^_]à E1D[^_]É$&_(EEFEȅbE@$^EyEGM+M9E O(U @9~F t$%gF E@ffO@E % ЩOH ȉFEfFE@EȃvA}$nRMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$IfG UMȋE@A%GGfGfwu}G9uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$6EEGT9tBuW,u P GG(<$1FEP1Ʌt=Uȉ}$QiMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$\1$A!E1$<\>E u E;GTuO,u u6uč @4E;GTRG8 v<$<$ EE 1oUčJ‰Uĉy19yuĉ)UBHFBLfFMEy19?E0B,4v4BDfFt$B|U$bu 4M%EOT9E M MO(ʋH92OU9U+GHFGLfFfFUO9UGDt$G|$bu+  GHaUuUȋu6O, 4I49~X}uEFDfG|$F|$aFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 E 1W9)ʍBE G8 M68u E<$rGG8 <$XEuĉ׉EċE MO(@9E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM E<$FEG8 <$ZmUWVS  w8uE;E0E,EP@,Dt@ 1H470RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fU VhUT$M6$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS(諠 f}GDEM698 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Ou¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$<$1([^_]EU_ eM6$]USE †eE] L *t&tl AL p 1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0詞 dE,EM6EL l E1M6EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9L ~#tyڅlE)e)UǃL 10[^_]UWVS蟝 c}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVS .c}G(~"1D0$D0$G#9w([^_]UWVS訜 buL 1~019t% 9p uDŽl 9uۉ[^_]ffffUWVS A Æb]ƉE׉UM$HL]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]\AG |$F|$IJu [^_]ËEED$E@,$];tыuF,U)D$F0$];tF0V]K +J K( <K,[+ZR,UʉUrprpP 9MuԋEU܋zUED$<$]1KUBEE9FEP1 [^_]ËVE}ǍD$uF4$]:ÅF4F0V, M܉ً]Ӊ]u܉HXXXX @x9UuҋE];9NG EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS͘ _E]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$EM691[^_]C:}M6M69M69M69S9M 9u M S EM689E9EE)Dž#EM6tS} x }x$}u UM su 9+EM68;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U膖 \E~M ~M69B$t ]1]ËE 9B ]UWVS = Â\UE M6Ex$9}hM6P H4 9unfH$p <19} JBzoM6P H4 9u80H$p <19}  0%D$E$hu)M6P H< 9H$p <19} E}x$} x M6}:M6} :2u #vt@:u$wvuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVS< ÁZEM6ǁ3~^U ~W;A$t^U T$$D$M6$t [^_]ËE D$$T$1[^_]ËQ 9U u1UWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS ZY}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$|$4${D$<$l1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8u ⿉P81]Ã@]UWVS ֑ XE} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]MBFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HR$x9tC9uՋMQ ztɋQuut duH8 uX8UWVS(蝐 VEUMQI$&,ƅ1ǀǀǀE܉$+EF,D$E$/ljF0MF4EFXFF]^EF^ F$EFE F F8F8~xfHf@uEfx~SE@uJUR#h2u`N68~}$J t$JutE1[^_]f~E@t܉M6fy~ӋUBvuGfv뫅t}$@J z덁T$M6$G}$ J F^UEPT$ PT$P T$P$11\]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]x뭉U델[^_]UWVSCx È>M6@@MtƠS6J yqIED$D$ƠS6@$<[B@B6#B@t2ED$D$@$[B@B6#B@~`N6t $nD[^_]uW~udtƠS6qIEtqID$D$BL$pZ`@ƠS6qIE*ƠS6qIEED$D$@T$ ZB@B6#B@&ED$D$@L$Y`@`N6[^_]UWVS_v ǜ<}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVSu <EM6Eԋ3 ]M6]ZJx> XHUE@8@u B8@P B@ ]qIt$D$S6E@@D$XEԋ@@Hb D$u4$]f8E@PhtfEԋsEHȅuvϋEM6 EP,11M~9z_{}~r}41҉9} L$M4$]MuՋE̋SK,B9E}E@@%ƋE}9})EU*Ct}EU9-EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]RuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex${EVE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9CM$PE@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]rM؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9 tS BDt$B|$]eFfFEBLfF9uE̋sE; ]A1ɍ UL$D$ <$]U€w֍V)‰։L$D$<$]Q‰EЋE̋@  EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9n]]]E])؋UЋuӉ]1uu܉1M9| u9]9]9]E؅( 9]܋KȋŰrU9Sf E䍐 E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ tftE܋]ЉXE̋BD$ D$ED$$]dEKgYdKt$D$$]C/d]qIt$D$$CMčGED$D$ E؉D$|$$]M U܉M8D$)ȉD$ ]؉\$EȉD$$] EE@T]qIL$MD$$CU܉zE܋ML$D$E@$BE܉؉}܃}EUedR]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCmM}UčJŰ;JUHHEĉD$UT$$]"dqIt$D$$yAD$D$ D$M܉L$U$t$D$U@@p$0AD$D$ EĉD$D$$U@|$$rct$1|$$@E̋@D$D$}@@0$]3ct$D$$@D$D$ D$D$Eĉ$&t$D$@@p$I@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]1qIU؉t$D$E@$]?U؃9uHwHW1҉Ut$D$E@H$]8?U9uXD$1ۉ\$ EĉD$E܉D$E$]|$E@$taqIt$D$$>E)ED$D$ D$D$E$]WE@|$$at$D$$`>D$E܉D$ ED$D$E؉$]H } D$1D$ EĉD$E܉D$E$]1qIU؉t$D$E@H$]=U؃9uW 1E@Ut$D$$]z=U9u ppfu;t#t}Măű;JXLJEĉD$ED$$]_qIt$D$$<D$D$ D$U܉T$M $ut$D$U@@p$<D$D$ ED$D$$+U@]؉\$$]^t$1|$$0<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EZučD>ED$D$ D$E܉D$E$]UE@t ]̋ ;qtE؉D$$]]qIt$D$$>;D$D$ ED$D$EЉ$]E@E؉D$${]qIT$D$$:D$E܉D$ ED$D$E$]SEqIỦt$D$E@$]^:Ũuvt$D$E@L$]!:u 0EqIt$D$E@$]9uLn E̋];X] fEqIỦt$D$E@L$]q9Ũu&D$D$ ED$E܉D$E$]|$E@4E؋]9Euucfr 1t`u 9}tQpt$$]uE䍐 E܋Hcfw\]䍓 T$U}܋G$OU 1ɋE䍸 E䋀 EE܉E;EBEEUWVS~T ǻ]M619X‰PtAC:uf11ɋCD$ CD$C D$C$5tB[^_])C9uM6 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]US M6$]UWVSS u] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]:F9uM6 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSR ut$5#vu[^]UWVSR }GDEM698GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EUXQ M6$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSP )U} w to1t6~RutF$u1[^_]ÉU$6t8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJU @ E]UVSP Eutv$%u[^]UWVS O Mq~X1Q,zQ~>1҉EM׋q tMv$uME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]USMN ÒEL t$D$, ${x)P 1[]É$1[]øUWVS0M 6UL P ` E싃\ EǠS6HApEЅM6EE䋳X utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋T u)y ‹u)֋Uu9Guԅ+^M6uu܍t9B~ Eԅ3bD$D$ $/ǃ` EЋ\ EE1ҋX EMM܀}EEM6>\ ;T ЋM)ȉEԋHAEЅzEEE9E| E9AbT$D$EЉ$/@P#\ ǃ` ;T ^J, UN6UfbT$D$$.P >u Eu@@l8 \ ;T J\ AluL (D$ E$w…yP )ЉP pL t}쉻` }艻\ 0[^_]Ë=M6EEU싃X EMM܀})y uyFȉEM6> N6ЋM)ȉEԋHAEЅ \ ;T }xM9M M9ML D$ , $v)P ǃ` \ ;T t` X E܋E9, Eb"t$D$$,` ;X ~aP p` @@xuL XD$E$uy)P ` ;X \ b<\ t$D$@$,P \ ;T ` u؀>X u)ʃM6E䍃, EԍbEfșƍry )ƋE9@M؉L$D$$P+` X EE0u9~1$ P ]$oXE܉E\ ;T \ M6u܋R,r@bE؍, E0L P P u` R9X E܋EP,\ 4v4F‰EEu@M؉L$D$$*` P yu9bD$D$EЉ$)ǃ\ ǃ` UNE;H@uRFuLf~-$` D$\ D$F $?VP f=` @$ ` P L tD$ Eԉ$r…yP )ЉP 덋@lbT$D$$(\ \ E9T EЉEԉu($ \]L t'D$ Eԉ$qy)P $ ǃP L D$ , $qqy)P P E)ȃ9u@bD$D$$'` 9X , Eb"t$D$$X'` ;X ~b` @@xuɋL t5D$E$py)P $ `0$O됉Ƌ\ L t*D$ , $4py)P $ 1ҋX EUWVS C ^ E苃X M6M19|T X ` \ 9T M6EǠS69T 9N6EqIE)$ DEu ǃ` E98.@@ltˋM t‹UT$D$$%뵉T \ PBh9}dX T$t$$GƅtDE;` t4$B U qID$D$4$%uU1T \ X ` [^_]ËX N6Eu@@h9ME4M䉋X E;0 GE\ ` ǠS6p >u~xN6UqIt$D$$C$mtGUt @@tut$D$$$@@lu$ amu\ ǃ` M6ET 9P))ΉT \ $ 둋T xǃX U@ [UX UT U ` U\ 11]U? UX UT U ` U\ E1]fffUWVS? %M62M6EM6]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u?> S6BH8~NHD~GBlthtËuu拐tt 1= S6@ xUWVS(= ƉEYS6EBH8ˁ:uM6u@D*= }M6LJd M6Y\A`fAdBt%]qID$D$ $N EBt8]qID$D$ $ M6p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇d %ȋtp"xt"LJl LJh 2M6EM6E E9tE9tE苘d ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]o_j1([^_]øEM6ȋtǁl2wM6Ћtǁl2Ntttǁl2)UWVSV8 ÛEU MfUfMf]M6;7LftvM6949)M6l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS6 EM ]fM6;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$5 ,U} uEEEƉEljEfM6;B\ @ frftufvS6 I ytX2RtE}|$}|$ ut$D$$-;qIT$D$$1$[^_]øU5 SEfx?M6;B\}1@rU f tUf vEf1]ø]4 M6ǀtǀxM6 t%d ǂp"ǂt"l u1U勀d %1]UWVS-4 v}M M6l2t^ftfvǀxM6 t)d fp"fr"ǂt"l ug1[^_]f3fthfufto'ftVfmcfuؾfLBd %1[^_]þ뜻닻3 WM6h2UVS 2 6M6l2tu? S6Rt*qID$D$$B6M!A@f@d [^]UWVSy2 þh tM6} 3x@tOu fM6f9pdt6l2t*M6fpdQ@E % ЉA@[^_]΍N} f_f|SM6UL$2@$7qIL$D$$UUULf`L$2@t΍N} ff|M6UL$2@l$ 7qIL$D$$bUUULfL$2@h$6qIL$D$$UUM6$UM fxGUM6$sUM fN0 M6f@dUWVS00 uUM6pFFy ;F|# tH4$H[^_]Ét$$UWVS/ Uu FFy ;F|# tH4$[^_]Ét$$UWVSn/ óM6x|$E$Ɖ<$[^_]UWVS,/ q} |$E$Ɖ<$_[^_]UWVS. :UM6tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@m- E}E E EE E @$]ÅxyGEGE؋E @ G]% upEM6E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]CM \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]^Q<$FM1 EGy1G1 <$]E9GT G8  <$]D1E D$<$];1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]3UBHGfG9}s*w tUv$]*uUG 뜉]ȋMĉU) UT$M6$&]UWVS ) u}ED$E D$4$t} u [^_] [^_]UWVS ?) ÄuM68E D$ED$<$tu } [^_] [^_]ffUWVS|( &E}}M E $]1EQw$]CE1EHMGEȋGEEċE @M qMMMM6M t[E2 $ ]ÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EMM6MU rUUEM  / m$ ]DžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]lmuE]4EȋQT$ UT$D$ $M]KE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]6yVMmEEMmEąy1EămyEF$]y)EE9EbEWMFE EĉE_$]ymEHU8mEąy1EċF$]Vy)E<9e}U&FHGGfGfG9}FD|$F|$]ruE$]|[^_]ËyQUEĉAEȉA $]kMyUQE9ATtNEȃE u{}ω4$]<$AE1|[^_]E $]hyMEu붋E$]=U " U T$UT$M6$q]UWVSN" ÓuEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U ! D$UT$M6$]UWVS ! u}ED$E D$4$tE} u [^_]h [^_]UWVSv]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS(w üEUM؋ufUވM݋U 1ɋU EEԋ}P-Et$$UEx}P$u܀G$ĩUt}EMU E1‹E Et~MލAf qCpЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wCpDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVSF {UE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ ƍ/t$D$$E[^]ûu111[^]U p r D$ ED$E D$E$]UL p r D$ /D$D$E$]UWVS  FNj2FEF<\<^t{Ѝ\P-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%PP- QuJ{E< v^]v.F<P-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS ƠS6t| t~9t $sK| EED$D$E $`uI| tG@t  dN6 x @xt [^]É댋E[^]É| @uUWVS( ?UEtBEES6E}<$UT$ D$D$<$(u蹵N))wU܉e)‹M)wUѸg4 )3̅D$<$EtTH tCp$1҉}܉ 9t-~fuUE܉D$$}UuF([^_]1([^_]ËP 3Ѕ([^_]UWVS( UEtBEES6E܋u4$UT$ D$D$4$e'}kLЍB)wUeЍBM)wUѸ>Љ)<;D$4$jE܋tRH t>x$1҉u܉ 9t(nuME܉D$$*MuՋGy([^_]Ë;@x([^_]UWVS(W ÜUEtBEES6E܋pu4$|UT$ D$D$4$&}-?L) RЍ)ЍLqGEeE)  IȍE) GE*SRЍ)<;LxD$4$E܋;PxAQ tJy$E܉u9t(~suED$$uދF E܃9u؋E܅tЉ)ED$<$-VUE}<$UĉT$ D$D$<$B Mĸ-?L) @)ЍLqAE-?LeȋE) @E)AM*SRЍ)LxUD$<$&Ute}tu}cu }uFEE3Ѕ$z<EE$J=Px$0>렃}u E$D1҉UffffffUWVS &E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUUƍp@Hπw09}맋E D똉UFUUWVS [48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$4裨8C,s0K40u4 8$4"8 @0@4$48G,_G0Gƅ`%4P- Dž,Dž$Dž(Dža`0:~LJwDɋ4XKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4`W0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4XE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4Mt8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$40,OPDŽPUw}7D$$o>D$t$$-‰E$20UtYEE[^_]Í]$ǗƅSE1ҋEEut$`>D$$ՂM$-@ x Utb}ut$D$$虂EJ<>D$$x$ǓEx t;MEt$εD$$-=D$$ED$D$ht@E$utEftUft IA(Q|uEt E1}$Ut!D$D$$'2RB($"tD$D$$1RB끃} >D$$3D$$UVS LEtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVS ƉEωD$$tB4$մƀ?u1)9tXzzt"D$|<$=…uۉ<$蟴9t 1[^_]Ét$ED$<$/[^_]ÉUt$ED$<$.Uu[^_]UWVS uEUt E<t]迿 [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]肕ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]5]C ExD$$!]‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$]ZEx E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]近]C(11ɍ&mC}G G$t$]ՕG$uyf fE@$$]xEx D$<$]]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS,5 zE׉MT$ D$D$ E$o=v(8,[^_]D$E$sƅtʋE$UU܉T$}|$ D$ED$4$tJUMt@:tOE$Eǃu(EPEǃu E䉃 14$,[^_]ËE܉D$ |$BD$4$u΋MUD$|$E$E=D$E$zƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS  ǃ $A8/u$N… ${$t!4$‹ [^_]Í$ыt,D$ D$D$<$g4$ [^_]Í$nTI/@$Mlj($<$貐uDžD$$Nj$sOmtQ<$)4$‹4$|$$)t4$$ď<$t 눍 wUWVS9 ~EEE EUUD$$rtƋM‹E1lj4$3tKMUEt81ED$E$Qt' uMȃ[^_]ùȃ[^_]ÍHPEEE[^_]USc èjEu[]ÍED$E $S[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVSt ùƋ$衍F$薍F$苍F@$耍F$uF $jF0$_4$W[^]UWVS H}wu G9r [^_]Ått$$跉tw[^_]É4$nUWVS U MuR u+ftO؃tXf;0t&nt(suXDuo1ۉ[^_]ËEx DC볃UWVS ( mE 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS *uNE|F9sXtd|$$蟀tH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<${렋}<FUWVS<= ÂE@ EE@ 0t$$sM4$D$E@$~Uu$EE<[^_]ËMAOMփEtfEtǤ$ɁE܉$辁EP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$Ep@@LEMA@AHADALudfx臦111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$E<[^_]px1113u܉4$֨u8uDMUU$EU r}fm몍$E0GU7UWVS HUJEtB9swt$U${Ut]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$uU]EfUWVS =uVzF9sHtT|$$zt8~VM f FHNMLF [^_]Ëu1[^_]É<$8uUWVSXn ED$,E$} D$|$]{s_xD$|4$] dPU4$]^= t<$G= E$].= D$$P]xÉE܅F@ t$$<Et E 2t E D$,E$qEN EEEP-E̋EE u<.tjDy@u붋}]]D$ED$4$]ËE8g E E܃x f_EĉUED$ EԉD$E썈 L$E $@EċUڍwEJЀvD$E $n4|$ t$E썀D$E $I[ED$ E܋D$E썀\D$E $E D$ D$D$\$D$D$ npt$E썀ZcD$E $AED$ t$ضD$E $]}1 DD$ D$t$G $ QE$]Ɖfu }܋G0W)ύ)ȍ,D$4$萎u [^_]ÿU 'E=w L]1]UWVS u4$UT$ D$D$4$}-?L) RЍ)ЍLGEeE)  IȍE) GE*S)ύɍLD$4$~u [^_]ÿUWVS4 ufF(}ȉ|$$ft4[^_]É<$A1t9 ufV(4[^_]UWVSg ìu  fN6fV EdN6 4$@V(EfD$FD$ $U${=UwDE |)ʉM싆t7T$UD$E$zU9sUJM|M))‹FtIT$UD$u4$zU9r4[^_]1$dN6[^_]ËUыU|UVS butgF$DmF$9mF$.mF $#mF$$mF,$ m4$m9 t 1[^]ǃ  @ Ύ @tÍBAfffffffUWVSQ Ölj$U蟆D$$ Et$UT$U$19UuED$$ ̆1[^_]ÉUED$$ 謆$3UD$3UD裑UWVSdv û$7EE1EEƍEE> tqE9D$t$U$1Utˋ$2$2UDŽ5Euu ;t1< tHv0FIU$2$1UDŽ&UWVS< $7U11ɍˬt6u規E+<ȁ<[^_]Ãu@W@0ƃ:uVƅ/lFu$b9$br#  Ή$k0D$Y0D$D$ D$D$o4$y{qD$@|$/$ u:tRP:uVpƅz빉1$L/Ή$[2Ή$*/D$/$ /D$2ω$.D$.\$\\$/~$oaƅD$/4$\/tY1ɉL$T$/T$VT$ L$D$4$t$D$$pL#1҉T$T$ L$D$4$蠻빉oqvFUWVS 1u}D$:4$Lt!D$T$$考t|$E D$4$, [^_]ËU t考 [^_]UVS i îuD$:4$ALt!D$T$$tE D$4$=} [^]U REwt ]1]ì]UWVSh Eu $7MU1ҍxUED$ D$D$@U$UuUƒE9~ЉEΉ )t$|$ʉUM$*MUӉϋʉU$+uD$+UDlj!}|$t$$X*uU+u h[^_]ËE6 UWVS`] âEM $7U1ҍpUMED$ D$D$@U$UftUD$$ }EED$ML$ED$A(;EUT$$ u@|} f!^ut$L$$'U+uW`[^_]<}U$5*ED$&*UED-UWVS` @EU$7L$\1ɍpwbtNT$E UD$ T$D$D$@T$$T$ sT$1t>$uT$ U MT$L$$lL$\+u`[^_]øUWVS . sExw|Mt_ƃtAkƍU$(ED$(UED [^_]Ãu$(Ɖ [^_]UWVSp臼 Ă}EU $7uM1ɋ]p3MmQm8@E~Eߺ81xEM}E )|$t$ʉUM$]M&MUЉ΋ʉU$]P'}D$A'UDK!\$T$$]j]U+p[^_]ê0f%.t&CD$D$ ]$D$D$@}<$pGj뉉f>~$E~LSC9u1Uf~7g]U]US$ iEPw*Ӑt-[]ÃӬu$([]USϹ EPw*Ӑt-[]ÃӬuU T$$FU[]UVS r ÷uD$:4$JDt!D$T$$ {tE D$4$v [^]+- [^]UVS ?uD$:4$Ct!D$T$$ztE D$D$4$# [^]ËE D$D$4$ [^]US t ù~EMPw*Ӑtc- []ÃӬuL$U T$$# []US V~UBwÐt1[]Ãìu$@S[]UVS ɷ ~uD$:4$Bt!D$T$$`ytE D$4$M [^]肁- [^]fffffffUWVSI dž}}E1E xt=1}t ƒu@u[^_]UWVSĀζ }}E|$7xƋE, 1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%uL P m\ EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍU @t?E,t鸓$I )9uu1믋}@ E1ۍ,E0 EEEu1}}}8+tDAuEƃ@E}t,ى%I$))9D E9u }u _]uE^@] 1҃DD [ u̓E9uE, a:!@t$EDu۸@u܋} Ƈ  E}8L8 0u}l ] ]E M }~Et M  ЋU 1ҋMDŽ  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹E,t 1itEUEEt @FEǀ, ]UWVSX \wuE EM$7ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHEL EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME 4 UWVSP -sE̋uM M$7EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍dEEEEEyD$ D$$<$]w?9tD$ )D$|$E؉$螯f}2ae}sha1f}1 }argo}argo}argo}n2d}M̈ _ȍ  MElE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍ MEM̍lM/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍ MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9lK?9lK ?9lK8lEfM ȃ?9lK?9lK ?9lK8lCEf?9lK ?9lK 8lCC EEԉD$4$I2}n2i]UWVS٧ "nE$7EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]>UWVS,a mE؋U$7ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]]UWVSD} lU uU$7‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$yN @D$$  @D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$D$$(D$$MP489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$LtD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1UWVS> {hEu $7‹E1D$D$H $DžDž4$+8$u t$4$fƉ$_DžD$$ff8vu[x=uUT$$ D$$f DžDžDž DžDžb|$4$e3ptjtmt2$D1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$$%buDž!t$Ʒ$bDžID$$QdƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$bt*D$ swD$D$p$R$A 4$[|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$aD$D$|4$CD$D$p$%$%D$ηD$,$wUUVSݛ "buv$蚰‰)Ѓ[^]øh`UWVS4藛 aÉED$ut$u 4$B]u3D$ ED$${cEE8$E $]h`)‰UE E h`9tt$u+E E܋E$]BYNjED$ut$u t$u܉t$ D$D$b K E$PJ t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃D$D$b}<$uOU^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$XE4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVSɔ Z9ɍ,  dH USHLf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂK $2?