ELF( 4AO4 ( """CC[!"\\@0 6QQ O @@( @0 fH!@P@Q?H3yР -L⛝p/[de@c@kdmain() returnedlmd   ! X(@@T @@ 0/|odxodT (/// P-_O8d@c@-@PL00S @0080 0 0 0Ϡ ЍX}cCC+AP/00S 000/X}c4De@-@iMpVP @iߍ0s HPP +00 0\`;V   h@ h 0R)0R cOoB*uBedA ,A\ 4S/0!8 00 (   !/@cddd@-O~P|0 !!X0T0P0H000, !  !)3A;,A@cdddG-aM0SJpP  @T   pP9  P@1 vP rP h妎P5 DP@ maP%_ ȏ  P ςPP 00 B4R 0 @a0C0 ӀP InЍG٣ @@kP|fPlaPP +P( 8!$ 0@ We*uBWeL,A,A@BV,A~AY,A@-<@@P$:P4@ dq.A,A UB,A@-l00: S㑸T 88S!~㜸0Y,@ 00 @kd@B@-0@0PS@!@0 4Sʀ0! 0    !B? SS 0 !! HDl<8W0c4De-@cddd,A,A,A@B -A P00  /$@$0P  000/dPd<0 P0/S/0CQ/@kds@-A0S<`P`ȐP. ÐP, 徐P P0000 8=jPЍp@ x姐P`h@0: S P0RЍp@@P8P0Ѝpc-A&-A--Ap@Xc4-A@kd` @ @O-M⭷@'pPt< ?WO執2!7GR  E崑~P00l'0d'd7!`' \7PX7+RJL7尤ᴴḔἄ e U `P& 6  ::Sf0匷6*P S "01%6PQ P!! *!& 1儆 !&f0|6#6$1  1" @P *LH&H6HfUTS$1)0C$1|0!10C0PU0S 9#9S  @P :$1I)0C*$1,|1,!p1c001 1 @P :|5*$10C$1| 1 @P :$1Du*0C$1|0! 10C01 @ P:$1t*0C$1n|0! 10C01 @ P:$1t*0C$1[|0! 10C01 @ P:$1lt*0C$1H|0! 10C01 @ Pl:$1*0C$16|1! 10C11 @ PZ:$1)0C$1$|P#3Jq㰃 u,JW#%J#!Jx#xJp#pJ$p`3`` \3!XT3 0C 0p 0J! 0I 0I J": I": It: I\: I0p09 I 0p0 :IXp!J!p0 I<fM$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xyQ- 1J0JJ010! ,1,! (1(!h$b*Q! 1"G Ѝ:-A@|> 0 DSBO@kd4Deﾭc-AmdAiPc4-A?l?e,wd`N-A)i` <ce-Awd(odPododdodhld|ldldld@ldmdwde CBhmd clmd@vc(c $c@ @c @- @0 ƒPЍO-`p㨱LM P 1 0LЍ001!4 S6AT1S1S1S* o@ gTTW    ,00< @0p08 @P\  0<0 0^*0 00 \S 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/@kd` cp@-d+sPT'sU@ $ ``06/Tp0`$ p@/ဵc/p@-0 P T@``06/0 ``6/`0p@ /p@-P@ễ@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` @kd) A-0PST@ Sq [ :Bu 00 `0*b6/`P J  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@.A.A@cp@-P0 ` T@003/U U ,岺  p 003/.A@-00 ㎳ Ѝ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-0`@TP Vp V hW00 3/P0T00 T0 `@4/A0T0 `@3/A|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~?/A@-@00 S @0 -P@oЍ@kd@-0 00  0 0 0ЍA-PS@`p N P PAW    P ݺUARu/A/Ap@-P`@PP00lhid00 P0   ,0 0p/A,AcA-P`q@P 0S  U000V0000p0  U  R0 _oSRPU 0VW0 VW0 Ay`cc@-@|p0P Rd T0@0@000@0  T  R0 TS0 @@S`cc@-@p0P Rl T00000 00T00S0 OoRB@T @+`cc@-@p0P Rl T0 0 000 0  T  R0 OoSB@T0@ `cc 0o/8md/0@-0M P@ 0onP 000 wrЍ02 p@-0@Tp@ttʹ㴭$0dP 5/0 dP5/00 0p@8md}>/AA-(MP@D1P<4L0100: S# 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0P (ЍA05p`WV ||t Pdm r0 0@0 0m(Ѝ8md,A@kdc/ApAP6 /A2 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@:A-1@TA0P`dp 7/U 庱帱 0dP5/徱0dP 5/0 4P5/囱U嗱 A裱 咱U A荱8md}>/Ap@-0@Txx弸PpPP0 4P5/ 0 4P5/Pk ig8md}>/AC-1M@T唸Ѝp_0` dP5/ 0dP5/P B@MOpPP p d09/0 49/ :0 49/ 0 49/PU 0 dP5/0?<#8md/A}>A-1@T  (PP0` dp7/ 0dp7/ ذְ0dp 7/0 4P5/ Գ0 4P5/ 0 4P5/P尰8md ~>0AO-,1P@`(婯,妯0壯4堯0p,3(00-4*剰凰 唰 㖳@P0 ~ ㏳(z ㋳(兰 ㇳ[P0~ m ( ,04OOl8md0S@- S S@@W傷.0A0 @o/@kd@-@PЍG-@Ђ2PRp`0CRdh2R 3C7CR0 0 $ Gd,2RW 3C7CR008#8S800 0ZR &VR004004 0(0L00P0  , Q  !% b ,R!X , % , h0l0& d  '!00 !11  ?P008#8S308#8S0x`0 pQ p(`8p<Q00500``5008#8Ss308#8SmSW HdHdV0AY|B p0A@-@`Ph @l`0 0X 0P0 P0H000@o04 4JP$娶Ѝp ~>ch,<~>cL@ h@ /A@-۵@-@ǵ00: S/@kd ~>c00@o/@kd` @-b@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ G2RS 3C7CR008#8S800 0QQ &MQ1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011:P008#8S308#8S0x`0 pP h(`8p<P151``5008#8Sy308#8SsSW HdHdV0AY|B p0A@-@`P@h `0 0X 0P0 P0H000=n04 4GP$奵ЍpD~>ch,L~>XcXD tD /A@-~{@-~@o0 0R/  ^@kd` D~>xcp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/4/-/-/-/-/-/-/A-Pp\`ᴘ0@ 2/ p 0S0@0 @0000@A-P M@`L0 0 0  p7/0P * * p7/0P  "( p7/ Px 000 00@0L1 R `   P $o Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  m5|000040J> 0 0000Ȅ 8/0$@0\0` [,y0A,A0A0A0AHmdN O1AN N N @-I|@A@-C|@~@-=|@y u0 0@-1|0 0@k0 0@e0P/_Hmd@-<0@TP T0 0 @LHmd0P/QCHmdp@-0@T/ 0S S* S& P 0 0 P PU% Pp 0D0P0000C00 0P  ppHmdRW SW 0o/Lmd///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S @P@P,@ @T,@ tpG-M`{@P2`0p兲븂XP>V V0* Rq "Sl ph2h P00 000!h<" p-PP00$P(0SIP㴑ġ0SKP 1@P 1@٩P l1@ѩP L1@ɩD10S h 0(00h0 01@0`0!VjdЍ0!p P_ a` P0p 0P0qw 0* R 0 @ጩP S T0@Lmd,A@kdT ` >cT /AX P T Q c cc,~>cX @-z//G- s@dVʀ 0! $"0""   !P 0x $0P0S P0SP0SDP0SK( ]0T Q0S001R0 P "00 S^0 ?0y  0S  P0p P ,0S -0S (05#0x ṩԩP0p P Q 0R(0l0S$00SPXX0S`P\ d:'$0Y0 0 0?cT 0!D d08 0   !T@cdddLmdEcgfffA-X0P@0`0\00`>Q:@kdEcgfff@-Mpax`@ p\彮S4P mSS fS Zp10: SRZ e0s(VSP@  1ۦ@  1զP0P0P 00P0@9 0@2 0@+ 0@$|0x 0t00 0@JgP <@00RЍu1A,AX` P` @kd<` ` lb Pcq#Ec@-@-@<0 @0REc@-7@-0@P1 lp002000 bp0000 0000000000 Hp000 Ѝ0\ P/0 !8 00 (  , !/@cdddp@-@P`00    00CS 0 00p0 SpA-`Q`pSP@PW b b b b c 0S0<000S0;UP @  wz@jЍ P@- R ||Tmd0/Tmdp@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !pTmd@cdddp@-HP0PSp P@ `6/0  0p@/Tmdp@-p`0SpdPP@0 S 000p0CS0p0 `6/Tp@-+TmdcG-pP`̐P@ P% P# PV `FPE⦧@P P #P P00Z0S P ᓧP`4卧 `@刧,A2A2A.A/@-0,\ @T 4/ЍTmd00S/ R//Tmd00S/ R//Tmdp@-@P4`/  xy/0p@80/lmd 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/cA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 cs s 0  )?)/ 0  )?)/^/@-@q dQ0P0Cq 8 q (ܩq ש2A2A2A2A2A0@-LP$M@-ȩ b000 0^$Ѝ0,At 0@- 0@ ,MPr           0 040$0]P 000 a,Ѝ00cs /0/!//A-pQ`.0  P@ x0E;P Hpp`@tT:80`+0 'J Dc@>@- 2A@-  3A///1/8#81/1/ W  R/ R/ d 0s S40@o//0@3S0/@cr/2Ap@-@0PT3/.p`R0p@8/4! $$#  p@/<3A13A>73A@3AQ0 Q Q // VA<3AI3A8BO-P`M 0 3/Ѝ03/@zQ [0$  3/0 0Sp "R 3/ 0A0CS000l 3/u0d 0Q 0H 3/, $.!4 3/!0AYS}z T { $ | L h H 0| Ё T Ā (} p| ~      ~ } | |  |  | 0 | } Ȃ  0c0C S+0{ { { { { { { { { { { x   0\3/ 0L3/@ 0<3/W  0$3/ 03/W07 1p 2/0 30 r#03/0A CR@S> 000 0R8L3/4$$(0". (:$ 03/$&0$0$3/0 0 &6z R'zppF0$0x3/p60S `6`&0S T&ZP0H3/083/ jZ0 03/$r0p0pO8OS $03/50S 5Z 2/%5 0|| 3/Zc 0L3/0X3/p0! 'R0,3/0 nK RS 0 3/  BR03/Z  03/R$0Y$0 t$tO0J$80 0C2/ $0!?3?3 2/!;?#00@q 0s0 0$* "0  : 0#$90"? :$#: \0LH#0$"<0,,7S0 S003/ 03/ 03/ 03/0000$3 0$2 p0$0`$40S$HH 2/$03/!t03/0t3/0h3/W_ 0~0$03/$($0p 7/0z0l3/200p\$($0 7/6$8$&$p(0 0[L3A> >X3AAd3A,Ad[A19AhACvBAh3A>f3Al3A3AopA<3Ay3A/3AAxBbBB3A@3A3A3A3A3A3A3A>3A3A>>3A2A%B3A3AęABIvBA4AqAAE9Ab4A>>3A3A3A5B3A3A3A3A3A4A >//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O<- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ 0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P f\!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S p@4@c ,00,0/0 R,00,0/@cp@-(0cZ0@ TVPUp@cp@-2@02 P<0#0P20C22S 6%Upp@ p@-\0!C !2 Q02(0$! S (0$!p@@cR/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/@c -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480C-pPM`0SZ 0 S S SQ !SV 0 @0 R =R Dh[P 0=S@V6ꠣ ԣ  V 0  SR0T=S0(0 hP@Ѝ h  )hP  8 P 7@- 0@P P0P R Sx @8 Ѝ0@-@0 }P g [oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X @P0`(0 0PN@ @0 4/@TP @> 4/@G8H@c1 !0R$04$0/|uc/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ chmdlmdp@-A0S! 0S\X l\xj0_03/UA 00<000S: #: " ! 3\ #30 00C 300%& %6 " ! \ #30 00C 300000C0^$00pBBMlmdAi!iL c_7A1?/ //?0 0!0S 0@o/ c//0/////?  22//-P/6 c N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N c c c c1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  N6(00(0/O- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0@cH00S/@-@0  "!$0p03/0 !!(ndlmd03 /0@-$@4 g< 4 @ 8 L < @ 0 < /p@-P$@4 g40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/-1$ 400 001!00<p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0p<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@R0` Vg1017800G` !.pW 0000 0 00 `L<`划0@0 0S101ߍ@c@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  Xo101101 0\! 6 SSO-0p@`0M 46CSЍO*t 4R000 0$00 L04`0C0C00g Ѝp!```Q 0 Z0cQ f0 J<!PP81\Z 0  PP  P0 0  3/ ZPu U  u L0 0C0CL00" 0 0 0P0P20@-0t 0@@$!0   80$ &08@1011@2/L00C @cc02/ᴶ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$!6  P 0@-ZCU0 lPC^ 1 0 L00L06&0 6&0/0@cpP 0@- @ |M l Q \\ QQSH0t S1Q0  !0 @k |Ѝ0@c0!R 10/Xndp@-@P {Pp Xnd0 S   {0@-4 0S$ @ Xnd cG-82p&xM &  , ! L   PALPRcF0@!104C T*0FPALPRc0^S t P0  !0 P xЍH03!0%@ 0 :/P> 0t P0 !0 P$@ xЍG{0@ T03:0 H@      "RD$  H0XY ,S@ Y @ccXnd7A^ l  , "O-`P|T&nd0mdDc@vcc/@- 00@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00{P 0S#020 0nP 0S"020 0aP 0S"010 0TP 0S|"010 0G Pd 0Sh d0= Pf 0Sj @03 Ph 0Sl 0) Pj 0SnЍ0Ppr!000m0 Pn0 Phj`!0@00e0Pfh0!000c\0Pdf!0:0a00Pbd 000_0P 0800Pp 0800P@ 0700P 070CA4De9A)9AA39A?9ADADADAG9AAAV9A&9A-9AZA09A<9AD9AM9AP9AS9A]9A@-H00S<00SN0 00000/ЍTldXld00/G-Sp@` @ S( S11P0 @D`Fp@03/ L03/X(@`pGP@@0P3/ L0G/RdP@03/L0 D03/ P03/ZPH03/T0 ndlmd$ndO- 0@4`lTD r0P\qX pX>  R7: R3* P N Y  L\!TWX# D p(p W*Y ) p 0S p    0@[ ЍpWr P@@- ^ 0P \0 B^0嫐0>`9AA-Pp4`@auP 0Pp 0<0`@P00 (@0 0,0 @yc4MuG-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0:P  `FP@VU0,00,0000,000000/O-0p `0 W W WP2d0 ЍO/@08"0 S )4S 04PSz H V @D P T*O0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!)0 0 A3A3C?o20 0c @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0: @ `FJ$$孏 婏 Ѝlmd>J>}9A9AC-@Pp T PS Ѝb2"0S@V0j0O-M"?oZ20SP 0 2"PUN 80`P010 00Y1Ѝ p 0 GSP`T<0 00 0Q[!> 0S0>W:W: 0(% "S  R 0 [0!> zJD Dc>9Ap@-PN@N@M 0> p@0!>Dc@-0 PS@0S 0#G-p`@00hTЍ PZe 0 YUP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 Ѝ@ycO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR ODD P P P;/ \H0H00HP0` B0 0 0 H`P0``>0 BB6*a"*UbY D0 0  0 P PE\ 0 H0P0 B$0 00007 @ycO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T QP%@2D P @[H0@@ $D:S P%0:0PD0@S QQ Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R Y (0+0  PVV0P00 0 DЍ R Y *0PVV0P00  0 | )$ R lY (0+0 PVV0P0 0 0\>9A:AG:A//@-M`@VPT#Tٌ,'HՌ0'<ьUH/, 2?0Rr pB```@Q```CPPP T@%PP `1l p唌 000T0 茌 @Ѝ@膌Ѝz:A:A:Andndndndndndnd:A:A;AA-HCM`PaVTYЍA9RI  !pŸ *Q   0"gD3S|P0P 0Sl gPX!\1- L Rg< ⯌, H ,AWT3W80pW0! .1 剌 # G R#T3T3@T3  tpl1l!0S `1*B0S P1F@T,,T3   !1@TT 0 0 0 0  |W P01GT 和Ѝ卌 ӌ;Ac.cA\>A;;AAZBh;Aq;A~;A;A;AP;A>A;A;A;A;A;A,AAXV;A;A;A;A`A`Amd,nd+Aa1N 006ah1R 00.aL1V 00&a01Z 00a1^ 00a0b 00a0f 00a0  00`0j 00`04S ЍC&d@` ЍCًlmd@cA>A*>AD>AP>A P-`@P p!c pЗ!P  R $LpL 4D 4/!`@S`!W , ,`! !oDЍ@c0Reset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! O!oDЍN  0O   ! "`"РoꋙB7A$>0EAPEA6FAEAEAEA FA2FA=FAPFAcFApFAmEAxEAEAC- @`p(P  0S 00PAP 00(0Sp(Q 00(0L0 Ѝ@0?  0 L0 00S 0 it %C  p$`|FAs@-@ \ TP`t  C 00 `$PЍp@-1@``QP R& $ z? 0    !巆0t0豆$0`0諆40(L0襆0880L00蝆Ѝp@cFAFAFAGA/GAO-,D,M0Pc3/03/10100S  !pp0G?o$Ğ  Ďß2$AT 0 4/PW W, L  <O@0 q Q* ß\(\ R&BR "  R t cB00 0(00,0!0 *R J L ,  W !T"< :  @ P7 L>+ T R2 RLDLOoB@   P 4(S0" [04W  P P P  P A@!T@@@0 (0 i0P(W YW [ 0(0L0Ѝ 0 0崅t  0A 0 S{ S S 0, (0A`pPzO0@ 4x0 x唅 0(0 8< 0\ 'lmd@c$>ZGAhmdDcGAGAGAO-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 P/ t qA0 [0 0a`Pzo`0 w0 * 0 0 0t QA0 0 0$  00@4@@0  P0 @TL@0* R @&Ѝ@chmdGAO-p1pd0P@3/tXXaWTʀ 0! $ 0    !U U+ U5 o?oT20S00 0!t!0   , ! Ѝ c?oT20S00 g?oT20S00 ~lmd@cddd>HA00P (031000Co//,c@c!:!P/ 0  P/@0. 04S/Q0 /0,c @-@C.@-@G-08M@pl00 00,(p$@ @@ @`P0,0L0 0D000000(p$@@ @`8Ѝ;BodIA0S;0;0 / 0 R/<0P/0*4S/0S0 0 /000/lmd*4S/@-0@03/0BN0lmdQ(QP0\0 /)Q/R0 S 0@0D0/S/0H0lmdQ@-@ (4S80BNX03/00)4S0<03/0)4lmdp@-@0Do A("(RP p$$Ph$! ,$" \%R 8A00CS0p0 p@ ,codqd@-@||0T0S$D 0SX 0S@@<0QD$   D$ @@DD,ccod0 04Ē Q884/0H4S/?s,codT H$R (s@-@@8P 084 $ 004od,cDc@0P/-    B B  P^^ $ B$ ( Q !! B B!!,c0S@0P//O-PP4LpQTX4Q9 @䀟䠟fU*%*1QP \ : 0010?0@03/@X0Ph嫄%!1XLP L0뚟@03/@Zodlmd IAp@-0PXdT4S N@l $60L0V L0?4`003/03/+>pod,clmdp@-D@[P\y_0``003/03/`p\4P_podlmd0O-P` @P\Q pQ00؁U00SG R㼑= Ѝ ^^p Q@` WW0p0U0 WU0 `` 0!&Q0 !SL   0-  @T00 ЍO/QᤠT ``  U [  R`` `s!& 1!T0L  @,clmdodA-P @`pTQ 0 "A9P 0`PR  V`p@V0A3100@cA-`PJ@p<@'[dP_\[_P`h003/`003/03/`hMd4P\4P__codlmdG-1pS@0!R00R0P  \  \ 1!aV0`0ó?0`PQ 0 ^ ` 0S 0PR! S YY S 0h0hS 1S 0h  PU0S0`000ĝ>,cP/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  ,c/O-P64M@0$0p o6`H4S 0 I 000 \u0(0X0勱 6T&0P0 '6000 0 01,0 0Z P 0P P IP0S  0S<`X00 000(0S X00 000X05`5T4 0 0S0U0S 0 00C)4S ( `00 4H03/Pd$0ST Z 0 X000404. 0 皯,-0?T 4x4ST$0S  $4,'$ 0020P 10? 0S T 0 <U hu@.''PU LC{PP P 0 0000Q@  00{P 0R  T{X0  V @YU uQ 张姁U(06 <8  (0  00 ` 0  P0 0000 0000 1T!R110011 0404<Y|X0 |   @c4ЍR 0000 00(0$ S000T0R0SX0 0T4U 7<` P  ` 0 QX0 @0`5 X+ 0 1?  hmdodsd,cclmd@cqdodIAIAO-@4M` Z TU2T 2x4ST B>0PS0 4pp0V :RW @tp&: :6S1!f0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% GP <00  (T.[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0 4P00? 4Sf0(4S   0t S4Ѝ,c@csdcO-@p@7P`'4 ( *60Q000  谟 @03/00 3/03/  0X4% 0?UW 0<0WOGPP <`T00  S  S80d5 ,0T42 S0`5,clmdod`0@-0@D0PSM45PЍ00 0,8P ;640 U0*0:4e@O-@p T:G003/O$ZZVUP!2`$5ᔠ?`T:0 0C0FP @0  <@0H4/ 00?@03/003/J`,clmdodA-p@`P_$4$*$00Sb(DF0@00V@U($<01S  2# RE$60=X 0S(H$HJ$J@L W000 ,c00 p@- 0$@0P000Sp`H4S d0)$4$MH P4~h5hE000D40@@DDpod,cJAO-`MlP@?0I 0000 T : 0 S:0SMmЍO$jjf V `!ZP@ p$5?pT*. , 0 E ᚯ뚯R0 <50    )d/0  R!* Jp +4S 0,03/0+4ЍclmdO-^PPE@p̿댐匠ZT:O `fV`!P@ $5?0CV0 GQ!803/@ZlmdO-@p$M`!5᛿'<01S 01 0  000Y' ^'v00100PqW X [  G E-EP Dn <P 0 壿Pᠿ$Ѝ @00@0 00 0呿0皿  뚿$,$$0 !R3 0?  PXDP % <P 0 @00@0 00 0R0皏   뚏P R0lœ\l% 0S 00 H{0 <  0p{ 0 {cod+JA^JAJA0 #!R/080/@clmds@-@P_ž %60vD`P 8巾0 00<TЍp@PcO-q3S$100@-4S0,4T封勰U !0 PU ,$$#2$$0 SQ 0T(4 xDTE|D ЍU0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$` 6/03/00  !!000T(4xDT U 0-40-4|0 3/VBn@c,c clmdhmd10 P0  044-4/@c@- 4@S 0 4;P $0T E0(4 0@0/,clmd@-(a  v @ 0 4$(4@T 0R0D4 p000 00S 000D40P0D4$TPp,tq0000'0$4$0!*10,$020 0 Ѝodchmd@-@I0 4Rp@-@Pp 4S d0 4+TP Pp 1T 0(4p+1q*$g$T傽 0S0Q D$,$ ,$ B  B  Q@@TQD$h0 0T堽X0x$R x$Up@ 4uDPD$,chmdcodsd@cud@-@P{@SO-0P 0UM0 0@p 0 00   P@ᱽPa]qPUЍ 0    D+600 001000 SZ `B 0&`  1` T4 00#Y0 皟  0뚟 0 Z 0 Z  0d V! B!! !  B     0 cod,cp@-P1,姼@@@ <a@޼pcp@-P1,喼@@@ <P@ͼpcO-`|兼PhO%@@@ @Q8pW0S   婼XQ @T0,03/03/XPP  ᐼNጼ Hp0 0傼 v$ B$ +60$ B$ @ 2jnc,clmdsdp@-@0>00' 7D h@t1q $4!*$010D,$020 0@01 0(1C0 0@@ @@@o1 0000 @@Zi0 0000@@ @@@o+000@0@0 @@@o Ź<0,ЍO/@c,codccJAKA"KA]KAlmdxdKAndcsdhmd KAudhcKAsd KAqdl!KAod@c@-f>?0@ \>? @Gm0H4xdodO-$M,q($q 1@`#PQP+P(PE]ܐ(Vᖨ(:$Ѝ0  @P x0 0000009  ;Ppp@W T:`i. 00JpodqdEcTldDcKAXldKA@0!S@0L4 S00P4 S$0;00;010?/odxdp@-0`S0@TT!* Sp0XT S`0dUP0SHVP,w$EO0?podLAGLA@-@ !:0? 00$ 0D,cO-n0PP04 w`nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  M /FVH0Q  Cw P  |($"(XR#  UB뚿HXH :/JZHzLAxdod>LALA !:!/ ",cA- p@P` X0 X000 0pmЍ p@-@P`++`%L 0+T$;;L4;PdkXd ;/0SPLdkTd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?pxdod !iX!!G-`@0匀pB00>0>0PT0?0?0000?$:=P(v$5?[J c cLAO-@ᨐ娀zT:00ЍO/ 06Sx`1`! P$5?PT:0?L0 HS @03/003/ qJlmd,c0$4 /,c0  ")//0 !Р!/0 ! !/p@-PMBP# @,`y0~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍp0cHldc002'0 S#3/Hld 0P/Hldd0qp/@-EP P8@ 0BS B 000ccO-`2`BM<03/ sr DR0S0,,"S  & PsЍOrsB`Pp 0Sm D@stЍOsjP;0Q@1į0 00S|F0p00 I06SP<14As 0 @1:0 0 0 0MAmAtMA,AMAMAMAs@-P `0R18B!|B!B!B! u@P1 00 @Ѝpt0d03/00 `40P0  Y@P0000400040@@lmdc/0 CG-p `P /C ~M0@:0$@P $CU 00<0 0@0$000 0 00@D@T //C-H0M00p0t00LP@0` 0%&rx00@`@TЍ p0 00 ZMA3e c>A- tyt0P0>0\ @X0`@Dp@ f00 L0000L0MA> cO-p1MpR00P `PH0 P@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@TSP S0  003/03/Y 803/`J$JQJd$rЍ00?>lmdMA0/c0/ᰆd0/ᰆdT0@-@0 @RS ,0 Ѝ0000갆dcl0P/0 S/@- ^@LS:0 0CS(0 S谆dl0P/0 S/@- ^@LS:0 0CS(0 S谆d@- @ tu00耼c0p@-`!P qX@P$P`ڴ00#@p@ꀼcA-餀`@̴0PU |dsp R0P R 0LWs >u 8#0$A 8Xꀼc;NAMA7@-PLud000@T juT 0PE0%VE$ @ Ѝ00S 0ES:@ꀼc0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/A-(P`p@P @ 0 A0PT`\00XpD0 0L0$0h000 0@0K00S/儱cxNAp@-@P0Ppp@0/cp@-@P0 Rpp@0/c@-㖩@P 000T0X0\0`0d0h0l0p00Pt|x0o hNA@-@h@萩O-P@M800Y*Ѝ0 S+ 0R'`= p`GP = ` UGP =  JGP 0p` S @P@N!\O!N!N!N!N!N!O!O!O!O!O! O!(O!0O!8O!TO!@O!TO!TO!TO!TO!TO!TO!TO!TO!TO!TO!TO!TO!TO!HO!////|/x/t/p/l/h/d/`/\/X/T/@-LqH/D/᷎ANANANANANANANANANANANA OAOA.OACOA}BNA0 8< 0/P0  T0S0CT0/ 0S/0C 0/M 0@ 0S*0 0S*Ѝ/A-\0S"`0PSp`?X@ 0زA @TX 0@0VD0W @@0@-\@M0SP P 8 00  bfЍ0@ Ѝ0踆dhOA0@-@MP0 | 00 0H0 S 0 0@00p00@,0KP L *r"qЍ0A8u!oOAOAp@-@P0vt00t0hp0S0p@ᩲgp@-`D @@?YP0Z! 0PQS0  @ Pp@0⌲0S   0 /0T0RG-@`007X⨐Up0 S%80  Z X, !cPP0W b 80<80U 0 03/_  <80S8pp00 X P80 08000#g005 bPP *0X8`@@<0`100ޱx0 0P0x`000бW00C0 80<800000 03/W00C00 03/((kn0x0 0Px`dOAAOAp@-P @@ 0R8` 0x0 0  O2d00C0 80<800S80 080g80 080p@g00SpG:Pp0p@0/dp@-@P40Sx00x0p0_x00x00p@蘱L00L0/L0CQL/80/[g8 @0 |Q 0d0#/@- | R |080H^|   @\H@^ R@Q p@-@P00L00Lp@0?p@-@P000p@00p@-P@`00Sp@0"800800fp@-P@0`03/0Sp800800ep@-@T}m020C0S 8 0Sp,`P@mmUp0A>OAA-@`@00SIl00%S PH SG SN SJ 00 03/lIm6Sn0m o48`>mXAPA"PA-PACPAYPAOA40:-$M4  0 001]$Ѝ/'C-$M`P@p n(00$0　pJ0 0@ >P0 S <+CP J0 00@*$Ѝ'\>@-4@$MJPp` 9(0040 000`0 @@p $Ѝp@- M@P` (00@0< 0  ` 00@ Ѝp`'@-@ M , (* 4  0   @ ЍA-(M@p @`P'Z00&4#0D0 :00 0L00H0`00p$`(Ѝ-$M(000 ,0 $Ѝ@-,MPp` @'U00$4#0@0 :00 0H00D0@00p$@u,Ѝ@-@PP s0P0O-4,MD(,00C#  Dp w'01@100@0a$00 09 00`CPP@TB,ЍPG@ QTUP- `0@D1 T00 0 )@& `T  0@KP!P `A-@p0`1P0P0jtPP P0at0p0`t0'd0SA-0P4p@W`d0T# T) T@t`@H P 0 S08 @TWA0"00S 3/|@T c\0Td0S`!@8 0  S   8 d  @@@ jP 0Sd``0VQ00SA/Q QG-@@`(MP0⏭d0Sm0Sj80 00 03/9j'0⹭`0\SA,j40X3/p(Ѝ0⥭@ 80;808pppG& 0/xz 0p l0  80Pp;80夠 Pd P0 d00 03/i0d080p 0+d0S p0a0[d R񟗸g!xh!xh!j!h!P P P P P >/0( 1d/0000>P@- P P P P (<00 01d0000ꀖ>00/00/G-@p0⎫x0S G0ǫ|PU @ 0R,L0S)80 &  80! ZP(P  `0⨫ 0aGP80 @00 03/ hPx00x0t00t0Ya R00 8080;80 0@P `V0S f`ooT `f&T b0V0 0 03/ 4g`0000V z}QAQAp@-@P40Sx00S0Cx0p0x00C?x00:x0Spp@_p@-@P|00P 0 p@Ht  t `p@0p@-@@`P0ͪ<00 0LP  T    T @  B 8 8 +8  @ !TT< d < 8 Q& R 80 p@0تR0 0L 0L0d0S0S80@;80@0`d0S0⻪p@0000@@G-L @`@RP P0S P1hSRL0003/<0\ 0<00` d0080@80   ! 880000080080p08S  0808pP6 0Z0 0"3/7880808S S S 00 03/84f,h"0!0 03/ fY0=f0 p03\0W Z 00 03/f@00_<0 0:p90˩p0ĩ[&RAQAQA.RAJRAA-0@S 3/`0ⲩP00P0Pt0US0^p 0t003/ 0t00ԩ }t0 00!/@!b00}p 0t00⵩ U R00 0⥩ppp_0✩ፖEcgfffdRAA-@Pp@@ @`0SЍ `P@ 00 0X q- ^ /$0/p@-P@v?P$0S @P@pip@-@Jw?PPp$0SpBp@p@-8@P@T;p0U @갇dp@-M@Pe $0HS 00 03/e$00&`V !R00 03/eP ^0 : 99000 @`000PЍp@0^00 0:GSASASA 嘨갇dA-P@`h0C10@B1d0S6z!Pz!pz!z!z!z!z!z!\0` 0C 18000~0A0ⷨ lA!50C1plAq 5Cq00 03/<e00000 03/d eSASAO-MO-M0`+L 01 ]YA\ O-Ph0,M `p $00<80@10030 p*8 00 e^50S^80 4 0\ 8:/t0S0 $_0 \20 :/d0S7 04 $0000 0>P0  000 0O$000 0?&P$0 0Sm*000 \^0 SɅ0040\ 89/ \80"L0S"0 0!!0 !!1t0S 3/0 $_0 \20 8/ $0000 0 pA P 0d!S0 8   #8 @000`0 S8 00 0 ,PR,Ѝ3/U)000 ]%]0d0%0l040\@ 84/ K\$t]0d0`)0 H]0d0 cYAYAEcMb\%YAZA)ZA7ZAYA^ZA@-@$M`0HpP    0 4   ,  ,  P PPPl0PPH00PP080 0`v400( 0PD$Ѝ`!h!x!>vZA! 0R://p@-PP)@I)`E)P0_ P p@0①A-`P2)p@嘀l0S 0PPሥbU`U^Un46Ph0(0 dEc|ZAp@-P(@ P@ P000cG-Q@M ;_0a@DP 0!0hT` 0Aap 0ZT T0Q0 HPD 0P   (P00 _ЍA#[A-[A3[AAA[AO-p`MPP,3p@0Dh0lJ 40@ 0 s 0S 03S 50 * 0ES$ `PP l0 , &R8  8 n  H  R R 0,0S P3/P[ 0@S0,0S,0S l0 P0m0P3T0t0X0|0\00`0n0L@dh0000PH tR<s0w00 00  00@ 000000000R 0 0SU SV 000900000:00000000000040P 00P 4PP B000  L0$uPP, H0S 4@)0000000L @l ЍRPs0 000000000:00&L]K̞>ܞ>L5!UB00S 0L0Sp //O-qM `\00C(0x!0`$0H3 3100 0P0(0VЍQ`\0S(X`0S$d0S @ 0PH@L@P@3P@`0D@h0$ 40Tp(P $@X  P @V00SH0 +A_0H0)8O0 8P#< 45h2@00 0 P0HJPNPP0P00f0 8< 0 4 Y*! S0!P@PIQ@0@,0140 0< 00 @S6 8< 0 8<  4   0$<Y08, 040, QF00  1cT"j @pPY@  `?0 $"449#9TPM00S ^ @ @$0 S00X0S  00@cU ̞>'$i[AP!@-@%@A-`@P0P  \0 0 ؜pP0V Qx  `Ɯ 0XR00 R4ፒ0l~[AEc[AddćdA-@a P 0S |0T  T T0T 1 00A OA0A 9cUU UP/p@-Q@P S\0S L M\peAeAR/0@o/A-p>%P`0T\0S @P 0S `|A0}p@-P`% @0PPySQQQOQ_ 42PY 0p 00s @ S/Q@-@ P[08^@00 0 0 [ЍA#[A-[AeAA-@P$@P`$0d00`0([\[4,2P 0˛pPPPpp0 P\a[P\p@PWA803/@,AeAZAZAZA/AQ @-[/fAA-`(M0Pp 00 P40 040@p0 0|0 0@P 00 D0@(Ѝ%$UH[>!!UB <0 80 40/0 8< 0///O-P`($L1@ 0 +PP3n&&p#1 !)0   0 pWWkr0L80Pz*+|qN Ѝ蜰!d>>0@-,MP@ 508 00  L  @ 00,Ѝ00up@-#LA0PH1  80.u80080p@-,M@p` PG00@0P "0D0  #0H0 $000 00Lp `!Pr,Ѝ0u0@-,M@P K08 00  0 00 L$PX,Ѝ00up@-(M@P` l[008D #<: 0 0  00`8(ЍpA-P`G#P@000S3 S  pp )p* :W0LQ0000P 0X00080 080|YPZ0 pPA,YH0 SH10H1̭>u5B,A>/Ap@-@@0P"hQpP`0U0$00p@pp@-@"P@0App@0pA-l0@P~0pSSn0@0SLx0SIypWF|`P1 0n00Sx0Sy0S|`P0 0wn00Sx0Sy0S|@P00( 0\Ecdp!A-4PM[d@p` %|%0$0:01 00000 P0$P PJPJ #  QG:;;S? Q?4PT7 1RQ0 P00P"0p؀ (80pH00" PN0S$>$$0 (D0 pl0< PtcP@0cS400Ѝ QX;00u RCgA@-@`Pp<<0$M(/(0 00oЍ@cA-@p F`0@PlP L180 0S9@A VT(0 0`0=sЍ@c@-T0( P@"6 0<H1 (0$ 4cR$0L1@,@cO-@`$ p,6,,MBd4H dW  `d0@yP. MF0ZL00 T0P `40LfPm#"448#8S B P [uX5 50Z00 ^00pX`pFPK0 $"44%8#8S00 `3 _00X``-P20F c `$0,($0S)?o\20SL\ 0LSࠑ (0岠`QS@ @0004 00 00000 Ѝ 0Q Q pQ?oX20S '2S'<0QQ 00Q9 K0Q0C0 0ᰐ P` P ,C(0Y0 X,0 0S,, ,$0  0C$0S X<Q0Q0KQ@ S ᓍ P YC0X00 ^0 0pX`pP0 $"44P"8#R#hB#< _0 0X``P0 0 p 0 ᰠ`FV 岠ZpC; 00 00 p0m 0@Y Y 0 ZZp@pG\ \0`F7O d&j"448#8 S㴸͑ f040 g04i 00000"20 00 0@0k 0@0 0Q<<<;0lp tx| R 0uCp@-T@P0`S 0S 000 0$000S 0S000 0$000܌W0Sp0Sp  0S0R0 $00njp@@- 00 0* Ѝ>0@-P$0M 0 0 >Ѝ0謸!!@-(0 0600/Ѝ䬸!!G-P @P  mP0 bbH0$ H08<06000000 0(0T000$0@|!A-(M@P D`pxB00@00&4#0L0`T00 080 000L@0@"p$`?(Ѝ 0uA-(M@P @p`PC00'4#0D0pT%0:00 000 000L0@"$p(Ѝ0us@- 0@P La@0P40   H0b",4b4#0!4400 S0S000Ѝpp@-M@0La Px0K?4X0 X 8  !0 X0<0 00 0  0ߍpgA0@-LM4 $Pd@ 00 @0LЍ0 @@00@0L N@-S\ 0000L Ѝ0 0L  NC-P0,M p` @P 0 P 0S! "ĠČ  Ƞ,ȠH p `  P ,Ѝp@-0P(M ``P @P 0` }P 0S !$$("( P   (ЍpG-(M`<Lq@0 'P?`aL0V SH1H 0㩜H1  PP P PU Vq(Ѝ-PP80L;L  0PPX 0 S 000P P0S !$$ ("(R  $(  R%Q0 0!$+PX!T1808 080 T1 0P1$ (0d0,0000&H1 0H180080    P;L  0*P 0 gAgAO-MPLAp0⯔ 0R80 080J#@0Ѝ@ $PI4@`#$$D0Z(0030#P00S"(" 409 00` 00*0 000+@P0 W0 K 0 *0(0 0&4`0 ` 0 !0D040PT`X\L0hP@  EcD!0u0@-,M@P  S0!0:0 00   0 0,Ѝ00us@-0@ CR 00  P0`P0S L140  Ѝp0 h0C1Q   L!4  l(,"$l$" A0C "440O-MPO30 F0@pᰳ La9@8A੐)T Y @g?W e2C7CW-0CW`?WL 0 0 0pdlP@M0 0 0pOic|GrGWW >W >W0 0 d0 @PL140d &"44 6 @D>W P@?o20>S0 ߍ=W =W _Y?C0CWQ =W =W@P`PUx V@=W@8`0`@D 4P` P0D ,@PN00`0d "@P80SM !$$L("( l!      Dp<W ;C?CWt 0W0ߍO4<W(P@P~ e`P E0fd0p%4k08< 0000lP@ @@Ld;W 46C0CW 37W 3C7CWd @PM6 0CS 1h@;W E  d 0 Sn !|!!!!!!`!!!!`!:Wt :Wu :W 0R<0 #30 ߍO:W0S,!L!!l!!0 @0d0@Pf g0@0C10 0d0@Pg0f U00VJ0C/1#S #S 3S03Q#QQn@@P0000000 `0F,Sdp`p0 @P6#$$("( R !"d @P6 0CS 1h0S d030 ߍO7@D`0`@d P P0 d @PD0S&g0h "44l 8#80   00]G Hh g0 30 30 30 30 3ߍO ߍOc  0S0`$4X0 \0@ ,@P) E@PH1 0H1 ߍO  Q<00<0<00;&00    00 eB Y0$&d00h00  l00 0 00d* [0 &D00  M0 0 d0D@P0k 0"30[0D00 030N0:00 05M 00D d0@P h[0D00 030N0:00 0 500D d0M @P [0FD00 030N0:00 0400D d0M @Ph 203"! 0  0 0d0[0D00 030N0:00 04M 00D d0@PX0k 0 1\0D00@030N00 hM@e0:00 0p3@ 000Dd0]@P0200\0D00p030 @N0 0 hM@e0:00 02 00@0d0D:@Pp 0[0D0003?0N000 0200000 d0D* [0 D"D00  M0N0 0 d0D@Ph 00"320i00j00 N e  \0h * !D00  M0 @T@ E  d R0D00 J0:00 0@1@00D0d0M@@P`dpTP 0`0F00F000F00F  0V 030FV@ccx@Q c@pd c@d@cpdcc ccccdc(c c<d@ d> ChA0uDhA N eR 0d  D0H0 0D0k j 00m D0 dk@P40?