ƂK aHK ƄK $,T$ T$D$$B7D4$J`D$HD$T$K14U+u{[^_]Íxƅ??tOlEȉDRHUWVS谋 Qu(} $7E14$I$?$u 1H$9u勅)ȉx  @4$苀$D$(|$4$蠀D$D$4$膀T$|$4$j}<$.$D$(L$<$CT$T$<$'$D$(L$<$ |$0, ${$lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$rt&D$uڋ(D$4$LuڋfǃLL $1ƃNL $ D$D$OL $ :D$xD$ B$Wt$,$]1s$D$(D$<$~ ɋ D$,D$<$~|$,$B<$%~ʉ)Ѹ%I$))Љ)‰ :D$,D$<$} ɋuo$D$(D$<$}9$D$(D$<$} D$D$<$u} $D$(D$<$N}p D$D$<$'} ?LL ,L D$06 < ȉD$$,L ,L D$17 = ȉD$$=,L ,L D$28 > ȉD$$,L ,L D$39 ? ȉD$$,L ,L D$4: 5 ȉD$$w,L ,L D$;T$$M,L P,L @D$D$,$覾E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž DžUWVS QKMMUu$7ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$ D$@|$<$+E D$D$<$|$$蕅<$D$@t$<$D$t$<$ʃ|$4$SE+[^_]Éu4$MUT$L$4$lt$4$Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfUWVS FGutJD$ED$4$INjE9t.8u)J8"tE 81[^_]Ãu1JUVS蛀 FEU ]~Íу? H9u[^]UVS\ FEU ]~Íу? H9u[^]ffffffUWVS8 FFƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U\ EEt t&t1]ËM t6]ËE t]ËE t]Í]ÍƷ]Í]UWVS~ /Eu} 4$9uw[^_][^_]UWVSd~ Du}$}(E($7EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$!UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$L!jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVS&z k@u4$xu1҉[^][^]UVSy 3@u4$@u[^][^]UVSy ?u4$u[^]}[^]UWVSwy ü?}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXx ;?M $>7ƉEE$ljE4$vƉEE EEEED$ML$}<$1t.1EM $M $4$EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSw =}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSw X=}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSv <}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úU1v r<E##+0ፂ!]Íe]Í@]ÍL@]Í8]Í]Í]Í͹]Í޹]Í>]Í?]ÍL?]Í]Í?]Í?]Í?]Í?]ÍL]Í_]Íu]Í]Í]Í]Íʸ]Í]Í]Í ]Í$]Í;]ÍT]Ím]Í{]Í>]Í]Í]Í]Í"]UWVS t ;EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$2tffffUS t h:U T$D$U$ []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSs L9u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS F  u} FEFED$E$O?$ug$ED$EUT$<$Ou?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSX E N }EE$7UE1D$E$wƋẺ$-E+} f$OME Eĉ4$U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$ɚUĉT$ D$D$u҉uȉ4$4$^‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$4$9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$t4$L‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$4$‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fENUMR)уtu]UVSU ṽщcw[^]ffffUWVS? P|$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSL2 HuE $7U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFT̑UWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS. lj(UE u$7, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋( UWVS\D, ÉML$} $7D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~s!D$0 U"D$0 7!D$06 "D$0!D$0f !D$0H!D$0* !D$0 6!D$06@ e!D$0IG!D$0 )"D$0q !D$0v, !D$0Xa"D$0:b!D$0!D$0|u!D$0gW!D$0N9"D$0!D$0!D$0h6!D$0J!D$0,!D$0!D$0g!D$0,I!D$0m+!D$0 "D$0x !D$0Z!D$0<ʺR"D$0"D$0"D$0k"D$0W"D$0C"D$0/"D$0"D$0"D$0r"D$0^"D$0JzAك\$02كJكzzك\$0,t$D$$Lt$ D$D$$\,D$ D$D$$ʓ8,D$ D$D$$蘓R,D$ D$D$y$f,D$ D$D$F$4,D$ D$D$$6!D$0,D$ D$D$o$M,D$ D$D$$菒g,D$ D$D$2$]a,D$ D$D$$+,t$D$$kJt$ D$D$$ ,D$ D$D$Z$趑,D$ D$D$$脑,D$ D$ D$|@$R,D$ D$D$7$ 4,D$ D$D$`$l,D$ D$D$$輐,t$D$$Ht$ D$D$$yo,D$ D$D$ʻ$Gv!D$0,D$ D$D$K$5,D$ D$D$$Ϗ,D$ D$D$$蝏,D$ D$D$$k,D$ D$D$$9],t$D$$yGt$ D$D$$,D$ D$D$o$Ď,D$ D$D$ż$蒎,D$ D$D$׼$`,D$ D$D$ݻ$.,t$D$$nFt$ D$D$$,t$D$$+Ft$ D$D$$訍,D$ D$D$$vffffD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVSl ]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]+K$C C(1uиɸUED$ E D$D$E$]UVSEM tYX tRP$tKPtD;u@B-4?w3t)x6(r@1 w#EB?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍l}WPGX WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍U܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍@U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍@U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍U܉BE@Q?}/]ԉU-}E̍EPD@B?} EEUԉu@}E̍]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍U܉BE@Q?EЉEE}U̍CM܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍lY&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}s]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS k ð}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$f Eԋuu$7E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVSJ E}Mx11 rtE xfDU9uEExfG0UofxZUWVS4 Ƈ}̉ÉEЋ@,E܋{t-Ek@^S,sɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS誐 V} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$~tE 8$ [^_]1 [^_]UWVS Y " }GtUD$U]ƋGD$U$t+4$P=yarauE 0# [^_]É4$r1 [^_]UWVS `Y å}GtUD$UW]ƋGD$U$蛑t+4$Ӥ=tciduE 0# [^_]É4$1 [^_]UWVSX (ED$E D$E$EtSEt4}D<$\ƋED$<$tE01[^_]"[^_]y"[^_]UVSPX Õut$E D$E$t.yaraUFƅu [^]"0[^] "0[^]UVSW &ut$E D$E$Ct.tcidUƅu [^]!0[^]!0[^]UEU E MMM] UEU E tcidMMM]UVS4W yE D$E$vƉ$Ǣ=tciduE0[^]1[^]UVSV )E D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS V E$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]US1V vE D$E$uUT$$dA[]USU =E D$E$YuUT$$A[]USU E D$E$ uUT$$A[]USU E D$E$tUT$$)B[]USMU ÒE D$E$tUT$$WB[]USU YE D$E$utUT$$`B[]UST E D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS O OE$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS N E$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS EN ÊEU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS M (E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS M E$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS M `E$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS L E$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS UL ÚEU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS K 8E$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS K E$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS ,K qE$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS J E$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS eJ êEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVSJ IE D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS I E$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS LI ÑE$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSH 7E D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS H ED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS H dED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVSG E D$E$gƉ$P=gntst 1[^_]É4$$P$U*DžtڋUT$D$4$$t U:[^_]É<$UVS3G x E D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS F  E$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS {F E$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS F e ut*t$E D$E$%flj4$ [^_]1 [^_]UVSE  E D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS wE ü E$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVSE ` E $jxt%ƉD$E$蟊lj4$[^_]1[^_]USD E D$E$ˆUT$$/[]USD E D$E$艈UT$$F0[]USVD Û E D$E$PUT$$0[]USD b E D$E$UT$$0[]USC ) E D$E$އUT$$0[]USC E D$E$襇UT$$0[]USrC ÷ E D$E$lUT$$%1[]US9C ~ E D$E$3UT$$p1[]USC E E D$E$UT$$1[]USB E D$E$UT$$1[]USB E D$E$舆UT$$1[]USUB ÚE D$E$OUT$$1[]USB aE D$E$UT$$ 2[]USA (E D$E$݅UT$$ 2[]USA E D$E$褅UT$$2[]USqA öE D$E$kUT$$2[]US8A }E D$E$2UT$$2[]US@ DE D$E$UT$$$2[]US@ E D$E$UT$$12[]US@ E D$E$臄UT$$22[]UWVS R@ ×E$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS? 4E $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS ? E$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS0? uE $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS > E$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVSr> ÷E $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS > \E$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS= E $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS Z= ßEU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVS< =E U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS < E$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS;< ÀE $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS ; %E$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS}; E $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS !; fE$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS: E $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS b: çE$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVS: EE $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS 9 EU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSC9 ÈE U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS 8 -E$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS8 E $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS '8 lE$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS7 E $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS f7 ëE$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVS7 HE $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS 6 E$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVSD6 ÉE $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS 5 -EU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS5 E U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS +5 pE$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS4 E $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS l4 ñE$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVS4 ME $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS 3 E$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVSG3 ÌE $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS 2 /E$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVS2 E $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS +2 pEU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS1 E U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVSo1 ôE D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS 1 WE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS0 E $7 t%ƉD$E$FtAD$$U"U [^_]H4$l [^_]1 [^_]ÍBAUWVS I# ÎutJ 9u@~ G$ھ…t,Ft/D$$UU [^_]1 [^_]ÍBAU" Et 9t1]Ë@ ]U" Et 9uP@tt ]1҉]ÍBA]USl" ñEt 9t1[]ËU tH Q9Ur@tD$E $[]ÍBAU" OEt 9t1]Ë@]UWVS! }t; 9u1G $hƅtGt"D$4$*[^_]1[^_]ÍBAUw! ¸Et 9u @t]1]ÍBA]UWVS8! }ut 9t 1[^_]ËU tM 9uFtA F EP$U袼DžtŋE HɋUtOFt@L$D$ AD$T$<$#F~}~ t$sBA븍BAUWVSt ùut 9t 1[^_]ËE FtE $F EH $Mٻ…tFMtI} |$D$ AD$L$$U^FUV}~ t$oBA믍D$ @ D$D$;A$|US Et 9t1[]ËM tM 9uL$$)mUSE ÊEt 9t1[]Ë@tU T$$[]ÍBAUS 6Et 9t1[]Ë@tU T$$M[]ÍBAUS EU tG 9u=t99 u5Rt@tT$$[]ÍBA@uፃBAٸfUS3 xEt. 9u$@tU T$$[]ÍBAfUWVS  (u~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$6DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ ͸ƅt' D$4$eFF FE 0 [^_]É<$D$-D$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]USG ÌD$ $L $蠍[]US  NL $z[]UWVS4 &M EpAQAtpD$ T$L$D$ uԉ4$D$|$E$ipt2t$E$5mt|$E$^q4[^_]Í 14[^_]ÉD$ T$OD$D$ uԉ4$|yAD$ D$D$A$UVS E 0t$ M $4$1[^]US D$L $ƋLD$ M $1[]UWVSM Òlj։MMML$ED$G$VEU9ErfEG[^_]8"u1UWVS lj։MML$ED$G$V!ЃtNEG[^_]}8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS %ƍD$ $XL <$7t$ M E$\t $E4a<$ UЃ[^_]ÉE<$$ Ut֍lD$ $M`MAFAFA<$證t$E$Mt+$E`<$脉M $3UЃ[^_]ÉL$ME$M9uE<$HUЃ[^_]ÍD$  D$D$MA$pUVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVSm òutl9u4$^[^]1[^]UE@]UWVS& gEt l9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QUV —Et l9t11]ËP@]U) jEt l9t11]ËP@]U =Et l9t11]ËP@]U Et l9t11]ËP@]UVS Et l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS ZEt l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUS1 rEt l9t1[]ËHX@uȉwދE []ËHP9ȸsU Et l9t1]ËHP@txE P]US Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUVS ^Et l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS Et l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS YEt l9t1[]ËHX@uȉwދE []ËHP9ȸsU Et l9t1]ËHP@txE P]Up ±Et l9t1]ËPH9иrE ]U+ lEt l9t1]ËPH9иrE f]U &Et l9t1]ËHPwE ]U Et l9t1]ËHPwE ]Uq ²Et l9t1]ËHP@uxE P]U/ pEt l9t1]ËHPwE ]U 6Et l9t1]ËPH9иrE ]U Et l9t1]ËPH9иrE f]Uj «Et l9t1]ËHPwE ]U0 qEt l9t1]ËHP@uxE P]US +Et l9t1[]ËM tM 9uL$$[U Et l9t1]@tHxUxU M3P3H ]U[ œEt l9t1]@tHxUxU M3P3H ]US OEt l9t1[]ËHX@u xExȉ3E 3U []US Et l9t1[]ËHX@u xExȉ3E 3U []UWVSq Ǯ]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$D$$~tU [^_]ù RAu_Uu>fUWVSP^ ã<$eH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$3C_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS< &4$}cB BBB$BBB(B8O)Bf^.t{BDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upBhSxauZxluTxsuNxeuHxBJB(z:xru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%[l8mBB([уzc<$N1USEJv[]ÉuUS  E ;Et1 []ÉD$ED$E$Z> []UWVS@ Å]u}E E $|‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]<u?/ F(<>tt uHvf~ t{ lqG u\.x$E]D$ D$D$B$ t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0R EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$Ep(r EpD$%t$$t}(u GtXtA1(u~u EpENjE$迠[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS$Llp$HthD$D$E$zfp0xD$p$$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$aƋt0<$fplD$T$4$KkE D$4$NjtPD$T$p4$kpT$4$2t$mĬ[^_]ËlЉhdD$D$p|$D$ D$D$$4`Ƌt0<$ehD$T$p4$ajD$D$D$D$ D$lD$p$_ptdtAT$4$1t$[1p$dt$81UD$E$]fffUE 9E]UWVSƅtBD$$jEt E$@-DžMu% $襜1\$@ DžtED$<$@D$G$?kEG,w0G4G8G<[^_]US5M $ai[]US#BD$,$DlM $#i[]USѽD$M $hD$8M $1[]USDÉED$E $躹[]US\ED$E $芹[]US,E$(jE $j[]UWVS(UM܋p4@,EEGEt@E<E tdD$ D$D$B$袰UWVSuFt09u&x<$cƉ<$c[^_]ÍBD$ D$D$B$*UWVS8}Ƅt1fƅtptC[^_]ÉUx<$Uc1ɋU5ƅtpt<$4c[^_]ÍCD$ D$D$B$華USE xt"D$ D$E$C[]ÍrD$ D$D$ B$(US8}UB4tB4R,…t8$ 8[]ÍD$ D$D$B$ĮQD$ D$D$B$蚮UWVS4UM@8t 14[^_]ÉƉ׍@E$aMt9pE}<$6Ex4$C7E$a4[^_]Í#BD$,$bM ljE؉$_UT$8M Mԉ $諗E܅$6<$V_V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$MԋU|A)D$|$E؍D$/TEF,}܉8MHF4F<E؉$^E$kE܃,}<}ܜ$莈EMD$ $I5}|$MA$4EU܉PU؉$^|$}ԉ<$?E܅$5U؉$]E@,vu1<$\0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$ D$4$3~D$4$<4$<U܋T$4$P tEO49H1bEq<$@[D$4$>Ɖ0[^_]Ë}4$(<E$5m@D$4$v9n}эAD$ D$D$B$M}E$l5n 4$;EԉD$4$J=D$ D$D$B$UVS?E 0t$8M $ԓF,v }><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> D$ D$D$e8D$=2gD$ D$D$,8D$諔UWVS $]p,D$$UUBB BE u Ѓ [^_]ËE $ pUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS .u} tEt=$ot%,T$$EAE@px [^_]11UWVSǙuE u@1$oDžt,D$<$GwE G [^_]ËE $ntDǃ} s E uE u뛤ƐfE tM E tE o1UWVS  u} tEt=$[nt%,T$$EE@px [^_]11UVS_äutG,9u=Fu!F D$F$tH[^]É4$[^]1UDEt ,9t1]Ë@ ]UEt,9u@]1]UWVEt ,9t1^_]ËU tP 9Urptt} suuɤfuufUWVS REtH,9u>P pt0t{$Ult!NjUs*ut[^_]Åu!1[^_]ftt鍃DD$ $D$D$8D$QDD$ $D$D$8D$'U?€Et,9u@]1]USTEt ,9t1[]ËM tM 9uL$$US  Et ,9t1 []ËM9H uU tL$M L$@$ []UWVS kðu>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $MjEtFVT$U$MUK9}D$D$4$I$1jƅ,D$4$FEF~ E 0%RD$ED$F $JljEt\UF$F 9:" "D$ D$D$8D$趍E$r [^_]Ǘ8"uE$q$IiƅtEE$q1 1Uh©Et l9t1]ËM tM 9u9]UVS$ilt$TM $ƃ\M t$HM $~ƃPM 1[^]USE xtD$E$#[]ÍUVSגulD$L$ AtTM 4$[^]ÍHM UVS?Äutl9u4$[^]1[^]U KEt l9t1]@]U"Et l9t1]@]USEt l9t1[]ËM tM 9uL$$MUVShíuFt [^]À~(tD$ D$FD$F$u_D$ D$FD$F$itWlD$L$v?HM 4$vE 0[^]ÍlD$L$??TM ǍED$ D$D$`E$YfffUWVSaæƅtBD$$jEt E$@eDžMu% $Vn1d$@eDžtED$E<$vED$G$<EG,w0G4G8G<[^_]USޏE$<E $<[]UVSdéPt@9 u6p 9rUWVSLÑ}GtC9u9Up4$y3GtNU9uGG@~D$E$}[]US ̷~D$E D$E$ []US蚷}D$E$赻[]fffffUEU @]USNÓ}E$KOt[]ÍD$ D$D$pF$vUWVS0:}$}`HtыpG$N`tBtD$D$ D$ED$$:u0[^_]ËUT$$PDžtօt$0NKu}DžPtҋ@w4$M)T$$PtЉ4$MtaNjPu냍D$ D$D$F$*uD$ D$D$F$uD$ D$D$F$tD$ D$D$F$tD$ D$D$F$ttыt$PD$ D$D$F$/tUEt]1]UWVSD&kz$UtEDžDžEU 9 u @|$t$ D$ED$$BEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]ÍFD$ D$D$#F$$rEEU D$E D$E$]UE]UE@]UVS'x]C$$V[^]fffffffUWVS螱wƀ8$oD9t- P9/t9rq/u9t9t8/t)ȃ=%׋ƄfDž.