@K`P  e}R0d00 @k00#n 6:00 00 000d0LF@P+X E@ EY dUR0D00K0?0M0:00 01@ 000Dd0!@P6#$$("( 0BS EB`P}  e+R0d00@ k0D2d6:00 042000L0@P 04#$$("( R@   $ʄx p  -*F0 ",00  40 0 0 ,@P0 $"448#8RSd#00Nӑ;@$ 00J@P$0 ,0-F0,00 30:03 000 @0,Ph 0 SH0<00 000@<0;0 9Q080"0l$L@0  d08m@PN 0S%  M$  G ~$:$ F 0L 0  DO@P:   B# D# F@K@#0 @ 0 L7@P #   B# 2@PT*0 $"44 8#80C-  (Sk!!!!!!!!!!!!!!!!!@!x!!!!!!!!!!!T!!$!!!!!!!!!@! (S1|!!!!!!!!!!!!!!!!!\!p!!!!!!!!!!!h!!!!!!!!!!!8! 0(448#8S   0(448#8S   @ z 0 (448#8S" 0 (448#8S" 000+ 0+     ++@ @ 0  0  0J/. 0J/. 0 0 ,, S0 0S@H9 0EYC0D00J0: 0 (0DL*@P+ *00C8#833##fkm 00 10000h0n43i0g 43oj0# b 4303000 p000@ }0| 8< ~ ,4 (0 $"000 000 0(0000ߍO@ 000:0d0-@P20m0n00n0 0 CR p GR0S D4R@P4X0HIp0o0W00-"- o p t   p    n0@0n0?000:0d <0(==vo0@O-鰢(0P# 00ML180 $00ЍO0(p(0 S  x`P ؃⫴ 0 p$@0 ?0SO@@0KD@ $ @D [ X0 7:#: :0X000 D\0T@$ T$ $0 KR  $00C00; 0 X0`,00 0 P @DT00 Q?00  ?`P ,@0&"z ,P000bQЍ gЍOb@cd>!<0!80!40 <0 80 40/0 8< 0/O-P`L0@ PP5AXp1 !)0   0p W}>b0 0#M \kMa Ѝ!>Į>p@-La(MH0S4@LH1P@0H1 500<0\ 000P0 @@}(Ѝp꠆p@-LQ0`H1  @PH1`0 X>JH1@0H180 .380080pphA@-eH1  @PH1`0 JH1@0H1hA04DeO-LMЧ@HH1 < `\!PP0 p 0  @P(  050100 8 30 48@0$8A08 384%4!B0$0:040 `000 L00$,LЍ耄p@-@0@PH1h@`0H1QpP`0U0$00p@`p@-@P@0A`p@0`p@-|0( x@"6 0dLa80 80000$00p@PP p@_ cO-PpLxQPH1`0H1 ,MQ~@PP`D  1 1%yH0 S7d1 00 00 PHP)R 0 Px! \ XT*$ $)")  #H! H!h ld`P`&~,Ѝ` 7%0 01X0P00`0 0  P`P`  P N@-LP4 D@  \\ @@ @00L0Ѝp@@ @ 00L0pC-`@pLMP0 00 000Y0 0(0P XLЍ0S!0"4408#80S 0?0S 0!448#800\S000Q0S0 $>"448#80@- 00 0 Ѝ>C-@P@@0$M,c 0`^Ѝ cX p@-`P0 & P<@P RP  0p@4_p cA-P`p%0Mx@PЍ1P L180 0040 00000pF_ c0@-P$0M 0 0 墈Ѝ0!!@-(0 0600㓈Ѝ!!p@-@ Pj `14L180X00X0pO-"448#80C-1@SP\Mo< 00p`\Ѝ4 00000L(0rP P00/ $"448#8 0 LP< 0@00 005:5 020,30(40$10VWSQ! p`Bp` !<#$+4"8  :> C"X!\1, P!(00 T!4 x!2L0^?0n/ P0G0p`{ 0# 0(0,0002 00 L(0$ OP`_ Ps+0Sp 000SV Sj ,0p`c 201 483 00LP<0'6#$+4" H1 0aP0 (00 00 0( rP0S"+0, "440 8#8S0 48L1 80 xP.  |P'xP$  h 3/P paiA NiAA- M`pC @P ⨁n X409400000S< S  Z!Z % 0LQ0100P 0X00080 080gC|D40 qP LCDC0C/H0 SH10H1^ P`CV V3 V\!<# 4! \10X10P1T!Cx1StCve p0pP`uC Ѝ\PCQ <C8C0x>,A>AjAiA$!x!/AiAiAHB!jAG-P Lap0@P>?PQ$0U S @ @L @PP@  XP@x@"T"88PP P80080Y .P.PP 80080PO-4M@E La0400X 0R80p 080^9#@00∃4Ѝ@ 0\H1 0H1$ QT KqP0#|pp4@#D0 X ).*U.4090*00徐 00( 0P 0TL10pPPC 0 u0D01Ph@TXp\L0@S 0帑 *0(00(<0(%40PWp !0 0   " %<*0%8+08#<42 (0(   0tk  `EcD!O-,Mp@PP LZ(`008 * %  $, $( (",$! @ { 8  D L <@PT``Xp\`  <0 d0 S ,Ѝ Xu0  01%<"0%8#08#<42̇d '0@-3@PdM *QLAdЍ0  00R( 0 m  0F@3jA>FjAp@-P!@0PS ?!60#Q0P(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P1 4 X3P@- X3@  T1P03/X3;X3O-Mp؃@ 13`Ѝ?0P X3` t0P }` 0 up$1$@ WJX0P0/ @ 7% ) B$ H$  ))`, 0徲4 #(08 <#T! P2/P! %< #`P!kV0p@@0uԯ>A-P1P`l0Q C`PP>VL>@DDpDV4 ! >@TA>>UjA[jAAd[AAv2BO-(`p" \@_[00P1GP*0VP1P1>p 4 d$t"<402X#  p3`S002ձ02ű@202(0@P<4T103/DQ"l"\"d"D"T=P= D@<=(?00lcnjA,AjAjAjAjA@- @ P@WG-pPW`@(  8 @D (,$D00PT`H00#AD   (,W00 02X3  D (0p, 0 Q0000P0S202l4S P10  W0 202 0< 0m4S P10  0S2<2X3@20202X3 0<2X30 0 2022<20RoSp40p4T1P03/GJG-p+ @RoBP1PSPP1p$0 S 0!R* h0 PP_P SdPO:P0 U#Ec"p@-R_@ x#Rp@Fd0x3T.p@-R_@#Rp@5d03T@-@`Pp<<0$M((0 00\VЍcC-@ Fp0@`MPP P `3d#0 X3A> S9@A WT00 00pZЍcp@-L(0H@P#04X3 @t3$0S$@p@c@-`MtP p<@9T 10'*"*0*00(00,00 $0$00Ѝ>A-PP@<00$00u0P1G 0P$P  <0P1@ 0009SaSh" 0C023 0tl QP0S 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P1c0m' #p  *  P1 00AaS_S<00SS #l     P1 p `p , * " # -  "$.* P1 `0P1 0\jAkA11@@p@-l0( h@"6 0TX300$00p@PcP p@UcG-@ct2PY P1ЍGi D0T`R0L0Sq$"#"#"X#"#"$"#""" r`~0 00000{  R! ;;Y 0S<00L0S,3d00!C=ЍGu~hq 0 P1 BP *0P P1: qP R  qqpx3 d00xC0G~00 2@0S *"*<0S 0S$00P1 }p40Cp4'~TЍGTlc\kAV,ArkA,A,"jAMkAjA@kAdkA"EckAp@-PT1P @0`3/P P P2pT1 0P3/T1 0P3/P` PpPP10S( L6 @00;000000 e66P1 ,<kAkA0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RP!     8@-M` PpP`-*0B8#8S) ' Q#P17 0,00@400300r2T10P3/P184 P1` ߍ-`0uH>@-@8  t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@p@-T1@0P3/PPX3V P D<T1PP03/pX30X3X3;X3kAO-MpP`@ HQ| 0pdT10VP1 P1% P1  xccO=LI;< PE >< p`R%6 RM h vP1  ^ 858彁P(< PF~D00,(P$  `0P 0$;ЍcH0 p moQ Q P\  PL t'<<Q7L1S /0T t$Yt <L1 ;0P!00P16 (;?0 X3<X3n?0 X3@0X3X3l  ;"> 1sp3t P0L1@o 8:"1S0!p3`3`?0) R<pt3 , - p( jt# 0s?`9 Si&i `t`Y!<#ĠhlÄ tX3@W?<0 0?_ !t3,t 000W?000;W t;V  0z;x;v;t#l8"8"/AUmAXmAAAT>kAlAlA^lAlAlAlAlA mAHB%mAkAlA|mAmAmAmAC-@P@@0$M,"c 0`fRЍcX p@-`P0 & P< @P P  0p@Rpc0@-P$0M 0 0 :|Ѝ0"!"@-(0 0600+|Ѝ"!"O-hhS@ 0M`L8<X3 03Z p 1CZ 1Z  0 US`~2Z] 2Z0 0 0 BPq 0pS   Sz*0Sw <0 00000 00,0 :601 00:60 0{0X0P0S`  [` UBQ ,@ X00X0 `@帔0YP P!!0S`ЍJ80 ,,ĠჁ ~R`0ЍOxЍOЍO 0000100000` 080,041 P0`` `cvdndQ""A-`0MX@p `P\ $0HP 40 000p0`0QЍlccR/00S  00s  @o///p@-P`e8P10@,0`02X0!40T10P3/P1  &P1p@nmA@@0u>O-pU@ 0 < `P[xpP1 !)0  # 0 PURP HyT1߿P 03/   =   鿄    pyY   OtTU >0t4_~F y0P!0P!0 Ѝ`">>@-T1@0P3/P WT1P03/p@-PT1@0P3/P00>p^0   " ""   00H00D000h0>p@-2RP0@`2 R0 RL00P0L00P0<0, 6#p@ /0 T587_XAXAp@-P@`Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@pDMT(h0P00 `<0 $0g [H 0 \0p 0+ t0S 3/0 $ _02\ 0:/ 3@ a`8@7P k3@ @P7P80!0d R2  R00p + v3\ h0<(,0040 000$0$ 6哂" 010000S 2< 2p`(`X002 p  2( t x@0'x 00 S0!< 80 S( 2@ ŠĠt0S $3/,0( 4_0 $2\ 0 pAa$ꀈdp@-@P` 0B 04@0 0 )p@0`0S 3/ 0 pp@%ꀈdp@-@P 0<X00X 0@0 00S` p@!00X0S0X  0@ 0 0 04' 0 0 00 R0S 0=@Sp@A-`P@0pSpP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <(AA-@p`p0<00P P h0 03/z<0P0 i(qA-@`帀pA@-M@z0 0Sv80S0,8A- @$pe1P00 1T27    0T0 0T `C0,S><0 R 4S @t T``@PpV<04#P@4P -`cξ3A 2Ap@-@X 0` S <0S 3/PP 00C 0P+pC-M`@P`0 0@P40S Y [pᴀPlp00ppp:ux0 0 ``0p] P PP00D DuP4ЍCD0Ѝ,AcH"pdA \"qAV"dH"/AT@- D@P 0P000`cp@-@ 0P CS <0S 3/p@C-@P 1MSX03/@Zp8`0S ${%pb< R 08 QX?p 0R00 G&tp ЍC \ p9\0 0T0 0D0P\ P 4ЍC/0Ѝpdpd;qAxdf"AqAG-@p`0Ÿ8 R4 䁟ܑ 00S 0SA % 0` 0  0; 0n P\ 0, 0S< 0 <  0  80S 0: 0<05#0  0*P 0  P)3 0R S  P 0BS@@$.S,0.PAQ%\<>kqAqA4@- $@000`cO-@P倐倰M80SЍ<p R P    0 00H. F.P,AqA0S*@-@@0@Q00. >0,! ,1Q 0 @]EcMb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  A$G-`@PP@  i,p0S S8 @\@ D1. 尓 ,/ 408p<003/3 3@ 0#S0RR00R0S @ 00R80KS 40\ $$\ 0& $$ S ,@ "44Q0ꀈd NEFXPi'TDG-p`P_@PP 0,00202?Sb40003/S3 PP;耈dO-P0M M @0NpP00SC000@/=,Po 2000/0岧bS00x2Z4 2  R+00\ [^d R  POW -bd R  Q@0000# = R8*X0 @00R X@000S0S00ąxp 0p0p00S ۍ ЍO,,p[*Wۍ ЍS,`S'pW*p ,W W| Wt W h,0#  8, `@Wz꯴AqA}A,AqAqAqArArA+rA8rAO-4@4MP_mpm80S<0:l=S,08Q D R< #" R+T03/80 S&d0S 3/ `p80SHsT,m 0PR00 4#(am KZ0<` `00SQ  00  `00 00 00)< `V I<0 0`, <0 0Q Q<0` 0 pdErApd@F"irAp@-P@`l PUmp0S \P0 P/ 0 /p@-@Pl@lpp@-@`Pl0 @Tlp0S \@ Pp@-P1 P#UDP3 0 P0 0 00(005@$ ,00!$!4!<!pwrA}rArArA@-@!!4!<!@D@-@ Rl,A}!0SrAp@-@P 00P`@lyl3lAp@\!A- a@TpUʀ 0! $ 0    !E 0  @ 0! T0t l   ! 00 0h0 03/@T \p P @cdddk&l/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-@ZU0` P ^pp {=,v0帢,<zpsL!DH1003/u#-  Ѝ_?0Q R 0hg)100100100 0Q)-/@@@rArAG-@p`Nz1 0 : 0h0 0$3/UP0V/R $0Sh0 03/P@ h0  03/0V0 ЍG@-MP`@@*8*`0000 0 00000000 $ 0S882      P Ѝ@<*P04P800@PD00P0t2 X0l2t0G\@`PdPPwj Hsj poj(L/"p0  c%!0  Z!0 F Q!0 N H !0 V ?t!0 ^ 6T!0 f -4!0 n $!0 v  0 ~  0   $0 P0 0 AoPp) 00 0tTЍ@,A sAX""0sAжA9sABsALsAVsA`sAjsAusAsAsAsAEcz"/Aw"O-`00@0Q0z P_ PppJ R/U? T~&2L SARD 420r,, pWp Sp0SpU g& QD pW? _& Q!C0S U&S&U M& PR  PD&U p2T SR@PR( 4.&Q ЍPR &0Q 0W  &&P &0|`tpJO PRS \&St<% PR @%0T @@d[AAtAA.cAsAsAsAHBsAsAsAtA@-Eo@-Pd0`@ P0@@d0<0 000`UP Ѝp@(Ѝp`@A" tAp@-@PH`h 0S 000 P0D0L0@@D@p@"iA-@pH`Ph 0S Q D 0 0 00@ iU iLT0S Uhh=iP @hhG-`PHp@h0L0<0S7hm"P,$0 Մ$0 Pc8 t Xpqhohmh~owuP PqUm @-A 0X@[A-@ppQh0 03/` PYhV 0AEc0   Q @-0 03/P0S/A-P(Ms]@P'@(Ѝ0`P0$0(0 `0 03/ 0 $0 0008q/  ?0P: p 0 `p*08/0P*0=0 888/P< 8!%P r? 8 P *(<03/ 403/]'tAp@-P@ 0 $0 (<03/400 43/p@j] #-d}P0.X X%,à1 0")!0 <"#1o\Q "丧MbEcCcOtA@-XM@X  [ 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X 6701H0T@9C>H0 @H0P  0$ 0 0 XЍp@-XM@X  < H0XЍ0@-P$@\M h"%\Ѝ0X  0 010408020H0P 020ZtA2p@-$0PXM $`XЍp,0@S Q S 0R,@`X 010 H0nTP`  H$X  0108020P,@tAtA@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P  `PU 09 0PA-@p`pf0 03/ 0PY4 9 0fU 09 00<0S 3/ P0p03/7/PP 0 4pW  7/PP P%$0 0%c9 0ofU} ЍA03/$0 EPP$0 0 C4PU%%PP$0 0 0 $ 0  dP % 0 P %PU4P0S ppU 0 9 0e 0 9 0ЍAf0 0S $0p p00 00 P PЍtAtAuAuA5uACuATuAAt"A-@`)HqeLp@PU  0R0D0 0 TPe03/eT0S 0P  eoePuAvAvAvuAvAvAvAG-0@P*0)  ,Q p㄀|Ko0S #p  WP 2"8  $ G #wA:wAAA,AIwAswA$ X0R/0p@-)00+P@*0,,嘾JoNOPVPp(!ر>C-pP@d`㈐刀\MX  0 1PH\P ?o 2? `V<?oT20S 00\ЍC'C-Q @lMP0@4p+N+ 0BX `@50270X00,@LP U01PPTT0@P@lЍH00 0<P{!,0X0@P 0BwArBA-`MpP`]@P*U@x 0PN0X TBP4402|0PSd020P0$P@P(00 <T 8 U400`0 0 7!`Ѝ2@BBwA@- 00 00 00  0@Py 7P 00 0PЍp P 00 0%>0S(0 0TP P0 3/ `PP, PP "꠆wAwAA-@00PP t"0000P80P0800 03/pP` H\"`0p`0808(0SxA*xA@-000 00<Ѝ@-1 0 /ЍA-@00pP0 3/$`Q\@    0 03/P t""`P X"0001k  1\1\1 R004`V 6/P` ! &"@T :e0  "03/t"yPp`PFxA^xAPqxAxAMbxAxAA-00P0S@S 0# YPP`Pp0S 00B0P30PU*< Ec0uB0S/p@-0@0P) 0# p@.@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ@P@@@0 P0`HC-Pp`"Q P 1  0 Ѝ@P@@@0 P0`HC-@P`pQ P 3  0 Ѝl@P@0 }P0 P ` GC-@P`#pQ P !3  0b ЍD@P@0 UP0 P ` G@-0000  0Ѝp@-0@0P< 0# p@Ap@-0@0P- 0# p@2G-p0(0S PsV@P lVP`V@ `_P `0S00(0 3/0000@00`p@-P0(0Sp@`` 0R000 Q0 (03/0`BVp@?V@-N0(0St@gp@-@`]`PU`0 p@,0/0 3/Pp@-0@Q0Pp ` 2/P D$ @p 0`( "4`#/ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00)|@P8p0 8|X (0 Xd000p0$00(h`X0l`射\@P$0 00 0| %cUP@P $0 | <03/ 403/ЍgU rZp@- P@@@4X`TQpC-@$0\MPp`x( X  `< YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"QP \Ѝ@ 0b0?o0cS2   $ $0` 1011SX  010 80t0H0P X   01$0 080H`P 0  rr2 6$G-@$0XMPp`x+ 0/X   X00,10D <11@`H0$0d`0 0p0 0 jP% 2"0 2"P XЍ?0 SX  ᣤ*00141 H0WP @ 0b0?o0cS2   $ $0` 1011SX p 01|0 H0P X  b 01$0 080H`P 0  2222 6$21BP31 a1/G-0M01S`P`1  V~$0] p00 pp0@0*@4/@P PUЍ00p8@@0 4/@PQp1@ 0@0cz@PCp@0 rzX (0od0@0h0l0041(0D00p0$00X0@P$0 00 @0Oz`@ [V $0S@SPG@$0 1z@ <03/ 403/TS@ rG-`0$ M@p0c   0P*5/PP@008P< 5/PPB,1P 0y,<03/ 403/T"0`R`X ( 0408(D0p`[@PH0  0p0 W 22L2LxAC-\M`PX p 0 X100  H0-@P$ U PE_oYRPU 0XP PX  k$0 080HP@P  0 D@\Ѝ   6$6$2 2 xAxAp@- P40 S" 3/P@000S@  3/@P`04`V  H 6/P@p 2/0  3/a O- 圀\1PX!0`4@ MT 4/P@ D03/H1S< pP  @ߍD1S R0 d1$0      V@@   0@P0 0 3/1Z @$0  pB21\1 R0Q 0 4@TD 4/P@W@ R0L!00d1S Se!  005h1h1S 0 ! P000 !@}Zp ppG0 WPZ 0 103/< S@PB0S |@TY00 W00S" Y0  @PC@P"040S   3/@P0000@ R0L!00W00@Pz \1 R0Q 0 4@T 4/P@ 03/qxA&yAEyAgyA'>&zAyAyAyAyAzAzA zAO-霐\1@Y!0`4P MU 5/Pp Pߍ 03/$0[  000 0P0*5/PP PH^008P0 5/PP:p 00vPP0 wX p0000090308$0p 007PP$0 00 0v fX $0hFP$PP0x0|052< !4 4tpp00pP  'pP "p (p1PS  pPXP\$07 5 $PX p082000p 0PP00 3/PP0 0  5$0 jv <03/ 0403/U @O>1S\1 R0 Q0Sj 04PUX  5/PPZ %`1  00PP VU  0o 0$0  p  00lPP 0 T\YPP< 08 0$0        ppp Go57#0娂\1X0 3/P 5堀7# 000$ 0T p  pp0P*@5/PP/00p8P@0 5/PP14P 0@0uPP#p@0 uX p?00@00040 08$0p 00PPx P $0 u@ <03/ 403/U  @NP0 0 n0 pc0 0 0 R0WPt# شґXpU XI W01PL{ <Z ,Y 0S W= X U5 PP5  $0 00 @0up@ 0+W $0yNNW01,H^W㴁 X U U$1S  p0P p Y#t帱ZW W:1S 1S !p0pPt1<1p!A?pP0  <j 0Gp00p  0 !020'> !RR p0,  0 S01"90 1!(pp00p  0 !0r:000OqxAMzA rgzAzAzAzA>zA{A'{A:{A@{AF{AL{AR{ACzAZ{A,Ap{A{A>zA$A{A{A{Ap@-P`@v  0 DS P: PJ0 0(0L  rPH TXX~ `[y1ap P0!?A1c L\1j`0P!2 SOp 6^ `'Y`` HLaQRpP  rD 6H? `':`` HLa2P. T)XX% `[ <0ap P0( ?A1c\1L!4L1>gfff{A{Ap@- `P`@0  p `l XpPtHu@v8w`0xya | pH!R0BS2lp ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w}0xy yzas|AC-lM@d p$X 02XYP*00 0`40 ` 0 0 `h0&hS} `Pb$0xP 48$0 p4P0`UlЍ00S00P080P$0P8PX0 0 3/$X Zr08,00X0P  NP 000P0 F bP C7|A@-0000000ЍM|AC-@`Pdpܐ܀\MX  $0H010 0 )0 1P$  U   `\Ѝ0 1?o2?hpW<UG'p@-XMP`@X L0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0a PPPE_oR_0]dЍ$0 X :020U0?$0;P0,P,000 03/ `DP0`$0 0Q pH zP0SQ0 03/T +P 00 X C20P0 02PP 08 00@-\M@PX )010 PH0\Ѝ02p@-$0P@ ,Pp 0 .P000pP pO-@`pMP0 0U$0 p0 x 0 pP`\Y )UЍ2 0 -qP00SF$00C 08 S"00 Zf 281 000 0 qP00 0q0 /P ’+0qq 00 0ppd P00 0p0 P00  0p00 0p0 P00  0p O-P0M@ 0p`UT 0 0 03/P 9 TЍ$0 P0 80 0Ppl W 2 0 lpP00SF$00C 08 S"00 Zf 281 000 0LpP00 0Yp0 P ’+0EpCp 00 0R`>:pSX  y 0@ #0 01020D@H0@P X d 0` $0!01020d`H0@P X O&0160 H0@S\Ѝ@A-@M@! `PpGS 0 1pA?!0@P !0x@P 1 4;kSߍ0 w@|A!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@- O-P@ᨍP)m_R01naV!n1SKS᧍U~o p\`ℶV Rv~AM$pҶP ᑶpPW R$00R[ ὶPs1 P C-MPpfpQ@101Uo0|1 0p!]?lT 0t 0p1l! !0 vO|!0 ~F\!0 = m8R4nc010ȁ1ԁ @׵01$ F40 00\` V10㨁 t1P DЍ|A,A|A|A}A.}AB}AW}Aj}A ""H""r}A"{}A@-@pP1haq律1p Q V  0 1 00 PU:p0  dp>W 10@0(0$}A}A}A}AAMbxA}AxAA-PL@B`mQP0n`AQs@- 1`QPpc@p:_000#<0RЍpm_kQHP 82<"0820 <"0Q0P0t0L`000 01noS1010s 10CS1nRfvd@c"p@-pP@mo1QP P2""N0 0 cQpPP0P0 P1H"p@-p@Pmo QP#@ @@(0 @0 @10 4 9/0 4 ;/Y  Ul 40 3/[  Uc^ 0 !0 < 8/ခ PE(_CSe(/C#b?0EL Pp81  P,!, & 0P00 P(01! 010 000dP 000 P (00 000>00QPy  0 00 094Ѝ>^괉dcpc5A0ANAqA@AMbAAA.AAA"@AMA@UA"/O-A B Qar᠃0000LS \ ) @0003@ @40 = 2\0Z\  9J0/ᴉd@-D 0S 40@/0S 6 贉dA@- D0Q d@/Q 0 봉dA0/ᴉdA- @0PS ` p 403/0dU00 A/ R 0Q000 봉d΀AN  0O   ! "`"Рo@-M A@-I "Ap@-@P᎖PpH0. `@@@Dᄊ$0u p@0>Dc00! $0 /@cd 0(0S 0@o/d@0 !!/@-0 !@@-0 !@p@-Px@x(P9  $0dP$0 ,0KO R0(0,04S00!pdHA\"@cp@-@n  PPPDUT ʀ0 ! 0$ 040p`Ad0$/dG-`0p$0PUG|U !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pf10, TP2/@cd @- 0 ! 0^ Q    D $ 10@S@@@d@cL@-0DPO@cp@-$0D0P !;3p@cG-@`pn  P00TS\3 0 !HP10,p1,a(0 ℑ41 0 , tAd@c@-@m  Pl ,00DQSQ @ 0@!,1!,0,q@dA\" $0 0!0 00 /@cddd,0P 0 Q>0//pd@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S pdAP0@-  d@/  R 0pdA@-P`@`00 00  p 07/PPXG0Lq 2/y/, 0 4 8 < @ D H L Pm  P   O R0 P P@ Ѝ@, 0,0 0@ Ѝ@m AApd "/ASA0@- !" 0 !0@- ! 0 !`QO-`P% rpq>U@@Tp  I210@ 010l  P`U pT X  ЍRR@?U  0 @[X ≐@0 4P0ک 2/p[qA@cp@-P @@@@pl  P`@p0/pdA-P`81_Q@0`AOS _Q`AO_Q`A Lp _Q`A L_Q`AR 021   0 0A000S$ S=A+pdAǂAA-0 @Px_T`D0C00cl 0``_T`D@s^ `pdG-1xPPp@ dW 0GSL ,0S 8 0 @0p,0Y`0,!0 B0  W30% W W _YOO@A !Y0 ` t_YOpq  _YN @pdA)AXAAl""G-(1Pp@b0  R. , 0 ) _T`DF) b`a`$B@  A0`P&V P_T `DI``D bC`pd@-@40_Q0`A@Cpd (0_Q0`AF#pd (0_Q0`A I#pdA-PP0_P`@@`BB@C@Ap0SZ  Ahpd (0_Q0`AR#YpdG-0@P0`tW_T0`@DBB@O@A+ D &Vh""""""" , (G  pd@cAp@-@@0SpP 0 PpA-`P8` `p00p 81@ ᴬ0P   8/P Ѝ0t " x0Q  6CQ@ 6AoTც0, ! 0AoXcAp@8%`A@-P 0|!SF &BS &SG `ЍpH!S0Sj  P(A 0SjA1  P@`p2 0@0  L0P` ` 6/P@0 \` 6/ J0` 3/0Si\@\0 0SiD@D0 0@  p@`AcccXccccc/!/!`!//` `! /!v`!~`!`!`!`1/c 8!0/c#c4 4#1/!`!`!`!`!`@-`P@P0@00 p0 7/0P P d`6/0d` 6/ Ѝ@,AcAA@-o 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-Qp@ 0d`6/0 `P0d 8/0 48/V *V``U`3V  PV010!SV0`4P 5/ P0d 8/cEcA-0p@ 0dP5/`P Pd08/0 48/V *V``U`3V P"V010!SVk0`4P 5/ P0d 8/Acp@-D00@ !0 4P5/0 , !pcp@-T0@=04P 5/0 00dp@/c@0A-\!\Q\a0@0[h  PD p8 $p  `0 00`r0 00`j0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/0`0ЍADecDeP1Ec+A##7@-0Â"6 @FC$0S0 XPV0@T :PE@d0 0S B @DT Ѝ0cQY'A-pP@`0!0 48/0dp0 7/0 dp7/0 !!c@Bp@-8 0403/8 0d`6/pA-0` Pdp@403/ ;7/0 4P5/P0@ `dp403/ ;A/-8/48/-8/-8/-8/-8/-8/-8/A-@`Fg8!  P010 dp@`0 Q00 7/!0 B0C(%0dp0C 00C< 7/0  0dp? 1 B85<0 7/ ;30*&40 dp37/1d A?/x0xA- PPp403/ 0 d8/ 403/ ;d8/8 403/ f   P00 d8/JJKGLD0M>0@  R @0S@@9+@T*AN@xx0 0 /xdG-p0p 0`  q_0 !,00CS p40 3/sf  P'44|0 d:/, 40R 0,dp7/40d`!.06/08 d`6/N40 3/ 0d`6/0  !!Ѝ>O-`4M84  V 0 p VڋF0  F P P<#d#D#`#d#d#d#d#D#`#PPBEQQS$0 PPP  0   0,`(0   0P@ 5/PP R0 ?o210(008P05/PP0S (P0帒0$0$0Un:03/ (B00006 ^PP| 0( ^PPt0 [:/0>0 0B ( 00Cp 0 0 0F0  0G 6 RQ 0J$03 ,000  0 C 0壐 000 000p4$00S0@0@00000@ \PPBEQRZ P4Ѝ@03/d03/,0( ކP, L0 0R0@ 0R0?ZpPT (Q <0 3/ R 40 3/J0 0coA$tclmdxcUA>A-PM@0 00 ". `6/`P # 001! 0@0P $ 0 dp7/T1 R `   P ,Ѝ@(0@8p<0$0:0 080 S@   1H0D 0S0009Qd  000040I> 0 0000 8/0 @00 ^,ꃄA,AApcH #Axd!1A MA 0S/@-@ 0S/@-@ @0S 0CS/@-@MM`pP T1 y00000 ͋@P@܍Ѝ,P: h0R1ʖQ001  d $0` pX@啁000040@ 0Q Sp@-@P  Pp/C-MP  p`P): @0 0( 80<  S@ ʜS0H|0D 8  R40 00T 5/00 @00Ѝp@-0PS @  00C0 0S0 0P!:(Q $ <03/ R 403/p@A$p@-@R 0 0R 0R pR 0Rp/00   ,000 0H00 4P5/ @o_W@@W@AW@EW@- o ϜDH R< o    @03/Ѝtc-0 4 0/-0d /40P 0S/0S<0//ᄋd0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LpT P\LX` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPpLpITP,Z`N `Y  \ X B`\  ::0:0 & SG-@`၁rp::S1YLR M"L"8 R ~b  P   d0%S   DPQ  O-P P4 pჟ0  A ` !@T n`pW㋰   Ѝ'b  P  ' 0R S 2/< RKSR  " LMLr D Q @ 00P `RA \ R> SJ @  f r > R"4AQ43 Q!, 8\, ,0@8 @8   ** * 0lP0 u @  f rS 2/ha0S8080001@]lAC-M`p@p0000 00 P0 5/PP pЍCp\2傏@   p@Wga  P ("( 0 00 00$ (0,0 0S?3 㾶0Un0" nU]]PLRPLP*00 PPp008/P  1 000:88/P <)>0:! YP!: YP<: R? p@ P 0j=0:* 00 Ѝ5AAdGArAADžAd #O-0`SP@ Z-0S* `p   P00Z0000 ЍpQ#3 0`  P  0 p@SH 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddhxhx@-2P 0(0C*s` Ѝp0d0 @0 Lp`P 0SQ Q0 ,X_`P,pWQ Q0<00D00 87 H0R1 R2 0SH01H0WH01H0 0ps8 4\001  @ 08 0@@0 0s S#4  4 YV2H02,00@008000@@0 0S%40040ꄋdA-@P2PTD`q@pWA20@008SQp 0sK 80SQ88   I븁D;XD< :R!D01 "0D20LML q @%0@0 0s S#4AQ48 ** * S#4 BR4 0R", W S#,@ 0S#,8Q, 0 ,0000001  @ 08 08 @@0 0R", WꄋdAp@-h2@4Pld 5/`Ph”l0d`d 06/@(h2ld 4`6/h”0ldd p@/'p@-P`@*PPÿP X p"R h2l`6/0p2pA-P`^p@0h20prx$0`Rh?0  0 8/ P ЍA0hp2(Pl5/ h2d 4Pl5/4Rh”d 0dpl07/h2d 4pl7/h”0d dpl7/h2d 4Pl5/1h”d 0dPl05/h2d 4Pl5/PGh2d 4pl7/h”h1d dp0l7/h2d 4pl7/h”0d dpl7/h=dph l7/h2H 4pl7/h1 dpl7/0 BP ch2p"lP5/0p2DX0P  PmKX4 Ѝ,A1A'0&,AKA #p@-P@$^  PPp00pp/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/zs@->0`@ P  B` 0ŒQΌ Q @0T00 P05/P  0 ЍpjAp@-0P L00T0@4`X 6/TX0d` 6/p@ꆆAO-,Mx0@ d0SS0 p(а d0S ,ЍS CS 0C$0P}(0``03/P 0PP0  (0`&P  pꩆA6#Ap@-@$0 03/$003/=0$00) 3/ $003/-$0 03/ %x#$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ s0 0T @ ` BT0 0p@/0@-@ X T A-0@4DqDDa`PU P Py&0 'y R00 C1y$003/P00P$003/P0` 00(d0 U T0X 4P5/T0 dPX5/PՆAEc߆A/O-@,M d1!Q єd0S TX00 P0 5/pP X,ЍOd0T 0C?odP2X5/x0d0SS0pd0S 傭,ЍS CS 0C0(P` 0pPP3/0 0 0 $a h p@0 p0 h00꯴AAAAAc3#ٕAl2#t2#p@- R 0@P5/00 p p@-@9dP8 5/0dP 5/p@ @-@@s@-@00 P0 5/PP \00Ѝp000(` 6/ 0000AO-p0 bԂ009 d;/d0";/0 d;/`0 d;/d0\";/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/б 403/@C @0 d;/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/ 403/ 0d` 6/40 3/=d` 6/ Ѝ[ [  Yf9d`T 6/d`0D 6/0d`( 6/=d` 6/'O-0 c0 09 dp7/ dp07/@0 dp7/`0 dp7/dp0"7/ 403/ 0dp7/ 403/ 0dp7/ 403/dp0 7/r 403/@Q 403/T@0 dp7/ 403/ 0dp7/ 403/ 0dp7/dp0L!7/ 403/dp0 7/q 403/@ 403/p@0d` 6/=d` 6/ ЍpW @pW ;ZX9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0  q009 d`6/ d`06/@0 d`6/`0 d`6/d`0x!6/ 403/ 0d`6/ 403/ 0d`6/ 403/a 403/@ 403/`@0dp 7/=dp 7/ Ѝ`V Y9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0 0@d@t0"409 d8/d0$8/@0 d8/q`0 d8/d0#8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/8 403/@  403/@0 d8/d0"8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/H 403/@a  403/d@0 d8/d!0 8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/X 403/@*  403/(@0d`!6/40 3/0d` 6/=d` 6/ ЍX ZX X [ 9d`T 6/d`0D 6/@0d`( 6/=d` 6/'p@-@9dP 5/0dPl 5/\0\ dP5/08 4P5/90d p@/G-P@ep|0 4`6/`6pW 0;@@ 0<@@0dp 7/@-0d@ 04/d@-0d@ 04/dQp@-@P00d`@ 6/0d`( 06/ p@@/A-@P0  00 `0dpH 07/ PP0 4p7/p@-@P0d`D 6/ 000d` 06/ p@`bO-00pS&Z)d`0\#6/40L#3/d`B?4#6/`$0HSC 403/CBPi {XASZ` ` Ѝ0d`"6/d`="6/ `㈲ 403/P `V U<d`D"6/400"3/`I  40"3/C0@S 8Z=d!8/00d!`:/Xd0|!:/ 403/ B?d:/@0d@!8/`,,40 3/0S: XZV40 3/0d 8/3/?d :/ᔠ唰40 3/0S Z4H 0:/d`00 6/ `d 8/'G-P400!3/o>`d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < <000( 0"(>2AJAp@-@ 04P5/0 0p@-0 d@4/s@-`P᳻@`0000 ` 0 6/P xЍp@Q$ ⡫@0`<SiH8008080(040,0Ѝp@肘 0 00$0fAyAAS# S#|P#P#@-@᳾P 0SU  P0<00 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-P 0 3&*?=0 `p?x0@xpS x0@J4 F@".PpP0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0 0%3?0 00 02000%VP4 P0d/// QX0S/X0@0/-0d$ /p껇A Q/0iAD0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PELqU AEcA%A 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-P@`U$ T  P0UP0p U /0S  \@t x0dP 5/0dP 5/@p&9Ap@-@`TP TkT  P @ph@@p@-@P0d` 6/0d` 6/( d`\06/T00T0app@-@Pt`\00\0dP( 5/p@N@-@$X H00H00X0@qep@-@`UP\00\0d`( 6/p@/Q G-@P?10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPUDpPpmQ  (0L0GP0 d:/ 0dp 7/1 dp7/P0<0USH 00@00  00004040@P  T0L0H00H00X0( $00040(0S  P.`T0XP0T0@`0dp 7/ d`x06/0d` 6/E`p刐X0V0C?o20SX0S<0(@ P T0`, 0o`F^AAAEcAO-0@4P, 5/0P( 4`6/P "pPX0S   P0_ X0@0S X0<0X0H0@(5 X0L U  X` H04p8 0p 0< 4:/04< ;/ 0 'W0L00 4p7/pH0p  p<0 - + R  P'H0 0S#0L0< < 8/04< 9/04< :/2$p 4 < (p,pLpL0S@0SP0<0R  P H0@(. P `>P 8PX0Sk  `  X0L P0 X0<0X0H0@(0V\P \PJV   P` XpP X` `0HP0H0@% V P0S+`P + QY'0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@AC-4MPo@P4k0 0P 0 P05/`P  `4Ѝ0"P 0P P5/iQ|"  Pt20Np0ltQ  P<;PPpd0hPpO() 2P0IP 0 0@0!p0P00  0 0 P0p0 P0$P0( 0,p10P,0Pt(? @(0d!`(0P(0(0  (0  (0 (0, `(0,P(00P(04 (0 ` ֦0@ 00000l0 0p0$0P00(0NQ  PP0(00(00 PY|kP0P (P 깈A,AA}A]#ΈA N,LA@AAU#DA AT#}ATcp@-@p`lP-2&p@M-X0 @-\0@S ` 0\00s00`R`0(0C#p@   t &X0/舋dd0S/p@-`d`@P~}h0 0!T0$LH @   !ep@ꈋd@cddd\ P/0 !8 00 (  , !/@cdddp@-P@dP9\0 0T ?S5fl@0,2 03/Ppp@EcQAd P0P)0@ S%j#k#j#k#j#j#j#j#j#j#j#/P P p `Sl/d/`/\/X/T/P/L/H//</8/4/\AvAiAAAĉAAA%AފAՊAEcAA-@DpD`lP.+ j+H 0 jEc AA-p`3lP@+1W 1W 0W$ @F+d1W# 1C7CW2 03/P0 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0000000 @cA @A A(@AcdQ @-/'A0( o( /ላdp@-@8Mp2("( Rd Re  R C$ R R  R C$ R0 C/o "`PQL$ ,`K(`H$0S2 03/203/2 0 3/P 20S 3/`P l7*d`8$06$h0  00l0P 20S 3/H8Ѝp   ,A2TAcd1AAAXo#NAp@-@PP " " " #p@m@-"op@-Pᅥ@P000DXQ01 01 Ѝ说Ad[AAAp@- 0PQ@ `M ` 8U < 0 ܍pA+AG-`@ pX@ 0sP<WP@ @H S0s  SPW/QP ҴP P Q ɴPP Q PP Q P W U QPP 7/P@-@_0@00/X0 @-(/=A@-N<1 S@-(0 `MS(@(0X001U PЍX M D ARG:@ PB,,00@@D  BD H0H0L pM lN hO dL0P  B^(0 "$ W S(000Q?0@  Q T RC G BX00X00S 0,p P 5/PP H 0 D  pP 05/PP 0  2/$MG+ꋌAAp@-(0 `S!X@ 01S 0S P X00X001S 0H  2/ 0,  2/p@X  D  BQ:@ Q0ꋌAA-pX0@`P  h0 p 07/P  0L0Q0CL  QL P R*P0Ѝ֌Ap@-X0@ P 00p@/A@-pX0@P` \T0S L  0p p07/PT$T Ѝ"AOAtAp@-X0@P 8T0S( 0 $ 2/0T0p萍AAO-`p@㤱M 0SP㸐 0S7 0  P 5/PP,80 S03C S#3P^ \  P5/PP$ 0Q0 0S$0Óh(VЍ 0 $` 2/0S 0 S @X 0  @ 2/, 0  2/$`AA-@`(Pp 0S `p0S 0 ` 2/,p 0 ` 2/$pG-`p(@ 0SPp㸀0S%  0   P 05/PP,p !0PP$p 0S$4@WЍ0S$4 0S ,0G'T 0,@  2/A-@P$(`4p 0SP,p0S 0  2/PPp@-@P`Up6/PP Q(Pp@s@-@@N@-@he0 01 0!0!!01(!10!0(1A-@PUP@`P]PqYO-0p"SMSS# Ѝ0C@ S#H#H#H#H#L#ȋ#H#H#H#H####S0S00001I0S000S 0 0,P5/1 0 0,P5/P`1 0 00,9/P X 1BP0 !0011P0`!BP001UVڑ0S 0 0,P5/ 0P 0,`6/1TQ 0 0,P5/ 0P 0,`6/1TQa0S^ 1S! 0s01 0 0,P5/1J 0 0a,P5/1S= 0S:0S70S S2P0 0 0,P5/PPP 0pRP3U_W\pP 0 0,P5/\ 0 00,9/P0S 0 0,P5/` Q0`PP S:1S 1 0 0,8/11 0 00,9/! 