$oP /.pl@istX@XXXXf@ X $ ƃtb|$D$4$9Kz84$ $袰1,z8[^_]z?1[^_]äƄ3f P4$c$FIlj$<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$BuύAT$ T$D$#G$(jt][^_]UVSݩ&p]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍AT$ dT$D$DG$hE >][^]UWVS5o]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]ÍAT$ DT$D$cG$gD$/$;E >][^_]zUWVS 蠧mUEx } $Cƅ$ CtzFFF E Ft.ED$4$ׄu`$SK14$IK [^_]Í<D$4$u뵉4$ K1 [^_]D$ 4$ztFu2D$4$kD$ 4$ESD$4$-;>@D$D$4$-D$ 4$Ex UWVS @lED$E$5t>Ɖ$6dE oU4$IoU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVS!fkutFwyM MJ]ZMJ [^]$q@t|] X]XMH ]X뼍+D$ D$D$APG$Id|GD$ D$D$BPG$d1fUWVS&kjUu }t`t`tAtA}tA uutA} $G[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍GD$ D$D$ZPG$ cUWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r uhctBu wu&?UJEtMEMED$UT$4$CFMu E<=tW4E8E4uʋM9|?)э T$D$ $32*1[^_]ÉM4$%M럺ÉMUWVS̓JEAh,l-ptDžxAEEEEEE|(D$ut$$D]E$D$t$$DDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$@XD$4$t|$4$茻D$04$'\27D$hD$t$ D$D$0$#,(4$(,4K8D$t$0$蛯tD$(D$$CD$$D$$BD$|$$I4[^_]D$$R=[^_]Dž4cK,Dž4GD$(D$$VByD$(D$$.BD$$D$$BUWVS@茀Ft$(D$T$L$,tȃ"|$GD$8UT$$\$(,<uL$8ǀ-;+=D$D$,C0LD$D$$D$ D$0 D$4D$, 11҉D$8T$<~09L$,xfD$$|$89T$ |$<O|$<1\$81؉ -D$0T$4Ë|$<ߋD$8d$0ډډD$8T$<NyЉ< uA< W9L$,jߋD$8T$e[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(AH"D$8D$e[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$5D$L$8D$9\$(C"D$8D$D$ D$LD$D$H$AD$@T$D5>8"D$LD$8L$H9tgHwDɋD$@T$DƉ9Ɖ|D$8HL$L@L$8t$@|$D<*D$=u4$u9)EE8EE1҉MԉU*}D9FEE>tHED$|$U$)uى<$`&}9EuEEE>uMԋE܅Ex‰ENjp,t,t$E8:tED$ED$$4Gt60E<-<+<:?eB9FB 9F <;uEy69EBBAxt,tE8:tD$WL$!4t6WE<-QEx:T:Fw E؉Gw t01EE4[^_]ËMԋUEE$$EME8<:y)EEw vpSẼuE MЋM؉2t,t(E8:t ED$ $2EEЋO1t6EuxEEyU؉:BAxP}:EЋupttE $MЉ)E)uKt,t$E8:tED$ED$$1t6GyuEt,8tE8:tt$$1t60t,tE8:tED$l$1녀z:}9E~} }؉BAxt,tE8:ht$L$"1QG Iu xUWVSc)|P uǃ|P |E ;M8-pxP -BAD$-E$ǃP --|$E$tAx:ǃxP >u|[^_]ÍrP :u>u|t E8:?부xt|BA됋|>uMx:tE|9MBAE8:t}t|$ D$EE 8tr@‹Mϋu sptftuM)ȍx)lj;>M)C E [^_]EE [^_]ø‹Mϋu ru!u)wsyPfUWVS]M}4{ 9)1UD!ЉEUE)‹E1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsmUVSU] z)uGB1w<v5J q 9r#L tH8tP9r P9s[^]ú9r9s)8tP9rP B9[^]UVSU] z)uGB1w<v5J q 9r#L t^8tP9r P9s[^]ú9r9s00;ut.tP9rP9rغB뮉1UUE ttuB]ø]UWVS=JEEEuM<vwwٸu[^_]9rE|0tG)ϋU t9} rˋEtɋUUu_B]ZU [^_]ËE t9} r]tEMDċMnE]D몍BtYZUYM\$D$$]MUʍBjUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVS]U Et9u4څt89stEt+p9r xD89s2E[^_]ÍCōH9rHD9r밃뫋U U:}7)[^_]UWVS}M UEEt7u2t99st1B9rr9s+E[^_]ÍWĸ9r:]t뫃M1u)UWVS] UЋ}uރstft[^_]uuBfUSvFû D$D$ED$ ED$E D$E$Ѱ[]fffffUWVSPFc Ɖ$7E1ƅD$D$D$D$ D$T$4$t1U+P[^_]Í1ɉ  rFDžDžD$ T$gD$<$eutjƅD$D$D$D$ t$GD$G$ut$$stu<$ $rUWVSTD Ɖ$7E1ƃP ƅD$D$D$D$ P D$T$4$SD$D$D$D$ L$|$4$;DžDžDžDžDžVDžDžDžT$ D$gD$$wtjƅD$D$D$D$ t$GD$G$,ut$$thuGtLD$ D$@ID$$G$1U+u)T[^_]Ë묋$S4UWVSXBÝEE uE$7E1D$D$ D$D$$&PBD$ D$D$$Kt6D$ D$D$$Z#$)D$${D$$w_$D$-$C+$譬$蟬xf$$jt$RD$D$$-nU+Ā[^_]Í] @$8}D$<$tu D$$XDD$/$Pt4D$TD$T$E8PD$D$|$D$ VD$T$$D$D$$Wv$@D$D$$&v$$D$$u$@$8u D$/$D$|$ ,T$D$$D$D$|$D$VD$ D$T$$RD$D$|$D$VD$ 볋D$D$g$ D$|$tэD$$}tڝD$$^t$UWVS<El$7E1rf|tffDžpD$D$$_DžxkfDžrpD$<$8x*rflE+u6Ĕ[^_]<l<$ 'l̜UWVS;5EhU$7E1pl } t2} /E+Ę[^_]ƅpt BtE qD$D$E $.DžxfDžrlD$<$xIrfhoƅptBxB |BEBEml<$軦l~U D$E D$E$]UWVS~:ƉtE|E xE$7E1DžDžDžDžT$D$$ΣSDžDžDž,D$FD$${DžD$D$<$FD$FD$<$c<$#?80.t&,8=~4${Dž)8#tf$pvD$D$$rE+Ĝ[^_]ÃhI$똋F?=ƅD$D$D$D$ |$FD$F$|$$ ovƅD$D$D$D$ |$FD$F$u!|$D$$D$hD$<$pD$hD$<$TA&$D$ @D$D$,$Y8D$FD$$DžD$$.D$ ?D$D$4$4$D$t$<$轟Ƌ$}9fDžfDžD$D$$赠D$L$$蒡Ƌ$b0<<4$D$t$<$贞|4$vD$t$<$蓞x4$UD$t$<$rD$D$<$蘟 D$D$$脞D$D$D$D$ D$D$ $xu(4$vL=4$gL=I$D$BAD$<$芝Dž$(k$褟<$蜟!D$t$$ tD$t$<$:tƋt$/뉍I$j$htD$sw$hj뛍I$L覓$4jUWVSl2uEEEEEEEE$7E1E fD$ [D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$#ukEPt%D$T$T $UUEML$ML$M $M'ƋE$E+u1l[^_]É$FD$D$|$7UD$ED$ED$ED$ ED$E D$E$h]UWVSl1cuEEEEEEEE$7E1E fD$ [D$D$ UЉ$U0EEEEEEM MEEML$ D$UT$$E@t"D$D$U $UrU4UD$$ tM 9Ht?ED$ED$E$MEcƋE$E+uhl[^_]Í~$wD$ ED$ED$E$ME 8뭉$KD$D$|$<UD$ED$ED$ED$ ED$E D$E$ ]UWVS(/elEdE TEPEX$7@E1D$pD$NDžHDžLphP-`L-\dD$ D$D$h$luD$ h4$l$9p< `\?.< t.cЍLDSt< A< u< t< t< u< t< tuh9>uPp<+<-hq<@oHLDD$ D$LD$r$l(؉DžH<+ti<-,t$X$lnPH:f41@U+}[^_]ÉFg<@qs<@PHLDL$ D$D$r$l4DžH hUTd \4$ln uDF)<@t$X$l+ DD$ XD$D$4$litthLqUTqUT؉DD$ XD$D$4$l豫ADžHDžL1cUTLUTLƅplUWVS *RE,E(E<$7E1ǃP U@D$D$ D$DD$<$@D$@ D$4$D$D$4$v8ڷ4@@ $S@P T$$h@@$ k D$4$0t$D$4$a0|%=%P $8$4$E+O[^_]þōk D$z$…tG(D$*O$0$L$$Y0x t!@;AtSe|t I(D$E]Xω]ߋu1!1߉EyZϋMTω1׋u!u1EyZlju}l1u1u1Ɖ׉]1!1׉u]yZ߉uMu}1|1u1ljMϋ]1!1ωuyZ׋Ul}1x1u1lj1Nj]!ߋ]1߉uyZM]h1ދt1ދ]1މÉƉM1!1Ɖ]M yZΉ]d1ދp1ދ]1މËu11]nƉlh`1NjE1Nj]1lj׋l11ωE]n߉d}1NjE1NjE1ljl11En׉h`|1NjE1Nju1ljϋh11߉ulnljl}x1u1u1ljh11׉unϋlh|t1u1u1lj1׋l1׉|nllxp1u1u1ljhl11ωxn߉Љt}1u1u1ljl11׉thn׉p}1u1|1ljωd11߉plnlj}u1u1x1ljd11׉lnωU}u1U1׋t1׉‰ߋu11ljhd2n}U1׋U1׋p1lj}11ωdn߉M}U1׋M1ϋl1ωNjU11`Un׉}M1ϋ|1ϋh1lj}11߉\nlj]}M1ϋx1ߋd1߉ÉM11׉XM nωU}]1ߋt1׋`1lj}]11ljT2n‹}]1ߋp1Nj\1lj}U11ωP]n߉M}U1׋l1NjX1ljMϋE11LEn׉uE1Ƌh1ƋT1Ɖu11މHnƉ]|1d1P1ÉމM11ӉDMnىMx1ً`1ًL1M щˋM!ˉ! ً];ܼى|t1\1H1M !׉! M}MܼMωuxp1X1D1Ɖuu !! }ܼ։׋tl1ڋT1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋph1ȋP1ȋM1E ؉!! ȉEEMܼEuld1L1u1MM !! u>ܼΉ׋h`1H1u1‰U ֋U!։! uܼӉƋd\1؋D1؋]1E !! ؉EE]ܼEÉM`X1ً]1ً]1MM !! ً];ܼˉى\T1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋXP1É؋]1؋]1E !! ؉|E]ܼ|É|TL1ً]1ً]1M| !! ً];ܼˉىxPH1ڋ]1ڋ]1‰׉‹x ډӋ|!Ӊt‹x!ڋt ډt7ܼӉډLD1؋]1؋]1؉Ɖ Ëx!É! ؉p|ܼÉ΋H]1ً]1ً]1| ։l!! ً|x;ܼˉىD]1ڋ]1ڋt1‰x Ӊh!! ڋxlܼӉƋE]1؋]1؋p1E !! ؉lEhܼlÉlM]1ً]1ً|1Ml !! ً];ܼˉ]}1}1x1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhlh}u1t1u1Ɖ11߉ublUu1p1u1‰֋h11ʉub‰Uu1|1u1‰։ډd11lhbщMu1x1u1΋d11ubˉhEu1]1؋]1Éh11Љ]d3bƉ֋U]1ڋ]1ڋl1‰Ӌh11ʉ];bdUt1ڋM1ʋM1‰щd11‰MhbӉEEp1ȋM1ȋM1hd؋M11hM1bt|1ȋM1ȋM1E11ЉtbӋpx1ʋM1ʋM1‰щh11p]bډ|M1ʋl1ʋM1‰ыh11‰|9b׉}xM1ȋM1ȋt111؉xh9bȉߋE]1؋]1؋p1ËE11Љh3bƉu]1ދ]1ދ|1Ɖ}11Ήd};bM}]1ߋ]1ߋx1lj11lj]M b߉ ;E]1؋]1؋h1ËE11]bЉЉEEl1؋t1Ћd1Љ‰1M1ȉUM bȋMUUEU1Ћp1ЋU1bʉU1ЋU1E1؋|1؋]1bʋE11E]1؋x1؋]1<bʋ]É11؉؋]83uF,lj~@ F 0A4$7M+u [^_]É`UE#Eg@@ܺ@ vT2@@@]UWVS UJEˉZs Zȃ?H]Ã?@)É]< u EEuzEJL$$UPE);MU֋} T$4$&ڃ@;Ur)]] E< u sHtft [^_]äfEwu^uDMEMuPuX] uD0Ezfmu KMfUWVS$jEu] $7ENjE1U1Ƀωу| uىUD$}䍇D$$C%=Ut,ID$|$$C%=u݋UD$T$$t!1уuuE+u$[^_]Ë]>]UWVS(aE؋}u $7EԉËE1tX|$}܉<$]o1L F TFuF(}ԋE+u!([^_]$)]萗ƅuՋ]\UWVSEE EEu}$7U1ҍ $sD$@$]f \19ȋ})׉ 9}PD$T$$e~3D$T$ $319|vE[0$hf0t 14o0$>fZ0D$ $U+uw[^_]D$ D$L$$蓩$e1몍D$$聕tыptvpZUD$D$D$D$ E D$E$]UWVSt[àUUEE$7M1ɍu4$BM L$UT$4$ED$4$U+ut[^_]YffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuMMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$0؃,[^_]H8 uEƀUGffffUWVSC} $7E1D$D$HtHE$Lt=ED$D$<$;Es1U+[^_]ø"㍅D$E$Ustt@D$E$su[ED$D$<$s;EsED$|$ H%D$`d$T$U.t&D7UWVS D$LW \$E$Ɖ؅u [^_]É诠01UWVShΜL[ ut$$L[ @B1E}E1uNjU:ME1uEHt$$xxL[ @B1Ƌ}E1NjExME1EH D$E$p"u(L[ ]ٸ@B1E1؃h[^_]øh[^_]$'&L[ UWVSaæD$8D$E$HSuE0,@t&tD$E$u܉[^_]D$D$E$Rt 1[^_]ËEpD$CD$4$RE@<-u?EPP-DPtEPD$ ED$$UMU9p9g^My+th)ƍF߃1BD$lD$4$ RE@t<+ !M?!UE?w0,t u]Ë u@u1]UEP>w 0,]1]UWVS(HÍu}܉|$D$4$詔xINE uG>wl/7EظE! EED$|$4$\([^_]Ã>w2/7EظE E趜詜UWVSŘu*5D$ toD$D$[ <$蹇y)l[ @-t@l[ [^_]ÍU T$ t$)‰T$$.뵍swD$D$[ <$JfffffUVSX=v^ot.&vnuucts Ƀ E u p}+t}}-t}=uP[^]Ã+t-uuPU #UP[^]ÃXtguu-tH@+؉M @ @+؃밉M 뫃P묃PUWVSEu gt,C-X.t&u!E I@t pguԉ%+t[^_]ÀouuPӃt>Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS\u>;EEEE}|$EԉD$$c9$i$E iD$|$$49EID$D$Ẻ$G%MẺE0EUP-DPuHщMEE1E]0d6t]썃$k3E$]fE$-E$-ϋ01[^]Ë]썃$&3]썃$39UWVSxýUd61c 19VuM$@qM}8D$|$F $t։4$eE[^_]ÉM썃$H2c UM^t$ 2訊뭍$2`c I4$dUWVS\QÖE}|$ ut$E D$E$@t$t$E$[ƒЃ\[^_]ÉEEED$$_Ut։|$ D$EE D$E$+@MtZEEL$ME$ZƒMtU $cUЃ\[^_]ÉM脉8Mt9uWEE뤉M$vM~9E~ωL$$Z‹MfffUWVSP VEu]AE E AEEE0E~ 0MU tEEyGz;EGEkMddeEUMEEE EIE܋E$]| 8MԍD9E c0>EUM]L$\$ $T$]!9tu׉EUM]ىeщٸ9и| E ;ED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]D$E D$E$E]U]EdEUM]^$xUԍD9E ỦUM*uf~*u1f~*@DFP9\XD$lD$ PD$|$\$phd…hfDžHdf8,D$DqjD$$`]e`l@ @$TP `T`l@ @DTt4p8`$TЅlS t%XYLYL! x . h9pHfKfu9p}H@u5l4d76|%= P\hS89sfC/fXD$lD$4$pd}hfDžPDž@DžHdf8tld[u|%=@tp1ҋf?f[uZp!!f90f[ʃfu‹ffP uO f?ʃFW Ӏ_ Y9t fx*f*ʉك |$|$<$jU+*D[^_]ÍJfzuf[Qy f2f]u답f[!u pf@!Wf]tI׉΍Nf%ff-uGf]HfF-Nf%fF_Wf]uH Af]O9]D$D$ D$D$$=-|nP f 99sWfPfu9t.P9fx*P9fx*ʉW 9= ؁T$ D$)L$pP$*2I$hF…@D$D$ D$D$$K,@u\1W-f[!ʉfH98MUWVS Ӊ9x)ڍωރ׉HPftPΉ1ff}t[Fftf[tYf{uFfu勝M E1 [^_]ÅtJF뜍~Ff]fu{rZf]tFr^9r1=f[uSf]zfً9@S{f{f,uu91ҋLf fuM A}1xDf5f}4vd!qQf]tyىC)D‹΃s tfFu@ύSً{ fsJfPUWVS蛣iƉ׉MB tA PQ wif>{tBEEft>f{uED$E$ZuۋE[^_]f~}uf~uM[^_]mUWVSU}DžDžDžDžE uGE E G EGG؍uE uM}fH9z مtz\uJtE@̓fH9tiJufE tc[^_]É\@[^_]G4}뫋}UWVS趡gEPtF@1EID$@u$EE EƅsuPcE$uc0yD$D$F$/J$C5Dž E|ƅxDžll$gYUc1E`DžhECD$D$F$E!EEE1ƅsu3ƅxqFTbp~EL$X<$T9…EhxhXM >l/hHhωxD$xD$F$usދhEDžhEaY1lrs2lƅxrhu"E ?ƅxDžlƒhE`D$T$F$E<Džl|DžlmDžl^sƅx1l31lEƅx1lEUD$D$D$ ED$E D$E$[]UVS9~\c t8t$[h D$\|$4$Gt8t$0h D$g D$4$ @bD$\D$$QGƅ8tщ4$Luċܳtܳ >t|$$Puቻg ?xuxu U+8[^_]ÍD$\|$4$F.8t߉g 8#kD$\|$4$pFt8t㉃g D$\|$4$MF8t߉g 8xuxxu x g 8sxwxg D$\|$4$EtM8t$Lh D$\|$4$Et"8t$!h g ueh D$D$|$ZQǃg B&T1mǃg ǃg <ʈT$$NuUVSIÎR h tutKg [^]ǃh k D$4$E h ut$$L1[^]UWVS΋Ruǃh h t-$\t$g $&NtEu1>k D$<$RE h uщ|$$1g [^_]UWVS0uQuǃh h t-$\t$g $MtE/u1>k D$<$D h uщ|$$1g [^_]UVS蓊Pǃh h t$[[^]Ík D$4$3D h u҉t$$1US!fP h t$:ǃ h []fffffUWVS@&P]ԉUĉM؋uUP-EσUFET]DCtEL- ?*VЍL]DS<*EL-u<*tЍ\]]DStڋEЀ*Ҁ[\U؃] ȃ]^]^]tu܋uD^]u?ɍv*F[\U؃]]u\9tV@[^_]Ëu].}"D$E D$<$ututf [^_]UWVS WxÜ>}"D$E D$<$SutuFtf [^_]UWVS w<>}"D$E D$<$ututf [^_]US w=\27D$E D$E$& []UWVSawæ=}U $7E1EteMyu )čD$UPtMP}y:u}D$<$HpU+ue[^_]øUWVSv=EEM $7E1EtgEǺu )ԍT$ MJtJx9uD$T$E$kU+ue[^_]úEUSvb<ED$ ED$E D$E$5US u0<ED$E D$E$=US u<ED$E D$E$8>fUWVS u;ƉUt/ t"D$4$N%uM) [^_]P-DPu 1 [^_]É4$c [^_]U!ub;Et8t 1]ø]UWVSXt1;$7EEED$D$Ẻ$a,h }e1󫍃4h EЋM̍Ch |t:tEЃ9s EЄuDh t$D$Ẻ$eFD$D$Ẻ$teEЉED$D$Ẻ$Uex,uЍCD$4$6h 4$D$:TD$Ẻ$Tth EԉEȉD$D$Ẻ$ZhDEԉTh EȉD$*D$Ẻ$,ht Eԉ\h EȉD$VD$Ẻ$ht EԉXh EȉD$&D$Ẻ$gt Eԉ`h ED$lt$Ẻ$2d lE1f0h EЉ$EȉD$v!D$Ẻ$jg^Eԉdh EȉD$>D$Ẻ$t}4$+T9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vi 9u(Ƅi [^_]Éր>/t>qji ǃstftƄi [^_]ÉڍeffffUWVSl2E$*}|LP-DBL-fkfbfg@?6D$ ED$E$8EUE8E9t8u|58"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs 5[^_]þUSEkÊ1D$ E$[]fffUWVSkV1}tz?tu<$X)D9u p9ti8/t9t`sc~/t9u)=vm ׃rtftƄm Ѓ[^_]øqj€8/t Ƹ봸eUS ,i)\P(\1= ףR}؋E@9R}؍ʃ;}EPMMԃuEXQ))Ѓu.,i)\P(\1= ףIEP@}+}G MEE@E܍k%y |Q))Í))эI P$I )Ѝ))ыEH )Ѝ))ыEHMEp8hE}1E   E $M]ljD$ED$M $Puĉ}Ep4u}ЅtMuuMEFE}1E # E $M]5ljD$ED$M $uĉ}Ep4uEЅMqUMEDJ@tDZ@uMEЅu6MEP $=ƉEE{MM߈]]u}Ѝ~}ƉEE}GEЅoMMU$5ƉEMwu?%1}Ѕ&^MEU$ ƉEE}GErMUЅEP$ mƉEEx @uMEЅM E؍uЅnEMEЅTE؍M$=1ɋUƉEEMEP$1ɉƉEE MU$ƉEM踓$I )؍))ыEHEMPЀ cEMEEЅZMEP$;1 MEP$ EEЃ} uG`MEP$1ɉƉEE UMEƍ@DJujMU$c1ɉQƉE$MElU$'1ɉ*ƉEE-l}G}ZMME MU$c1ɉƉEEȅEHQ)ȍEE}GMEM MEЅE؍5} ]ЅE }}4E@E܋E@k%y DEԸQ։)Ѝ)ËEԍ)֍)эIP$I)Ѝ)‰)؋u̍\)Ѝ)‰)Ћ]čTE)؍D)UBEԃ}}}Dy@V؃DY@u]utU܋DB@UЃ@)aFUDBfvME)붋EEUЃA룉YD$1$E؍ډct"UB M)i]D$1<$Ed,ډM]K U 7sUbK@-D$ ED$E D$E$j]UWVSD,KqEu q 9P|MP LM܋HP UPUPUElS *$JT$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$9D[^_]Í*MP M*MIH??? F??? F?? ?F ?:??F:?? F????fF 늍DJ9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ hJD$|$4$9mT1D[^_]UEFt$V tQFtB1ɉωMT:0$V T:($xV D: $iM;NV r$SF,t$DF4t -$0F8t$!4$[^_]UVS; 4$6Lr D$E$R=4$[^]UVS;4$Lr $9=4$۬[^]UWVSA;Æ<$責Lr D$$AƉ<$蓬[^_]UWVS :;uED$@$*_ED$E $_…t?t$U$CUt'zu Ńtt$$uUEHutU$zEUЃ [^_]UVSF:Ë 4$跫r D$E$l^4$蚫[^]UVS:F 4$rr $^4$\[^]UWVS9 <$3r D$$^Ɖ<$[^_]fffUWVS m9UP-E܍uu<0 )E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruuTM؋ut}u9tvwn<.uQy<0#BÃ߀XtXtbEf)Ǎ|&uԄIEDX@; [^_]BuԍE9t1 1UWVS 7聚D$D$,<$$E tED$E D$<$[D$$ E$US]7âdUT$ U T$D$E$qdffUWVS!7f}Et5[^_]à M ME} #>E11} ;cgEEE}u#Ћu0}91dtt<u|7u9tȋ}*E TP-U P-DPttE 7] Ј} #} U P-DPTu Vɨ=E bE 0<KE] DЋuQ} -} ^E nE TP-3E 0EEu } \JEt } %EEt } &=Et } =]E EE} ?gU  Ћu9E TP-7E 0] E } = ]E E 0<E] DЋuuE } ;U P-DP"EDBE ]=P-u DpuE /E 0uE E EEEE\EoE zE iE XE G}d}ufEcmduE 0 E P]L-WEL-W ti1WL AUWVS,;1p} EEEP]tsMM؍MM܉UE< )؉EED$ E؉D$ED$E܉$wAMEE@uEYYυtl+E,[^_]ÉMAt>U9t-ECR uEyt E됉/UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$^]UWVS/ur />3)Ѝ)Ѝ:~ 9w$&r umP"U$Ѓr DU4$Ѕt?w$WD$ D$$U UЃ[^_]É4$Duw$Wt$ ɚD$D$ $UE Ut1҉Ѓ[^_]Ër t;U$(NjU4$DCЃ[^_]ËPǃr 뫋U tuW3ǃr Dr ^D$$=r Jǃr 1+1UWVS-ur ))Љ):~ 9w$&r um`"U$Ѓr TU4$Ѕt?w$WD$ D$$UUЃ[^_]É4$Tuw$Wt$ ɚD$D$ $UE Ut1҉Ѓ[^_]Ër t;U$(NjU4$TCЃ[^_]Ë`ǃr 뫋U tuW3ǃr Tr ^D$$r Iǃr 1+1UWVS+}E$Džr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$MAF$U 1[^_]Ër VD$ ED$$E$H@F$맋r uP$Ѓr $( ƉuE$H@Or aPt $Ѓr @~Pu㋳r uED$$=Ɖr lǃr ǃr IUWVS)}E$Džr gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$MAF$U 1[^_]Ër VD$ ED$$E$X@F$맋r u`$Ѓr $( ƉuE$X@Or a`t $Ѓr @~`u㋳r uED$$Ɖr kǃr ǃr IUWVS'UELtЋr t'Ǎt$9uǃr ǃr r t'Ǎt$K9uǃr ǃr ǃr EPE LEHED1[^_]øUWVS&UE\tЋr t'Ǎt$9uǃr ǃr r t'Ǎt$`9uǃr ǃr ǃr E`E \EXET1[^_]øffffUWVS%pUE DžXE/tBD$E $p8%E $uv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p ])%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $pDž`&$`psD=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5pM?t9E tX$pH1nىf t~uf.륃8/utщ$pOE tE XfE pXE /t/tpp?p>1UWVS }E ttrD$<$c xX[^_]Et$<$}=DžMtAt$$# ymt E8"tƉ<$e1[^_])1fffffUWVS6}<$9r $}r ǃr 7tyP-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$Mǃr ǃr  yEUVSE] :tu1҉[^] 8ut$8tù@tσ}:t$ u}:t;MuPx@t[^]Ät:u‰[^]ULUd]UWVS}u 8u u|t1:t,t(9s:t|tu[^_]1UWVSl] $7‹E1}! Mu$r t\$4$,$Dž  DžUD$ >D$D$4$DD$D$ D$D$@4$$D$D$@$萇E<DžDžƉ1ҋ9slpȀ ':Dž\1҃ t t DžO9ϋ9rD$D$E$z@؉؍pȀ Mx@<#D$$ߍAdbDžD$=D$<$… <:<uz)ED$T$E$qƋtg<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $膀T$t$<$p$褽y@E<$LDž:ύO9))|$$脹)ljx1kO1tCȋ)Љ)Ћ))ӉL$$ܸÉNjÉC:{DžtE$q)P9rg8E+l[^_]D$ D$D$E$DžD$<$ηxr $oDžqt$$"DdcƋD0<$g50Džu*$3E$辁ËE$諁jnƉ<$ֹ$D$ \$|$4$V tBt(Pu2Dž4$VDž$UH $蓰DžL$T$${4$Vf18Dž<$蒸tE$)? <$S! 4$Vċ$'u/$  {tE$UUD$ED$$M E]UScèr t$\ǃr ǃr ǃr ǃr 1[]UWVS, OEE $7E1Džr r P-k r tr D$r $j6D0Dq@:#r ux|\u ǃr ׍:\tWut$r $5lDҀ|\tǃr ǃr r $AƋr $^ǃr r Pr @L$$r dǃr ǃr ǃr f:wu<:tAt<|uD$t$$ƍ@E+/,[^_]Ër $uhr $*ǃr +r r 0k D$r $r Kr t$贿ǃr ǃr ǃr ǃr ǃr Zǃr ǃr ǃr -$?ǃr oUWVS Qu} r t$ǃr ǃr ǃr ǃr } u[^_]UWVS ]D$=E D$E$$d#Dž<:}dUN<\Έmt>}<:tk_]J<^uF<:mu‹]U)ӉߍCdD$$]®,ljEEd<:uU_F<:PЀvH2Mɋ]FE1U]ND9ut 0vU] :U]؋})ptD$<$]ӭEtcE] [^_]ËU }1볾ʋE$]ٰ뵋] <$]跰UWVSh í]D$=E D$E$e$dƅ<:d <:t?Ytru)Cd]D$4$]ƬMtƺd<:uȉƍX)ˍ{t7Ή\$4$]般u 4$]Я@ȉ)ˍ{uɋE[^_]1밿4$]莯ы]R UVS D$#E D$E$6tv80tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wF@ctftƄ/JDžDž)S$J9>:7, 81Ƀ4uA )čD$pxr󥋵t$D$$UsD$DD$$ q|$t$$pD$MD$$pudurqj1qjrBvBDžfzngU \27D$E D$E$]UWVScè}U $7E1EtqMyu )čD$UPtMP}y:u}\27T$D$<$qU+ue[^_]øffffUSD$^$Lw D$ F7$kH w []UWVSHaæu} }ԋEE$7EЉE13D$l$yw u}MfMUT$U܉T$ D$ UT$$buM vU܋9Eo} u w t%9w t1uЋE+H[^_]Á} u w uD$D$ $UE؅t( EċE؉$YKfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$X % ЉD$tD$ wD$ED$Ẻ$߸;E1B9EBf9EwB U؍yM|$D$Eȉ$ EċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$7W3")UuuB r EfFcUSkD$ s \$ ED$EU $T$u؃[]1[]ffffffUVS<WM uEEEQEUAEt8MEȉD$L$E$9uUȋM̉NU܃V<[^]ÍuD$t$E$<[^]ÅuUS,fëEEEEE܍ED$E܉D$$kuE,[]US,WEEEEE܍ED$E܉D$$juE,[]USEEEEEE$cj[]ffffff=̀rS[ôC[ḽ̀rS[ÔC[̀rS[tC[(̀rS[TC[L$S[:€,[t'L$̀rS[€,[ US D$E D$E$^ []US vûD$E D$E$Gl []USDÉD$ ED$E D$E$][]1UWVSH}E 4M0M($7E1,hEED$E$oD$h8$phdžPdžTdžXfDžD8H<$裼L$8<$褔L$8l9t$LbYD$<`T$0E[^]UVSX@-$ ML$ML$ M L$ML$@$R4u E[^]Éў0E[^]UWVS$]Est M$ UT$Ut$D$ D$D$@$QU싀$ T$t$UT$UT$ U T$]\$$QHƅuE$[^_]ÍU븉0E$[^_]Ë$ 1UU @-D$ED$ED$ ED$E D$E$]UVS~ÙE$ ML$ M L$ML$@$R8u E[^]ÉF0E[^]UVS`@-$ ML$ M L$ML$@$R8u E[^]É0E[^]UWVSa5D$D$,<$Et8ED$ED$<$|$ D$D$@$!