0V1 01 0 000,9/!0U100C/     0 0,P5/aPV@? 0 Sb CC/`t011B/X0`1 aP 0 0,P5/P000@000 000000 0 00,8/00000P 0,   ,03/P:8   ,03/PX0C/X [0S 0 00,8/0S0PPSPPP0S2 0S 0 00,8/0 000@0 00 : 000 ,8/00S 0Y0P00 0 RU 0S3 0S 0 00,8/0=@0@000 0<0  0 00,9/ 0 00,8/ᴚP0`0  R S @S9 0 00,8/00S0`1>  x [V [ [C Y fY @Y 0$000000[   ,03/   ,03/   ,03/0    ,03/P   ,03/P   ,03/   ,03/PY   ,03/   ,03/   ,03/0    ,03/Pi   ,03/P\   ,03/   ,03/PC0 01P000P:00 0 00,p7/ 0p 00,8/0P000} 0Sz 0 00,p7/ 0,, +  P1+ _ 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/Pꠂ  10 01>  0P 00 R0So  ,0   \73/0PP1>  X  X,0   L3/P0S  ,0   \c3/0P 0,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( 吩8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0 P%6R0P0$0(P3/0P 04 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P0T CR #|#|#|#|#|#|#|#|#|####|##\04@\p0\08 043/UP 0 S000 ;@p9/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0QP/0C?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0h`X d,0B"3/PXp\ @v@Q` ,0d3/ 0 T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P0[[n <1QU! !,@p!;!  9/U\0 0\00 00A@-@M. ᠗ 010K/0  $!(! 111 1014!, p1>  ލ #O-PLLF  Q&R4 R(;@;5Q01(1$!)0aVKO0S# OŴ`s圃0S  ` V `0 S3X######ȣ#У#أ####  @T`\0SŦ0 0S  S x 0SQ0S \pP R]Q 840 $0 0 0 0 0  0@ z0 u0  p0  k0  f0  ta_Av\ZpP QQQ A I$p CQ A;Q 6p,A'A3A:wA,AIwAeAFA^AAAswA|A5AwAAATBAAAAŽAЎAAA AA(ANAAȀAA܏A֠BAA AA A%A+A5A?AIATA^AAǏA׏AO-p@Pa崱$!0r0C?o20S (!0r0C?o20SP@ Q= JP:P7 Q4 AP1X0S ΥQ)oX hPh q0041P041CpC/b0pBpp Y ` ЍL0 R 80$00Sp>cA,AAA 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q `P 1S PᵨP(㕀 0S>p@-@ 0P` P@HTppA-`PTX4S @Tt!tPp@-0@@ TCPPP T5PP PT\0P4pc%@-@TPTP0P4C-@Q4MT4P 0p`  8/P 4ЍT4  0   p  09/@PE |PT4 0  2/0 , 9/@ TT4 0  2/ڐAAA-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-MpᲤ@hp \T P HЍOd 0(0  RC> 0800P 5/P M @ 8$D0<4>`P2帢42 4HV8G 0 P Q CPP`P$0- PP ,2 ,4$2<0424242$42(484,;/P00@4$0 0S( R !0R "0R 00  1, 04|1<4t14p1$4l1(484,;/P00@4U@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4tr0Pv H P0 > P0X4Ѝ,A#A2A#% #PA%%%<%%%%%%%%4%D%%@%}%d}%rAA 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0$>p@-P`ᄣ2S @uPppp@-a@0 sP(Pp`PP 011D 0(1S5Q  8%Ab@-@h01p@-`P6@P z P p@ 0t(0 tP p@|0H1x0p0p0@1l0D1`}P0P PfP@0H102p@ذ#A ##A%%ȳ%/A 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-P`ቢ|4S @Pptp@- 0 R\0S 0 000P00 ЍT>p@-Pa00S PpU@t 0  tOPP xQ tt0x4< 0IPxxQ tcxTP4keT%O-M`p.@` tpP  k P ЍO 0A(P0000h0 00S0404РE>L00 8/P ЍOY04 04 0S E> L00 8/PB4X 00 0#Ec A#AA 0R R ?R//p@-JZ1S @ePp$Q gpO-@M`P *0 SP*0 SP*0 S ڢ ԢPU*0SY @00 0 0Y2Ѝ0`pX d0`\h0Pl0UtT=S3: 8t #8;/T=X \S< x 0`;/X=p`T=S00> 0| \6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3: 8t `#8;/T=X \S< x `0;/X=opT=``S> 0| \8/~0@-01 0P Ѝ>p@-@T=X PS0@  ``\6/0  `WT-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 EWT=X \S`PA0@  5/p@0  5WAG-BMPp<U@a 0h#8P$  +PP $R0$=1S 0 # PP  PԢԒb0 VT-X=\R ( 08/ PX͔\T=' S  ` 08/T=X \S  `08/T=X \S  `(28/T=X \S ( `98/PUS  `P05/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/,PUT=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=\@PT=S0> | 005/0 SW0l l 0.POBߍ$Q $]S%?AA#EX>G-`@HPh@ X P G@ 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T} 0\ R`=a0P x G^ XP 01,AT#A#~;AA/A/ 0P/Q/c@-@Ԟ R`0S0`Qd\0@-@T0$0-p@-@PH2Sp$0SpH20$(\003/$@-@$003/$@DA-`Pᒞ@` p00%00pGW10$0v` N``2SB`0$03/H0S <A,&jAqA,A?{AA(#AcH#$#A-@P0S}K$[ 0H"$L&$Pb@a}fcd@cUtUUĈcH$D$p@-@ `(P p@긋dH0 60S @-@,(0 x@0@/cdcp@-@X & R@@PA@ 000S  @ pdcdp@-@TT0 60SP<0p@8h0d,  ppp?ddp@-\@ RPP Q.ᾠ5S0(0(0Զ00C0ppccp@-@MPQf /0PP0(00cS0`0e@QN@P@,% 8 x000S StxMU IЍpcddA-P`0@S"%0S A0\00P\00 0S 0S 0`0I"R$)V` 00I"R$p0, 0RIAQ1 t0 0P003/0`0I"R$V00I"R$0\0S0000S 00I"R$ V`W$ P ,0SP003/$`ƘA! !j! !fP//C-p`P0 03/@P* 0|D0s ns 0p@`l00t00㼑x0  0  Ѝ@-2>  0  Ѝ@- 0 0  Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ@-8 "  Ѝ@- <  0 Ѝ@-<  0 Ѝ@-MpP`P@P   ,0 ` P00 0 Ѝ! @-`P7@P  00 00 00 000Ѝp@-`P@P  s (0P00 0 kЍp! A-`pP@P  Y80 p `00 00 0(00NЍ! A-`pP@P  <80 p `00 00 0(001Ѝ@-  & Ѝ"7@-P@P Ѝ00  $0CQ RR!Q Q @-pP`@P@ Ѝ0P @ 0P 30 @P *00A-`PL,( p0@0 `UT Ѝ< @-,00@ IIP@EcA AI@-@F0 4@- CRS 44 0SR P?CAWAxA@-@P 000@-@P 0SP0S@-@0P 0S @7@-P @ P 0St 0S Ѝ0s@-PSЍp@` @ P P 0S St 0SЍp0  R0 0S00/ SA-`p P`0 @P W@@@-0@0$0 !0@0$O-@ᘑI0HDpF`B0 80E0PtG0@Adt R \ t  $0Q \/ t t t t t ~t ztt R l|tx R Xvtp R D ЍOnt Ѝ蝙AAAAA9BAAǙAҙAAAO-P0tMp@ `Ы0PS!E0DF IG0T@H$H0L 匱4PP0<`!`@hPlp `EY  ᮫tЍd !R8 "!00SA X00X0\0000`0000d0000D00  r @Q( Sr$ (ۀ0 00 $0000< 0, P  *0 0QdP!hh0WAL5H#@-@\MDT0E0DFČG0I`H0p4@000@8 HA00LB4 <P %|  ⏀h00`0` 4$00p(ЍPP !dP`php\|\ЍL5A$00S/c AQ @-@(W TQ/A!A3A@-BP 0000 000A-`P`p@P   03/@0 cAAG-hP`p@Pm@P L@0 4/@@t0 cNAP0 /@- d?3A4d@-@Jt +Kx 'Lp @"G-@P` $(P0Q0p0& 0 JP 0 KP0SD0E $}0SGEF0D 4$GtQ yaxQ  sa@-00B4  Ѝ\AG-`P @9-0p 0 G0F $ E D040 0uU@ A0` 0@0j@?0>HHI0t _P H/0@@0H @0H( L00ЍGdA|AAAp@-`Q@ Pp P $ .ة (pAAp@-P` ɩ@ p©0I"RP Q 00#-, $ ,# TFcEcMbA A-p 0` P0 A@P 2 @P0 0X@Ѝ @#@-@0P 40`CV^^p`W ^^P@U\p@-P04@Pp0S0 p0SSQ QS Up DQp@-@00$0PPuPP00$pp@-@00$|0 0P 0P!00$p@-0@0$g0 !0@0$p@-@00$Y0 rsP P0 0 00$p@-@00$B0 0S00  0@$wO-8PPTpP. @T` ᶨ`P 0$0\=RP 0ᣨ` R V @ᓨR^ NoRࠓ^ 0 R   R,    00@^(4@  ^ "$ ?AAߚAAO-M0@S,Mq) vP7s* 4PPY ;p` 0 `PP pW0  p7(Pp7s,ЍOPP0`U8P0TP 0 080P0T0 00X788rP Pp 0 pPa EPU p`#30P 0PP-[P)  ˧P`80弇 08P 2 0}B 08h P 08U" Hx8 ᩧ0800  7ᠧWP 0ᘧT B88刲 [,Ѝ0S0!4RTp 0PQZ 0L囌 0 P   P0S0!4R  00CSp XPPp[X0  P7HPPA8A@-`QPp@MЍ@ $P 0S Ѝ@M0Sp@-`0P$@0s S@@T00 @0$pp@-P@0$u00C00p@$G-p$ `PP-0000@0PP4P8`p $ $ @04A04B04 04 0S004 04``V5 bP0`V3\0S  0N΅P  P R&4ЍcpQ  1[d0P rJ~p GZ2೔``0X*V`$\ @!< R 1 0$    AQ     A-@P 80SP0P`2PP 0,TP 0%`Q d0`0tP xP pP A 8 8rPU8O-P @MT L`0S40$V 0 1  0$*Ѝd0qW  ZcxP  Q  ``0S`AAAA-pXPQ0 ^`  PQ  P AX   Rk PU0 X @ P R- 0 \ 0$ 0 4D\\\\\\ ? @-[@P`  /0   00P 5/PP+0qp08P0 5/PP0 PP  PP PP0PPH <0 3/40 3/ ,[,Q\$(P%P": P: \ PQ(0(0(0$X00C080@  "x00 0PЍ@s80X@  x00 0}$cD mA-0SL@D`ɏ0P%@ 4@p `30W  pG-@` pD 0SPT%P pp@G-@` Dp$0S0 00PT%P @O-0M@DP00Z `DP[ $0R 9ЍOPJ X! P! "  PP=pW 0S000000C0(P 0 S00 03/w($ӈ  00 0 $0R*Q 0ps#p0 03/0P<Z0 3Y 350$'(ep@-`_OP F`Up000/A-`0D0S A/@Pp 4Pl0 0S 0S PF0S 0 03/}0S ϖoG-Dp`P $@P(G520 0,P00半GA-D`P@P(pA5 2vA]D0%/D0/D(/D(/D0\/D3//D0/D0M300Ѝ/G-D@P`\ 3(pS 0CS 3 (D`Ӻ 0S0S 03/0(0S 3/X 3SP03/3SP0a`GAEcO-0D@P 0`S\ p0/00ps y s r s  K` 0  Z b D0OP aWlP00S 3/4ED3@033 @/O-@P$MLP `$Ѝ3@  00S1DP8`P/ïQ0 0F?oX20S# 0 02 0000@0?VpP D` ុ`Dt3/`P 0 5pP`V` D 0V:` D& p@0S  (  EPn=` p@0S  , 1PU)`$0V:5@050 0S `%?( 0 03/00` pcDpܠc 0V:`0cD_00SFu?oD 23=!2`00=$7`b.$A/$Ec1AFAp@-D`gPp0BRS@pRP >P P$< GTpp@`0,0Spp@/[AG-@MpD` P!8PB3S?0EUS;U%  P  U 1P&SU# <0P0200 Ѝ 0P0 S*40$03/ rA/$AA-PD@`3S AP 0U(p0C 0  U U t0S0A/h=^P p ᬸUꭝAp@-@D\"P <0Sp@8PU PpA-pP``@P0 0A/A-pP`L@~P0 0A/A-P?0`D20@2bR] B^ 6 2 . * `:3R Dp嶝$Dp尝(n0 /(33($h#$@dC-DP@(`Ă <T1X`01(p⸕01e01003& D`(021垟 2|1|!2x1202D0\d1`0 0 00 2S " " 0SB0380ScV0 0 P08/ 0 Px ЍCFd8P`P ᅹ Ѝ&$$$H+$,+$|2$,2$1$&$H),(e/A|#$AA-eD@T_ 3S\ 0P033\b(pSW m5@ &V 3S 80S<3S90003/pD0\rD`P  0ԜpD`P $0˜003 /-+)\s3S  ?ᱜ0D0ЍV(e@-PU-`D@(`003pc?cp9c4 Ѝ00S0  S/8cO-`Ɂ\0S~P U\0 E2#<@T `0S0 Pd Qh 0 Bh `QhpWdMdp`pޝAp@-隁P@0/0lpG-pኁ0\`V3 @ P0Z/ s DP 0S0EH 0\ $P (  P (P (◭i 0S P O-\0,M@0.0SA 0`S <00L0/P/0UC$00 $@P R W RP0 0S-*0( ,0R P $哅( qW-0S,Ѝ\0 E2#<Q 0 eP0 0SPp\pEz#8  8 $ !R!  z'<P \0S 03/ꕙ+  0Pw 010 2$ 3     0 0 070S  a0s#7 R7* V 0   0 @    0S  z#<0S     0    K` _P  X P1z!0 1024 R    0 0 + R X 0 P"  K R, X "  X   XQ HR 0z'7<-0k0-0 A,ALAkAAARp@-@p@ 1RPp`( U:,PU 0 ,0$h( op@+ 0000PG-XMp`@PYk`P00p屶 0S 0 CR %S50% 婶 pP 0S R~k^( 0o 0R^ 0CS[p5$ 07$p(p,p 0 0&pS  W   !R00.0700%0' 2p103 *0"60#X02pSJ $4Q0$W040 vWB*$P ( P (P (ߙX 0GHי0\040 0 8 0|/o20"S R 01 0"000 #0jX !! R0R!0GH⧙h3\0@0 00CS R  B̴. 0" 0C&0$C4'0( 5P$ .P0$S.P 儵$P 00S xws([(X (S $$( $n0,0001 0(0$00@0 0P00S  0 CRS0 <@P6 78Qd}A^DQAD W0\0  P N 0 W00S I0.0-00 PlXЍ,AAA͞AA9A֞AA*MBCBABA):$YAoAAAAȟAA?$AA/Ap@-@~P0 $ S00$p@⨾`V 0p@-P`}@pPPP 嚘P$P  00$0 B,(pQ@-@ ѴQ ̴.A9A 0S$0]S(0S/GS(0S 0SS@-H  /O-MP`}@P0@8嘴 ($,ҩ0@0D048< p` 0 ሴ c 0  P2 5R0CS  080 L0 00 S 0s!, N0PЍO P R0 R ^ 4R 0S$0]S= GS(0@ 0 0wPN T׳Ѝ0S S0CS $4  CS $S  3  00 0S$0]S GS(0S s(0$ S GRS`0xs0`0u00(0SH??^?cmL̠AL5dH$@-@ P  0T T L+Ѝp H`R @ 0R0C 0`\婯 $04$00 0 a 0 0S H⟼0 3/۠ARRG-`@P P(p0@00X\40X0\0,Ҩ 0G/000/C-`@$MP(p0P PP`P<0S0<00S,P$Ѝ8 R ŧPP 0001380<0S0<08 [0H 0t1 00@ L0 PPq= P00PP#T @ PPP`0+ 0 1000000P0TP T0S#PPP 0P0LP AL0L0HH,8:&<00<00800P&TTPP@cO$ p@-P@(` 000P0S @0S D0@P0,D0 p@5A-`@(P0D R )P0,D0<0S0C,p<0 8X0< 3R800B<08ާ000!00 0AT0S PTTPP 0P0LP L0L0H0H@cC-p @R`00f@ ЍP0 0~  0P@@-00 a ЍG-@ P0SP- (`P],0'4pWDy ቦP Pl03400@0 000 PTP:@4pGtЍP@cO-@PP0MS9 (p!0,4`V+Dx(0400 @0<0X0@0\0008008#80T 0TPP U 4`@X`\`, 6Ѝ呯PPPP$A0/p@-@p df0S S pP@0`ph0H p0h0c`?p@p@-Q@pP @0/(0, "R0p`@0/(0, p@-@p`PHp@dA- T@`fpPA @0SE@H@c@-` MPf3@Vt (C0CV5 a?V0|00 a?C0CV30S$ p0S01 iЍ2V 47CW0CVP 1VQk Qk Q0 S 01 sPWp0<H,p0S1 0  <p0S  q`0 R ,|000S 0R0S7 eP-x%^x:^Q Q Q0f ` 0V0 Sp HV@  {T 0$0 0$0 Y W`P |0 0 pl07/P* 000OPy "c|fh@iU@pUDUvtcnUcH$D$p@- @e ` ?o2R0S@ P(v@P|0(S  P@p 0cC-M pp\ex0P00 @0@T@0S7@  P0 Lv@Ѝ` @0S@X V#@0S O@ C@P ,@ RBo0SQ S0#S@1@!  / v@Pcs@- d@P& P0S ` Hldp` Q(T(`,$ 000000x0ЍpccPp@- @d@P P00寤pcA-d Xd@PP `0SPU PЍpP0x0p,  p2 PPp(Pepp PP  H|xVppp Q((p I0000x0A00} PccTc$@-@P`p/,  :$HIp000S ,pP W Ѝ@Scp@-Pv@V@\y`v0 p(Hpt?@-P`v`0@00H0@00<0@ +p 00 0  $t0 o|`"T嫭 @0 P[ Ѝ,A,AOA/A$0 0!0 00 /@cddd0ʃ0$R/ - "^G P Q H0Q -1CQ0 /@-:10/ W@ WQ@-@ :04Sh= HPh=0h=h= eh=0q$G- M`p P@z 01 0SđS: 018#(!#( 0 R R0S 0: 0@ T Ѝ@-v0 $2@-@vT0 04-A-@`uPzW1DT" l=S ut弩# h0 $P %eGm@P8P0  mh= \AHd@-:! Q \ \ !R0100  Ѝ@-@ 0 OPЍ: Q/O-MpuPp0@000000 00h]08ի0 Pi 'P  d]!`ܳծ8P|T]PFm", 0 #P8`G0#` 0 \#P 0 <#P h=0h=h=0h= 0!  Ph= 0h=h=;"Ql0l=02$@Z00 0O2`1081 aaAaOh.D2 b08"0 ,"!O0"+d0$14Ѝ80#(R 0Svh0Ssl0p h=0h=p :!t !x !ehQblR\ 4PXp  R ~PA娫 @ЍOcU B"pTtXx\ T<P:e@R _@t0 S 0t0x0 T@d=S M@p00t0 0x0`=t0d=l=Sc < p! [,A/A?Hd?h$EcMbi$,vAAӡAAAA@-<0DT 0 !0  !@c0@- ! 0 !s@-P@ UT`J 0(0C0Ѝp0(00HdG-P@0pS` 0Sק00h=0h=,2S h=0h=,2S0P #.P0C ,2 20*w 00PX0PGHdA0/C-h=@`M 0!P$1!400#S0 R  h=$  pWR <h=PP Q 40xU h=`   0%x,Rߍ < h=< p $`   UߍC??G-@P` {cpTT-0GR9`-!d=S@h= F  h=P<h= < h= h=0S0*1S001 w0 0@a0 GNP T< 030p 0S 030G@??EcQs$p@-@Z1Qp, 0 /Hd0 -  /00Q/-0 /@-r 0 @-@rT00-A-P@`pP Vx`@P V@P @UA-Ppr,`@00 pP W0S  PP 10SSHSa10PSS :USa^@-MpPer`@,Pè^ m2` ]800000 0`P 000010040 0800S 3/00S 10S!$00CShx$`x$`x$Xx$`x$xw$c4`8`(0S S0 ЍS PS0000010000C0S&611 0 B Rdd&!$ \,V 0S 3/P8a`p0S 0R S 0Q+Qe在0000PЍ@苨 0 SR 00SRR`Q:40078%0 0 %0  `P 0FSuq@ k Ѝ@O0S80 080 0P  ?Ѝ@00 0P D00S 0P  x0 p S00`Su 0CS|000 0P  0P  0P  0P   0P   0P  P000 0P~  Pv00Sw 0CS|00Sp 0CSH2n1 (0RjRjlP`i M000 m0PC  e0P;|  ]0P3  U0P+  M0P#   E0P   =0P  5P 000 ,0P p P|X0RF| |0 PNL,AA?}BAAA_AȢAAAAAA?A]AuA/A@-@P p 0S$00CS (0SSPS@-M$@\ ( Ƞ,Ƞ 0PЍ7@-0PS @ P P2 " 0  P   Ѝ0@ Ѝ0!@-`@V Pp1:T0P 00$0%`b0 P   Ѝ@ Ѝ@-@\ (8#800 mPЍO-P4`0U@DHp@B 0  ЍO/@N  0IJ <00D`@0000I?o2K3H0$t00|0帐弰`PȀpP 0 0<P  ЍOa ЍcUSBCR@-@  0S   Ѝ@p0P CR)P$P$$ $ă$ $$X$$U  Ѝ@8000S 000 qP ЍS  s00 0S  P0 0S s00CS0000000 0[0S 0 U U0Q 0 Ѝ@ 0S sU n 3`Rsp 0âU S0 04  \[04]8^<SU0[025S0^0 B0A@ 840_ C <#$` #(#p@-0@0Pok10SZU - U0 p 0 0P0 0pp@- MPd0`@00@00 00`PS[,00$ 0@`Z Ѝpԫ>GBX!@-@00p@- MPp0`<0h0@@00`08 000 P&[000( 0@`dZ Ѝp輐$?vZA!P/p@-Ph@1 01  hp@!p@-P@"T0SpPT0`pp@s@-@`PTЍp@00S000 DЍpp@-0@( AR P0(00(0C40(pp00@-M@P0P Ѝ000  00  P0P0@-M@PP Ѝ000  00  P0P@-@l0 Q 0 0>0HJP Ѝ,0RkP 0S 0?!@-P`@0P  0 00,     `0Ѝp@A-p@`rP %(@ pl@P({ pW< &("( A-`@pJPMP 0  00@@ 0j % (`6@P (E`V<Ѝ@&s@-P@`* |D0  R= 080#80C?o2S  cD03  Y R@0 D0  R= 080#80S0S @P @0  0L0 0nЍp@ p@-@ PPp PUJitD@0~$  & ~@0  { p@QA'G-`ဂMpFi@`P奟T@ <C 00H000(00 ,0L0d0TH` P@ $ P0P  ןЍ nPP0 0>0]H0@00S 00S 10S 20S4ᴟ0P   0 SR0 R2R1PMP` l #h#Yh\呜!`8V@90 $?,AAcAAΦAAAA-pP`@P00P `0VP  #H    @- @ @G-P`0@00oPH jL2H0L2 ЍG[RU pUL2H P0L2w @ @TЍ rP0 #  Q0" U-.R0W30B00Pp P/O-`eMPgp@ U 0(00,00 0$02P p@001 00 0P0@0@! $0 P\-,0P P 0 S,0 00,0 00SP  X00SP eߍOJᰳ R 00S! 10S 10ST wP@   PR0 RR1 X 0$hPZ*080啑 9kg=0 |G^ieߍ xP 8\P,AA?AAcA*AA_ANAAA-@0` (@01BT Pp0 3@0Ѝ(  (0k@-1@00  4P  0S$@oЍ(?@-Pp@@0` T@D T h0 0 0 h Ѝ@000  Ѝ @-8@0,00Q #^  P/0@-M@PP Ѝ000  00  P0Pp@-0P( 0CR@00(0 0(0 C40pp@-000 DP  Ѝ?@-@ P@0  0 P 2f, aЍ@QAp@-Pp`h_o@P 0 0 0 i 0$ k0/ 0$  0$ m0/ 0$  0$ 0/ 0$ hp@H@-p@P>T` 0$ R00@DR0S h0 0 0 h Ѝ@(00 Ѝ@-0  O Ѝ@@@-P`eP@Hp x =P H Ѝ@荜8100(00,00 0$0< P`@00 PP  Ѝ@tp0Sm8  P xer0  Ѝ@0P `  0 SR0 R2R1P,AAcA?AʧAAs@-`@P P (0  0` P Ѝp@@-@ `@p@-Pg`@ "P00P `FaV\P  ` $ # " pO-SPG@:GpP0 H2L2H0L2m00Y HO SH bVL2H0L2Vp9!H00H0 oP*!H0[0H0 00 `V@P/s@-P`d@\P W00X00088s0\0Ѝp@Ws@-(0P@ ?@@R@3: 0`0000( 0V  DTЍp@-0#00 lP  Ѝ?@-00Q@00  0 Ѝ@-@0  0 Ѝ@-@P@0`0 h0 0 05 @ ЍpC-`$MPQd@尚K#` xN)0(00p,002 00 J`P c@ 001 00 6`P c@   c P cX傗   P0P r  0 SR0 R2R1`~L00H000 `PPK 8hW0 0X0 0~0\ T$ЍCq,AA\?cAAAΦAA8AA?]AZ@AQAAĨAO-`Mtpz@d5P005]PP HXL2H0L2%  % ЍO505HEXWP    ((R  mP\  gZ   PXL2H0L2\5 0500\008 #8a%@-@M`pT DP00000R !X0<BP h0 0 0 hЍ@000ЍP/@-000 P  Ѝx@p@-P0( R@0(;Pp0< `R<pp@-@h嫄0 0 0 h@资s@-@P`TЍp@ D0 4  000]ЍpC-(P@p`P U nR ЍU@000000  @0``PE_oPRPU@  OR@- @0@PЍ@-0@ 0 0@PЍp@-PQ`00R@R@BTܷ$$$Է$$ d0R a0L LەPp Q7@ABF@-0 0 0sЍ@-  0iЍ@-0 0 0_Ѝp@-@Pp\P _<`Ppx HPUp@C.'G-`r MaP@堘x ᣘ ~000(00 ,0<` P@ $ 00P l> Ѝ PP wD 0 00004G>0@0dpS2P0S 00S 10S 20SR0P    R 0S0 ĵ1 ĥPR 0S2 ĵb0.080 P00$1@,AAcA AΦA+AΧAA-Pn@pCP00P `0VTL '   &/.p@-PQ@T T@DT꠼$$$$$ P0T `08 8奔PpQ7@ABFG-p0@00PKxPHPL2 0HL2P ЍGbV0L2V H XP  akP L2HP0L2? 1  Y!  00 `Ѝ&*P/@-0$00 ,P  Ѝ@G-@00p`P(@ 0x 0'x`S@dA_o0hR&hQ  BTS@  p`'t&dp` 0 ( IU 0    @-( PO:bb0]bEc@-P@`p2P  0@0@DF  0p`@J Ѝs@-P` @P3@ D0F@T@@ 0 P# Ѝp@T  "@@ @ AOCO R= 080#8S S S @LЍpLAA-p`@4X@@P0 P@0 @00`0  @VЍ! C-p@MP`4Y@@0 @g0 0 0`0 h@YY T傔@Ѝ`Foo0b0@  R`V00 aA@- 40$a S00@30 PSP: `0P" 140 PPS 00 $ 0P 0 pS  0P0 @S Ѝ@Ec"@-$P@z@-@h0 0 0 h@O-M@ pP` @` ( RЍO 0@ BD0P40#0 @R03`1:0D00`B @0VPЍj& R000Ƞ40# 0^ @@R::P ,ˠ 0 0 Q0  Q0`B @D@0C-`M0@000P   T\PP H兓Ѝ0H00poPL2 0L2H000 0 >bVp0L2pV HU000000 ' iP L2H0L2{00600Q - 2W0A00`Pp rAO-`0K,Mp]P ^   000 (00` P,0 $ HP ᚔ,Ѝ0 0$0D0 @0 'PH@0p< 0 0S;9@00C2@0SsK000 PjL0?S'(0P    0B?o 2 00S0@^00S 10S1R00S2K0?S4@0@pn p0 pg0 00`P010 pW봡8Z  p Xu$ $P$P$P$ $P$P$P$ $P$P$ $ $ $R5pD @0p40 S < 10p$0 S , 0p0 S@ 10p dpp0 p\0 *)@ Zpl$0 0 )@ 0 p0 p)@p0 p H0 p 0 lp  0p <8000 PJ oFR00셟 p0 pS괅 0p0 S{ p l<00 Sk 00pp0 S@[ x<0pZRp Ԕ 0p嶡W0 SB 0^  0pF 0 00S0 M D0p50 S@  =  0p%0 S - XA40 q0 4l40 14 0a0 4\&B 0 Dp( 40pS+0   0 p< H0 p 0 p(0p  00 0 l  H0pp  40 2 p0Sf0  0p1 0S0 Pp1T:040 xP L9011pW0H#40H(0 0a@0 0 040J0@0 0 2@0 v0  @0 <00PkH  t:P h_@,AAcAA AA  EcVUUU"`A`A U0թA@-PpJ@LP㣍@`800`Y0 H0 `I0 `J0 E`@0 !nt40 0 0 < <  K"40 0 0 < < @0 00 !;@00 ?  f??P P Ѝ0 4J T@0*@ 1L  >;5@0:@005@0:a.*aUP/@-000 VP  ЍD@0@-MP@PX0 00 A1P  Pg0 刏Ѝ0b@AG-P` @P 0   NpW@-@PpY0(`0CV0,  @00V$@55346x1V0004@ S0ż00 0:0#$$S  !S S0!) Ѝ,0 <) 0R 00 T!3!5 Ƞ #0##<00 000,8,̠00 0 0'R  0 0o@A@-@h{0 0 0 h@{G-`p@P`刁刑 T0|!|ˎЍG 04 8?  04!8@0J *0J8#8 S 0S 0 90!Q" Q QR!0A10@ P0@ 0R! 0BR@ *   9<0 0S8#8@T`Ѝ?@"ABAUA@-@qP @Dp@-MP@`cPP0 00 `A1P P!0 BЍp@@AO-p@`  0 P!Ḱ帠`PIPE$      0  PP P PD HP Ѝ,VX( @AsA@-@@  `p0PP 0S SL0  Ѝ@ ЍO-@p@pP #p&dI1 @7P` 峍<`@0  LV Ѝ!@D; 0@1`P $DU@sAA@-@@@ @Ѝ 0P@@DOoBO-Pᬨ!0H PH$ $ p` ,0  (0!0$0P pW=@sAAP/@-0$00 ƾP  Ѝd@p@-Ph@u1 01  hp@vs@-`P@0 Č  \ @D\0 Ѝp@ L(00"(Ѝpp@-0@( ARP0( ;R< bC< B4 0ppp@-P@Pp@0pD0  R= 080#8Spp@A-@`pPP 0  0PpP˽@P  qCЍG-P r M[S`@庉U- X 3000(00 ,0<P `@ $ 00P 8 t Ѝ ⊼`P ,L  000$G000@00p3200S 00S 10S 20Sȉ0P    R 0S0 ĵ1 ĥ`R 0S2 ĵ0208 0b P<@000$@,AAcA AΦA+AΧA07@-@P0P Ѝ00 >Ps@-`@P P  =  0` P Ѝpp@-@PPp   _Pp PUp@'@-@P`pP 0P0 ЍU  @    0  00@-@pP`P =  0p`妼 Ѝs@-`@k 0P V0 a qZ0  i@P% N ]F U> M6 FU 3PЍp(  PP @-@P`pT@  @ $0  p     ЍA-@PPr@0    ЍAP HL2H0L2 0 009HbVp L2H0L2 0 !*= > SW  C00`pV  F\P L2H0L2  ЍG-p@ `APCQR #U010! A-P@` 0$ pE\:) X0 A\ ^G- P$`(p,00 N\: AY Y@0 G V @ AT/C-@P@@0$M,>c 0`YЍcP p@-PH0 & @4= P t1  0p@蕟pc@-@xPt`$0M\p=P t1 0040 000p`00ᯟЍcG-p0P 6 0`0=x0@U  Z40 0 0JЍ0 00:/p cvd@-@( $0$$"6 0=@軞c@-@`Pp<<0$M(}=(0 00ܝЍc@-@dP`p$0MH`d=P t1 (0 00ᓡЍc0@-P$0M 0 0 Ѝ0$,$@-(0 0600Ѝ$,$@-@O 1R0@-80( 4@"6 0 =$p@cA-pP`@O^ T 0pA/@-O@}s@-P@OaV 0@ (6/@P@ЍpلvdA@-o/@-p@-O@R_t1X  /0#!0$+4l1t1h!@0406U /0#!  0` E!1 0`10\10X1媅1Q |噅Q l唅h咅d吅8 > EP"1(0`1!,0\100X1401L01P0W E0 P,p(ЍA5:6p0: 0\1?0~.`1*6p0:@0\1?0?-`15p0?0: `1\!~-{`11 X1P0\!SH00t:@ o(ЍA@lAlAiAHB,A %H%%/A%>`>p@-P@RoCQpt! @-0@( UP/4%t1/G-R@#`PST1S  czP ́QbyECPZP`MP1QY 0 G`0 GVPmTT^2 zGEcA@4@p@-@R_⥛T1!0CST1Szp@p@0S$00"0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0 P 5DЍ0A55A@9AA-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 t9<l=D=S  L0 ,9l=hml]衆^A{AO-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P DwT-X=\R6 l 0;/ 0P4xVA@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+~XT-X=\R0P  5/x0PX0 `<T=X \S4 h `08/ 0 蠆AA000 ͓0\S❾p@-Ph@;n1 01  hp@DnG-@}`J01吀011S #S3P11011S QxPP 10CS1yMP@cp@-@mP 10CS11yp@6=  -0=X T=\`S4 0h /D A-@P`}X= 0\8/  D=S1B~pWo<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/ Ap@-]p@1-P X5= S-<<A=0=,0>03p +A@8A 0!< 04 0 (   !/@cdddO-P@`0ȐpW #  Lᣥ` V -;0000@@ T ЍSA\ P/0 !8 00 (  , !/@cdddp@-@P Tt9S 9S 404 0@a 0 (%p@ %Ecgfff%D=S/p@-@=P0C==0CS=>3;3p@hBA-=PS`p @PVD=S@ 0;} &=@S蠆A-@p !P`P  0P Q- 0T  \BЍ0A S  ,5 0  ꈭAA@-@00PPЍ7@-P@@=S 0 7 00009Sd=000 PH=SQ  m09SP%X%X%L%X%X%`%X%h%Q Q   Ѝ0  DG-0Q@pPxh0MQ w0ЍQ o 4=3/|7S ($h7N>0?0?h70?|7S 0 0@a 0 (m$|7S H/ox"ɜ"0 \  R # N01lq NBAEcgfff%Ap@-PMM@x#P00C0S0ۍЍp S;0#0Q0e  Q  QH @=SA a"Q{  Q: @-RX"QN ["Q[  Q* BQ@-\ RE"Q 2Q*2Q-0S00?600 {@2QQ 0CQ0Q 5>8#8So T` M0SS`  /  ("(  @=S d= 0 CP6M0000@=S d= NR d= 6M0@=S d=N0@=S d= N09S >S$Q:0SKL  S* 0C#1L 00 (M@=SH0QN0 N P%F*+:iA-όp` 0P@aP 0 `YP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S( S S@@n R 3 0tt{ h@Ѝp@S@ S S@ S@@S@@Ѝp@AO-@lM@=S D=Sd?`< ,07=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 06 p 0 P 4 0 03/039Sb.030@]  EoP303TW ?9S徾PU 巾PU 0S000000C0_ Z0(P 0 S30 03/pPG2 0 儳ޡt تPPԡ\"(0傿)R d- 03\ʔ#G   0 aD9Sㆍ P0S ` P 0!:> *00! 420a08/ᠾ(0"0D100 0$00KC195 S) 10170< :0!`(0 501=0,0P(  0\!X}.d=  P 0 H0 0YXZ Z!0  b 0   0 PD10=   =0C== S-0'>0>p(ḙ@AA-0=@S 3/`pD]U  y PP `V|2}PT=X \Sd 2 0``6/T=X \S4 h `` 06/  NAA-S@\`M 3` <3 L6`0 `ЍPU bVpP Q0E?o2P0S P偽   JW00`pPVPq3<30A-MM@p$PPq`l$A0Vn  V7* V  V @-R ,wx $VG ? V Vr  V@=S0 S0N0D Sg*$AS0N0; S06M05 AS0N0/|#VP+  V* BV X RVd=B @#V  ;0#VV  BVd= 1A *J0 ᧼0 ۍЍ \ R\P@-R 6  - J P Pd= 4S0N0 S0N0 VAS06M00 PrP 0C. P 0SP@-:R .0?T0:@=S >P@=S 9S H=S S S!Y0>0P30 00PPz0 00@=S2Po 9S#Pk 0tP Pd P9S9  09Z gPP S9i*F%-? S/@-@pP`,M 4 @UI"0 @,ЍC-3@@DM > H=S  CR)N <G a3@ > d=;d=9)"" 2PP 3@. >DЍC> P@ 4[0 l U CI@PV0@0 TP3@ > U DЍSP- 1R >  =H=  S9S `P^ PP0 S 30| Q ;S3 #d`P{0 PP` V@p * !(#<1@$ 0d- /p7/@=S/D=S/=G-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> P=0 .:^^XW3XR=3 ,=3/@]G`O-@P@MY,=3/`P0@= Cyw*H=S989d=0d=9S1%1%1%5%1%1%6%1%6%`P  ?< ?989H-R9  ;S ږo #}> p ;d("( ;px0} 0G0 @9  )%$ ~  d=   d=  d=6   d=  :S0?ӥ=t /9S H=S)> L <H=S $> CN0\ ; ~9S 3   s9 : 00 x0======H=Sp3iYh3f 0>>0.>0R 3;@030)9R3S2壝T=X \S2 d `P05/Y 9S HQ  9S9tR:k@+R0 0m`Ѝ  H=S ?  00C0S0020ӕ fڮ۾=-  P  y `yT-X \R0 ` 003/ tT1XHx<`T-X \R" D 003/T=X \S4 0h `8/= [0=S0- 0F@Q bH=S 0 yꁮA  -%3@2D 1D.@8 .AdARAp@-P`Vf4P@@MT @:Hp0p@-@2@=Sp>PS 0CS>02lup@>S 0CS>H=S >S02p@bꜮAC-PpMzAP@ n`h@P $Ѝ1Y0CYD1Ye 1Y 9 - 09 !94P@4 =#@=S M\1Y7 1Y. Q@P#@= S7 9S    @N S 6 y4P@3@ @h0 @0 0~j@P4P@3@ WH=S@2iii9iO-@=@SdM  @P #X=\@T͔ \4 h ` <dЍO/0 000T-X=\R0 ` 0P5/P  . T-X=\R @ 0`6/<00p  0P 0t+tw2 9S2"ἴ'804;[:9S { T-X=`R" D 0p\7/=-0C==0=1 !.& nT-X R$ H 00\3/00` (0P㖯! 0@*4/w= 0.#3 ;3& ET-X R$ H 00\3/<0 0` 0 P▯4 0)w= 0.3 ;3 T-X=\R  0P5/` 0p`1)S q S  BS T=X \S=4 8h `P#85/= /3  d=0S P 0=00 S0( z0=T=X \S`02 d `P#  .mD0< 01(320@@00` P! (ǟ:|"!(.$΃$ *00! " ( (.@70 p07/0)0RSЪ zJP 3 5*8S00C8uM X*ᐘ0 0 0W|X"ttLs e`P [ p0R_ 8P 0/)` V0%.F'K+~Qp  Y0H(མ=[)0@%\u= -JZ %,u=0= ᓙ0F&>=~)0 S$bP uX r r r Ttv rVtrpr )pXG&n` K+Q 0 /⓱w0H(མ=[)0#u= -JZx#|u=0= -0G'>=np S0 0 02_0CS񟗃XE%F%|E%E%E%F%d=0d=9S9Stv `43/+jd=0d=fH=S >Sl"PZ 0>W9STd=0S9`S 4Q`PEUP#D뎄 U >^pP>Ph` 0$ 0 0$ ps`-00 02` S02́"0000H-Q0R RJ RD2G  0> h_'P``:g>  ".L0>YP 1>#F&U   0e1  ?& B22?2 ?"LP0C.>2>2?5?# R #.{BttoD@A@@(e@ǮAծAAAcXdA(A?A`AtAA,AAO- @ $MP( q $Ѝ] ȴ=iT=`X S2 d `P0\5/T=X \S4 h `Pp85/0D= P0D=U_}0 4"P  dHPXB   BMq0p 00 ppD=>qH}0wQ R*3q0H=H=S10S"t)q0H=0 000X0 0d1!42# 0L= q( 0(=v pq0H=0dp0 0 1!ᬆ2# 0H-P=R0&SS+ 000 j P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=<H=S% S% pH=帥帕S L}dd:9"a0@gtpPd :9ȏ"a@h 00p< 02 t=$2(x=6=⾀ᰀö]j44=4!8=141:1:141=1=1=1 =)`@p1X 0>9/  +>pp1a  8+>p0T8<;^j>0d=$1R| xH0P-d= 1R9 <9 p@-@:P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( K/,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002`pm8: x0@000X%TV%g%V%xW%xY%Tj%b%A@-@4S@/G-3PA@,p0 <300Y SH|bVH嵯3<3o> - 2X>00`V  "CP 3<300 UHG蒯O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S 35ͳAXl%n%n%m%x[%A%@%4%D%p@-0@P&pp@-0@4P PDp$0 0!0 00 /@cddd-0 ,0/-0\ /@-00l@ 4/Ѝ@-0 4@4/-0d /A-Pp@`T d08/< S   S Co    / 0 /c$@- ? @cp@-d0@#0?H1nP0 0110  00p@Dchp@- T?P@H1`S /P 0 p@0/pchp@- T?P@H1`S /P 0 p@ 0/pchp@- T?P@H1`S /P 0 p@40/pcG-,0P#0?H1S@j/P0#`ᔬPhQnღ0tp000!1-1-10-1-!03/0 P1UP!؀0!8/10C1101G蚦c@-~M@R P` ኦ/880U VA0cЍ说AAA@-<0DT 0 !0  !@c0@- ! 0 !G-L1@pT`,A- (\0@ R'3/# \03/\0P$3/00S "YZ x0| 00++R4Sx00x00 1 PxPh\0@3/ PU`0 83/00 (P 05/ЍGchdcXmdI0 0 0L \00P00T0!3~%@~%d@h~%p@-@P 0X %S  05 0pp@-@`P 0X &S  0U6 0pU 0\00`00d0p d~%~%~%A B/o P" RA-P`P@& p@" p@OP@ 0 ? ?00??CS0cS@@-@`08 3/ `0$3/\083/P\0$3/8-lM 0 f lЍp@-81@S@00tP-1-!03/03/81SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p0-181S-1P0 0CS-10-1-!03/*10*1*!0p@/A-P`-0p9@@ 4D1S H!R 3/0H10@ 0 0 0/`=-P 0J''0E' P;CԮ4 aphdXmd@ *08'1Q0@   D-1/p@-@x`tP03/ `V81 0CSp03/ 0 3/p@d_03/Pp@-@tP81S@  03/81S 03/0 03/1!03/81SS/10!tx4``8 #86/,!03/*! 0+!3/0.!3/81S t#0\` 6/t \`616/81S*!0@ 3/ 03// 03/*!03/0`1 S 03/-!0p@/,!0 3//!03/0!03/,1Q@00,1&10/!!R !10!&1/d21S/*!Q00*1&10/!!R !10!&1/O0| 00Q  Q  BQ*!0 &10/!!R !10!&1/*! *!