^E $*~D$D$$螋E$QUS OD$ ED$E D$E$;[]fffffffUWVS8ÉEċ}u t$E$0Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&El$EԍHwq{E@N4$]utEԃ0<Eȅu tEtJM\Eԉ0҉Q0A0q AEЃEЃ8[^_]E@uU\UƀtUMƍBEЉ4$]ttU@^GE@uQ4$]tuT tOFvGE Fv5 *-UЉrBEBEP-DptGEЉ7EЃ8[^_]ËEԍPEP-PUȅE\@sEU\B0E0<UE\@aEE\@nEpE\@vEUE\@fE:E\@rEE\@bEE\@tEE@0@ 0E^?iE\pEUWVS}U EEuEE tu$UsUtT t! tT$U&$x,Ut==L&GG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]SUWVSY}u EEEEEE4$quI.h v.%&GG  O[^_]ÍN߸?tċEEEEEEu }[^_]_uUWVSeêʋEE$7ËE1}}P EuD$$k( D$<$k) vDžE %@  1)tru䋅D$ v D$T$<$px9 ru1ɸ)u)lj9usu$ɈD$$,jp 1󫋅t# 9uE t *%H uE t '%H uE t E t E t E t "E @u \E E [g wT$ L$ M L$KL$$ׅu͋ג$l$l$l$lE+Ĕ[^_]Džu%fČ (fqX1U11҉#UVSNƃEE$7EE EEEMED$ UT$UT$$1{xEU+u [^]1"UWVSEE$7EEEEEMU ED$ }|$}|$$xEU+u [^_]1"UVSGÌu t44$D$ UT$UT$$1ҍE[^]1UVS:ut54$AU D$ ML$ML$$ED[^]1UD$ ED$ED$E$M 1ҍE ]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$ME]UVSMEE$7EE EEEMED$ BAT$UT$$1BxEU+u [^]1e UWVS茿хEE$7EEEEEMU ED$ BA|$}|$$xEU+u [^_]1UVSTu t74$[}D$ BAT$UT$$1ҍE\[^]1UVS躾ut84$}U D$ BAL$ML$$E[^]1UWVScè}u t74$|D$ BAT$UT$$1҉[^_]1ULD$ BAD$ED$E$M 1ҍE`]Uý U D$ BAD$ED$E$ME]U肽˃U ML$ BAD$ED$E$ME]US EÊEEEEED$E$J(E []UWVS$DDžE = tIƍD$D$ t$|$$ tyDž 9AD$E$~uƋI} t9rcJ 8 uv9t<$`$WDž9t4$_Ё$[^_]ÉUE D$E$K]fffUWVSAÆƃ ‰ ‰ ‰ ‰ z|$F$[tF~1[^_]øUWVSٺ9H rn~t PRuF$D$ D$L$M<$=^ڋM΃tyE:BGuETB[^_]ÉUy(MbED$|$F$cpM>Uu ~ MLЃ[^_]ÉUWVS>ljօxlxD$$UtE3G4U3W0 u|3Gt9z |1tft Č[^_]fx t~B8z<~ ^z0Z4FB@zT.BpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFČ[^_]3 nČ[^_]ÀzUtBT%=.;8tm fg{Pfh{QUWVST芵{]ƉUUċ@(%D$B$E܅}F(ƒ3EE]܋M1ɋEEЅEԅEfHJ]~EEEċH(MQ@|/-EEF(EF])؉E؋Eċ@DEEEEEEUЅ]ԅ'MtF(WTCGGG,D$T$E$] F(1ɉfGHUԅ~PffGEExE}E܉$]-ÅV( u { .oC ǍK F}<$DžM9MEȉGDEMȉG(GC <fOJEЅ]ԅt MF(GGfGH GE0}.ҋMċI@M)щME]܋EċX(]S@|/EEEԅu fGHEċ@GFE؋EUT_FU9tF(tQUЉEEFM)ȉE{]f{.|MEЉG vGTE뵉WmEEUEEEFX]/E܉$] EF(tfE9FEtWU̅rEt\}uVV(EċxDu@EEEE^@EU̅@F$t Ẽ-ET[^_]Ë] {E<$,UEt}$]UuE܉$] z]Ef@HN(EET[^_]ËEEU]zEE}E̅7V(Eċ@Du}aF$]o}v!]#zUĉB }EEEUT[^_]Eċ@U썊xFNtPXT9t+PʉPH@uUЋzDyЋXDPXT9t+PʉPHPu׋@ԃ}ufFH]0yF m@Et)}V(EċXD!>}/Ef@H!V(EċHDhUWVS$藮tE} bD$,$]JNƅ EF$~(E }1҉u׉$]l9sǃuuV(F$}BA}܉Eq@DEE1}EC]E  $M]kÅMV(F$ÅP@DECCTCF(fufCHEwCMEX]E e}}UtEv NjV(F$MtKxf@H F(E$[^_]Ë}]v$]PuE$]PF$]P4$]P1뤃&]]-v1s}D$D$@]qj$F6N(-E$]P%V(F$M71EUWVS腫q}tH@JHDy$OVDxpup$|OVDy4$mOwtv$YOuGt$FOG$;OG(t&<$-O1[^_]Ë@$$dG$ ƃtG$뻉ttEG$<$NEttUUWVSlñp}7QG(EVLfFLNHtlfv$KNVDFLf97tȍD$ &D$D$$iQffu@tUV8N<3O3W tEFJ Gt uƉv$MuuGfFHuE[^_]ËOMt+tKG(uΉv$qMuuGEGu0G)tE뛨uNjGEGGMIQ(rI|/u/uV,UT$VTT$$7E[^_]Ã1ɉCfFHpu$L~DWMA(AD]uFJF$G(u$F$$My fAHG(uG$F,F(NTD$ML$G$D$/M $At;9EP$Ue@MD$UT$E$XMN,GFFF8Ve[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$('D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(Mh"D$8D$<$N>d01d0 d0ƋG$$n G$$>.&c0UWVS踙_}D$`<$t.ƋM t[^_]c84$dc81[^_]UD$E$]UVS5z_u|D$4$4tOE%=@u5D$D$4$t#1҉lĈ[^]b1Ĉ[^]fffffUWVS8衘^]E@ EEܩtE}ԃt MEԨEeEЉ}1E1Ew?E܍ 0MMT$UE$]8U})ljEuUD$ D$D$E $]mGMAQt$|$E $t~")Ɓwe]a8}}؅:UEB ERU9ia1ҋEHE1$ƋX t tE9sup)9~Љƅ$]2…EM9st1](D$ D$|$$U U2t|zuEԃEU܉ǀ t=~tQG UJ L$$]XG uËEtG~uU܉$]`:EEE@ EEUPUE)‹EPE@U UԉP $] 18[^_]ËUЅAE$]9D$ D$D$E $6Em@뫉}UE܉BB$]1UB tqE@@eBE $] D$@E$-E EUP ]_uu1]^uUWVS[}G $8wt6$8uG[^_]US{ZE D$E $V[]UVS8FËZut&== =('ED$E܉D$E؉D$ T$E D$E$=t3w  'Ef>@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]ffff̀rS[DYC[UWVS E<؉EUt`ME9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu [^_]UE]UWVSTNXEU }+ &E EẺ׉U }G$]-EȅU Eȍ 8MЃƃЃ)UӋMщMԋUT$U$M‹EUȍD]Љ]\$EED$]$U1ɅMM9MXEEUȉUEEE؉E܉}ĉuEM4u}ԉ9du E9s#ED$ED$4$U9Etщu؃9M؋]U+uED$T$U4$U}9NjUt +EMC6ˉUE‹E9r]U}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ċu]9.EEE}}čGU9 Eщ}U܉EA‹M)ʋ}č M9~ȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅?U!ED$\$<$UU9~]E9rՋE9M̅qU܋E 9r}G9C)EE܋M܋E}89uM܉E}9}M9M M]E̅{U܋E}Ћ029r}GU9IЃ)E܋}EԉE9JEԉEG׋E9EEĉ$]N21T[^_]ËED$E$MEEЉEȉEċEE뱉ˋ}M 9sWEƉ}Q+ME }uڋEE‰]M؉EE HZ9Eu]M9r}M3E}ljMU]XJM9uˉM]9sMˋMUzUuދM9U]ۍuM9ƋED$t$<$UM9Ӊً]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Yu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}ZM]U9UU̅U܋E}ԋ029rUB}9G)WUE9}܋u9rUB9)]E؉ËuEߤ9uu]]U+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE'}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UlEЉE}ċuEMЉvE؋MuuEU)ЉE؉ڋE]XJ9u]uE}9EŃ}tu|$}ȉ|$$] }SU7OUT$RD$ ED$E D$E$c]UWVS 譈NEuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]$t"N^HXVP MF [^_]ÃUWVS eNud6uu[^_]=F$$v4$*NjF$$a[^_]UWVSć N}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$ 7GWG1D$<$tG9F [^_]fffUWVS!fMu%Q8F}9FiF FD$ D$D$$t6FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_][P1}IP81F u1UWVS]L}d6t2G$$}D$<$ƋG$$`[^_]D$<$Ɖ[^_]UWVS 觅KOEOd60E@$$D$E$,ƅ@ ‹} >HE@$$OtlEM 1 [^_]D$E$ƅt[P } uuuFNuN}8눋E@$$NuJtN}8E Y]NIf뱤&fvft*N [^_]E xDE xfffffff̀rS[IC[ḃ̀rS[IC[UWVS$aæIEEE ETM8D$D$ED$ ED$D$E$+t 1$[^_]É M8 uL8US݂"IEy œ'9~)ML$D-D$E $31[]ÉD$ D$ED$E $)A1[]UVShíHEy œ';}.D$@D-D$,w 4$b3[^]ÉD$ D$D$@,w 4$@[^]UWVS-HEU MtFL-;4ut/M9t(\_rtwf9t)[^_]1[^_]fffK̀rS[ôGC[UVSUÚGulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS݀G}l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp419|[^_]Ë]싃tpu޾ UVSFL4$1ulU4$[^]ËE4$[^]UWVS cèElEL4$l@}C}wSǃǃǃE lhE MH1} 4$UE [^_]Ã}?vB}<6lp)ȉЉAUE PlщU쉋hEUpU)Љ?}҃?}}}Ƀခr4$XEUWVS}ClEẺEыE)ȉE䍃LE$ɋUl@P'<'EHlt)̋Eʉp1thE$oE[^_]Ëlp)ȉGfUWVS|BL<$ 7Ɖ<$[^_]US v|ûBED$E D$E$ []USE|ÊBE$g[]fffffffUWVS|VBƍu~$G$Gt$yF$$nFt$_4$W[^_]UWVS,xG>Ƌ@$ED$ D$D$}܉<$ t$<$Bt t$<$/u/'D$$DE@t<$Ѓ,[^_]É<$EPU؉UWVST^wã=EP$BM9ABEED$ JUL$D$u܉4$ }ĉ|$4$u4EE|$4$E@t}4$ЋET[^_]D$E$gEEED$4$EP|$4$}EUtMBABAXmEET[^_]UWVS,CvÈ<E 8t ,[^_]ËMy$D$ PT$@D$u܉4$ Gt$1GW T$U؉4$U Ut)G MGAGAE,[^_]ET$4$ GuGFGFUWVSiuî;E}$7‹E1D$($ D$$ d,$oĔ $SĔ A Q$60щr PQ@Aq QA AAD$$$$04E 8E\ Dh̀rS[T2C[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS j0u}F9r+)F|$E D$F $a~  [^_]1 [^_]UWVS HjÍ0u}F9r+)F|$F D$E $ ~  [^_]1 [^_]USj<0EU ]t,HPP UP[]ÍlfUWVSi/}u t$<$t t&t 1[^_]Ãt$<$À[^_]ÍFD$<$}t̃t$<$l}[^_]UWVS1iv/}u t$<$ku 1[^_]D$ FD$FD$<$ntԍF D$<$,tF t6u$FD$<$|tt$<$|듸[^_]ËFE }F[^_]UWVSvhû.}u t$<$u[^_]D$ FD$t$<$赀[^_]US he.D$E D$E$ []UWVSg1.}u t$<${u 1[^_]ÍFD$<$ t~uD$D$ F D$t$<$tUWVSugú-}u FFt 1[^_]Ét$<$d{tFD$<$~~tӍFD$<$>{tF D$<$+{tt$<${USf--UE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJ' JHR P[] | q f[@HFfffffffìrS[4,C[v̀rS[,C[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSEu MtXMX89t=JuMtBu {U tr9uu 1ۉ[^_]ÉCu1[^_]1fffffUWVS(d*Ɖ$7NjE1D$ |$T$$er<$"@9EZUT$|$$LFu1U+([^_]E @NteulN u`L$$j '$!HN tD$ [D$D$ $4t9urD΃sztft%D D$ [D$D$ $ _u-ujFfUWVS(bm(ƉЉU $7M1Ʌt=~t3E+ȁĈ[^_]ù۹Dž9Ff(tvEtoEfD$ [D$D$<$<$9EXED$|$$6Vu5F~uN uF=tu ~tMEEcED$ t$|$$a4$9ExED$t$$V1@FȉC:9<W<DžE4UL$ L$D$$8<$9EED$|$$t$ a+D$D$D$D$ D$؍(DD$<$Stk0$`}ED$E$F <tt oEu̓t,ED$ D$|$$_t14ED$E$B1襾UWVS<]$uU EEMEE܋EE؋E E$7E8}1wc~w]F,(vIE܅t }؅tFu f~V~Ή}U+<[^_]ËE}+8EԉEE؉EE܉E MM<[^_]vE܅t U؅Et1댋E܅t E؅FfVT$D$ bD$L$M܋E$DžM9FF ftV ffuu҉T$D$ OD$ȉM)D$4$rMx 9=EtEȃiviD$t$E$ 1T D8D$ [D$L$M܋E$M܅x9E4FD$ ^뻋EYQEE@DEԋ}1BAE؍fE܍иEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M+MH9@)ƃu1q҉Ű}UT1BAE؍fE܍иEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M9M)ƃ9}u1MFD$ [D$D$}<$C<$-M9L$|$E܉$ MUU܉D$ ED$ȉM)D$$M}9nD$T$ bD$L$M܋E$MUWVS@Yclj΋E$7EG uY$Yto|$$Zt9wuҋtD$G $#u1ffh$@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$/kO9Aff9't0G9T$D$G$Mt$ |$D$$"[u8u Dž11fB获UVS Vut$F $QXE $MUYF t [^]ÉE4$-WE [^]fff̀rS[ÔC[UWVS1Vv}E$]xkUtD֐6t;F txu@9uD$FD$E $Uu 11$d8[^_]1[^_]UWVSU}D$<$GftD$<$"[^_]þfffffffUE.߃At..t!.t+vPЃ v-u2-.u…uҸ]ÀvPЃ v_u_1]UWVS UE Hzu;9]苰uυ0qD9sDw]Y}D9~D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}ND9OD<]][D9^DυYDM9YDM}B4^D9_D(뮅f"f 9DupR?UWVS$E@dtfɍ<ʉ}ЍMԉu7APWЅt#xuPR#l;htՉNj@u݋F9]uAEF$[^_]ÍMUSQPt@uQPtuHuX uHuxu t1[]PtCu[]g/[]@ FtPtC1M]\$ ]\$D$$>t@M똸$@$&11 rFFtGGFEN]1ɀ.уu9`d9@ HDPDDžDžDžDž<$p38=R7\3G u$1ҋ$`{[$$1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$$ U+Rp[^_]Ë넅tJPd9\.$1ҋD$ D$D$$>u~d@}뎃1@<tE12Dž$1ҋ Yu@ WY81.늋$1ҋ^Y@u2u9,XGHDPDLE%$X1)UWVSM8ÒEhpPt%={DžthE11҉ rMd11҉`d r`VtA<$WWt[^_]ËhMEEdUMEE$lu`11 rU؅tkhd<$hE[^_]ËhMEE뀋hMEEd<$xЉd|diX\P}`1}dX  r*OTdDpPmHXLƋX9H`D$ PD$D$L$$hL$P T$ D$HD$l$&3xWE11҉ rlUEE!$\Xvl$q9T#X\dwc\$U`U؉h<$h(‹dG뎋DA‹@uDFEu11 rE@t`EEEE<$ML$ML$D$ |$D$E$)twEЅUp[^_]É<$MML$UUT$D$ |$D$E$^)t?E$R_p[^_]ËUE/tFE$#gMEԋAE܋A EAEAEAEAEEUԋE{EЉƋ@uj9UWVS\ bçlj$7E+MD$ D$ D$ $ƅ8#3D$4$D$4$xDž< < D$4$蛑xt$$t띋AAA AAAADžD$ D$D$4$~#|$$Lu@k D$0$*1U+u\ [^_]Ët܉ljtHt$GxGu܋vGt$<$utlwUWVS4EȋE0xU11  rŰ]ȍk D$0$9EЋ]̍EЉẺEtCË@uEuEЅt $]EU4[^_]UVS&uD$F $袵tP PH p[^]UWVS@ljE$7EG ut$kt$$gtӋD$$tD$F ${ue$1@=wI$ ‰@=wЋЉ==1U+@[^_]Ë~D$<$tu狵1DžЍtftȍtftD$D$ GD$D$@$&9OtD9AD$D$G$Lt<0L9_YB 9@3t9'9uۉD$D$ $zKut$ D$D$$A+u9u [u3fvfvBrUVS ut$F $LE $MUF t [^]ÉE4$(E [^]fUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPEE);UEމE} ]7Et@9rE)uu U<u sCtft[^_]äftu^uE[uOuW] ]u\3]|fu SfUWVS EE} $7E1WEEG?7w}8)‰T$*D$<$D$ED$<$EX1u4u:tftE+u& [^_]úx)끪WtfhUWVS$}Ћ]E E$7EƋE13P-8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]VfU ED$E$u ]ËE]ø ̀rS[ÔC[UWVS09vuE $7M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEč*ۃTЃut( tۃ\"u|1w eUWVSDÉE4M 0u,}$7E1hEED$E$1uD$h8$uhǀPǀTǀXDžDB$F8HDž@DžL|$ ,|$0L$8$ǃt>8GD$H$t4E+u=[^_]ËHt$*4 cUUT$ U T$@-D$E$@]UED$ ED$E D$E$]UXUT$ U T$@-D$E$]UWVS$"gu4$ruE荓UEEEEED$,xX<$jE؉D$<$pD$<$r $[^_]UWVSEX$7TE1D$D$$+cƍ`$1D$XD$$PDPT$D$i4$u4$t'lpTU+İ[^_]l\$c\t~։P6tN~ tu틅XD$F$uԋPGX$XcP$vA1A$X`UVSGuF tF 1[^]ËF0$F0F($F(F,F$FFN D$$:FtF 뇍k D$$Dt F ^YUVS6{uF uu,F [^]ËF$FF F tԋ$F F [^]UVS uF uetaF0$F0F u9D$D$ D$D$$ F0[^]Ë$ef 뷸US] $)1U C []UVS]u4$F$;FFF0$"F0F($F(F,[^]UWVSE@0} MML$$vop< t< t0D$4$v?x4$pfM Ay EpE pED$<$XvtbP1tJ< t`< t\E@H9tTE xFE7ED$$vtgPuuE @4E [^_]Ã됉U }OD$G$SDžUtBExE xzt7@ D$$ ƋEp/0E$01jUWVS$9EuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]ED$UT$E܉$躰MuTMEHE Hb@ ]lD$D$ E$gE]30E$E@$EE@@@0$)E@0@($E@(@,01$[^_]ÉT$<$]芚DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS`u F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]fffffffUWVShAÆ]D$D$}Љ|$ D$D$*4$3EЉ$覓EąD$D$|$ ljD$D$4$蝠}9E1E1Exu0P!uftf9XP 9rEMȃVUEЉỦ$]ڒUAEET$D$ $M]ӦMMUfEMzu7Ju%uftf;rz }p 9rMM̋Eĉ$]ÚuFM9qFE1h[^_]@t`X Eua M̍LM9Bu7fE 9_19Wr fuu11ɉ ruu؋JM]΃vEtfEtu|}}̉}و]vtft}kKu̍\]r!󥍳u 9)jE $]-EEĉ$]fH MEM1f]uutSXރ u]uE1f]] t]uӃ̋M؋}OM܉OGJOr u1ɋ}tރ uE1ۉU‹Et-EtMtkE uЋU}O M 9t"vtZ붻u}̉~ utftuN yu M}OElu}̉~utft֤ӻ]9(bM΃EMu}̉~utftEEEủp1MrEtfEt}}̃Eju]]]Lu'u MmfmKM뿋Eĉ$]YUSE$[]USԷED$E $)[]UWVS _E}} 'v?NBCDt]T1 [^_]ÁB u$<όƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]]OWF4N:V;m]豹4$ГP]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]4NPGV0N8F9/r<11͸11UWVS:D$E$2YƍxD$4$ʼn}и9ED$D$t$D$ D$|$$Tt4$YttFD$ HD$ E D$|$$t Ĝ[^_]É|$t$%1߉4$5YQ1ȉ4$Y1UE@ ]UWVS UEEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]讶Ӌ]虶UWVS$qöuF$ED$ F(D$ED$E $N~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z D$D$$e9ԋD$ D$D$}$f1P-D>DBu.L$$9ċ[$,D$HD$$蠓:UWVSMEĉED$ED$E $>]&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,+\D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[ẺEEfEEEfEEEfEEEfEEE`t2 u&FlUg\U x;uED$|$ ,D$LD$E$ˑE`t jED$$;E`FED$ D$D$y$cD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,bWu Wz?uED$ T$t$E$E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$?D$ D$D$<$f D$?D$ D$D$$UeU D$?D$ D$D$4$e D$?D$ D$D$$UveUP D$?D$ D$D$4$>eKś$}D$dD$E$ Ĉ[^_]ËED$ D$D$$9]ED$ D$D$$]ED$ D$D$$\ED$ D$D$$\ED$ D$D$$\dED$ D$D$$g\ED$ D$D$$=\@ED$ D$D$$\ED$$ IUWVS$ QuE }$7U1D$L$ t$U‰T$$xVD$t# $U+u#$[^_]$.1%0UED$ D$E D$E$]UWVS!f}ED$|$ ED$ED$E $x8Ɖ<$GuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$E$7E1D$|$ D$E D$E$&…tD$<$qE+u Ё$[^_].UWVS O}u Gu 4 Gt*D$4$}uUt E[^_]ËEtE[^_]UWVSޓut\~M u ( ~t9uUt E[^_]Í L$?D$ D$D$<$`EtËE[^_]UWVSHu} [Vu + Vt!9>uMt Ev[^_]Í|$?D$ D$D$4$`EtËE[^_]UVSkðuF[]l Bt ;2u[^]Ét$?D$ D$D$ $_v [^]Ét$D$ D$D$ 4$L_[^]UWVSU} tdUZ~U ~t;u[^_]Í T$?D$ D$D$<$^[^_]ÍlUVS,quZ Bt ;2u[^]Ét$?D$ D$D$ $N^v [^]Ét$D$ D$D$ 4$ ^[^]UWVSuúuPYw$ wWvK B, v|@vFI[^_]Ávf[^_]Á Bw[^_]Á v,0낃@t9u~jtuc OD95.#*q C<1t$TD$ D$(D$<$S\^ UWVS}Ž}XWYD$t$<$Wx [^_]É|$[D$ D$(D$4$[[^_]UWVS N}V\ rt;:u[^_]Í |$?D$ D$D$4$*[[^_]UWVSL֍$7E1E <tmD$\D$ D$.D$M‰ $MZMt#PT$UL$<$RU0E+u4L[^_]D$ .M‰L$ME D$$sM'UWVS4 EEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMBP-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVSA~EM HMHMHMXˁHɁ@ =+-EBAE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$#EE4$ #EE $"EUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$LD$u 4$RE$#eEt $eEt $eE Ĉ[^_]ú)‰UȩEESEW), u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍE}\$DD$@D$t?1ɀ:.u9u*u|.t A[^_]Éȃ[^_]1[^_]UWVS0KME荰EEEE$RhPlPHH8|$ x|$x|$@ D$L$T$ cD$D$4$s~ Eƀ0[^_]UWVSaæu Gt-D$4$nu?E tE [^_]Ë?D$D$4$Ã{]Uϋu U MUL$T$ L$U‰T$$EU ;tMUuE@@P]]]])ˋ}([^_]ËUt M t.t?Myt6:u1|.t'PM9r$H.ȋʋ]]돍눋]B~EE}8wUWVSMzƉЋ};stʉË9s/u!uuÉ)1[^_]äftuuXf}UWVS(cèyE׉΋UU؋UԋU$EM9L9MyE荃PEEuuE9D$E$=t4$MEx4$Myu|EԉEu؉0([^_]Ë}E$E}9}uAP9s:)؃UvM {9Cs1[^_]É4$EIx+[^_]ÉM]{EEMUWVS+híwEuE(},M }0t$7xU1҉M$tt$$Cƀ?vE4$t^򋅤t)t"<.g]<0M|0.70J1U4T$L$E$?ƅ)‰U4E$kE$T$D$kvD$ D$dD$$C‹ $a{t$ $ K}Mt}w}l-M$U$BAD$T$L$D$ D$dD$<$DB‹$9-5|P-f @)ȉ~ DžƋD$D$<$W9u׋)$$|}|$ $1ɺ0-kf; F01x JDNu.9uҋ‹)‹ $9Vt)ЋxU+.Ġ+[^_]Á}o}$M$U$e}`E4$qjx.D$$1ɺDž@f; @E4$j벍D$D$$U &yt)}$<$WD$D$ D$dD$<$>‹4$t$D$E|$D$$U O<$Ig|$L$$D$t$ D$dD$$=‹ $ GGD$t$ D$dD$$I=‹ $G$D$t$ D$dD$4$<‹$E_wG)9D$|$ D$dD$$l< $y}$C4$ fN~F$$T$|$L$D$uD$ D$dD$$;‹ $$n9%4$N $D$$|$ D$dD$$;‹ $o4$$GD$|$ D$dD$<$:‹ $ $4$kD$D$ D$dD$<$V:‹4$t$D$$U >)D$ *@t$L$$ /&I1E)0~0 $09t4$#d‹$y}$!<$WIL$T$D$YD$ D$dD$4$8‹$.E$HD$ *@t$L$<$-B$$$#I1E)0~0 $w09"4$b‹$@yY$ƅ-lj$I}u9e$>7M$)<$WD$t$ D$dD$<$6‹$4D$t$ D$dD$$w6‹ $GD$t$ D$dD$4$)6‹$}9)9D$|$ D$dD$$5 $yI9u$VƉ9?$wy}+}$=|$D$$U 6<$I|$L$$U <$)ƒ|э}$ }4|$ t$D$$4$^Ɖ)lj}4GD$LD$ D$dD$4$3‹$G9!Dž1pSƀu1$TnDž |$D$ D$dD$$2‹ $QP9 ~F$B= $I^|$t$$U %<$I4$L~$D$$D$ D$dD$$1‹ $m<$ݽ~$KD$T$ D$dD$$0‹ $<$efF $SF $ED$|$D$BD$ D$dD$<$!0‹$u}$<$G$購D$t$ED$ D$2D$@4$/‹$4$flj4$I$}lj$,F$"_lj<$|$D$$U kE<$G$QT$D$t$D$ D$(D$4$-‹$7U$r VUUU)ʉЃ=J$n}$S4$F$$QD$t$|$BD$ D$2D$@4$,‹<$"<|$D$D$D$$U )1L@9/t؉4$D$D$ D$dD$$+‹ $y6$~@t$D$E$$%4$.V‹$C}$.t&#E4D$ t$D$$4$UE$ VUUU)ȃ=Y $  E$ D$BAD$D$D$ D$dD$<$C*$|$t$$U p<$I9SF$葶t 4$肶4$wD$?D$4$]4$STD$D$$U n94@F9Gt1Gt`$D$D$ D$dD$$y(‹ $uPED$eWD$ D$dD$<$ (}$@<w}$iD$t$ D$dD$$'‹ $ GGD$t$ D$dD$$H'‹ $GD$t$ D$dD$4$&‹$NhGG<A}4|$ t$D$$螔4$bQƉ)lj}49a)=$w}$E4D$ t$D$$4$P@t$$K}$<$fWD$D$ D$dD$4$Q%‹<$<a}$@}t9$ȩ"<}3$I xl1YG GGDž====Dž$1lj9@w>9Gt1Gt`$D$D$ D$dD$$"‹ $-GuP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$ Dž====fDž==e)3|$D$ D$dD$<$‹$9SD)9D$|$ D$dD$$^ $yD$ @t$L$<$T o I1E)0~0 $+094$fI‹$yD$ @t$E$D$$=q .I1E)0~0 $E_094$H‹$y'D$D$ D$dD$4$d‹$?9@Dž@DžDDžHDžL@)‰t(19rU4T$ D$t$$}4$;G)ʉU4@9<$I^x|$t$$4,4$|ljF$|$ɚD$ D$dD$<$$Nj$rD$ $1ɺ%c$ "<<$茧Nj$M4L$T$<$d‰)M4|$ $1ɺI<$ F`$谦NjB $M4L$T$<$‰)M4|$ $1ɺm<$!j$ԥNjB$"Ɖ)lj}4S$}$qjD$ @t$L$$RI1E)0~0 $-094$h=‹$y|79S$}+D$}D$L$D$ D$d1ɉL$<$‹$"7$5 UWVS8}.DE  U8uqjE}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UO}CM8E#lp]UWVS}cCu})R|EtG9E r'Gf|t+E D$<$膚yF([^_]9} r+E[^_]UWVS|BEEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]BF(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$xUWVS{AEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$] 7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,bCM]C]C(UWVS ty?Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]蚣;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cAN]mA]]A(ffUWVS-wv=EM} QyYm M0ȈE<ƒ?