*!0*1,ltG-@ p?p(,^`PP H1SPЍ ,P  0$P 05/pP 0  5pP1T 0lUPP00N 1TJ t1T0CT 1 P 1?A3c0c\t]t@{t Ze1@Xt@jt@mt1(@1(Mb31S/ !t       000 `0/p@-@^`ტ 10 1@1  ` `0d 0 `0d 08!@0 0-10BRS-10-1R-1@0-10-!t3/ᕢD1Sp3/0H1pp@- ?`_P0@ @003/ၮH1S +P 0@0SpcG-P0`#0?2H1S@*P 8!(pR' pP⨏YȀ6$0( S S00@ 0990`1S @1S bpP,@ ѡ,0B 00351 p"  4!  *!?   *! +m R*!4 1!4!0)1(0S`1kS*12!0k8!0GtpR/1v00q R0 00 (0KS0ږ S~0A0R.1.10.1(0\1`10@1&10!!RF !10!&108A00 1 10 10%1 1 10 1ᜡ81S'000003/08m#!Rj #1fR*!1!4 *!*!*!  }S*12!0*1 0 0 0ccO-t0 vpTM`? 5@PpTЍ0  1S )P P0 pxP 0RSP0@0S`̐@1S 3/P ,`p0H1`0d 0h0S j܂0` dQShP0 h00&0-1@1 -10-181S-1P0 0CS-10-1t-!03/03/'(墠>  !5ؠ ֠0$@=L0K<1h t0L L ,0H 9,0,08,0,06,00`1V1810<1t1D1H5 m 111@1 01 10 1 ᛠ 6 0 ⅩpP0  03/pP3 0@00S-*?aSt Rh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34^JckAMbZehd+cEc@p@-0 `"6 0?"H1Sp@(P 31S ^V 1  10 -p 10 10%1N 1 10 1<cO-H!R (P %!PR %! A(0q 01pBR0  R<" 0" f @W`0@S @DWc AN᝟!  BR!V: !K !  !-! -!8!R:-! -!90@`FS AV    R<1! 0 "03/p !  !  !0@`S @D` BR-!`t6/ ! !  !}$!R ~$5'a(A(p5!@ 0 2/4!  #! #! , 2/"!R "! $  h0A 0,0 ЍO/ ЍcEĉ%O-H1S~ @'Py  tP03/81` SP4f03/\,!03/03/`81 S 0S @0P 3/10u03/ 5 R $ Q Px |  Q $R0x0 x 8!R0 !e `V03/03/`h0Sd`V"^ ẞ Ѝ3/0>  3/,!0 3//!03/0!03/,!03/ 03/t03/ pW03/0p3/ 0]0 3/0k,! 3//!03/0!03/,!03/W0 03/  &1S 0!&11!aV 0V`!p0!7/10C110103/`1 1%1$"!0 o 2/<20S  $0 R Q x0| 00 P04S x00IS 0x003/ Y 10%1 10 S 10 1 Y 10 181S3 0CS-100-1-!03/03/'at!`&`'  兝&廝)! (! (!)! 0110$1-1-1 -10-1-!03/!1S0!10"1^j'hdXmd:ApAZe@-@M<4@A-p@ `0S @S0C0\0@3/\03/\0P$3/l00S "SRH x0|00Q4Sx00x0chdXmd hdA-`0@P0 p0 7/pP pzVB `0H3/ cpPKP 8 `8/ `0<3/V `0(  (3/V`0MC <3/ `043// `0,3/ `0<3/ U `0H3/ `0 3 %pP V8 `#88/0FS `083/ `003/`08 3/`0 3/E$`0 3/V@  3/ЍC-`ph@(h )0 `PP 404 x h2(p2lpph`t ЍhdXmdcAC-@0`pMtP0 0``[ "% 1  - )4p ! 081@0f-10-!3/tEP0 | Q S*  S  h Ls)H60S t0h,0P X81 0CSt,0SXW 0S0@00000810C S񟗽X%ȯ%%%%Į%%%ȯ%ȯ%@%000|e00 8W0K  X[0  0D0[0454eAl1,5Pp1$5t1 \ 0 1 *10*1@ &L$6d#::d`D$0l$  $00m[t @1S0H1T0< 0Q0 1Ѝ000d00@000d00000c00000 0003/c000 0003/ct Pt0 4`x6/  `R006/(cZ0 006/ cR0 003/dV03/Pb03/Pb`0`0081 S= b81 Sx03/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ > < @000;0a>03/ 03/ 03/03/P0,, 03/03/0P 0     0 03/0S` S`0 3/0@S` 03/WZ,AAAA%hdXmdA'AAA%c%%@MAМ%$A4A>AKAVAAwAcAA״AAAAδAAA0@-@PtM0 0 00tЍ0p@-HP0S p`@eP 0ST00phd@-#0 0 t3/p@-"@tP 03/03/pp@-"@^@p@-A-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0fY03 \P05/2 ,P5/2P,` 6/ `V 0@S! V P03\` &N6/0 `xp0 `*VAWHU$P@ 4U0P,U#PA=ANAT%T%@TA]A#jAO-P \h ( ` ,@,4/ R@ WdwT0 0 ,P5/0D(0@0O-P\h@RpC$Mx102c000`0 00Y PP 00$10 0S[Ѝt0S 3/0 \$8/ *T ,0,3/[ t0S 3/0 \`$6/ T ,0,3/ 0`S  d0 R)0EcsA\0O-M0Q05ph` @/ t0S  3/0 \$9/ S0 ,,9/t0S  3/0 $\:/ S ,0,3/H XPPYYP 00ЍY t0PS  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PP t0S  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PXO |0 3/}R0 ,9/p +40\89/  |0 000 l0 X0+ $0\p 7/0 ,P,5/p0 r 0S84 t0S  3/_0 2 \$0:/ R ,03/ ,03/ ,03/ ,0 3/<0S ZP 2"0   Ec$0$P 0#! !0 1/EcMbG-P\ `@0h0p@$S T @@p@0 4/Ѝ  \`8V@0\t$1D 00:/P@\' S"PT0E 0 0`` 0 6/@D ,$@ d 0D9/`FVH0P@`S"PT0E 0 0`` 0 6/@D $@ d 0D9/`FVH0P@`G-P\ `@0h0p@OST 00@0 9/0P@T 0 ,@ 4/Ѝ  Q`4VIX0P@PT`E0 0 8/ 40@DQ T$1@00DD9/0P@T@$10 0DQ& S `VI0P@PT`E0 0 8/ 40@D@0 4D:/ o#`FS `@0 4D:/ ^#`F@-@pP+)`P0 , Ѝ@sU0P lU ЍzAAR0 R R#+ H@-zR@^T#+## #/#+## ##ꓶAAO-\0@@hp)#P3P p@K O Q  hP |0 ,,;/,0 ,;/*0 ,;/0 ,;/$ 0 ,;/"$ <"0 , ;/"( 8"0 ,$;/3- R p  34 8\ 0 08/0 ,8/2 420,8/", 4"0 ,8/$0 0$00 ,`6/$04$0p  34 8\`  0 06/-00-03 03 a"3 p0  yP OS! 0 0 0@40 \`86/ fPTG-P`hp)|03/8 R@ <0@@T@R 40S0@ T`  ldT XT DT@Tp +\0x!40\8G/նAAA,A 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@` 0p@'P "P\s 0T L0D Q 0 0 0 00 0h0 03/A0A AvZA?AO-\0`pQh@P t0S 3/ 0\$;/ Op +40\8;/}O0 ,8/p +4 0\88/ }OWx0S 3/ OT(0,0000/@-@0\੉hA-`p|7Px7@'X0VP`|`hp'V`''d7a7(%0 RT   RH  | R< |  R0  X R$ X T R T +0%$%(%>4%`!@-@0Q !@\0@00A-`{P@0S P 0q@P  PPp@-P@p@p@-0`@hPBP 0 \00 ,@,4/p&P 0 0 0 0h0 03/P 00 0pp@-@P^'p@0,i!O-Pp@(04L'Y 0 S0 0 ЍO0 `P` Ѝ@P`  T0 P  0B@@dAO-@MphP 'l`P ߍO'gP! \0W%p  P@<0 R80S@p<0$Rt&@N80SOʅߍt80S<0Qt0S 3/0 \p$7/ #N ,0,3/p<00St0S 3/0 \$9/ N ,0,3/<0 R@ 8 R4S@0 B#0|r0S&<00  &<0S( 0 w#P p&0"#k& < d#P ]&<00 Rp    S&`mt0S 3/_02 \$0:/ MX0\ :/0 \:/ ,03/XP<00 ,03/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 03<3$Ѝ 4à@  P ^8pP pP#8 ,KMbEc\%A-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`# 00 0"PP 0S  0  0` A 08 7 U P 0, p@:{A\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#90/@-2 ,@4/p@-P @2 ,`6/”0P\0p@ /@-P`p@(@Đ0A\ p Ѝ, @@-P`p@(@Đ0A\ p6 Ѝ, @p@-@P0 \`6/XJ 0 \`6/OJU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&ߌ 0!d!0    !0Gd@cdddEc7@-@ &^0202020 DR2|0S@4S0000 Z2S " Y" Ѝ0@臥%% %%T%T%@-@/ &@@-&gPp@-@P&⑌2020p@-@4@SS&R 0@Ec@-@&@萌/@-00 q ЍH @@-@ 8Đ<0\ @/@-84< ,@4/@-00  ЍH @G-p@d尐PV㬀ʀ 0! $ 0    !& 0!d!0    !0G@cdddEc7@-@&^ 0202x02p0p DR2h0咤0000 垊2S " ᝤ" Ѝ0@ˤ%%\%X%T%T%@-@s &@@@-&⫋Pp@-@P&Ջ2020p@-@&⚋ 0@LEc@-@P&@؋/p@-@DP0`,0Sp$B//p@-@Q P`00T0 0 00DPSʁ@p0C0Q/ P /P  /C-.04@5 01D`00p$M /0. $"44#8#8SP}/0. P$"44`#8#8Sl A/S 0@0IP(#PS #S3#S: S,T@8@ SS# 0CS%%%%%%%%%S ʜ"S CS" BS  S @$@N$Ѝ S @ S D"S(T(@#4 TT90I2,pS$0 $09/I2PS$嶌@0,@BUP! 8C8SM  SF  BS!G  S  S0ST@#h  S  S*  S0S T @#4 T@#0 ST@# S0ST@# 0 00S*T*@#  @ T0@0Ņ@@Y8ƕj@Y9ƕd   @+A @ @d @v @ @ @ @ @A0 0`( "4`#/0s@-@Ph0p2(`l 6/h2 4l0Ѝp@/0P/0?0/ D00H(/0-#20$A?0R  $$D 0 QH$ /0/0 0H00S00rA-0TP@0 `p 0 c(T0Q 0000A S@-#@R 2S00HG0\ @AA-@P` p 0  60 0 0 0 *P(8S_0 A0 O-p$MHS00H@ H(8S`X2XT7 0SP^ 000P00 S0000ˌj0&jjf V `T0`F000C0巌 00((0R0 0(8S0Z   (8S00 b2(p[ 0 㣌 P @0X   P @(8S X0000  Q0 ~0  0 0P0 ,(pL0P$ЍG-D0p唨Z b@` 0X0T0X?  .XP 0  `(=`( 0Q 000( 0Q 000(8S`  0 `202P0 0 (8SI0( Q0000 $Ѝ0s@-@_` 4h @0 400(`p2l6/h@0d` l6/Ѝp@艊@-@4MxWz` P Č T %. P  ʿ/BP>  BP@4Ѝh%P0 @X%P *BP PQ% @ PU $8UQP 40 8 0Q $\$4Ѝ@}U0$8UPLQ\ %@%%%%%%t%%%%%%%%%%<%p%%0h0p2(` l6/0hd` l6/0h0p2(` l6/h0d`0h0p2(` l6/h=p@`D b$\DW [ UD0h0 (pp2l7/h0dp l7/V 0h0 (`p2l6/h0d` l6/ 40 4000 R  00WVUtꙷAAȷAp@-@  40 4# 4p_I]p@脇x{G-D0P唨Z w@ 0Xp0T0X?p  pX` 0  (嬈`p( 0Q 000( 0Q 000(8S  02`020㈈W0 ` 0 倈(8S0( Q0000 l0h0p2(`l 6/hlP0 d`6/$P {Ѝp0yO-D0MP.008S .04005 XpX00p 0 0X`@ 04T 07 00000 (8S\ 0`0000 H(0P 000(ȕ \Ġ0 000 \0 `0.\0  ("2Q0 0(8 SvŇ0(8S0(8S 0 ,0(@(`p0 ⾇0((<RCA0@@-S>  pBFP`(@0So@P 0T:[( 01S <(@ <80A0(P徒1 0p0DT 000? D00000 T ?A-D0`p<0P@@BT0A#6T@1@n(@V:^POV  00(P异1 0`0`F翄@80@G-0T` 0 \p@` 0P >( Q0000 1(8S-fb YP /[~0P 0S0 0 0  0  RX0<( <8T08( 880s00aR1 AG-@ស UHhP%V P $P10CSp!p10W000$0vL0@  GpP 1 21PEc%D H(R/ $ vO-M0P唸[ @ 80@ S 0S S@4 4P0@Ѝ`P@  YT`VzP@(0X 00 pS"+ * 0 0C?o2000 4(8S0(8S05P0(8S 0 0GY Y" Y 2\@ 0@0$叄PO᠃$pP 0Xp  0PD2P080s0TS $<@W@ |<800$0T`P 0 L( Q000 0?/`@v{(0S t(8Sk0( Q0000A 0S$ $ $0 @A/uuO-@ MNU  0 (8S``8`Pp0 Php (p2l8/h0d l8/ 4h 0 4p(pp2l7/h0dp l7/V &1?0tW  V p0V Y <5?UXЍ 0 ⮂(8S0``p 0Sm<80R  \~ X~  uA>a.0 PSP.PS  (Xn39`00 `PP P4D l) P90p0P 0P'">XW ,=00 ,Ѝ 0 ,0p$~P⌂2,2 [0 4P- ( Q0000 P ( Q0000 rP ( PQ0000 o]PPQ)nV 025( P 0U000E00140((R0e0 P 00 !?UV⯄0(8SQ2 Q,0 J4<P0DH$@ X P81S0h0 (Pp2l5/h1dP l5/&0Pdh0 (p2l8/h dl08/*w Y\ Uh (p2l9/h1d l9/U$<h (p2l8/h dP0l5/dvPhP (p2l8/h d0l8/dvhP (Pp2l5/h0dP l5/ [8P Y < V   `h` (p2l9/h2dl2 08~ 0  9/h` (pp2l7/h4 dp0l7/h` (pp2l7/h4( dp0l7/h` (pp2l7/h dp2l7/\0hp` (plp29/h d0l9/$04yD'yN@ @h ` p2l (:/h 04 dl:/h` (`p2l6/!qhdP1@ l5/,8 04<:0PhP (`p2l6/h0H d`l:6/hP (`p2l6/h8P d`l6/vhP (Pp2l5/h0H dPl5/0 P$8$8S uHPU$0 0d000hP(L(0(Pp2l5/h 4 dP1l5/0t2꯴A &oAwA^AAA @AָA@( @s@-t2S P@hP (`p2l6/h d`P0l6/hP (Pp2l5/h0dP l5/Ѝp@A-P@hP (`p2l6/h2d`pl} 06/hP (`p2l6/h4 d`0l6/hP (`p2l6/h4( d`0l6/P8S hP (Pp2l5/hP(0dPl0 5/LXU+Pphpp2(`l 6/h@0 d`l6/`0uhpp2(pl 7/hP0 dpl7/2u0P8L8Ѝs@- @L8PSLXP0h0p2(`l 6/h d`l06/2tЍpA-@P$ ozXUP M2S 0h0 (pp2l7/h2 pdPl 05/@{Ѝ@P/ 0\R/@-@ 0^   \R@-@0U. V? 28 Ѝ@6AAA-PQ+ t@pT'P P $`0d s7\0 @P 0t000 e7Ѝ@IAMA`A@A 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0d @@-  Ѝ@-  ЍO-M@p0 (P $   `0 S p  .(s oߍ      0 (p @0p@-@MP `y  @ @@ @@ K }zw t.   ܍p@-  Ѝ@-@ ЍO-MHR@`L @, B?<00p (008 <040,0$01 @L +!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@h dߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00! X ( S 0 N 0 p$008,0040< H @L B8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@  x  .   ܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lx @@!H!P!X !,0( $ OZ`@ h$(,.`2 @.ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.` @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

*P0&4#000#0PeU1! 0< <0  P `F@0HV@0 00o`V 0  @02 4 iD0<0 Ѝb+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0 `pPU 0  %$- @00 

/PpW@@#x0S0S @X0/PD0SSU0SS 4&/Pyߍ, @ @A7AA׹AAAAP P /@-P1/"AA-@pP0SUA@0A` `FV`! 0PE@G-@P`0S 0X  P @0PEp pGWp! 0H0ppGWp!P @`FVO-PDM %  !  !  ! "+P%PP0#0P%PP! PP0!0#$0P 00#$, 0+<0 0"00 0#0@0+(0 0"0#,00 "`@ 0,p@,`P!` @`&! @@$$p + p p' p' , ,,0, '00#0#0#0# P(`pP!!@!P P%`#, p'p@$@ `! @$0#0#4(#0% (8,%p# p'p,$ !$@8(& @$+  4!() ,, 0,  , " " $* *4 . P< , 0 0#!.(P%P%+0# 00$ 00#0#08000#0#0 00 ,,0#,0# 00DЍt!t1G-P@  P@@P਀` ᩐPP`pP0 `0 pQ@! P A, @.p  q)1 0` p%RPPR$BpP@P@PB! ,"0 @ @  說UUUU3333-$M  $ЍO-R}MP R/ R  ' `p"A W! p1Q0c Z"@@eY 0` 001 Y}ߍ  p  W`0|0 0 pT pTW\ 0p0 PUUUU@p@-8@8P`\p 1001UUUURO-` R R p p pP"AU  0F[  Ѝp PZP `Dd0 0  T 0  T00Z0S 00 @G-MP@P* 2` 02 $  0( ,0 0rZ` >0  >2  >2  >2   /  @ލ0 0 000 00pG0  |0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:[OTPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/c00 0/cG-@`pP0@M 0a800,($@ @@ @b008 <0a,($@ @@ @ST00L00000S !&.LPP &> 0S !&> &>ş 0S " &> P0p0 58/5 0S !%tP p5 0S !P5<< ⽷$ş45 0S " 5 ⮷P0p04 8/؄0 X " $P P0 PU " 0\\ ⅷ0@ğ 0S " (  vP0p04 :/0 Z "  xP P0 P U " 0xx L0\ß 0S " D< =P0p0 $3?:/ 0 ?R !AP 0 0?S ! "0?X0#00tl P0`B0&.088/&.P &>0 &>/P&..00!08/!P 1 ն1!жP&.00l!0p8/T!8P <1@$ ⷶ(1 ! 岶P&.00 08/ P 0 ♶0 唶P&.00? 0@4/? HP ?0P4 {?0 $vP'ލ@l@!A7ƺA@_0A @ 0@-ALM0 P0`5/(@ r@P @0 P@ 0P00 (p7/@ 8]P @0 ;@0xP0 (P0 p7/8 HPP 0@, &PLЍ@@CA7$@QA@_Ap@-`@pMP1 3 /`a R '@Trh pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\08M 00 00 P  8Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 8?0 p0 P@`pPtЍC-pp0MMPSrX@`P `y0 (`(0y7 `u `q`⿾ N 7 (pWIKp S7 (U⣾  7 (h `90 `097 `5`⃾p 0b"!4b4# 0(0 7  (p0h 0p0` Mߍ 7 ( Y ( pG 0O-MP$0?0AP (0p00l  07 00010D \n D0Q`l7D\` R 婰@hR 0T ``Z0  ( l7 ? 0 , l)0l P0Y R ``Z0   l7 v0 , l Y  07\S0lpS WPUZO*Ѝ @,+@p@-l@P   ,ap0@-,M@P7&4\0     000Z?r,Ѝ0DJdgA 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddG-pP3 `4A%T 團, LaT@! PU,QP N  0 0  0< 00M  {,QЍG $c@-$M%`||p0 @P D0!4a000l  e$ЍDJd$c0@- $NG @ ԡ&$c0&@- Ѝ@- { Ѝ@- Q@05/cw^ 0do00`0S PX 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8T0S00d0Q00@Sg/1!t1153J`!01\A  1ES  0310@0/1S01 ЍO16&!6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S,01 (e:AD.@( c, cd&kA0.R  "-" R   wP/P/////RT&$&L&p&h&$&p&0X 4\ !8/P x7S0S/D.@O-`@0u_0Pw>0S4 0!0p눐到0S|@TP Ѝ P @  0 0W   p.cA0 c}AAzA,AAp@-`@PPp@0!0/00007wnS000q 20|7S S S0< 00CS&&&&&&|7Sx8D!0 0<00;080p0808070B;0;P/@AO-@`p0TM^ 0=0 ;j k qw>pWzp{ 3 a0 Yjp7  0 Qjp7  0 Ijp7  0 @jp7 0 8jZK0   0P> 0p !jp7  0 jp7  0 jp7  0 jp7 0 i0 0RP 70A \ 0Y0 SZpp0S (DjY 0 0PT TЍ `P( 0 S0 `` ip7  0 ip7  0 ip7  0 ip7 0 iph/@@B00 S   P 01@/D.