ك}Cu썶1ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u;Eu[^_]} Oσ7M)11}U+u\[^_]ø'UWVSJp6EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EEu}: w( ]u#M EÉ$SrE}~=Ut3}P-L-w\DAtu܋E })[^_]ÍM U$WE6M E$DxgEEM E$HEx>EM EÉ$MM|xEM?fffffUWVSAnÆ4u4$,H9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} _7(qUWVS,mq3E $7E1D$|$E$xFD$T$$zxT$<$U+u [^_]XfffffffUVSrl÷2EuUMx#L$ T$t$$y!x9s[^]ÉL$T$$+[^]fffffffUWVS lF2utcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f5UWVS okô1utcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$" 5UWVS j$1u t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!4UVS WjÜ0uD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVSi40u} tAv-u3D$4$$tD$4$`%F1[^_]3USi/EU tttu P1[]f3UWVS9i~/}u t' t:@trt0 wvONuI3[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVSuhú.}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tD$t$|4$bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$t'݄$4ݜ$D$P-otj݄$D$t 31ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$t~("݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$Mt$ $D$|$$$\$t ݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$tD$`$D$h${D$8$oD$T$c\$P0D$tـ܌$T$`ݜ$D$d\$tK"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$LـOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$t'C$D$\$t2D$4$h$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$tD$`$D$h$D$8$D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USD EM t.9t*D$ 3D$D$pN$=[]USADÆ M E%t.9t*D$ 3D$D$pN$[]UEt t]ËE ]1} ]USC UE ~;u;t5D$ 3D$D$pN$<[]ǂ[]Ãwǂ[]USC` EU tt 1[] UWVSB $ ~Etc@@ D$D$4$ u E[^_] 84$r 8EE[^_]UWVS>BÃuF~O9tHNM 1[^_]ÉU ED$|$E$U uFUF맸UWVSA}t;t-M tWt1$;wr$<$[^_]UWVSZAßEPt7E1U9}t#E4E D$4$u߉[^_]1[^_]UWVS@>E@EEE19ut|E}1th|$ D$t$E D$L$T$ ND$D$4$PD$t$$NBAljUED$ D$E D$E$4UWVS8??ÄEu}$7E1>'T$ t$D$E D$D$|$ ND$D$$Yu(u~E+8[^_].|$D$ D$D$4$D$t$$輧t 4H󥋅D$ swD$D$$:BAǃ$c…1A<+w,5uىD9u˃u뷃z럃b뇃Jl蔝UED$ D$E D$E$R]US<UM˃w5BtJ[]ËE E @%]3 ؉BtBt븋E E @BtBtUVS8;*EtyE5EEEEEUT$u܉t$U؉T$ D$E D$E$T=tD$ E؉D$t$E$؃8[^]Í5UE@%-@~1҉D$$$]؉=?w1҉D$$$]Ã1D$$$]ú1UWVSut%ӃKE tx9uu 1ۉ[^_]CfffffUWVS$:}EU܉Mtȃ"uFEML$$]8u]-K+EE0YEE E 1009]~Dx99Mع_SЀ vȍSW9]]؅t U܅t}܋u7$[^_]ExEFuu1UGM9\]-"LSc7؋M܅u}bxEE܅t}818A V1ҍ=tftH<@ lj)99_ ΃r뀃< t< t򍃰D$4$1Ҁ8 Ht$$t9$7%$< tW< tS< 9szwD$ $&H< u땸1$@ z)׃ (D$$4tljKD004$n@9]‹tft‰)‰ DžNtftR :)944$@9o‹fBf 0mDž1 P$uTfF()׃ (D$$Tlj$df\UWVS`'EEE$7U1ҋ@E D$ .u‰t$L$E$(}EE4$ML$ML$D$ t$ED$ $06t\E$$E@ U+u_`[^_]ÉM $5MB΍EfMUEFƋE$u4UWVS([&àE8@E苳 }teUE<$ML$ML$D$ |$UT$4$55t,E$)E@ ([^_]Í뙋MUE{ƋE$t([^_]Í $Z4t DUWVSxugx ua@@ HtHӋ}‰t"ƃ))u)9|[^_]UWVS\$/EuE $7NjE1Pt/1Dž9E3wG D$.$ P-8tGt3W\_u<.uuy.u}fD$:$蒮'tOfu:t .\uـx.H}OAuVGq ExA9t$D$$!q@0@Ɖ $@)9P‰ȉ@ M:E<$#t$D$|$LD$D$ 0D$LD$$jU+,\[^_]Dž9E%1D$ D$D$$V%sfcui=x.Af~D$:$\Z1flUWVS\ K׉E UEE$7E1} t>M1U+ \[^_]$(  9ƉyfQffQ 9>f4ED$D$ T$t$ $;@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$:Dž@ u4$Ѕ{8L8 9v<$9=fG$!=Nj$=Ћ9f}}$} - t$$}D$t$ L$D$$u9Džz@  99uQd 04$j=$CGvT'tO<$ONjE$N$+P|$t$D$ D$KD$$%1t9s;)d}dDž1 019tl!9hu狍Ƌf4JutJ9}A9p@ &‰))9V׋{z$螽<))9zrtft1iX@t$$9P Y}u,04$tx9_9v8Љ΃tft4$#=Љ>9}D$|$ L$D$$n4…s@ 89F9EP04$G=+Ɖ<$-P)9| Yt$ D$ 6D$$%,4$p)9g[T$T$<$Q8f~<$Ѕ)"Dž$轹1΋_9S GƋȉfpfJ2r 9t H0f9ًF9랉t$ FD$|$ L$D$$1…@ 9<$P9_SD$|$4$]1@ yyy G7)ʉ (D$ $v‰pX<$2\D$|$4$>0111fR9s<0t4$`01*s)׃ (D$$!ljUWVS$Z}EM@Bt $[^_]øEB $|E=ƅD$ED$ED$ D$ED$4$…xkG D$GD$GD$ D$t$E$ME2EE$z4$Et;$[^_]øE9E$B4$G tE$G UWVS@}E$7֋UHJ @BPƋ>}ۉ\$D$ D$)D$4$W~HƋ9sED$ ED$ED$E $Elj4$[^_]ËED$ ED$ED$E $EDžt뼋E1UWVS ,t@ËED$ ED$ED$E$ًU E|Ɖ$9[^_]ËE1[^_]UVS0? ÄEu t2/10[^]Ã} u{MMUUUUuD$E D$ED$LD$ND$ 0D$ D$E$SuE0[^]Ã} t`M9tPMZQOQt)ЋU9t|~&učDUM؉E 9uuM؋EEAEAEA EM.u&UȍrUU9rM؋UMn1et$<6 $M豊tM:fuM܅tRM؀9t‹uȍFU9rUffMEEEx:uPU؃:IUąmE؉EEȉEuȍEE_E91ffUWVS8F։M$7M1HL$HL$HL$D$ \D$D$M $MU9ЋMs!T$L$4$ƯU+u8[^_]16_UWVSZßEu uu|}}$7uU1҃t+tO//1uU+Č[^_]Ë}E+M|EČ[^_]M11rEEM Tu11MUut&tt}t~U9wuڋUuu}t 9|uU}E1E‰xEEB:u}tA}u}XǾL9}}t}u>Pu9:x)‹u9$t$D$|<$-"uE1E‰xEEE)ЉNjMD$ ?VD$|$$Ua9UЃ7}Mt9 U9}P}9sm:u}yEttq}b}UM)ыE UOtU$谹UPu9rH1u:}뚉}f[UWVS.`6qD$E$[E@(t}}tlpdh9Ɖ|X1lp9cE@Lؙdh!l!D$ L$t$E@$t!Ѓ\E@@}G0tO@9t$uE@0Ef` ߋdl)‰lt1E$E@l9})ЉGD$E$茑1TE$艉E@ 6D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UucEEPd$݋dE@fu`xT$$\E UEUԉdh`}wPTlp6E)}+GlpE@0LP}OtșX\GM8E8y}u]9s@zM 9hPEM8HuUЋM؅tJEԉ9rAE9EEt(9%BEԉE:BEuEЉUԉ9sM)M6uD$E$lEE}D$<$l|uu܋}}ԉu}U؋M܉A8uMFEM8M88MuEuuȉMBEBE؉M܋uEB]ωE$EE E ]E4[^_]ËM؅t$E9r9M1EUE<}܍DUԉD$E$ UVMUωuszEudEuH}8}EEE)9EM7E#E\E\Zuऋ}8}ErufuEtfUыuuZE8EtS8MuTu8MCE9EM܃9uu8ME}}ǃs)EtfEtEUuuauGM뽋MufumuumfmmffffffUVS"guF0t$ UT$T$$*tM F0[^]ËE F @u1Է8Tuʷ1fffffffU EE D$E$U]øU Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]U Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]UUM ttt1]ø]ËBM U]BM U@]UUM ttt1]ø]ËBM U]BM U@]U Ut)t?t1E EBML$$P]ËBML$$t͋EM ]U Ut*t@t1E EBML$$P]ËBML$$t̋EM ]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1U Ut2tOt1]ËE 1EBML$$P]ËBML$$t1UM ]U Ut-tCt1t&E EBML$$P]ËBML$$tɋEM ]UWVS GDŽ]M Eƃt )֋t4utSD$L$$R totNCu|6U ]@ .SD$L$$Rt?tCu U ]@ [^_] [^_]1 [^_]1 [^_]UWVSqöuE 8t8tZt 1[^_]ËEEFUT$4$PtڋMFUT$4$tUE9Us!ut<$0E 됃tQtڅuET$|$4$o>bZ}N<$؊E 8tuT$U$MNjE 8Ut E덍p6D$3$UE D$ D$D$E$]UWVSu} EE]EE|$4$ot2Cu Ct9 uUU u[^_]Eu1[^_]UWVSޫuEE 8t uto<$ΣEED$4$BtU9UrtOt,t1ET$|$4$>t>[^_]É<$NE [^_]ÉЃtt,E뭅u}u<$E 1룉UD$$茄NjE 8Ut E뱍d6D$3$1ZU D$(#E D$E$]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]G=UVSuED$t$ ED$E D$E$~>.t[^][^]USȨED$ED$ ED$E D$E$[]UVSCÈuE D$E$tE)[^]UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]USkðE D$E$[]USAÆE D$E$[]US[E$r[]US8E$@[]/7UE Mx6]UEf]UE]UEfU f]UEȋU ]fffUWVS(aƖu}E EEGE؋U 7uуEU܉UD$ED$4$]IUӉ׋U܃UED$]䍃lD$4$ U9GE؅b9M E9B+E E}뷸!E!ME䍀>EU؍GEܻ)˸!ȉD$UT$4$]NƋ}܋U!EU܍GEǻ)˸!D$]䍃hD$4$}U C]艥E9E E P.UWVSDDÉuE EEE PFE>"E E1ɍ7EM[<U|$M $eUt~UM)ȍ<FD$ $eUUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$dUEE})C~x9FP-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEEwUD$ED$ED$ ED$E D$E$]UWVS4E܋EEpu؋EkE@u8uEU1Ã}@9؍sL^uʋE EEEEȋ} EEEċEOuE;EU}ԋ M]È}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuẼ;E]U}ԈU]GUEFFEE]{+E fEp}1EpBfUWVS$+E$7E1D$D$|$ ED$E D$E$t>ED$D$<$tE+uЁ$[^_]ú.UWVS$EzE MU$7E1D$ D$|$E$t-T$L$ ED$D$<$U+u $[^_]Éb-US]E M9r 9s9su[][]UWVSUEU} E9slUP0ك@t$tNt<]"([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSԑuE t*X?w#9r6 )ЍXt9Aхu)[^_]É[[^_]ÉD()[^_]UWVSXEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]HuU270:ۅt9u1[^_]Ë]z[^_]Ë]_(1[^_]UWVS (mu}E9E |2&6D$D$$HumtF;Gt1 [^_]ø [^_]UWVSU2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]ÉW(뗉C4?UWVSTEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Éْ[^_]ɒ(F[^_]øUSҎE D$E$c[]UVSbçuD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS$uE܉U؅t A"}܉MGEML$$]腃u]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0$[^_]ErEJ0A;Dž|Em2mDž|EnnlwVwgED$ ED$t$$ڋpp_l)Љ$I)ЃJEED$ ED$t$$1ɉڋpD$E 9D$ ED$D$ Uډ$UTE]9M 9Pu1D$E$Dfe\$ED$ ED$D$ Eډ$ T-UWVShǥdeh0E] ]ED$ ED$\$E $MUEy9tEh0E+E [^_]Éh"1[^_]Uם d@-D$ED$ED$ ED$E D$E$7]UWVS蓝c@,<$D@-D$ED$ED$ E D$ED$ 7$Ɖ<$[^_]UWVS"gc@,<$cDED$ED$ED$ E D$ED$ 7$hƉ<$![^_]fUWVSbuU΋}JЀ wK1ZЀ w( 0ҍ J9~]}fT1[^_]9| u[^_]Ë]TfUWVS-tX+tL1u$1ɉN…M)::t#tЃ[^_]Ã1믃륍B$;1ɉ…t4M)::uB$<1ɉ…tE1҉Ѓ[^_]USJMt50 wsS$m1ttX8/t}C []S $ At%8.u S$!t8.t:1[]S$mzS[]cS$1QUWVS膚ƻ`uÉ։M uXi)\P=(\_NQDDD);QEN My *)R)ǃQ))|gfff)DQ)))Љ$I)))GF)4V}Ou} }싌9)Ӎ\9K@9|)}] [U썒9Ӎ | )Ѓ9uF}[^_]øQ))ƒt1EUV)F}[^_]ËFPLLD)F}[^_]ÃF)XENYDDD)sB9At DËA+BuA +B uA+Bu A+Bu+UWVSVǓ]|$@ƉD$T$`L$D} L$t@^~ VT$8VT$(V T$$v$t$$D$XD$\}t34 )Ɖt$XT$\))L$t\$0\$4L$X\$\ ʁыT$\))șL$ T$$L$X\$\)iiƸD$P%D$TD$PT$TyD$PT$Td$PD$ yމ\$0t$4\$Xt$\y<\$Xt$\D$x|$P|$TL$X\$\ʁ??ыT$\)уș׉L$0T$4D$XT$\)iʫiЪD$XӋD$XÉȃD$H%D$LD$HT$LyD$HT$Lt$H|$LD$XD$0yt$P|$T߅y D$|L$(*D$8D$8)‰T$XЙӋT$XRT$8)‰ЉT$0y D$0T$0$19>kL$X\$\1ҹ1)ӉL$H\$LD$@l9D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@l9)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@9D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$[S\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$81ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$)QT\$ Q\$UWVS M}썙]| uu [^_]Ë}|:dNu쉼puMTډ ?-00tċu! [^_]UWVStWÜL\$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$XMD$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XD$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$Xl9D$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉pE܋؉ }<$11ƅE؍:F(EỦ9sUWVSPv8=\$|ljD$xT$pL$P$7D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|9D$xD$P{D$D$x$\$|L-[\$|,;8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|^(ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|Xf1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVSh.\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$dl9D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$d#tlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$dl9D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$dl9$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVS1]n#}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$] =v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE(O9tUD$4$]Uu_ɉ1DžuUWVS["NjX U$=EU~|$l $! 5}#  :tpdž _y>u EX [^_]ÅxE P$RrÉ 2:tpdž 1뒋WZytىugb1ɍBA:dN}D$|$l $LUVS ZN L4$J uƃ 4$2[^]UWVSY EuM V~6hFhF1P9u dN9ut [^_]Ë]#1[^_]UWVS`YǝUM Z~/dFdFP9u09ut[^_]É!#[^_]UVSX5L4$1=$4$[^]UVSXL4$14$[^]USwXü=$[]qUWVS[XƐ$Rt6ÉǹUu [^_]ÉE$F"U1USW2E$[]UED$ D$E D$E$1]UWVSWL<$=$,, D$ D$ED$ $Ɖ<$[^_]UWVS-WrL<$nX u=$E D$ D$ED$ $ZƉ<$#[^_]USVE $11ҋE3t :P([]US|V[, $11ҋEt :P([]UVS]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS Ru} LD$$X t[ t$RXPL$ ;p H}yD$$ [^_]ËL$RlP)Ӎ=$\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVSPLD$ $X t< tOUM T$L$$Ɖ׋D$ $[^_]Í=$C uu} UWVSPSUE L-9t%\_ptwf9t)[^_]1[^_]USOp u#$l tЋE$UWVSrO÷e=t:F$V FtD$$4$juƃ[^_]UWVS OP}ƃp $tCƉxtD$<$E FEF e1[^_]ÃUWVS]t1U׋u ։t$E$Ut!~uu u1[^_]É뻉[^_]UWVS 8N}EU΍ <$衿t?$tYMHMHp  <$h1 [^_]Í 1 #txu8u막<$,UMU E]HUWVSM} E$  1ɍ E0EMt" Ct\9S t~ߋuMM E$脾 uMtω?$u[^_]Åt+ { uSUMCЋUM 9uY uE9rHE9sAZtҋ UMCK $ЋMU 9tE]U11ҋE]UWVSLZ}E0E,U$7E1M (hEED$E$D$h8$ĽhE (E ǁPǁTǁXDžD8H@LT$ ,D$0D$8$!8U+u*[^_]Í71rT蚫UJ UT$UT$ @-D$E D$E$o]UJUT$UT$ @-D$E D$E$1]UED$ED$ ED$E D$E$]UWVSJYD$,FX$F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$USIE,Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US 7I|E D$ED$,X$l []USIEED$ E D$ED$,X$l[]UWVSH} w}vE tE eFE EEu 1[^_]D$E$E@ E@U~1M19sIE}EtfEtME)‰UE$ U E@뮉Ћ}tftE)PD$$E[^_]ËUu G)t[7wWU<$Ut݋E)1u EEPCP@@D$$#E[^_]ËE\TEfH @urMuMu4 UD$E$EU)1u MfBfmyMyHMXUS wFü ED$E D$E$i []USFFË ED$ ED$E D$E$i[]UWVS FQ ED$E $%ƅD$ED$E$Ұ=ifFf~ v F$m F,!F(!F Eu [^_]D$ D$D$4$[^_]É$2NfF 1[^_]UWVSE[ }D$<$w fD$<$[^_]ffffUWVSD u 4$9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfϤUS DU E9ErD$E D$E$ݪ []蔤f!̀rS[ C[UWVSC u F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$u:N})9F4$ru뤉4$]t  UWVSB& Ӊʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVS AUM9 ?p9s΃ttUUn ED$t$E$oMJ U)UD$D$$E}E01 [^_]ÉUE ED$t$E$M uUEU JHJHJ H JHJHJHRPVU 0U$y 0`UWVSLJ@ÏljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw0,:1ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%0;L$1L$ 9<΃t$  9D$uʋt$L$9t4$71e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$L$L$'~D$|$UUU>D$;D$(` D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(\D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUL D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUU D$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*C PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$cD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUUs D$;D$(D$9D$D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(FD$9D$QD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$f|$UUU D$;D$(L$(T$$D$@D$L|$UUUDD$;D$(hD$9D$sD$D$$L$ D$ AD$oD$D$c|$UUUJ D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU D$;D$(`D$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$L$|$UUU D$;D$(rL$(T$$D$wD$9D$sD$D$$L$D$ AD$rL$@D$D$D$D$3D$OL$(T$$D$L$(T$$D$rL$(T$$D$SL$(T$$D$4fL$(T$$D$.sL$(T$$D$TL$(T$$D$5UUU< ;|$(rL$(T$$ 9|$s|$D$$D$ t$4D$|$UUU D$;D$(rL$(T$$D$@D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$GD$ |$UUUD$;D$(CD$9D$sD$D$$L$D$ AD$D$ |$UUUvD$;D$(RL$(T$$D$!8L$(T$$D$`L$(T$$D$A994$+L$(T$$D$ L$(T$$D$~D$ v|$UUUD$;D$(rL$(T$$D$JD$9D$sD$D$$L$ D$ AD$D$_|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$QD$|$UUUD$;D$(lD$9D$sD$D$$L$D$ AD$D$Y|$UUU!D$;D$(rL$(T$$D$/u<$vt$1UL$(T$$D$X_|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$>|$UUUSD$;D$(L$(T$$D$zD$|$UUUD$;D$(rL$(T$$D$8D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$0L$D$$9 $L$D$$9$dL$D$$9$GL$D$$9$*D$@tb|$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$~D$ |$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$fL$D$$9$L$D$$9$L$D$$9z$mL$D$$9]$PVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$5L$(T$$D$ztL$(T$$D$UL$(T$$D$6L$D$$9&$L$D$$9 $jL$D$$9$ML$D$$9$0L$D$$9$UUUwF;t$(rL$(T$$9t$st$D$$D$ t$L$D$$9G$:$f|$1늋L$D$$9$x L$D$$9$[L$D$$9$>L$D$$9$!L$D$$9$4$L$D$$9y$lL$D$$9\$OL$D$$9?$2L$D$$9"$L$D$$9$fL$D$$9$IL$D$$9$,L$D$$9$L$D$$9$L$D$$9t$gL$D$$9W$J|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$=L$D$$9$ L$D$$9$L$D$$9$xL$D$$9h$[L$D$$9K$>L$D$$9.$!UWVSX3)|$]$U T$D}|$4UT$L$7D$0Nj$TC0u ǀƄ$D$D$$^D$,$C Sf DŽ$D$LD$$$$$DŽ$DŽ$\$4$D$PDŽ$$D$HD$(D$tDŽ$$D$@$D$<$8e$%$)tc$1$$ C$$$${$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZwF$<1ۍFЍPwFЃ v$ H$FZv$J$Ƅ$$$DŽ$1$$D$xDŽ$D$pD$XD$\D$c$t$$$9}ڋ$T$TI0$$L$du$$)tE$$A$$$9$$tJƄ$0$D$<B$$$ $|$dK$D$x)Dž^$$$T$xPӉ$$$$$t$$)ƅD$T$DŽ$$$$8$b:t$PtD$P$$$$@ @ft DŽ$t$09t$$S\$0$T+G$e[^_]Ë$<$$mDEG f /$fx$$DŽ$DŽ$ D$$$$躔D$$8$膕$ǁPǁTǁXy 1AAtft$A f$f$Af$A$A,$AD$$T$$DŽ$DŽ$DŽ$D$LD$ D$4D$D$DD$$$ $P:$@%$fH @>;$)@uDŽ$$$m$$D$$$$jDŽ$DŽ$$t"$D$c$2.D$d$$Z$$/R,ۼ$D$c$T$$T$$T$ \$d\$D$$$$KDž=$)D$HD$Pt$$<$$D$P=<$"~$$$tƄ$-$D$\=$$߃G|$c-$\$\\$xD$xt$d Ɖ$$L$t)T$\}.|$x$)\$P$DŽ$D$pD$XD$c<$8$FD$c$D$d$al0X$=D$cP$$=$$$y$$)u9 I,ۼ$$D$$D$$D$$D$T$ <$$FDžx;$)D$H$yD$HD$d$uƄ$D$Pt$$<$$D$P3;<$${$$$D$c$,D$d$$$N$ '7v4\$$ $$$$$1۹ $ $$G.$t _5$DŽ$$X$D$xDŽ$D$pD$XD$\D$cDŽ$&$@.'ʃ⿀ $y$f$S$) $.$$$$$Q$$T$l= 3$ [L$DL$ T$D$$4$$o=D$x$y DŽ$$$Ƅ$1$$$$$K$ `'4[R$$$ Ƅ$1ۋ$DŽ$$$}$ $DŽ$DŽ$$$$y$$`32$[$$$$$DŽ$D$x${$$$$$$D$xD$Pt$$$0$@$$!$J4$p.$$$$‰D$Pw4$$$Tl= L$DL$$TD$ $D$$D$$蘿9L$PD$x$$i$$$Ƅ$ y$it$D4$$@$4$@D$t$8$Ѓ01 4 4Jу0 vꋔ$$$)$K0[$$$ۉ$$Ƅ$+mW7*A9FЉ1҃  4PwFЃ v뉔$3$$ $$$$K$ 5"0[R$$$$$$$S$ "0 [$8x$i$$$O-1҉$$$ƁƄ$x% À߉$$=DŽ$Ƅ$$g $$$$XT$tT$$T$ $T$\$$${$$)lj|$xdĥ$$$9}$$$D$pD$XD$\D$cT$ $$$$D$x$-$+$@$D$x$$$$s$ |$D$$4$$0$)$9~$Ƅ$$D$x1$$=$$$$ʃT$x 4ʍRR$$$$$ DŽ$$w$$$$$$=T$LBJ$$$҉D$LaDŽ$$D$x$Ƅ$D$tu|$c$ D$PL$HȉD$xƋ$)ƋD$\9~ƅ~@$$q$$$$y1t$\)ƅ6L$\$$D$t$ $D$,$$$0@$$$$t$x$)Ƌ$9~ƅ~@$$q$$$$y1$)ƅ*$/$x$$$$Jƒ~I$G$B$vDž11ۋ$$$$8p$$w$XDŽ$$b$$$'$$)ƅ$@,$x$$|$d$Jƒ~E$G$B$vDžuZ11ۋ$$$$p$$t$D$dD$$$$詛DŽ$DŽ$jd$ $x$$$$Jƒ~E$F$B$vDžuZ11ۋ$$$$x$$$$D$$$$蓚DŽ$DŽ$gN$D$$$$ODŽ$DŽ$ yDŽ$1ۋ$$DŽ$1ۋ$$$$$8p$$:t?$D$$$$脙DŽ$DŽ$DD$T$$y$P$$p$$D$,$$$0@C$$$F|$HGF D$$ 11$$\$H)ޅ1$ \$(ZÉ$$gB$$D$$$$ DŽ$DŽ$$|%$$D$8$$Jƒ~E$G$B$vDžub11ۋ$$$$8p$$$$D$8D$$$$DŽ$DŽ$b$D$$$$ĖDŽ$DŽ$$$$$$$$Jƒv$G$B$vÅu11ۋ$뵋$D$$$$DŽ$DŽ$t?DŽ$1ۋ$$$D$$$$芕DŽ$DŽ$SE$D$$$$FDŽ$DŽ$7$$1۹ $ $$‰%D$p$DŽ$DŽ$$XD$tD$T$ D$pD$\$$$$$$$$X$x$$B$$$u$$ $tB$D$,B$$$$$$D$PL$HȉD$xi$Y$$0@C$$~ yt?