@A-P@P"y.\8 8S+ S! S w~ⴀXa` 0 SD200S020R  ?PbS S    00P Qu?0XP `V0P/ P^P2q?0^ P! PQ000 P` X#0SP`h78h7JK400   ` ``0S 'P48S|74XS 00|g6 h78/@AJ0000 000/s@-X 0@^! S R 0 0S0A:1D!0CR< 0 D10D1! 0!0 0 0 00 0n\ SЍp D!R 0S00 000 R 0D10CD1! 0!,0 0  00 AA΀\Q: / AA!  ////p@-@8 MQ1P 00#!" 0 0000 `0V :3/P 1 0l t 10 18003/@ D08003/0<000 Ѝp-A0@8AkA<1@G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::<1@̍d8&&&&0S 00 , QQ  /10@A̍dA0S 88 4!RR    !/K0@A̍dAP0P//̍dQG-@p ڐ1 0" $10$1Ѝd`PX$1Q2S(10(1("Sh 0O }-X 1 0! Б p7岠`71 0! `W p71 P!l `80S0S `03/P 1 0  베,10,18003/ 0`R ᤚ0 9/P 120!S 0! 0X x W㲠`0`4!S 4!n 0 Hi h0000g0@A̍d0@ A8AL,AaAAAA'Ap@-@P:3/P:3/p@-@:3/~:@/G-8p(MWw1@P` ᴐᲠ2\0 0#!"!0  03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/-AFA0@AAC-`@ 1RP~P1US^1 [0 0p1p 000P Ѝ08 R<<  0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*&z@P  L# 0 3/P y@<1@0@A0@ AC-Pp(0`S!R# S 0@ v0 0R@@@N@80S*yPU 00 0@ Ѝ (0 S*!R $ $ $03/P0@A<1@/A-`P@HM p%&40%V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M 04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p +P`Ѝ0@ A@-0<S !  4 0 \ Ѝ0xA0@<c@-@ TP0@00 1@/O-P0 @$N$aA$P 0[ CpG   pGW ` | v0 G$@$N$aA$0PK 0Z  KS%P%G$P$@!@d!@!@0!>#`1# $ ( #$0  #(#< 0$Ѝp0R@-P@0  <0`101(0 0C`  &ЍpG-R@P<M0 % `1 01(ppG0G  0p P 80R %ЍBp$"P//O-<`@ P1IM 01p 0  0 0D 000 S0 0>1Q X 0 0>0SC Dd(0HL@@00C pTS0!@D0\pW)T* `1  T0 :Y  ZIJY ^ ..!.0@P^ ΂ a\aNL^Q !^UIߍ7@AA-0@`1Q X 0 0>0SC0 (@ B@D0R !@D ^P+T, P1  .0( 4?L00L0S 40040Ѝ, T0d0252 5n$YX0Zp0S1 <>4.Fb0|>!\D00D00J S*1 =-Fb0(>!GL00L00S St ' ' ' ' '| 'x ' '2St *Sp 0S ! 0D=D-HP00P0S0Pk xl00phQ1 <,Fb0 =!L00L0yx7S 0450!0P0C2X00Z0Q1 <<<,Fb0<!L00L0Wx7S0X0Q1 ;+Fb0(<!L00L0@0`0H5Q0[0 1 ;+H00H0Q  04 8 <0,S0S P |0S! *0Fb:!H00H0l0S1 :*Fb0:!wD00D0 R1 T*Fbd:!eH00H0X VY1  )Fb:!OT00T0YQ xQ 1  )Fb9!:X00X0A=P:1  `)Fbx9!'d10d1xW !/ A&V101<00<0101|7hwSpm2Sj W   Pd d7![0R 1  @O[ 71pw. h7R7!66h7[071?%0#  1  @nO ?qw>0S㺟)  ;5?|Q 2  Pq<`0S ;!0:1h7 0 000T0 )08W l7 U#l78l70 000T0(5   P! T $P 0P`00 0P  /x8Xh'* 13/?S pT0D$ d|g V 7S 40040 0 RY-1 6\%05 'D00D0BP*1 5 %0X5 L00L0P 2P P00S ! $0L5 H00H0pZ1 5X$04 D00D0_0 S ! $04 H00H0NS x RP 1 3  6`00`07h7 1 3p#03 `00`0%x8W` V , #`pW 1  T5N, ;0 00 00E 1 2"02 yV )% P   I#p0P Q5/1 HR  2"0, T2SL00L0㸑aἡ  @M 0 `:S  0 3/P1  101"-000|7S0 Q85/h7 1A T10T1!l00l0|7S0 Q5/Y 1 000! 0 C c ! 00 000 0|Qy`h0` UAA]At cAyAAjAuAAAAAA AADAAAAA)A;AhAAAAAA2AAAA-ACA AVAAAXA}AAAA@@AAAA]AuA~AAAt c 0>  C  !``$VH,> X> `0N 4P 8P < Sጾ0 0C?o20^3baE0`0>_ >!0>U i V1.N ?`/`0 4S !$0L00000h 0 0[ \5'4'3'\5'3'3'\5' 㠅  P 1 4"F$> >000c $P$Z 1 =  0 =  0SG Q1Sx=X 00 0 0S8x 0 $0[P 0 TP 1 $ 4E0P HE< <P0[0Z0S  1P   PPj 0000I|7S0C00S0S !R 0;0X909!5# ȫ" ##Z#\Q ^ Rʐ 0  0 Ph;h+j000101%0S S S;`4pl!0 l! 1*  :*00 0~4p00p 00(00`P cP 000 04 00|7S.9'8'9'9'9'9':'Y 1 :*l000 03  0  x P1 909R0000pY0@ h71 \909L);$00$0101Yx8U1 90@9(%000 00 0 2S1 808|( 0 a6/ 2" p0 S!-0002021 HD!= 0S!-00C02021  HwD!= 0{PQ1S} 3/z1  HaDP1 `f HQ 0SH1L1 P10CP1S0 900S000000 0P0101B 000 @  0c0p0  |x00q0궱0 $000SG Xb070倀07X 0! [  ,0tP,0  mP {b$0S 101sb000^(3`(0Y0 0(00嶱 pY p|W0p 0S 0080 R ,03/P1 40$4101000t0p0S*WbpP0pz  H0SX0SU0SR0SO0SLXIF^I0 0S`B SE SLX R00 4(40$0[46a pY (  B8#<40W0p2 2z08#S ! (  0"3F000101F>^L` XX[ `Z8]`Pa000(00@S. 1 l20,"|200000101QX^0 KfR0 , ]0, H0\00Z000CC@0 f]`Pxa 0 KfR00S 0 ]0$0$``n0h'?o2< 41R (00(0101 h10p!0h1(10/1!|7`S h7 0d wdP8Wi 2S3060U4_ˮAAAAAJWAA5AKAdAAAAAA_AAAAA'AOA`AxAlAAAAt cAA AA@ AAIAAmAA@p0<0(6*R5`0 0 0 P6`@h004 p0/004 h  u0P " x(S OW@lЍ  ! !B000Sp0p0p06 R S 1! 00 0. @X Xh'0@)4t0 0 0040a6/4`|'R42 H(pA 0  l0@ X 1 2"02(!.40040h7 1 202"$00$0{04 \Pq 40 0@00p10p180080|7SA00S<2S1# 30#3D10D10 a6/% S   03#H10H1HaV1 HkA, qx L10L11S 3/0SL1H100PHPX1  HGA M1S 3/   H6A0 ;09000000 0S``0` 0001S 0 0x5q -0@-@PM0 0 PA 0Ѝ0@Ѝ/A0000S0004 R 0 000u/@-0@|7S2S 000ЍA-`|7@S2Sg 0!1Rc 0pS\:P020100010020 0083/ ? 071 0!GR # D1"022222221 " 8," ZN292S988-#87 0C2c70r0Q   0   04Q   0PP0C0Ѝ3254D.@A-P L0R8pL `@|'R"p(R# #0 83/G?G/ @0?@D00Q0000L00 L00 R  D001H0G-PpaFđMT> 0 Xi (  妬00 4S! Q0 000Q0 S0#+   "0 000083/? 0? 071 0!GR # 0S/S10C1ߍ (0( 0" R 0Q   0   0" R 4Q    mQP0p`F@D.@p@-1BMS@BߍpP` =P@P  `P 0,"0Q  R ,!0 R1Ł!7Q@p@-2@SP 0aS 0 6/p@03A0AS@-@e v/C-@p Ax8TMBRUlQ'Q'Q'Q'Q'Q'Q'Q'Q'R'R'R'4S'Q'Q'S'Q'hU'R'@R'pR'R'R'R'Q'Q'Q' R'(R'R'0R'8R'XU'xU'W'T'U'U'HV'V'V'V'V'V'V'W'W'Q'Q'W'Q'Q'Q'Q'Q'Q'Q'Q'Q'Q'Q'Q'Q'Q'Q'W'W'h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍC{P7h7#20h70#8S >!0R1ā!!@R4OPPa|4V@  PP` 8. 0000000Q<<0| 0 0000W P'""#"0 {0S00 r000U T@ PPFVQxc n\ 0 ""0 ͪxW '_o`/R χ166S1 000P U0!01S 1OP' TЍC`TЍC1S  NPP  `P 1ZS01ā! BOP2괁X NPP  `P 2 01 SP0} p l01 R0PUQ ' `,0PE("(!p7 0/A0S 0(( %=>000QHW'PW'XW'`W'pW'00000r"N90r":9?o2|N8z?xh728s"}0p:S| (0TЍC/@<@I'J'A- MPp&%@M`P0%`Sb BS` BSJ? S#* S~  S< `02010?0x8D!0100"]00 k"]0h78h75^0x8?00h7#2^0n^0`P V C V0@`U0"0u"]0h7=$`C000i;0X 0  L 000Y*-OXeK'G- M@h`>%\(PL`P  0<R&!S ((Sp1>: S  Sp&@%`'S p, BSp'S?;C0CSLc'c'c'8b'pB!Sps HS:Sf S p'SW0S p7 h70h7? S* S}  S|7S pG  x'W/o"  6R| PX?;CS񟗧b't^'da'a'da't^'d'e't^'d't^'t^'4e't^'\a'dS[ *,AS\S#R @0SC00P0S Q>⪎0pⲐWC嶠C Χ Q@0Xp8%S BS6 BS  S / BSZ|7SQ cP> 13/8L%S r SE`=0W SQ`4#=0 ᒧ  (03A0ASW)0S&!V&R! 1?0|8|7S3A0AS13/4P` W 3   R< F$ ЍR <3W0Sb'b't^'b't^'t^'b'p'  |'S|7 x'Rp' p' W0S08 w~0S 㴀u?0X  R0\ Y "q?0Q  \ W "= s W "= m W0S p7  h78h7|7S7S03A0AS7S|7S4`xh7u  8h7q  h7 A ^RD0Sx( 0•>h75 0oR70S.0‘J1W/ W?B0CS)"= >W1n00S0 ‘V1PP6P 00 S C  RP0-% EOO-?@Q`|M? p3C>6CQ m3>6Q  ?QK 70Q4  |ЍOq;h?Q0 00 0p0{PPFx0@FSj'4k'4k'4k'tj'4k'4k'4k'4k'k'0S3A0AS13/p7  1 CbR.0‘!1R7P.!h7R00h7!h7R44!@R8IPP<0 SP:XM=0S|7SxxS >⵿P J1P|Ѝ > _ pP[ :3/ 0= 8 PP < `R # $"0 # 㷤< X9W >  PP 3S>ñ:3/W Xop᚞!Rh8HPP8Q|7SxH 9YPpo 9  @PPQD}`!*R<8tHPPi80SS*1|7S.9 iR B0<yPP# P?0CS|7S < @P 80S$ < |'R R0<0 S < @P 81#3/ 88  |7S P pP P, !HPP x!> 4U !h7R 331Sh75h7!R R R5p|4z5x1S p7h7:ph7:l!h7R33f!h7R22p'P 502 10h7EP!0B8#8S ȕzpt1S7 Wp7 WP pP W [ pUPY1SU$ "0pN!0B8#8S ȕhF!18p7b1019q W8 oGPPd 8[x7 ?o2x`QQ 6P  x@Q @A0 S |Q80 Q_P|X x0@`P|V` e 8⩷03A0AS7SP U x01@0S S2|7S cPP  13/P!zR8GPPW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U PP 03/P Z0U 03/!R8FPP 8 5 0P> "'wp7t  d1/@0SX1X  &%-  P0S108p'10!S"-08H#8,C("(R! 8EPP 8` V#=0 ۡ h9]o! 8ҡ7S (#8 9N! 8FPx 8  0BS !R r39S0S0 p Q ARQs0W@ 8⚡8 R>Wp:3/Pᚾ0S 0H pH0P,PpW@:3/U0S {@ X0 0CR00h'4PS4400Rh7{ aEPP u0 0H80ϵ-HxP h7~N#2000@000S@@W`" 0PPK0T0 TGFPP B > 0S p7  h7 ;h7h7 ; h7N50000> 0 ⁵ $λh7P:: xu1T%SX58 S!V&R! 1?08|87Sq|'R8%S x(0!Sf|8R8a x(0!R7S|7S|q|ЍO(0 00 0p0PP |ЍO$tx3%%P   03/P%|ЍOebYʀ 0! $&0    ! @aRa/#E07PPWa/f 0!`'0 !    !y0C-DM,00 `p\(00 00a00$  P<0@sP0(0`0$  0T00<0 a ,sP<  DЍABA>AHAl<@@- ,@0xQ S,@0AZn Xx( Ri x(Ri. Q - Q UTX P$0Ǟ$0 3?>4LD D@01"S o`% 0CC1%50 V00XW0+71G y027=02c|000D1 9?93 :5<:M?0:610<10CPb00000C0zJ0 R@40c@,04@T \FP,0I iRF9 RxH5 V' \P,0 0! 0     ! 0S 0ЍP4@ ,00 1S\,40G  P4@,00 p0Qp@cddd, cD.@0S/L c'O-@TMP8 <1#0p`0c_80$   ,p(`aqP0$02 0200,p0(` @408 MqP'> 0H2$,p(`0/0,2  0408 5qPv 0 00졟!18 $ 0,p(`40qP`0 00!18 $ 0,p(`40 qPL 0!X18 $ 0,p(` 40pP9> 0 00!18 $ 0,p(`40pP$w> 00$ 0,p(`408 pP0N@$ 0,p(` @408 pP  <<TЍA'JaBL cA'AAAAAAHA<@c020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍAR=@AD.@<1@ ) @0) 8408008,08089!= 01/'ؒ''<'D'2 029 0/202/@-8 040#Q0l78l7 0.  ( ( #- x Ѝ1@-@ h70 0 ,00( h7=h7l78l7@AHAAg=@p@-@P83/p@@-PP @QUxw w> G" !`  Br 0 0# Ѝ B7SD10 1  %`0< <`eGG?0L QYAdAuA}=@AA-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 E+0 . Ix D00x822x80!L0003/090020T100`Ѝp=@A<1@A-P`8p3/@P\00\0  x8 0 0x822x822xx80!x8 99p@-@P`X@pp@-P@P xG G߫1S 3/pA-P@p`000 ǫ ë ⿫0?0?x80101 M? 061071 N? (Q 4s$Q 0n 0 1SA/@-P ` pk@P 00 0s ЍA-|7PSS` h7M @ iN@p0 R0S P@xHJ*A-|7`SSp@ h7] P i^P0S TAT10 R0S P@xH0S i V1Sp1 *0D D0 0PAЍ=@AA-@y}`|7 pS 0 xXU |7SS@P ԳPLP1 )0 000=@AC-P@@@`pTAT ݐ  P01S⣳P1 )0, , 0v Ѝ@=@AG-`X  pR 0S R@OoB@PUQ@ ͰP 0R01 S  R 0S R⹰P0 P0T@`C-p`@P 墰P@T Ѝ0S ⑰P'1 *)0t t 0    AT  vP0S mP @=@=@AA-P@U+ pbP ЍA0S0S i V1S1 (0D @ 0!Ɗ:P ЍAЍ>@A@-@xP 0x8i  <P (0<8HP"0H8p@-|7@SP yn<?089,8yxxXP 0 022220000990w>018|7 S13/p8AA-1@` !^y~|7]S11 P8889,88PPp b(# [x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGtQ AR0>@AAA8A@-@xQ `P SP P 1  <10<1Ѝpױ*P 1 'h\ \0   D@  ,h7@TAdAAJAA}AA-@M|7S;in  `/?VU z1V6 S2 0S! q , !RRPq ܍A83/0p<0!SPRqC57S &1R6'S "R|7Sh7 8S|i^ P6S *h70h7܍Ak@AAA0C-@8l7Xc8l7⍟PUP vfVp0 ` v6`6v61 `0p lXx8qG ⦧ 13/ Ѝ8Sn>@As@-|'07@R 0P 07  h',h'  ! h'x w. 0d01`  \UU i^` Pz3h70h7Ѝp@v@A0 cAAO-Mi~<0p `P 80S@Pp 83/@P\00\0  x8p 0 0x822x822(x8 991+ h7( 0 0& 0  W !#21! VPW %000 E0SQ@00S PY R 00 e 07 00ܰ 0ڦ0?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4$Q0 00 WЍOL @Z Ѝ?At cADA,AhAAOAC-@Py`P⾙08pSVI Ѝ4(Y V A !<T U  DP1 T%0$ $0C 0;AA>@AA-2@P !m00C02021 4%0 `2Pq 02HQWP,RP ,PPCPCPCPA0SH1L1`P10CP1wC1S 3/AG-Pp```0V t p=G|@T 0V `Ю 9/@A>@ P'A-l2!@0SP` $2 @9|QI0S1 2Sr :0S 3/"<2< "!0!-200C0w>0SU? #~Q A1 $0 `l0Sp7  |7S 1 $!$\2+~Q A1 [$0 E0S1  ;h76h7p7  1 l |.h767h7vV @AA!@AA;A\A>@AAAAAO-P`|7MSS00 0ppp1 p0"0W  OЍO @T 00Ѝ0W p|7S2  0S 4"|0 0PCB00x8S| 0 0C8C80Q Rn P1S: 00! 0#0 00HP 0SH1L100P10CP1BH1S 0 R B0 Y 1 # 0 |1P 0Q113/0Sʐ1  0 J P2S 0 ᬑ9/000a)Sʐ1\  T0T ,P 0NS@]>@BAAEcUAqAAAAC-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< ` 92<2<! !000w>0SB !T20S` #` 42hǔ00 㲒 Ÿ  @1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? n0001 "0 0GP+n0001 "0 7S 1  h76h7?!  " }h776h7v202r1 ``V ~"` 00r@AdAAJAWAAAA>@DAbA2AA-|W`U U) U@w xP 83/@ ? 83/P@pWU!3 @PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,P00:p@?@Ap@-PiN@ @P`@xhVxHp 0^ 022220000990?p@As@-!]1 @R0Ł0 <) >HP1 00|!|1| yGY U07D180$881m`Ug,884X  P10X 00 0in  F1 - 0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 Ѝp?@AAH'Al' A-pʀjPQ` 0ES  B2U U U ,U UPPH$H@Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ *s000 0t u"    @v w 0  " @x 0S @@p8?@A-0 0SP@0p `.|'R','d''d'd''0 0   003213030 0ס  ӡ  0ˡ  ǡ t0/C-@`M!;PP000哂 Ѝp0 `ݐ0=0 H02 |7S0000(001011 `ώ X0P   D b00L7SPP7HWLW0P7AB A@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R!  R  (R  B/o"S0|'Rt@ R R  R R  1 0S "N)R8?@O-0LM SP@` 8 h7 |7S 808 8Rp>0pS s39S~p$H8R.p㲢 $$8Rh7 4@W80 & #RH L0S0P !0 >0'S s3)7R1 8>0 0\7\0000H  0C IRO:@P000S Yڸ 4:0W 000040  B    04@ 014@T7 V:U 0      $D"$  (0 0' #RH L0S0P " =@P$000 W 0 04=P 4=@=@q 0H   CX0C00000(00(00000|'R'''''''''0 0 >  80 0 00ZT 060S  S  S#:9S00w0 00#"!# #"0( R:W $4RN 0@0080 Rm1 !0110/1!LЍ 08ǟ > ßx 0 08⹟  ⵟ >32130300W7? o#嫲Qh' |'R8"Q S* h7 |7S8 2 R 0@0080 R (03/P1 8eh P81081%[ 80S 000徠S (Z !%*0$@00 00 0J(0(0 0C 00 0J00 00  Y ! Y: e$pY  I:PpPG8 I\90 0 0 010 1 00 00 I0, 08, 00(0080$0p0 C0000 000 000((0C80 8000000C00 PpB<>A<1@T?@ARAtAAAAO-0S h7 #  000   0  8H(#8CQ,[SSSx Jo᪢R  0 0PP 0< [㰠岀  T%0 @, 㘛0S 1 4 l0:0(101R(101 |7S  #RH L0S0P  8PP Q0 T;PP 0ᰀ00(0101@8S>HHPP |7h'S000 (  0/  p' ; W00  . x 000G h7