$D$$$$/DŽ$DŽ$$$D$H$$yPm$ݔ$D$c$T$$T$$T$T$dT$ D$$$k1ǁ$'DŽ$$|$\ t$d9})t$d|$xD$xD$d|$x\8\$x$D$$D$c$ǁ|$p$$! j$X^$3$$$$ $u$$$3D$P8N$`R$G$$$|$d$DŽ$D$xDŽ$D$pD$XD$\b< DŽ$$$$$D$$$$kDŽ$DŽ$&$"$x$$$$ك~D:B$Y$uDžuUDŽ$11$$$r$$$D$$$$hDŽ$DŽ$l#$$$0 u䉴$$$t&0t!F0$$C$$$c$R$$$Ƅ$$11DŽ$DŽ$ @  !$[$$$ q$ $$y$Ƅ$-$$$$$1۹ $ $@$ h  $R$$g $DŽ$DŽ$$t$X|$p{l$pL$@@$$$L$t |$x)9~υ~2x$$$L$t y1)@ʋt$XVL$pV$$D$x9$x$$$x$$$$$у~D8@$Q$vDžu[DŽ$11ۋ$$8p$$$SL$t $D$$$$DŽ$DŽ$fu;DŽ$1ۋ$.u{DŽ$D$t$U$$D$$$$葊DŽ$DŽ$$tIl$tl$X{$$D$$$$4DŽ$DŽ$D$t1ۋ$$DŽ$$L$t ~$$$Z$$$Ƅ$-$=$D$c$%D$p$$F$$$$$$ DŽ$$X$D$tD$d|$\'L$x\$|$$ $$$ʁы$)уș׉L$xT$|$$)ii̍$ȿƉ׋$ljD$h%D$lD$hT$lyD$hT$lT$hD$x1L$x\$|$W0G$$D$pD$d<9 $$9r$PD$cCD$dxtD$d\$xt$|$$DŽ$G$|$\$$$$$袸$1it?$D$$$$蹆DŽ$DŽ$y$$D$(É$$DŽ$$DŽ$1ۋ$$ADŽ$1ۋ$$>$$D$$$$DŽ$DŽ$1ۋ$L$t $ZDŽ$1ۋ$$m$$x$$$$JƒE$G$B$vÅu11ۋ$뵋$D$$$$ׄDŽ$DŽ$tD$x$$r$t$D$$$$sDŽ$DŽ$.|$ct&RD$c$D$\)-ODŽ$1ۋ$$#$R$$DŽ$DŽ$"$[$$$ $D$$$$UDŽ$DŽ$$1ۋ$$vDŽ$1ۋ$$.$$$8p$$$L$x$DŽ$ DŽ$[$| O$$$$@R$$$R$$$?$ ݔ$$D$$D$$D$$D$ T$$$$[1҉$$$$Z$$2+$ $$3$@3$ +$[$$[1҉$$$$ @* .$[$$$$$D$dD$c$+L$\$ /$Z$4)0ȉуcڋ$C0O$9$\)ډщ$$Nj$$X)Ћ$8D$(t$dD$( L$x$ D$xL$x$y DŽ$\$P$L$d$DŽ$D$pD$XD$\7_DŽ$$$7D$LD$L$`s.$Ƅ$1D$L( D$L,\$t,11L$\ 9 )Su߃݋$6$D$d$؃$$$1۹ ($D$$$$b}DŽ$DŽ$$D$$$$}DŽ$DŽ$$D$$$$|DŽ$DŽ$!D$HD$d|$c%D$HD$dD$cދ$$|$x$Jƒ^$G$B$vÅ11ۋ$뱍J$x$p$D$$$$>zDŽ$DŽ$^ $$$$aG $[ $$$$ . $[$ $ In $$$$ 3 $R1҉$$$]$u $vnWE $[ $$$$ $R$$$$$$$1۹ 5$D$$$$xDŽ$DŽ$1ۋ$$2$$T$l= 󥋌$1$$9$rC$ǍA$D$DD$ $D$D$4$$}Pv$L$Ht$\)L$dAD$d4f$D$$$$vDŽ$DŽ$$D$$$$vxƄ$0$! 9D$c$D$HD$d,$0$$T$$D$4,Q$D$L8$D$LJ$$8p$$E$$ D$xD$$$$uDŽ$DŽ$^D$L$D$LD$L$D$LD$L1$$D$LQL$Ly|$Lp\$L\$L$t$\$y DŽ$L$P$DŽ$D$pD$XL$d$O$$={DŽ$$t$p$$Q$$$xL$\\$tt$X|$p7T$x\$x$y DŽ$L$P$DŽ$D$cL$\\$tt$X|$pT$x묋$$t$L$t$L$$$D$LX$$D$L$$}D$L0X$$D$LD$L8$D$L$$vD$LX$$D$L$$ T$LB$$҉D$LvD$L8$D$L$$ J$L$LL$LD$LD$L{D$L( D$L\$L$st$LAJ$*$$$T$l= D$DD$$TD$ D$$D$$脋$b$$fH @DŽ$$4\$$;$[RW$$[R |$L$_\$L$$ $X$DŽ$$$$$[RJ$x$(1fDŽ$9ƃ$$$ 1D$c‹$$3 DŽ$陾$ DŽ$钾D$L1ۉ$$D$L$$ \$L${|$L~D$L1ۉ$$D$L$$H|$L$$GD$LT$LB1*T$LB$$҉D$LD$L8t$Lt$LD$L8$D$$$$jnDŽ$DŽ$*$1ۋ$${fg P$x$I$|$LOL$LJ$x$D$(J$x$D$L8hT$L$rt$LT$L $$BD$L$$jt$L$$t$LFD$L$@6$ $f$*\$LKL$LT$LB$$҉D$LpD$L8T$L $$BD$L$$ D$LP$$$$$$T$Lw$$D$P$$x$WD$pD$X$ (1k$ $$֋$UB$鏷$D$L+Sf$$ލQ$薨 DŽ$ZL$LL$L_$fH @ٹOȃ0 [14ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVS}ED$E D$EE$4k >E܋|\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$D$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$C$5Ɖe[^_]ËED$E D$:$5Ɖe[^_]ËED$E D$g$5Ɖe[^_]úT$U~ t^E|tEXrUWVS, N}m|$D$%U <$lh >m܋||$D$$%-BuM7U$T$M4ƅNT$DV9‰T$s )HFL$D$$/D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$C$=3Ɖe[^_]ËED$E$D$:$ 3Ɖe[^_]ËED$E$D$g$2Ɖe[^_]ú$L$U~t^E|tE\pUWVS`TÙE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$e¿4>፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$H>$>U:ue[^_]ø랸뗸1ffffffUWVSxNÓt&Z=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋܃݃T$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<'\$X,D$(D$4D$hljD$@D$,} <$@/D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$uD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$vD$8"T$DT$$AuD$XT$D$drD$XD$D$tD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$C$-D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$,D$`O}F|$T;|$PwHL$t |$@ 'D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$oD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$sD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$g$ *D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $nD$XD$ $L$h)*0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$gsD$D|$X|$$ptL$T6|$`94 vP9t|$8L$8=D$`0D$E D$:$(D$`|$PwuD$t(.D$0L$@'ȃƉDD$XD$t"'T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$q&D$,0L$hT$8T$4$qD$P|$D$X$Bq…@ fT$T$04$pD$DT$0$4iD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$oD$D1t$Xt$$pT$hV9zT$,1t$4FD$hD$X$VhD$h L$8tt$89tD$h4$.hD$hƉ|$8D$8$hF(MZD$PD$D$D$X$hD$XD$D$D$WoD$`p1D$@D$X$gD$8lD$hD$D$X$kD$X86+D$p[T$XBD$i¸ )6D$XD$D$D$nnl$@D$D$ D$D$ hD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8'D$Xr D$D$D$8$lD$81fu T$hvx0t|$8L$8 t$8F$Jd…Fz tftD$$kDžYD$PD$4HL$PD$h9L$("D$D$ 4$eƅ`D$8D$D$ 9D$8$eD$8,D$D$ <$eDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$cD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@'ƒD$X T$T$L$T$HL$L?'\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$OD$tD$D$h$V|D$lP1D$DD$d T$`D$t$BND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$@RD$t}t$tFD$OƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$PD$H#L$hL$$OD$tL$h $3LD$tD$h)t$4t$D$H$zRD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$rJKWx q tftD$$QD$d~D$<؋t$lL$dD$D$h$vQD$hL$tL$$RuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11UShíhEHP$/C[]UWVSD-vhEċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tHDžDžDžDžD$D$$ T$ swD$D$$RL11 r1D$T$$`$_$`UYepOUAeOUfffffffUWVSVeuM 1Ҹt B<uDU$:tNjUruu [^_]äftf9t뫍J‰UWVS莞du4$\P$U%:tNjUruu[^_]ä[^_]ftfff̀ffff̀rS[TdC[US8dD$D$ED$ ED$E D$E$[]UVS誝cMtLCUE)Љ)ƍ)ED$E$1[^]?c@,US$)ncEE E ED$D$ED$ ED$D$E$E؃$[]fffffffUWVS豜bUBJt@9stЃ[^_]ËJ;J}ABDЃ[^_]ËBU$<tËUJ<}x r s$EtfEtE$<EHuuMx r mfmUWVS0贛a։T$$L$ T$(T$ T$,T$$GNjD$()ЉD$(D$,~M5t5}}u tOuT$E 1wM tL$,D$D$D$$@9~[)Ήt$D$,9 GuP1L$ |$T$E$7E 0<$;e[^_]ËD$$@9t$봉T$D$<$ 8D$D$(D$<$8T$T$<$NjT$у(L$T$GD$J=L$9ȋT$lt$u GD$T$D$<$e8D$,HL$,D$ T$L$$IL$t$E {T$$#DƋD$D$<$7ET$$D$,t$D$$p $9ƋT$D$(T$D$<$6D$D$D$(D$<$y7L$,T$T$$D$,Eb"GD$,1T$$1T$D$<$G6D$D$(D$<$7T$61L$D$L$,vT$؉D$<$?DžL$,D$D$T$=t$t$#LɉU )ȉD$t~T$$#DƋD$D$<$P6ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PT$L$L$$<$5D$T$L$$UUBJL@9s t]UWVS&k]u} G9FVt]F9sGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS<}r8E $7Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]s4"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]3"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0c&*}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSb!)EM]E TsCD9sϥ9r)؃L9s&)D$D$ $]W[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVSbW(mF0)ˉލ, u썊Ga)ˉލ, u썊=A)ˉލ, u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rEu)} ȋ})B9>[^_]ÉB$MUVS`&UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS !`f&d6} w+L M4tetB,$a2E$|ƋEFEFuFF [^_]úMUEL )ȉE w|,$"t,$|UWVS_M%ut"F w"d6u&L 4[^_]É4$[^_] ,$U5N?L 4tU$[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSR}tD$E $ƅD$D$E$Džtt ʃ9t-xD$E$ t|E%=t`fp ttu ffp MfH@ P$m P,!P(!P Č[^_]1Č[^_]1O1USQE UD$T$ D$E$[]UWVSWQÜuD$4$nx$P8D$4$[^_]É4$mUSPAUjxH []É$6[]UVSP Uu`6FF uafF FF uwFVT$D$F$V$FV fV 1 [^_]ËF0tN@9t $F0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$賷e=<1ɋ8tBD$D$ N|$\$4$足 y8t6D$D$ ~D$L$4$lW8t6D$D$ VL$\$4$(W8t6D$D$ V\$D$4$?O8t6D$D$ NT$D$4$蠲_8t6D$D$ ^D$L$4$\W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$رu7O1$[^_]ËOu8,UVS GEÌ EU uMtTp4u 1 [^]D$D$4$#+u"udž0UWVSD Ƌ4D$D$4$*EtE$Gu͋$tMtf~ 18t$\9⋎t $4$6uu&E[^_] U9 8} ]EUWVSC ]tCƉ$[^_]þUWVSiCî ljUD$@$(:ƋUu 1[^_]ËOD$M$…1]~˃Mt|tatOt=t+tt9EGX<0EUȉM̋P uUE̋HM0u؉L$4$} #G,;G(U~#G0UD$ D$D$E$ Hp~UEEEЋU܉M#E)‹E9уE9}mOfwfD$ UT$?|$E$E5Mq~UEP uE9|Mċ}ȃ&YYD[^_]ËML$}؉|$ t$}|$u4$谿ƅh}UЉT$E$fD$ ML$'MԉD$MEAD$U؉$vMMċUȃHt@}GT6<fߍ4}7D)؉G[MĀa Mt$ut$}<$ͤMu҉MED$ M̉L$UT$u4$oMuYY1D[^_]ËMċuuMD$ML$ t$UT$u4$MtVMt$ML$}<$-5(E9MrU]9 `(UUWVS;M ]EUrt!u8tQ][^_]gt5][^_]KO,[^_]É-UVS;IM UEpEuU1҉[^]dž,[^]UVS:M Ep}w>tE[^],[^]nUWVS::} D$$ƅǀM]8bL$ ED$|$]$ mF8FF F FFFF4, ~D1 󫍾󫍕xT$E$Yq]~^ $iF]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$覦BF0F(LN,NV<~$]9~s~G]WEP IT$4$i0}M1Q\$E$oKT$ ML$|$}<$ÉX TUMQ D$t$$蠡ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ N<$ ;F@7NF(șdž‰<Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$>pXPLx H XPgp[^_]ÿO$r4$81Ë,f\T$ ML$|$}<$8녋 8"8F8FF F FFFF4, ~D1 󫍾v1$F~ j5$811 8ED$4$dž0881UWVS$0 uF(x~(V0!UN9F9MUD$N $ MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$`EEtlE܋UT$ML$E$oME)UЉL$D$$>M $EUVU(_US]ED$U $ #C,9C(}#C0[]fffffffUVS .' EpFtD$D$$۸F u  [^]UWVSy.þ ETPLx PpXxHPTt=kbPKҐ"DHD$$$ƅǀHDǀ$$+ljFHt dž w2YGrG G 8SG PcGaG XGE U%tAtCFt$t$貘4$1 xD$ ED$E D$E$HE EXuEX=DžX T dždž XTLtt!ȍDLX1PfffXL9aTȋX1D$ L$HD$$Ȱw 3D$D$$Qfxuu fx D$D$$!E t @E@t Ey [^_]Á1DžPDžX?DžLDžTDžP^?KVp t$ ,VT$XTT$$AD$$;8D$\T$X$ TD$XT$$…\}@@f@fBB PD$D$T $XD$XL$$D$PT$$xD$Z$H XADžX2D$`D$H$"f` =b1`abcddefghhijkllmnoppqrsttuvw `b1uedu\hX=wCu>t_u1 ȉ lpHO ?FUWVS$i&î EpFtD$D$$bFUED$E D$4$XDžEtwD$D$ED$D$ D$|$4$Ʌ!@uFЃ$[^_]ÉED$D$$迯UЃ$[^_]D$D$$蚯Ѓ$[^_]vUWVSEU M wHpPPHHpPPHH p P P H H pPPpPPpPPH t tZ[^_]ftHҍtP1Q‹ˉZˉZBtZ ˉZ Z ˉZ 9uȃ[^_]ftxҍtPu,r utu΋ʉVʉVu9c7W‹ ɉ ZˉZZttr Ήr r ur Ήr ʉPʉPPʉPP ʉP PʉPPʉP[^_]UWVSEU U P׃X ރ HpPPHHpPPHH p P ˉX ffxPpP[^_]fzHҍtP‹ˉZˉZBtZ ˉZ Z ˉZ 1Q9uȋX x)ʉPʉPPʉPP ʉP PʉPPʉP[^_]fxҍLPM2r utu΋ʉVʉV7W9}q‹ ˉZˉZZttr Ήr r ur Ήr UWVS(! EpFtD$D$$荫FE  D$D$$Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$Ϊ$2u 1([^_]UWVSo ô }wFtD$D$$hFD$<$tr$ctcFt$Kt$9t$'E4$<$E$赋[^_]øUS  E9ErD$E D$E$b [])UEtu]11ɍT9r]1]fffffffUVSAz UE XB1rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4QÖ }E@Et M 9H 1uEEEEEEU@}WQ  R 2fuft trfu#tPMy MIыURU܃! M0u Uzu@G GGBPWxG8GsBW]O ME9KOft DAfEtD$D$ E܉D$L$4$ԈVEE@#E UJU ыU M׃}׃}uYM0ɉMuFBEFEEF0E4[^_]ED$$註E6E@ D$$臻‹EPpt EME A AEuth}OAMOEG8D$ED$D$ E D$T$E$詄E4[^_]Ë}GMOEG8D$ED$D$ E D$T$E$F!E ]M؉EEPD$D$ |$T$E$蘆E@R$aUSEP M TH}[]UWVS E}9UNFt%O L$D$$]hF$軽FA4$]覽E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]@tUSUE @@ @HKYXBP[]fffffffUWVS  }ED$E @D$E${t7ƅt|$$t [^_]Q84$&B8UWVSD[ uE $7‹E1[mNt$D$ ^D$D$<$#=5DžDžDžDžD$D$$L<$ƃtI<$D$D$4$贂tntD$4$ɲtSD$D$$րE+uqD[^_]Í$n8D$D$${4$s8?-wfUWVStQÖ ]u EE$7EEExGtD$D$$.G %}(Et)]uU+t[^_]ËV]ċK9 E.D$D$$]6Gf_ @EQ)‹Eċ@F 9AfMGED$t$<$]vMefLJO fMEG(V]ċK9EM9r\L$MEĉD$<$]xEEEEȉEEċ@EME؉EċF9‹Ms]L$Mt$<$]ax8EEEEȉEFEMEċ@Eu9‹MG},D$GD$$]sGfEEA!LJD$L$$]聝ẺD$t$<$]E‰EeEJfMM }.EEFE]C EYf]QfU)Ӄ9f9UsCҋE)҉T$DAD$DQM$]yMAfEAfEFEUfQEf+EfAUfDQȉMMMċQP]XP FD$D$$U]*yMċAD$D$UV$ yG(Mtu 9Gt1D$L$$]}  1Q$Au9uLJEf  _EED$ L$Mt$<$]M91t$L$$]WYED$ED$ED$EĉD$ t$L$<$]2'vD$L$$]EuFD$D$<$]BAf}LJfLJjӋE9MGED$t$<$] rMO fMt fMfO Mf&Gf;EfGLJt]]pffffUWVS0 }E@(tEEEtG 7AuQ O)Ήt$D$ЉU$%vUfWE\GGMQft3ʍTOU‰EMMf9sf9uEMDHWуf+Uft"ҍ PPf9sf9uOfOE@(u 10[^_]èuE?9xuP9Us݃}fGыu9NV;UF(  }EfEED$D$D$D$ D$ED$E$mPD MD$E$;stۋMfA MD$E$stMA6E EuuKGfGG}EfEEEH(}EfEut$E D$E$nG9E49Eu녉}EfEEE D$D$D$D$ D$ED$E$lE}fEED$E D$E$MnGGV1҉T$D$E$ƅ5EfEED$E D$E$mE@(EMA(1D$t$$EuFEfF7}EfEt$E D$E$xm6EH(D$D$E$6ƅtE@fEED$E D$E$mtD1ɉL$t$E$?EH(81҉T$t$E$E@(EUWVS  }u FuIFu 1 [^_]D$D$$^tYVPD$D$$蘔D$D$$&t!VPD$D$$`|{UWVS,! f ljU,E싗E9BD$BUD$$袑ƅUtZBPUTFEDuIFfur>t$<$ut$<$g,[^_]ÉU܉M D$<$nMUuD$t$$V뻉ME EF )‰T$ȉL$Mȉ$oMfMfNEDFfENMMAftHЍDVEEufMډUUuf9sfMf9uuMڋUԋEDPEFƒ)ft;MAȉuu}}Hf9sf9uu}VfVD$t$$HE8tRED$<$1t#fFfFF 묋ED$<$ZD$D$$ؑ1=UWVS0 uExGtD$D$$藑G t>te0[^_]G(tި0[^_]EEEED$E D$<$9ƅEMu@E@  Nf9sit$E D$<$hu@FD$ ED$E D$<$tD$ED$$荐NE@AfFfzfMfUt$E D$<$ hJFD$ ED$E D$<$TvFHfu9fFE@4UtEfNpD$GD$$[…<@fGD$ T$UD$<$ƋUBuQD$T$$HfU 10[^_]ÅuD$T$$MUE@fUMD$ED$$轎MUf9D$T$$薎GEԍUUT$D$<$60O9fEW,Uʉ׋9AE؅mD$L$M$ E9}Mu25D$L$M$E9}MGD$GD$$]>GNjEA9Etf}ދ98}fxXDy|8f@D$L$$6D$|$$Ɗ1mЃ}uf}D$L$$D$E؉D$${\~rD$ED$$訌D$ED$$芌]D$t$$kD$GD$$… v}]D$D$$}t&bD$L$$贋ED$EԉD$4$4'0G,EJ9NMUD$t$$ZU싺1M9(/D$T$U<$)E9}U8EGD$GD$$蒈…sG>ft׉EfMދ?9}fyHUމMDFDED$t$$qD$ED$$ƅ@PMfPMsfUމ1D$t$U$1҉T$ED$U$葇ƅURjщEΉU*;fffff1̀ffff ̀rS[ô C[USSØ D$D$ D$ED$E$t E[]øUWVSC EpM dE$7l֋U1҅tUuMxIEGu@p:^)‰ЉhRp9\rD$/$kt)1lU+Ĭ[^_]ÃLB`\%$>O`9;π?Xt։D$ h)ЉD$T$`\$d`p9r9>/u`tD$p$5/|%=@`tOfp:uыp)~2?MMXdD$E  D$p$g8PXh9<Ƌ\LB`)@u08p9hD$`$>uVEt)D$p$4JtD$p$4.8m`\ffUWVS Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf[fUVS W 4$lD$$D$F $3 [^]UWVS  }$K$K#1$KD$$D$<$h3t$<$2 [^_]USWÜ D$$k[]US)n $k[]US,H EEVEEED$D$ED$ ED$D$E$苢t}u E,[]ø,[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C$wHuƃQ>D$$`uƃRƃPE+u&[^_]BfE}D MUWVS< $7E1}̉UȹEE9t 9t,EȋU+u/<[^_]D$$D$$=%ԃ $]MUWVS`*o EE$7E1} w6}̉\M UEjE9t~ 9ue $\]XM̉M#} E-ME9tX 9thM UD$ D$<$n$E+uI`[^_]D$$D$$G$D$$D$$-$똃 $\KUWVSD_ $7EE1uUč}̉MMȉM}ǹUOUȋE9r}9t" 9t81uE+u=ЃD[^_]ÉUD$$D$$y#UȉUă $[U6KUWVS8]â $7E1}̉11҉EE9t 9t)E+u/8[^_]D$$D$$"׃ $t[JUWVS8 UU$7E1}̉M UȉE)E9t 9t)E+u/8[^_]D$$D$$b"׃ $Z(JfffffffUWVS@AÆ E։M̋U  fM싀EEffEFEfEfEfE1fE1EԉЉufEE}TG:w JMMf9M}9SfE}G)fGMfDOt$T$U$OOUED0fEf;ErE܅5}+EfE}f9}Mf9ME@ E܉ƃws#EuTFr2 Jσ}Mf9MELE9scEM9tX}f9}-~EuTF:wEuEELE9rUuD}fGE@(2f;UE Uf)EEEMf9FE1f}uuZEHE fEV)fV}fT~D$L$$MfEEUf9U Mf9Mu fEfEE@ E܃m@EHEA \EMTAE_UuD}fGE@(>9x@f;ErfGf;EE̋MAEHEUJ}}?]fC]f9]u]fCẼ@[^_]fEEMf9C1뿋M }Of+EfG1fEuuu.&uUWVS! ƉUMED$4$S]ǍED$4$:]ÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVSU }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]JMUBfFF F D$t$$]m1[^_]ÃtQʋ]C ^)fFfF] H@ L$J UL$ $]IUBeD$B D$$]jtH D$D$$l&KUWVS,ݨ Ɖ׉M܍ED$4$[,UUԉf@UfPWPM؉EH}O M}O }G} f9ED$$EUE؉EB}GBfBEfBG EB ED$E D$E$M}S‹utftE9UE$觅E܋u0E]UЃ,[^_]ÉUԋED$$EUME؉EA}GAfAEfAG EA D$T$$hUPD$D$$ju UuEԉFEf@f]܉3u‰Ѓ,[^_]D$ED$$jj1E$u1}kfcUWVS < uE]u BEfAȉE{S ts׋}GEfAfA~V tj׉CfAA A D$L$E$]{i1 [^_]ftC|{M 9uMfftF|~]9u]oUWVSp2 E̋}u]E fEڋE M܃8M\$EډED$EE$U …B)fBMfDJ MQVP]XP AD$D$$Uԋ]1EFD$D$uEF$EuE܉EԋE 8 G,E9EEEEEEEBD$BUD$$]xeEЅUBfEfEڋN C<FE EËUBR)9UЋE:D$ED$E$MUЉrEЉE EF  Q])fQEfTAʉM\$ED$$UЋ]CUЉBE܉EЋMEEEIE 8u4 ML$MЉ $M Su[D$EԉD$$]TfD$t$$>f9UuEЉE'E܉EЋEED$EԉD$$]eD$t$$euEЉED$EԉD$$]eD$t$$eG$ҏp[^_]ËV]XVT$T$$]8B k EAf+EfAUfDQЍ\ UUċPURUЃPUċMD$Eă D$$]AM܉MЋE@MD$@ D$$]HbM|MH D$D$$]wdMEEED$L$$]JduEЉED$EԉD$$]%dD$t$$d1p[^_]ÃB]ڋU܉UfTYʋE@%EԋBAf+EfAfDYVP]f9s/)D$]ЍDSD$DS$]/@]KEfHEF #]ډ]U܉UfDYȉE]CCҍ\S1҉Muu9uMu]EԋCAf+EfA]fDYȉEFFҍ\V1҉M9uM]CFEċB Et{MAurMЋIMu f};]KLً] MUMčQ UML$M $ЉE M9s HˉELEE8E$MЋU c$RUPURPE{]C%D؉E6UB%TEMa u>4$MԋU 1~1E^t$Mԉ $M Qgt&Hg.&v8gfffffUWVS aæ ƉUMED$T$4$RNjE  EED$T$$`EGfEf}MA U9tD$ML$$_MAD$D$$[]…@UfG|$ED$4$A7U9;GfEf}VE붋Hf9OtWuV1 [^_]ËPUD$D$$_UuV [^_]ËE}?98tD$D$$^Eu0ufp1뒋E}?98t.D$T$$B\tfGID$ED$$r^UWVS0@Å }EpFtD$D$$6^F w8t<Jut(F(G Z,CGv՝Ѓ0[^_]F(ǀF,}`H8J@ TPTU䋖:fJD$D$$H]D$ED$$ZuGF,TP\@ P| fBD$D$$\D$|$$RZuME}}8FtM$vF FMF(~fNF(D$D$ED$D$ E D$ED$4$1!@EFЃ0[^_]ËE @EEE$U D…ME)tPEEVE$ƒMtEVUfVD$D$$k[D$FD$$Xk V(Nf\VxD$D$$ZtRD$|$$sXHEfM}}D$D$$ZU1뾉ED$ED$$[ZUyV(ENfM}}EfE1ɍ}}V(uNPf9Fǀ<xD$D$$YDD$|$$eW1EfEN,MMOD$D$$zYD$GD$$WzOf9}uD$D$$+Y8:fJTH|D$D$$XD$|$$}VH@ tEfMN,MUOD$D$$XD$GD$$VOPf9ukM9u:fJTH|D$D$$ XD$|$$U1Ʌ 8@ t%UVS uFt$qF FF(U VUfVF([^]UWVS,Zß }G,EԉGED$t$$T…G@fEEfEU܉GfEfft?fE<Ufy ED$E D$ $M.MUt(fuU܉B EftcU܉}B ueE苇20fHEDBtD$T$$UVB E1뭉ȃ,[^_]ËEMȃ,[^_]É  u$f}t3Af9EuAM]EEfG M뛋BtƉMD$D$$ZSEM]@fEED$E D$<$>-EMD$ L$M$YUEUGW E9uԋMu7?D$L$M$UE9uԋMEFD$FD$$RFfEftfm10ufpEpЉ&D$D$$REfEED$E D$<$,EMD$L$M$)TEUGW E9uԋMuUKFƋEA9ECD$L$M$SE9uԋMFD$FD$$5QuэGE  uKBfEeED$$LSMfE7ED$$-S>fE31mЃ}tYDqt0f@D$L$$RD$t$$iP1uD$L$$Rfu10ufp[u‹Uutqt1D$L$$CRD$t$$OJ@fE苇0fPUBuD$L$$Qfff̀rS[ C[ÌrS[č C[Ḉ̀rS[ä C[̀rS[Ä C[ḹ̀rS[d C[O TUWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrn(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSż \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PPlC}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS]w } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSwüu } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS迮u EDžDž<|<sFz DE5NG=' ==D$D$D$D$ D$t$ $%D$D$D$ 0D$T$4$Vtp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$$?o&w̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$FU D$D$ 04$T$ z1vpDžDžDžD$D$D$ 0D$D$$TyPD$D$D$ 0D$T$4$!T0[^]ødj낺FsGdD$D$D$D$ D$t$$"`&C0D$$0D$$ah ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$$^ /D$D$D$D$ D$t$$ D$D$D$D$ D$t$~$D$D$D$D$ D$t$j$qBB DžDž DžD$D$D$ 0D$D$$Ot0 ><S,BD$D$D$D$ D$t$$`1D$D$D$D$ D$t$$up3fED$D$EЉD$ D$D$H$fJu}u tTE E E t UWVS #hg X<$t V6uEk$Et+oE|t V6u<$HE [^_]EEtt V6uD$<$E [^_]US$yþf t$[]EEED$D$ED$ D$D$E$Ht $[]UWVS@f E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$:F]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $A?tljGUL$$ ?tMVJ}OUWVSWd uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 衜b E}E pE0EEE90EuNEU9sщL$MFD$E$]0D$t$$K&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]uUN8]n_t?]U_{]UWVS<a[ EE M$7‹E1%;E = 9ƅDƅdD$$ BƅC8DžD > BD$4$)D$ |$t$$Ƅ=D]D$D$$`IƉ׉t]g 8X9;-D$BD$d$ D$D$$  {tD$D$$Ct I\"U+ <[^_]Á}@ Džh1Dždd <$0-D$`D$D$ t$D$$$:~ 9WǸ։,D$ D$`T$ $9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$@tYR etD$dD$ $s@tUt=6tftt\1Džp8H41`9t9F@FD$$Pu9;dt9FD$FD$$F D$ t$D$> tD$t$ $>9eu d3D$BD$d$5D$D$$@p8/tD$D$$=tVBDž.D$BD$d4$g89:y``9_$D0}d$?J4$09U8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$I|tD$DD$$<tT?I‹uB8`9r勅9s$4`9u닅$p.'$wHgtStD$D$ $:D$G$`%Nj@8@P1f^$]GFU$=G=D$G,tLtD$D$ $9+_t΋$FUWVSUN <$E D$ ED$ED$E$MU EƉ<$N[^_]US 資M EU BJ  D$T$$ []UVS _äM utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UwED$\$<$UED$\$E$UpED$|$E$UU؋M܉]ZGu]E؋}7ED$ED$ ED$1uD$E)ȉ$LMED$ED$ ED$E1uD$E$}MƋE]XQu]E)ًU)+U9sʅWE)Ӌ0wPu3U܋>xNuML$\$<$UXML$\$}<$U<5ML$ED$4$U ut$ED$<$UuUT$ML$E$UUT$ED$E$UxIEEYU܉u 0sHuuML$ED$E$UxEEED$|$E$UNu7};U|.C UT$|D$ ED$E D$E$]fffUVS |B EU M9Mr/9r 4 9r$9fu49rL$T$$ [^] fffffUWVS$A|ÆB lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$M1 ЋMu`EUD$ T$L$FD$$;u<tVT$VT$$$Ѐf1$[^_]EUWVSZ{›A Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$Åt@C؃[^_]Éډiu1V룃T UWVSz@ u xD$4$1E%=D$($Džts@@@9uE ED$D$ EЋUԉ$T$EČ[^_]C1Č[^_]UEU U U$]UVSy? ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D ,D$ D$%D$O$ U D$E D$E$]UWVSx> E HMxPpt)rP@t3B E$1[^_]ÃMt P@u͋MAUWVS,*xo> }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$_1 ЋME܋UD$ T$ED$AMD$$69‹Mt+AMT$D$$&MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i=@1o$@1~BEH M?O1WUE PMt ʈP1]UVSu; ut PtH J H $u4$1[^]UWVSjuǧ; uu #[tCtډu[^_]Ë$[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS tƽ: U Et7Mt.ZYutD$D$ $$E [^]UWVS t^: } uw vtօu 1 [^_]ËEEUUU܍EEED$E$HED$E$Ku#ED$E$CE܃ [^_]ËE+E1u=TEfH @jUWVS$>s9 E܋E XE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1$[^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]GnE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]GUq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]k)EE9xsNMʋE9sBȋutftUE}8$]w)}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]g]+SSUSCslj;C ЉϋutftE)P)UKUE$]m1ɋU-Q]؋usStft]E)C=EE\D1.fvBvBAf9vEBf:X9f1vE3f+]]7]J7 UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVSl2 utLD$4$F t$4$ED$4$$[^_]c6 ƀ,4$$2Flj4$s[^_]ffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSakæ1 u`6t\F t4VtCF uuIFF1[^_]FF؉Ft^u$VfF u4$볐1붋V0 t~@9t $ V0F FV멸{ffUVSj0 uFft]|T$$+xGE%1= ‹MUtJM VL=u,!9F(u!Ą[^]ËEE Ą[^]ËE UWVS|i*0 u$7E1F t)fF FCFFE+|[^_]ÍED$ED$4$EF u9vtlEE$"*`!7 FEFEu E f F Fft$tߋE f F dFfxD$ -D$D$@U$UPU$EF6$UWVSg. Ɖ׋@0$&F0PE9EED$$F0Pt$T$8$1F0PuD$E$V0U7U쉂PF0ǀTu Xt$x[^_]ǀX\D$$YF0NjF0TXtXUf, Md6u]1҉]UWVSrf÷, ud68u [^_]ËF0$F0PGV09t'Pt($[^_]ÃT1݉UUPV0ǂT1UVSe, ud6u[^]ËF0$&F0Tt$ [^]ǀP8$KF0UYe+ MU d6u]É]sUVS/et+ ud6u[^]ËF0$F0U t XtTt/$_[^]D$\$JF0ǀP8$F0UVS8d* $7E1EȉD$E$KU+u 8[^]fffffff̀rS[t* C[US dX* E D$D$t,@E$t []UWVS4c$* D$$΋ED$ E D$ED$ED$O׋U6Et F"-D$-ED$ t$|$D$$$mD$(_-8Q-L$EuKD$$9t:D$(T$ 9ЉT$9D$D$8tEVtEWL$ 9L$(L$ET$(9T$L$tD$(4[^_],UOED$$D$(1D$(4[^_]ÍD$0E|$,E"D$ D$(t$D$(4[^_]ÅtD$D$(t$먋E"UWVSbK( EU uM] $\$M] @-}}$}M] $\$M] e[^_]UWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]lfffffUWVSAaÆ' }D$<$`t(tt$<$#[^_]1[^_]UWVS `'' uD$4$tfUtf|$4${t>UT$D$E $;Es1 [^_]*"y*l*UE U9r 9]ø]UU E9r 9]ø]UWVS`E&  u \27E1ɍ0t-ωD$4$u t  PEu׉MD$D$4$ MtMljMuD$|$E$  8Ftt$E$. 4$nuME 9t$$Pǃ ǃ [^_]É TD$D$$[^_]UWVS^$ u} t%?*D$4$tt=t1[^_]À=t[^_]UWVS`^å$ ED$0<$tƉD$<$* 4$j[^_]UWVS^Z$ }G$ƅtx @D$0$[^_]US]$ ED$0$mtU 9P []1[]UWVS ]# U\27E8s7i1}ƉUE D$ED$<$u E <=,EV FfV fuUT$U T$$S[^]ø"8u V F본UVSX uFftAȋED$ E UD$T$ $!уN tFPVTfN [^]ù뻀fN [^]USXY E@fu$[]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)뵸6̀rS[ô C[USSPØ ED$E UD$T$ D$E$f[]ËL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffUWVS0O ƉE̋]E $7U1xu2  t8u)؋U+0[^_]Í}1 r}̍I]ȉT=Ѓu]t; t\="t]y$]E k1d]̍蕯UVSu] U؅tHNtuxu)؃[^]UWVSHNǽ |$4D$ T$L$@utȃ"=D$ uƉFD$8ML$$\$4 u܉t$DL$8D$-+|D$0|$@0D$8 D$<D$@ \$0ۈL$D$8T$wN# t$ED$EȉD$4$+xE<[^]EӸ<[^] UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^] US? UT$$![]UWVS,? $7EԉE1ELIBCE_ALLEOWCTEYPEAEBUSEfE=\278t=u tD$t$$ u߸MԋU+u ,[^_]1US ?P }'D$E $t []ËUd []ø̀ffff7̀rS[ C[>̀rS[ C[USs>ø D$PCD$ ED$E D$E$[]ffffffSD$L$ T$.&&@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8tt& )[Í1[ffffffVS\$ t$tCFtU8tOu9vCV9u !€t.&CFt8t)[^fffUE1]øUE tUt1ɀ81U ]11U ]ùUU ]UE t&Ut1Ҁ8‹E1]úE1]1ҋE1]UE1]UWVSU ]E8tOt(G1Ht*t-Gu߉E8E1[^_]Ät1ݻ뮉E1[^_]UWVSU MuEEtxtAE1}EXt?:tWEt uԋutE}8E 01[^_]Ät)Etփ뢾u1ЋuE뼋u1UU Et$Mt!tȉ U1]1U]UU E=wMt1]ËEU]UWVSU ]Etttw1=w%tQzt.t&=vۋEUU2[^_]1ɅtE1U2[^_]Åt1뷻1UWVSU }uEt^tgtc1tt+9t#t=vٹUU [^_]1ۅtE1U [^_]þ1Ʌu1UE Utw1U ]11U ]ùUU ]UE =vU1]UE@E@1]1UEt2Ut/u }wE UM 1]øU]1E ]UEt7Mt"U tЋM 1҄‹E1]úE1]1ҋE1]UU E=wMt#Mt1]ËEU]ËE]UE1]UEu E1]ø-]UEUt(U JU1҅‹E 1]úE 1]UEt7Mt#U tЋM M1]ËE1]ËE1]UE =vU1]UWVSU }]tbtC1ɋ=w#tArt)t"=vݹUU [^_]11U [^_]Åt1ǻUWVSE ]tEt)uV1Jt%8tuE1[^_]Ätǻffff.&&$D$4̀D$̀fffffffT̀rS[d C[PS[M [US5* d6u 17[]&[]f̀rS[ C[US5 $1[]UVSl5ñ t [^]É4$\u`U1f1ø115` 1øUWVSH4=  tss}1f1҉9r׃uF E̋ E fE؋ EЋE D$D$(Ẻ$UH[^_]f불UU 1EEEu AfEEt%uыqEuۉt Eĉ }t Ef } }t E t3 9s#M>u +N 9rt 3ƃ =@AEĿ0AEE! t xUWVS13v \$(ED$XE }|$8}|$,$7\$$1҅ \$X؉D$DD$D$$D$(SD$D$8<%t2XD$$\$X|$D9s CD$XD$8D$8<%u΋D$8P@D$71D$Tt$\HZw|$(RD$ \$0T$8D$`1D$HD$LD$\|$`D$T7D$\t$\T$09}L$$L$TL$<2L$D9L$Xs'L$Xq0T$D9 L$ Nt$X|$<T$L~-|$L|$DT$HL$X9s0r|$LL$Xt \$DT$X9s  sT$XD$TpT$0D$\)B[L$DT$X9s sT$X;1ۍHЋt$\ABHЃ vwD$ \$0T$8D$TcD$TuD$T|$,؃|$,mك۸D$7-t$\L$Tt$\L$TD$ \$0T$8D$,X\$<8 t$\t$D$<$\$()9؉D$L҉T$HCt$xu4~9rg4$AfV$A;u u;EuD$$dU+u8[^_]ø1UWVS<!S EM uU$7U1ҍx Pf9 9px(qff9t1f҉m4~94$@fV$@L$L$ D$t$$t}tmD$D$ |$D$ $<]E+u0Ё<[^_]Ëqx(ljDL$qUWVSQ]â h9q dqA$7LƋE1D$<$mFw ^P $Pu atZ,pXt$ D$D$$zt$ h@D$D$<$_DWw hx\f9w1~t bTtjDžL$L$$~ut Љ9x CPf@@Px Wf Nj@GGG1Džt<Ǎ L LL$LL(LL,Lzfz9t&ǹ BHHH fWDž\E<$2fLJWp ~p1fDŽBDŽ|:t&t:1t:qt:q|:y 9uf@@ODž@<Dž`DžH,XXW GlDžtlDxtЉ@<< DžP$t ЉoGah@p|l@\ t4F<<SDžtGD$ pt$|D$$;{9?20G!0<$m0ttl9G eHH9G1$,0\m`<Dž*hL$L$dL$ L$L$4$ЃBw<$y/fLU+eY[^_]aËlF<.Dž1l@<cDžPf7H担tt ƍx$D$ t$t$$T$T$T$T$T$T$ $,XTdDžD$L$D$ D$|$$P |7f90ua tVXt$ D$D$$辡t$ ȋ9~D$|$$;Dž`x$D$D$D$D$D$D$ $/XC)ʍ‹fDž@D$D$$-8"0Gw0<$,u&L$$vOD$ |$|pD$4$ N@u a QTt$ D$D$D$ D$D$$Ct@Gk <$*Dž`qD$t$D$ pD$|T$$O}p97D$$~T<$c*ua ',PXT$ D$D$$膞T$ D$ D$D$D$ t$PD$$肴Ut$ tD$HRD$,X$$0+8$0@  0$S)tߋjD$D$$stG,XD$ D$D$$4tDžDžPG,BXD$ D$ D$$ÜDž\Dž`D$t$$|Gt0GR$ED$ XDǃ<$'Dž@(Dž`$D$ lD$D$,$cGGGG+t .n0G0b4R u6d@t* <$&Dž\Dž`Dž`N`!!4 t5,BXD$ 9~D$dD$<$4G\<$%tDž*L$t$dL$ hNL$L$ $Ѓ.&<$Q%`VWd@WO,BXD$ D$D$I$RG`D$D$,BX$$D$ TD$D$,$wJi\OHuttЉDD@<.<mDžDžpxW<$#D$D$PD@$n6D$DD$$w\D$ $N,D$D$4$&pD$|L$4$D$D$$t‹p9DžfDžd)ff҉T$t$$u@0G0<$"@6xk<$!Džd$*9Gf\dfx‰)fftg҉T$|$$t̉@0G$芵D$ srx|df9Gu a &,pXt$ D$D$|$t$ 9~ȉD$dD$<$.,PXT$ D$D$$薔T$ 9~D$dD$<$v.$iD$ D$D$,$ff -$u\ =$γD$ =D$D$,$3D$$j<$rdHf+f)fffv҉T$t$$qDžT$t$$5xDDu<$/Y?,XD$ D$D$I$8Dž@<W@8MDž,XT$ D$"D$pR$ёT$ 9~ȉD$dD$<$++,XD$ D$D$4$]MDž]WSa@TG0G$D$ 0+t .0G]$走D$ GG<$Dž@(@t$D $%J<$Rdv\8U0@1<$D$ D$D$,${d<$fׯD$ 뿋D$`D$,BX$6ff̀rS[ C[UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE+Ex]ø]É]UVS  uED$$uEEFEF [^]D$E$Nx(E EUVN [^]FF [^]UVS / uED$$ouEEFEF [^]D$E$LNx(E EUVN [^]FF [^]USMEE UQY[]UVSMuMb)E UQY[^]ffUWVSL# }E E$7‹EYJW`D$$D$ D$D$D$ED$ED$ D$D$<$ ƅIu G$@ED$D$ t$D$<$XƅZWу @ 1 $AED$ ED$D$$ED$D$ D$t$<$ ƅ~QG D$D$D$D$D$ T$t$<$sƅGD$<$E+RL[^_]ËD$<$‹Pu@fffuGtwp fHfHff$5t$ɉL$ T$D$R$蔴PtGtftPD$<$s$f$SD$<$D$<$D$<$^UWVS,2w }U ME$7E1GED$ED$ L$T$R$舳L$T$ rD$D$$=E D$D$ED$ ED$T$<$fU+,[^_]Åx$芺=wttH|.uT$L$ D$D$$OUD$T$R$pqD$<$9T\UWVS(xý E E$7‹EE@ I<$֙&k T$$EP-D$ D$D$4$ DA@tD$4$;uDJ@utSFNu tDJ@tEpt$|$<$薅7$$1U+u ([^_]ZUWVSL }u E$7E1D$<$11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$t>8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$ED$D$ED$ED$ D$D$<$PG tD$<$낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$eDžDžDž`UfffUWVSlƺ u} FM(}, E(@@4$ fF@fM(fV  ЋM(qfuf fAMEtXl[^_]ËE$F'EE$w(UT$D$ ED$ ,D$R$@},~q EEML$D$ E,D$t$E$mƉt$E$EEFD$ $E(f@UE(E,) }|$}|$ D$t$E$6Ɖt$$ $FD$E$FD$$FD$$E(f@  +E(l[^_]ËE P E, 9pE(@ D$E$E(D$E$E(D$$E(D$E $cE t*E(PE ׋us-tftu ։+E(}(fGl[^_]uu#}(GE(xE fUWVS TÙ U }E@4E)Ѓ FD$$)FD$E=b$qVfFE@ uH1T$$MF D$$:G fffG F ) [^_]ø뗨u믍$QU >U$8U͸UWVSNÓ M uU E@}ω}EE‰EPE)9UB9E9}}|$4$[GD$u4$IW׋u$sBu3u,u֋ED$+E$+E[^_]äftˍvu4uC먉U$&UM MAyEfffffffUWVS(F ljUM܋EGlE8u䍃EE썃&E< t< tD$ED$4$`D$ED$4$AD$ ED$4$"/D$CD$4$G@$u< tt < u>:([^_]ÍF$~d ʈdGtD$$Y닍F$~GjD$$$SD$ ID$4$tD$ D$]D$4$t*D$ `D$4$ugOD$*D$4$谭u O@D$BwD$4$膭u OD$lD$4$\uZUmMD$4$蘛ƒ?v?T$U؉t$E$vEUƄD$tD$4$uZEMD$4$ ƒ?v?T$U؉t$E($CvEUƄ(D$ }D$4$l D$D$4$Gu OWD$kD$4$5g)UVST+p $@XtK|xEEE%EEEESD$D$D$ D$ED$t$]stT[^]UVSǯ Et4D$E$ 6EEFEFKfF [^]Í UWVSx%j $7EEtbUD$E$5Ef3EfF}<$gD$t$<$|$4$FUM+ ux[^_]Í cIUWVSϮ }x$`TLJft/1t$/TDŽ9Ӄ[^_]UWVST u4$`t&tuOxu:<$džt$džf[^_]É$S뼋|E_I9Eut$lSUu¶ Et]ÍE]UKŒ Et(]Í]UWVSu] }4$sfdž1҅~1u{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVSlñ uD$7 E1D$4$rF u uD@@$跁D4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$* WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$$qw`D$D$4$pƇ_WHwDG` \Dž01'< t/t 201Ƀt&9n< [< uuDž(k D$,$8Dž4DžHT,8D$ D$D$H$ðj<;t<#tH8domaH8searH8nameH8sortH8optigxionsZ< t< GD+<< ~< ufxinM< t< L( t t Dw`D$D$4$mƇ_D$4$[tDž0ft DF 4DdLʃ Јd8$FD$D$ $[Mx8$Ǒ,D$x$Y}Dt6hlp Dx`0DpHH`HD@H@`t_<.ǃu~DD$. $kDFH.D$.$kDqPALD@$>t‹DgDH U+![^_]Áxservfxer< t< 9< t< t򍃮D$4$< X11rDž\DžTD$5[D$ D$ D$<$rPD$ ,D$|$4$pPB=kDt/RωփtftPB@D<ЉT$L@$gLt׋$ˆL,D$ $L)&D$M7D$4$? D$.4$(gD$D`$訩DǀtǀxDž0Dž(XS$D@Dt$D~DD$4$[u덃$W< tt< uDž0<4,LTDD|$@$f<NFVe9xDw@ut;u㈕$<,t$$<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $$L{;$1!$tDž0pvLusL@DDu|uc'9D$D$S1ɉfLu LVfqUD$E$#]UWVSXӞ }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E99EttISD$D$ED$ D$D$t$oaBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[ C[UWVSdӜ k D$0$D(@$qiDžDžDžDžDžx@ N L$T$ VT$D$$ZT$$p@ 9@ωփsUtfth@ lj)#Pb덋ptŋ t|$$~u똋P04$ɒ@9‹(tft‰)@0DžuY tftlj)@4#tF4$ @9r1‹rf$p@ $wO1d[^_]U[‹);Wh@ 3ffk$F0P@~~ <9V) 9kVʉ)ȉQ1ҋ;tftH<@ lj)9ts9h΃r5@ $ 4$B@9q‹ytft‰)‰DžHtftR<lj)944$d@9‹yUffR 3PD$sumuTk@ $Lsf+ f넋$~@ iUVSؔ ƀ6t$臟[^]Ík D$0$@[^]UVSDÉ ƀ6t$;~[^]UZ U0]UVS= ut$[^]Ík D$0$訇[^]UVS ut$}[^]UEPM¸t]ËE@ ]UWVSGÌ }E0upq @Ak D$0$ƅu!yH L$UT$@$tEG D$GD$ GD$D$4$u4$|G [^_]É4$|[^_]ËG [^_]UWVS kð E 278 (-:)lj}싓( u2E  D$ $ [^_]Ít$E${t$$ ${t{( t1= ;txED$D${uًED$D$ED$ DD$SD$$w [^_]ÍSD$ED$ DD$SD$$w [^_]ËED$UWVS G ''w}  )ƉT$U$ktn  UT$ $sktG   D 1 [^_]ÿ'y qUWVS(5r LJ LJ LJ     11ҍ[EE5 )Ћ  ڍAw SD>ЉD>]T>ӉT>[MHL>@CD> C kLZYE֋ xzt =w ; TEt =w ; T tH~k LJ yM !؉ MeM썇$  MLJ   M싗 1ɍ T]MEUtwM<9ErMtu艷  Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>[YZ;D> rU7UsD>HL>PD>HL> H [7Ë ; eVH P H HLJ [ MULJ D> UMD>ЉD>]T>[Y]ف9 TVLJ 롋 LJ$ LJ( D>ЉD>]T>[oMU(-E 27E䍇 $UMD$1ۀ} ËE)؉D$ DD$SD$$qUMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@pUM^D>E싟 ]X] É %LJ V f gUUxz Mt   ; r tXV H P H H [ Ћ]!LJ  $.fffffffUWVS0։ EЋH , u䋸P }9El`uԍ^\u썰]u؍l_u̍H_EE]]Efd t1P}艗T PP , 8 X 5R}苗d \ D$8 $d \ 돋D uЋ@ Eԋu؋< , À8 u }胇49u}UX P ,8 E苐4 ,X4 U苂\ }]苃4 D$ D$< D$, $BGP X >E苀, P[^_]ø]苃, $$Eky…MtO1EP-}L-E7LEDXtE7<$]yƒ9r̉E17R1KU}X MԈ@ }ԋD EU}ԉ+, EX Ћd U\ }Uċ:O,T OŰU苂P , U9E2\9ËU)Ӊ]W(EUȉP H XND]荃 D$$ f!_E艘T 8 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]YGt/U艂P Uċ:MO u#O)ȉƋ_uGE荀T1uȉMȁ vE W18 M苹d \ MċKщˋMD9UUċ]苃8 $fUuUȋ]苃8 $rUE苸d }\ M[^]mw 4\w 8 Kw 4 :w < )rw , U^w U4]UFw U8 ]U.w U4 ]аw 0 U輰w U0 ]UWVS誰v \ u"$d uމ4$TLJ\ LJ4LJd LJ` LJP LJL LJH LJ8 LJ4 1[^_]US9v E$K[]USѯv E D$E$P[]US觯u E$S[]øUS~u , D$ED$4D$ DD$lUD$$[[]UVS*ou uD$4$Iff D$4$I[^]fffUVS 'u EpFtD$D$$8F!u  [^]xUWVSyþt uM.D$ ED$E D$E$襕Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$!DžH V€ʀ UTPjwD$ D$D$T$\ыU !ȃP{v ww0<$hT$v01[^_]À Vvv0<$  PxD$T$!HP^E E DžTED$D$ D$D$$p}Džt HƁ Zuu0Eu0 GG̊G G  GGGD$D$L$3PLPP LЃHtfD$PD$L$5H  D$ $PP D$돉Lt8PLen  P7D$T$^WP@ ƒ@ u"bfffUWVS6p }EpFtD$D$$3F `  D$4$u_  t$ur  T$U4$Džu=U9B0E s[^_]1UD$D$4$ot̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$+2[^_]UWVS6n EpFtD$D$$1FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$e !@MuFЃ[^_]úЃ[^_]ÉED$D$$1UЃ[^_]ÉpUWVS$迦m }9EUEEEE;E MmG$Tu݋M…tUL$D$<$VUUD$ ED$}|$4$/u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$Ft㉇1UWVS(k uE䋆EMM܉;E E苷EHMU$SƃUtY9Euȋ})lj}苊U|$$EU}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$5.u@EE9E 1([^_]D$ ED$ED$4$-l([^_]UWVS(:j EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$]]uU|$ $k;tUx?UWVSJ` EE,E}1EED$ED$$]!ƅ@ wXf]1 9M rTVÃf9EuUMUfY]][]]}tH}t8M[DF,D$t$$]#E.D$DFD$Nj]>cE}E9}twu})D$D$$] #9utAFD$FD$$] tVTP‹}u뙋u]b}8[^_]ËEpE )}fG w[^_]fUWVSQÖ^ ƉU׃ VU)D$ED$M$ GMf FE@)D$ED$M$UҋMf f>\?)fDfL[^_]UWVS覗] E xfEEETf}tU)ƋUJ;MLW)ȉD$T$ΉMщ $'E9EU|6DU+UU\WPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv %E D$E$P[^_]UWVS$[\ E}EW u}EGft;f~su f ljEfGfEnMfyvE̍DTQ9>ED$E$E@EM $M̋UEHfEEf;EЃ<fD M)‰UύU)ȉEEċỦT$MȉL$E$V9E U/MfyvE̍DTQ9ED$E$E!@EM $M̋U+EHfEEf;/]tED$E$f1E$M̋UȋEE$M̋UȋEf9MsFfED$E D$}G D$|$ ED$ED$E$ uOEEtE@EEEt5@EEEIpEE@ =]c]cx[^_]|Af+EfTM)fLFMfLFD$ ED$ljD$E$eEtpE@ =tGNjUt(ED$E$f}EEEfEEEEMt봋EEfEE1UWVS$vûI Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$\'ED$$"Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$ d…t EME$EPEwD$ |$UDBD$4$c tʋ@f8 $dž KUWVS(́H EE} w8}PUEEE@E|FBU M9sωU DF)fEȉ|$UT$M؉$]F)}}C}ffE‹M9sfUM9L>f+MT$U܋ED$M$]UU)UMfL>fD>}f)|FfLFE pH|FU҉׋]9s߉]9TF)ʉU|$ED$M$]}CUfFfۍD\M)f fTN)}uefDE H14rJ|F E9PfD>([^_]ËU9ZC8fDE D$E$]E tpHTFUWVS\E EE @u E1Oft{DXND$ t$D$E$]o`ƅt|$E$Ff]PMuJfwfuf|Xu E녋U R1M AMf E@ =fEɍ\)fDJMfLBE Ht$E$]t9t|$E$Eh81[^_]DXfBfBFi[^_]fEqUWVS}C U EzMq uf+4GMM9U t$ED$DM$Lu)uD$ U T$MDD$E$^…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$趵Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVSm|B Eu} 'D$ D$DJD$4$]]tDPfzuft,ˍ< fD$ t$MDD$<$\ aLJ(@f8u$LJ 1;D$ t$DHD$<$D\…@ fEB@fE1fEE$MAE9F ED$EFD$$#M1U)fUN fMD$ t$MDD$<$[…ZM_LJ $LJ(14CUWVS(y? E։Mz@ =uW)ЉEN MMȉEGfEt$}ED$$UE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$0Z…t#M L$M $MEEvEjBUVSu]ED$E$1ɋU Ct1[^]øUWVS(w@> EuD$E$1ɉE--D$ED$E$]HEED$E$} fG fE @}E;EEHp@ˍQU40fUt0UfHUff]f\ftPE ]M HwOfw]E;EE t81([^_]ËE jx}D$ |$D$E$]OX] C$NfMЍLLXffFfLF|$E$]DžtMfNKf̀rS[t< C[UWVST vV< E؋}u$7EĉËE1;FEE 9b}}TD$E D$<$]A@fEҋ9E E҉EBFEȃEYf]YfU])Ӄ9f9UsAҋ])҉T$DYD$DYMԉ$]MAfEAfEԋFEUЃfQEf+EfA]fDYȉMԋMȉ]XVT$T$$] D$MԉL$$1uċU+T[^_]D$E D$<$]M@fE҃}t>}ED$E D$<$] @fEfEEE܉D$t$<$]!EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]|D$E D$<$]tK@fE҉ED$L$Mԉ<$]iM1D$L$$]s]UWVS(r!9 }EpFtD$D$$FG!9t~rd94D$D$ $ZG)‰T$T$$""E䋆E} v&6<([^_]ËUE} wڋM aE 8t9  u|$4$tH9s`!EEUU,D$ UT$D$4$VOH9r!<ED$ ED$GD$4$u@}} u~$ D$E D$ |$D$4$"([^_]F(~$E 8EE 89뤋$U; E\UUT$L$$> H(T$ $!GE$K]]]USo&6 ffff]}]ufffffe`[T$Hfffffff50+&!fff] ]UVS(om5 EEEEjuVj uǃ `!7tj.jj-jVjj.j/UWVSEE] }3t>uGj/VZYtp%%t0MPV0ZYMu}] EEAe[^_]Vh!hU!h,'UWVS]u 6}_h!VSb tful6-ۋ=p,)uj=-u h!u Zt- -!hj5-- @u5-hDŽ!jh?!Xu4'hЄ!jMUW6/ZYMtUBk `(%u6h!j0VKSWh(%POUWVS] 3rh6"jIh6"SuJ @t h!p,DPy-Zu- #1--`*%5-`*%jjP- y 5--Z-菖=0@,v-u h!jM-u#--!-`*%-`*%(-%H%hPR- yT-P(-%H%hP5-ң- - y5-hg#j-l-衕(-u--u-H-uj-D- -9ӡ$--sʕ-tá-赕-t-----  -t- -t(-%h=`u; - ----%-RP5--P (-t ḧ!jh-hj')hūj)1=-=-= --h0@,P0@,T5(-t'H-L-@-D-;0-4-ss -- u15-5-5--P$ u15-5-\- rPPhg#諠{Y[-u5j5-5-5--P  t5-hg#hXZ*-------K-]-](-] --9Uu/9Eu*--ڣ--@-D-6esEUӣ-- --H-L-(-t1----j蚓1=-=-XsE--EUMth-l-EU-uRR6 --8-8-=٢ui=u茑=u蜑*-t=- -9ȋ--s")1=-󪡸----- -t j蠒[Z -5$- tH -1=-󪡸---- - -)։ -5$- u-=-ujPY@u08th!5--PZ@u h{"jjUWVSX ] 3Γh6"jjKvh܌!Su G-$*%|-1l-H-x-t-1l-H-@p-z<-l-1=H-Yh-J15l-H-3d-$`-1ɉ l-H-\-X-T-P-L-=D-th@!=l6tu he!j1nuou8-j,PYZFt@jVpD-^Zu hu!W8pj,WbZYt x>1>Ph!h,jtp-T-=t-t t9h!Buu/ h-t'h!&=h-thH!\-p,jW @-ZYu ho!y;O|-=d-t11X=D-uمtՋ=X-jWY[^t' 9=|-tЃ=d-t ]tlj膡ti ȉ=X-\t 1Z01C PbjZP0Ptt 1B"@-~h u)V_Zu h!jT15@-DRPRZYy*ƅu(3%=`uƅu3i@- PVaY_=@-i =`-t9PV$YZt=P-Vh!.}=d-t%" r=P-ughAu#3hӍ!. Q豟u =P-u7hAu#V3h!^. G=@-=P-u3hg#;XZ=x-t4011Dž8hh$P L-5x-8i@- 192t;t SY PtZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =t-u1&t-@-=x-t50譓";@-si 茓C1e[^_]USEEE EE0[1҃vU|r҉-UEhܑ!RP tvpt.Et?SuF-Ƀstxu0 -볡l6---Ph`.%h,` jEp,EE)ЉEEt9E8-u/-EH~p,)EEEHEj蚺1ۉ$ZuYhjDXZjj9Y[h_j+XZh@ -謁Yt1h,h!_XZh!YhjY-Et^E8tTE0YtEEj0ڱYZyjZ,E8!tYEh0h- @Et9h,h!賠YXE8tjZuh!GXx*-tPhg#Y[hX,X+y"= -th -h"h, uY=-=-h,h!ZYh!1ۉ$"Z&f% ,1-냋 -| ths!Xf% ,^1 -yx(,x-PRR tt 1j1ɉ -h,h!N[Xh!1$d= -ujpjQZuh -5-h!h,Kh -h"h,2 h,h!۞Y[jZn= -uj蜟h -5-h!h,UWVSXu} 7軇h"YZu! ful6h!WV} utt p,)NvRE8}WGZE1.% tAB9EsEUPQMW UuMt6QWh!jփ빅u Whڒ!AE@t1j URPE ;F|E8tEph!jSE1~PS9YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW/ UWEffEERhm+fEEERhmW 1!EPhm8@WЛ x E.%6ShpE"jpf9tfuPh!EPsh!KU2!K U9! ^uuuuuh=!$uuuuuh]!luh{!_ uh!OXZQURPW x%uSh!+ ,URPWњ yShg#j~Phœ!jjqUWVShu E1E1ۃ}~F8-tEhՔ!_th!P}ZYu  -h!_th!PSZYu h!$Xjh!h!qEPuh!d0E_t<1ɉMMMMMMJh!!~l6PuZYh,!j"EhR!WE)PdE @}w}c}6to)}4E뷋Ed$H1%}8tEKwn뎡l6Eh(!5l6EXZjl6E]EQEEp,p,}uCp,Eup,4>tj@u Y[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtP%Z\tSfXIEt'U)RPSSÃ~t C}u"h(!h*$"2EZYu hb!"}uEEuh -WuuEpEPP!uM yj= -y h}!}tLjuVjhSy h!*XjVjh5 -y h!Xh(!1juVjpSjVjw5 -l,uq1ɉM̉MЉMԉM_11%H>v M DGu΍EPEPj = -t}t.D1}tEjEP41%Z Gu蘱Ey huA"jVh~f5 -&Vh~fSSMUE}u j uȽXZjUE 0譻jUVSEU eJ -uc1E1ۋ43%Vh/"uU=q`,H`,Y^yhX,j %XZX,PX, Cu p1e[^]ÍL$qUWVSQxq14E-8E-@E-DE-LE-XE-0E-TE-HE-,E-DžDžDž1|h!!V @I&/0$3%S'$(4%1A,A,A,sA,d,E-jP5l6 :uy5l6hx!A,0E- E-DE-XE-@E-tFh@I-h!i[^h̿!h!Xh,jdh@I- 6h!ۋuw1ۉTE- 0E-u`A,=XE-=,E-A,u^Ã=@E-uMh$!hYtpjhP!XZؙjjjjjщڸ|!dh!Zhtt Sh!h^_1^G-@u ^G-0E- LE- TE-1s=0E-D$-Džt~ Džh!92G-Y=tk jhjjjщ¸!cƒti¶ f2G-jI-DPXZh!g9Fjh%!;4G- 11bG-tJ?tEWh!fG-1ҋΉT 9u9u @u1G-1;=I- I-؀tet\Ph!pU[ I-1Ӌ Ɖ\ 9u9uGtDžDž19~JCWShE!މD 9u9uG뮋y1RPjjjʉٸV!aTƉVf=\G-?1G-4%t4%u ù19rGD80G-G0G-E-11ۀt,4G-t#u;u u@ $ut0G-u돋5I-I-19}{.tK;tFȉJYC219u9t0G-A뢡LE- XE- TE- 0E-=@E-uYhj!5^=LE-t„D- lD-t h!5[h!!cYtMD-l`D-l2D-wl~ hF!/Z`D-^l~ he!Xj񋅀Ɖ1ƃu h!ϡG-11;G-ÍPPXZYx+=w;)uvxE-=tE-5pE-jStP 1eY[^_]aUWVS}] 1ɉ1Dž1h!SW rfq1stw51҉j P5l65l6 8t :tPh}!&8"[N5l6h!jDž-Džp,)OtІjhP6P2Ãy2 hI-hedAP y h!=jJ-9 @fjJ-1ɋhXu uXh!軉jhI-hX,蕎襉  tȸp!u6"Ph!LZYDžfhJ-hI-訉fhJ-hI--k~PSyh!Jjvu"PhwdS h%!1XS1e[^_]US] 3caSu$US] 3LaSu訑US] 35aSuxUWVS}1ɉ@j/E 0[^K-t@E K-~ Ph!`XZ1 $11<8,(Dž4h`!u Wà A6$F%Dž,jhjjhl6!8jhjjjl6!O-jhjjjl6!O-P-Ajhjjjl6~$ $jhjjjl6!`O-`jhjjjl6P#9ƃt @5l6h!Y[l6O-jhjjhl6#P-jhjjhl6 ;$P-jhjjhl6!P-jjjcjjl6#gA,jjjjjjl6!FO-I@Phjjjl6#P- jjjjjl6)!4l61҉j PS:k< 8u 8t Sh=!h!< )Sh=!hG!jUDž8Dž(p,)Ov< t5<@t<t# ~ғjl6<([.HE8w,utLEڃ=t-u*t{8,x,u1f=x,x,< t< uG< t< uMjEP5-:K f=y,{6"} uA"P#_8w,uGEE5w,PHZYf=x,tCۡP-t H-fEjEP5-J f=y,uEP谰XMhf"jUWVS E 0(-W1-t.h,"+Y[t +"[4"^[hJ"ZtTD[MBugl68tpjRPJ :uS1ҋ -buV.. -hu"u uDà uC$%5l6hb"..먃 -륃 -뜃 -듺|"l6Z낃 -vl6u#h"h$%h0W -h"S^_À;1h"SHZYƿ@%t&VRS1 u <2t&hV$S^_SPh"0 - G-O3u8=eRh" 8=tRhЍ"Y[\3hV$S蘨^ZƋtt ug(S衶YSYZh"4jPS9‹ 3 9r(<,tuxG -QRh"SV7h".Wu5l6uh="h%hKh"{1k$@.t!VPZYu@.-yGhL"VhO"j苧l6 -I=p,u)- uW~=-u,PY@u h"j"W--Z!Ãt~@%t%Ft!á-0Rh"  s-0h"XZ s-0h"_Xt Sh"[^j uh."tthR"{jHE uC.3hRiǃ u R3hpE"xPhPՅ tlj=--t %"1 $.hPW`- uR5-h"jh-PZY@u5-h"-t&h-P_u_-05-hď"j @.=.t8-8th-PY-u$߃8u5-h"j~=-uh"h4%h0hjs_t. u sh&"hx.P!_Z@u shE".%=tE-Bt,=@t shf"\5t.`t.Y sh"7Cp.-5-h"萪-_Ztpp 0hƐ"s -uB.%6"=@u""up.u "RPh"& .t Ph"Y[--th-P Z "8th-P_%"#Nu@u h/"j}h-P^p'"u RhY"(-%=u5->^[@u5-hw"@\5-^Y@u 5-h"t.tP|^Z@u5p.h"j|j詢UWVS}u 1ۃ~^;-tp,11ɉ<8Dž4h "VW肎 it1҉4y,t+:t!;B uBul6B뵃Pr5σitot8DuFDž<늅u l6{Sh#h" cDž8Tu^dx1jSV|Ctjjj Sǃuh%VhiP裠 @u h8"jD{W\Yy,7tvFtjNt^HuTeItBQ ^Z.0QXɋ0u hG"jz'f돃넃8t_4t]f<taj茠UWVS$u] 3h6"j胘 h"SV背 Btb$D%jj5l6*.......s.d.U..XGHHf wT$%luAjWh|C .w 趔PwhpE""Džp tt\tGPpVZY`t OP9A_PwZYOdBwhg#ZY$R8t h"jcrp_UWVS]u 6|h6"jS1҉.... hȢ"VS9 >vBeR0G.f"$̢%H $%a...G.1..a.1. .?.1.1."..1..1=.....p,)ӃOl.=.t*thբ". . .tbh "jKpt3=.||=.t=||)=.||| Dž|4 .j.PtCx<hSh},ۖ=v ShN"<h},Y},},X/tK},},1hj=XZ=.t.Ph},,x/uP},@},= },wPh},`Y_@u8Uxt)o%=@xtbK=.u=.t. .t P6P6c_Z@u6hg#jn%=@t /t 1ɉt4h},h`"jVn. .tDžt Džtt$P}ZPvЀ8/uj|VG5x 1lpupCpQh},B^Zh},CHfuFs yPshpE"pDžlpx8Xu$wfushv"蠰Y[ftf tt)},C,-},=~TSh},h"Y o{DsC(huTttCpj/V}YZpt)xphC">P,YZphp>h)8/t z/t/Bс},vPh},h"襯 VPRp p}, },= },vx/uP},@ߋp=.xt Ph}, Ph},^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh},h֣"CP@% =@B%=@t,M1@ush},h"1Jp΁@tpw `~||t {DPSdZY/sH . .u&fNush0"Y^jSx;*f5.V..lhP"hD%h6tCPph},O^X=.h},sh!谖 E%=@t%fuL=.u%.H..yhx"h<%h?jRP\ZYhc"^sh"ԬZY=.t'PRd=.tPR%dPS[]|78t h"jHixv3l9UWVS|]u >j/W&yYZtxh%Wb_Zu^h6"VS"{ @uip,)Ãu]p0qLZY@u jjhje;LtEPtIFu'</h#"VSz w~@dfw$L%10/0/@/14/$/8/4/1@/,/t(/e$/Vp,4)Ã=,/t /-=</t, /=1=</=4/u@/1ɉ $/ttu#e$V1ɋ\cP|=8/xt)SWYZuE%=u SWOXZt Whg#jgE%=@9tb ÃSsUWVSu 6 h6"jj:vЉÁp1the$Vux tVmtDžtptc5l6o Xu5l6h"jRfhW* pWF 딡p,7hg#ߋ^Xt!DžtpSZY_yɾߋuڋtV\UWVS}] 3yh6"jP h"SWPv tUit)ft5huP/σvu?/1//15//뗡p,)ǃ4jt/h<$ jH =/tuϋV:PFTtP2l|pY[uNj|%=@luh2lQ$à =lv2h"jbltx/tlƄ/CGh>WZD>8/u 9tH@j/WrZYtPRdY dvWh"詥XZ"@PRl!? t Džphfp3UWVS@] 3V/,Su]Sj>uEUEUSjq^_Sj=ZYuEUEUSjq^_Sj=ZYuEUEUSjq_XSj=Y^uEUEUSjqXZhD"u//1=/=/=//P]1E؍}ȹE uVSjhxVSjX x"}ujVj? y}tVSj$ xjVj y}tVSj xjVj y{}tVSj˗ xjVj踗 yP}tEVSj 虗 y1jVj膗 yVSjt x/y yhL"0jJ0 ^=,tUjhe$@,[^y 谟hl"0j0/ #=,u=x,t C@h" tYt8ua!V襓ZÅt @|/tCPp/_uh"j./ZYtlj؍P//h/w h ; j输, t! ttBGuBX@D9=/t h"j^U=,u,ht //e[^_]UWVS]u 6h6"j| 1h\#VSp tLtPt9p,t/hN"r_8/u|h"P讈Y^ukh"S蝈_ZuZPS Y^@tHxPhe$ _Z@t2|9u;xuM9 u;Etjj裲Y^uj ShX,fXZd,@t h!jT]jTUWVS}] 3qh6"jH{ 1hK"SWFo ft]/WPtwR)d/벃vtbit6rtxu{//1/p1//Z/K/</-p,9=/E-zu8QuthU"Xt/؋Ht ʉA?jl/[/ /u t1=/t =/t@jPW&"ǃ uhu"C =/t.u)W+&XCHHf $%PDs d|PshpE"jpZ=/tC ?ƒuts #|PshpE"菝/k=/^KPSC^+HjSW*C 1ɉK +C  Cu>S=/tCHSftYwifu`KPC*usjZ=/u&shg#/Y[REX KEHm/@/-|/x/edFEPlXu u]XZu uRY[}um=,t,Eh"]^E= /u PEuE=,u}rEj^=,'7= /u/QhX"S[u%jh "PjÃP$fY|=V,uL= /uCEPw$"*SZu EPX8tEP$$lXE/1ۀ=n,t$=/uEPHX/n,u'j4H%7^XC̈́RPRZY=n,=/4,/5/(Bh?"D$Ї,CXUWVSpE 0h6"juq1ۉ]t, 1p,] ;E9h"WZYEWF_9Euph"Su4e tZftatDeuI렃gu=j5l63EZYz5l6hg#jR^p,E ]Su9dZYy h"yEPhBt @uw y h"X}Whht@uw y h"jXEPht@urw y h"GXt$FvE 8uVEPuWSSv^1ɉMME 8URu V|YZURV@uYZuURV}^ZuoE 0P-DPt"VPSE>VSN>E9jh"V uVSvEZYVh"aqE E}tSju|~ y hB"jP}t Whgtu5v y h" XjvUWVSu 6h6"jn,)/ xo/11ɉhdt`p11ۉljh,h"VuZlRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds=l6hDžpYMDžt@Džh1 p,E)t 4Hubupt uY//t//pt$t*tt h"jN t)//>=/tzj:W{OYZt@0j.W^YZlt!h/WØ_Z@lu Bz>t0<#u1$/h/W胘ZY@u ۉB8xPWPZY@u Wh"j!N=/tE/E/jSV"ǃ 1uh">pu jSWJ W!X CHHf wg$8%s aoPshpE"͐Džl=s 7oPshpE"裐ttDžl Džl/ht)KPt;Qu/t;Au A<5/RslЃ t"`ushg#Y[ds]Z蔌8t h"jLVrUWVSu tItt9Ӆu5U1ۃ jj@QMQMQhg#nU1G맅u) `,yhX,j sXZX,PX, 1e[^_]UWVS ƅ]-ƅ_1ۉH/L/H/15P/T/P/1=@/D/@/1h- #u uS ycPtJTtgxPl$@% 0/뫃 0/q 0/ e 0/Y 0/M5l68/Ye5l6>Vj:VxA[Zuh #SHP/t)XV3xZYXu C[ӉP/=H/t h@!j)@l6tuhe!1Ҁnuxou܈,hV$Pz^_t6"H/a֋=l6u 0/i6"l6@/3O;h%Ph #h,nje^]4/@0/t0/0/t 8/p,M Tu)tP1ۉXhq ho 58/R膴XRrRh"RLQwZYTLS脱jjLRPV9X}XTPT0VhPc(à uj/SNZYuSh!hׁ$hSiV(Xu"V+(Xu9S(^ty2LhV'à LVhg#juhz!LR5vZYh #LRvZYSh> #jjhVjS?ǃu Vh_ #jo=h`/hzd@Pb uWX/`PhedAWb @uVhp #WVHqH__9~Vh #(NE X= 0qh~#5r@@0jxlP5@0phZ}#&@uph~#B0@th #A jr HM1󫍝`4󫋅 =d0u d0tJl0 h0P[^@=d0h0l0s=x0u;h0l0}hR^ @uh#P%ZY@uh0#=x0h0Và uVhpE"jPh0P ujhh 0jPyh 0hF#!P%^_@tڋ%=`uh 0hX#1=x0jjh 0, yh 0h}#jP14`E =0u 01=0u;00}hPf @uh#S[_@uh0#=0.#jhh0j' yh0hF#SZY@t=0jjh0ƃ yh0h}#djP[_uh0h#;Dž0jh0h!> u Dž0xxjWh!= u ƃrWv>ZYtWRa>Y_uSh0h# 뀍`PPjh0@uh0h& =0u0u h#jVt] uh0h#u7hs$P=_ZDž0t h!h0h &jDž0t(01RP5050000019؋|i<@ t" 01SQRP~ 0019| h#t5 009sSQRPh #jtM00 0mRPV ( @u'5050hN#j1$0PVyY[@uhi#賰XZ X`&1t\&1У`&1`Hu 9p,t 9}hh&2(26" (2%Y^=u <(2 <(2 u(2(2f'2'2u'288ht,'2hu ~ <(2 1~ <(25'2=@(2W D(2Zu Wh#ji<(2@0(2P-t DKt@9t)Ѓ ~hX,I50(2h#jEMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPhR#R-Ƌ'2'2H19}L'1@91B<(2uQh#&_9~'2'1Ph2("%CZYj %XtG 9} '1FIT&18(2xt&jSjh5,(2@u h#6X8(2t&jSjh5,(2@u h#X8(2t&jSjh5((2@u h#إX8(2t&jSjh5((2S@u h#詥X<(2 t-f&1&1(2&1d&1&1t'd&1ƀ&1')ˆ&1ƀ&1d&1( d&1&1)ȣ&1&1jSjj5,(2y hV#g&1d&1@dB<(2f@fJwuJB  '2J (2J s*EjEPj j5,(2y h#wt)jwPj j5,(2y hܗ#=(2tTjh'2j j5,(2y7h#q s'jh'2j j5,(2y h"#D'25(2SSPh&2hE##jhd,hh5,(2<yd,-d,hb#jhd,hh5,(2hj*1ɉ '2 '2 '2 '2 '2 '2 '2'2EEĀ1ۉ]]]]jEPj-(hje*> ^_19\&1~h &1jx CXZh&1j&1^_ٞzt,-&1݅(=&1ݝ01ۉ@D2%ݝ@1ɉ04h &1jXZ݅0zt - &1݅(=&1ܭ0ݝ@`&19X&1}y݅@؞vj &1%1c3%s=`,t#<(2tv &1%1*vܕ@vq݅@g0&12%H&1vݝh%1 &1݅hܕ@v݅@r j ݝh,(2EfEjh'2j @݅hu h#S 2%ٽrfr fp٭p۝h٭rhPjEP; (0 C38" hД!EEPURj5@(25D(25,(2}Ly328 3h#$h,_X h &1jAD(2HX[^~9LU8<(2_ uOPLh#4 LX)dHhh@;T&1 hfXX&1Hff9u `,%1 &1%1%1 %1u%1P&1<@P&1<(21ɉPT s)hPU@ EʉU1҉UiE'%Uthp U%1ݕP(&1(&1݅P &1 &1h,ܝPv ݅Ph,݅P0&1v0&1؉ff`(25&1v!`t:H(2tjlPhg#j{}tVSh@"j}DžupPm_j#t8=d02tj jh@"=Wh#=`02t j jh@"Wh#j}8j jh@" tVWhϝ#jUWh#jC h6"h"!h#/jjh6"h"!h# }ujjNjjEjj<jj3 jj'jj jj@u h#jSjjgZY@u#8th#=j訛X}u>j蕛_j j(ZY@u"8t+h#%Y2 u h,#&Z WRXVShS# "0jjjƒ 6"Bu#SPhׁ$j[UWVSDu]  't32h$&SV v~j cStITtbLu32뼃dw$&32323232zp32k32\32M32>p,)ƍ232=32tjjhi$V32 >Ejjj" 32jURh@hP @u h$eY=32y h%j;u=323 @ WZ) (    mt /  =32t1ɉڸW1ɉMhj6E؉Ehj$E܉EhjEȉEhjEĉE hjEEhjljEhjEMU ʃ} ʃ} у} хuu hBQ"E1҉328gtj532s_X1ɉME6"E6"FEȅ"CEċS:-0BRU ZH3U$H&32"0,320,320,320, 32uj|32[x32L32A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸ECEu/CEċSEP1ɸX32uCEċCUpEuKMċs t^032hw$&]1R832F@32:H32 .P32@"X32`32 (32 32 |32 x32t#  32 $32 32$32t1|32jjVW1C R32u#EPM̉U|EXUUuEPM̉URj^uCh[%sMZY=32uhq#h#h؝$ 32CHw)=32uh#h#h؝$ 132SEP1ɸX]ċu32Muhբ#5u>au uh#"32Eġ32}tuȉuth#jMu}t }EEă=32uMEȉE10E18021atctguIE02E020232@3202320202 323202U9sHxt)Ј32t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ 0232tMutHXSVh02M =32t =p32t02-#d32tE}tHpVWS =32t =p32t:#32tE}tHpVWS譵 =32t =p32tH#32tE}tHpVWS_ =32t =p32tV#z32tE}tHpVWS =32t =p32tg#,32 tE}tHpVWSô =32t =p32tt#02f02=32t!=p32u=32t02;=t32Sh02532 u([87tQPh#XZ9~kPhǡ#~Y[]83u =32tH 8t32 32 32 32PSV 11ɉډe[^_]}We[^_]UWVS } )hǩ#P ZY…Uh!Wu Ut.at"t=72l672뽺붡p,])Åt>um72t&h4#Sx ^_th#Sg ZYCt/=72u&472rujRKuEVhΩ#h,Vh#h,j=$72u.$72h#Wu t@ A3w$&z=$72u$72먃=$72u$72듃=$72u$72{=$72u$72c=$72z$72 G 728 72)72 72 =$72"$72@ 727272725l68a72X=$72$72=$72$72j=72l672h u$P. Y[>72/=$72F$72$72)p,E)tH:Eu5=72= 72t =72=72]= 72t =72=72txt4h4#WM YZ!h#W8 YZu/ h4#W" YZ7h#W YZ"h u$W _Z,@JK E À572jj5725 72572ft572jj5725 72572=;E572SjV 0Shg#j72E*  =72mE jEPj @u h#t}EUuuh1#C[Jh`RPdChD#t SCYyE  1SQ%1RPhT#SG1=72t5 Xht$S_Zt#h#SZYtuj~Vhk#j Vh#j]UWVS u] 1h#SVe tRtfu2H;2ֿϡp,9td1ɉ`^lPV[ZjxPP|ZY%=`=@uxhuxPh#[^Dž`ddPhV "j_XEt7U ESRPzà [2uSjj^_jkXE j:03Y[t*E 0ZuU ERPDy_X9jh3[Y^uhhjXZhj Y[E 0j@V_ZÅt @vhPW E @1=3t1ɉ 2 3ER@PXZ=3=3uu 2ujSV =3t 1ۉ271҉u2Ph#503 52yY=3a뿃jh3PZXZhhjY[hj ^_-e[^_]UWVS}u Chm!PYZtWhh!SYZthg!SYZut3)~3ltXnuzh#VW dup3׃Vt1PσwB0,뾃cu3t3l3h &h"h,Hjh &h"h,-Sh#h,jp,9u,=p3t 1x1Tppt8-u ƀxu t1L=p3t 1hx1pp8u;J5,ƍxPV,m_Zti=p3tSuO8uCV ,Dhl$NYlhuh!!g1th#vE@uVh#xu n=p3tX=t3tO%= uu-jVXZy Vh#,Wӟ^ Vh#ZYSX5h3UWVSu 6ah6"j1ɉ <(3 1h#Vu ua`Gt+It2EtHa<$8!& '3먁%'3뜡l6u6"<(3@03z'3k'35l6A$y 5l6PXh?"Wl61 '3l6u6"<(31҉@03jjjhX,h#/'3jjjhX,h&#siX|蹔PPhG#h,mj$p,4 '3ut >tt1y#j5393hX, t h!j誻5D03UWVSP}1ɉMM1h7#u W t3gt!utGu.l6El6;ul6E85p,9(3t3S蝵Zt@E%U&3MM@uSh>#jϺ1}1ɉM}t E_3E1}t6hV$EPYZt"8tu hP#j肺G$3DʋE 46Z@u6hg#j肺he$uY@ttEPW#_Z@uhw#}tu)Y@u h#jShg#jԹUWVSP3133@3t$13h£3a1X#&;t2Ct&S =(3uRh(3y^_ RsPU <33333h$Y1ۉ]u"h,hc$rjIDuI3h e$u u tumtW~҃ptZrth,hc$rjft$Cuh3h3hc$5l6똡l6p댡l6ET3sd衘jh=#h#Uƃ tU5M65M6jjWP豣3uh,he$4ct5353XZ53yhhNDhjRhjFhDj: 5M6Qhh 3eE1Ej@ÉEj@ljEtu1jiPU1ۉ_X}u"Ue$p}u U2e$pUEp}tjhU}Y~jRUoXZtK U<}8y}9ujjjjjjjjj jRSj?_ǃ4t EEjZiEPWTW`SVXE];u}4B4:F_XP/S)jhà tPj&jShS"P3jg3j"gČ3N[^ukR=T3t j6Y jjTXZ,觖131e[^_]UWVS(}E 0X1ۉ333^Dž111h($u WZ @p&ab$=&zFjhjj5l6hy#ιBul6jhjjj5l6h$菹336l63'p,9 t jjSǃ yShg#j(1tttWu$TShVB uj PVj j 33Sgy h]$j,,^P[yh$螇yh$t'W!薔苔RjjWf[jh"h$h$(t h$D1ɉ 3 33X,t,3@ftPhht@mƒ PBt3~Zu h$Px^y h$by h$u@U jPI>S3 3hӚ$jkP"h{j jWڑà xtt148tjæh$j1Ήș 33)tSPB y8tjqSh$j辰p[11PKƋЃYtuƉu#@8t7u@1҉9t拍9u1 fj賥jj uSUWVS1 }~XE Xh$S^_u h$E#[-hӟ$SZYu#h@A&hS$he$# 101jչDž`$@,DžDž$Dž DžDž1((,Dž\EEEEEjj& @u18jj[^@u  jjZY @u1$1ƅh%"$t!$ PhD&Ru uƸ^V4M 6?4uƅ뛃Nw$>&ft'j{$?&Dž$`l6`Pl5l6Մl^X-Àt ˀDž$hDž$Dž$Dž$h%h$ [q ƅDž${Dž $gEH;p,t dSblE tEpp,U)‰u 0SO2jjjS8(ƃu(h% ;p,!u uPjS]%t%huąn h$ $h$uY;p,u;VS%jjp,u 4S'ƃ u uPjS$C0t &h$D@S h¤$LHS+ hϤ$TPS.[ g dh  t u, @ À翉  dhd%@Sd%uvtSZv88Sh! T"tT"t6"he$PSh$j+0PMEh6"h6"h6"h$j+0P&dE9p,u t1h%t0PKY h$Z@uh@&h$v[Xuh@&h$ jj 0Sh%jh$A&APn$@uh@&h$v SS@YvKRh,$WRt#8t hP"S0PX'@RhH$:S? dhӃdhu,PPp,] 4 dh u-CvPjp,] 4¯ dh 7Pjj茯 @m8th@&h$e[XdhuGw08hĥ$8 8 dhh%hhڥ$NUZY@u!8thڥ$h@&h$ hh$U[_@u!8th$h@&h$ 0SRYt&uSh@&h$SPh$dhB$1ʻd%@Z0F(Pjh0j@u ht%z,\(螇Sh'j\@uh@&h$Y_詵@uh@&hY$0zt$u/w}Phd$ huA"L#hh$Hh(\,Sh'j\@3h@&h$XZh@SP_tPh@&h$ .^cd%h u =u6vduA%1Ƀu p,} RQ0P @uh@&h$dhǃ p$u6"w$u6"~$u p,U QWPh%*G0W@uh@&h$#1҉覶h[PgOZY@u hʦ$XWh_-jq@uh@&h$]_Xu*dhǁ@u dhQP0P1҅uHh@&h֦$\4PZY$u64h$_X$P$9x uً4h$‹t x t]@h% h)$PL0Pd% uhC$:Y8t tjjM UoXZލP0WPW1d%@tWcY8t" t藲W[Ztڋdh@t) y tI߅uGÁt:Áu- hj$P0P蓸 +t'%@t0PhQjV0P0[_~ tVh#jjCvՋd%@u hc$Xu u0S葨 [h$dh@_dhSh jj@Shj @Pb$ZYy)h@&h$[_ 1ɉ$ 1Dž$d%0uS試Z@uh@&h$DY_PS8XZt;t HxtyzP PmXR1ɉ_VS, _ZtP^S&ϸSfDS};@,tP襸[hƒ@tRt \tBh$h@Yu&j$RP} @uh@&h$&XZ{l*hX,6h$tPRh@&h$7h@&h$(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉPT31L31,0<48h$S@P ,H01$^&@6%@65l6fp31Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fp3F누0fp3%01҉Lj LP5l6*ƉP 8u!l68tL8u ;Ph$pj LP5l6NL ~l6:t L:t5l6h7$3z @6@n蘪tphW$jU @6jhX,Z1ɉ |, ,,^_l6< @6j LP5l6K,l6 :t L9t Rhw$jŚ@=Rh$l64 @6 0LP5l6l6_Z8tL:t Pv)ݝ p݅ tjPh$!(3%v5l6h$AٽFfF fD٭D߽ ٭F $|,,߭ 2%٭D۝ ٭F ,xy5l6h$ uh$,^ @6S}tUh$j LP5l6I8 xl68tL85l6h7$&,%@6 @6 @6 @6 l65P-tDFu hS$1B卅(R$R RRRRR RRRRRRRRPhR#QAƃH1Ʌ~ )1@6h#Y13@9u919~3Ph2("`GXZj u @6t1DžtDžxDž|Dž:h(5Vj5l6PtPPh|$(55rJB5R @6@Yj LP5l6tG, xl6:t L:t5l6h$=hh$@6% - @6k@6%@6% @6CLP5l6K3XZL8u5l6h#8LP5l6x3_XL8u5l6h$p,@)Hth]B6j.SxY^u SZ)؉@?wPSPؖ@Ƅ t@ P-t L-fBۍ1V@KjKPV@SVVdP$TVh$j Hd`hSVj. SkX@6t=, h1$Xt1DžtDžxDž|Dž:h(5VjS/tPPhg#j(5BtÉ3ru ha$ 5Jr rrk5 y h%<A6@t"55h5Pj t h֯$<1DžDžDž:PtPj<=tPP ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260628152902Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directoryopen: %s%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_RC5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog11.0_RC5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= ntestsmanhtmlrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuexbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1181: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist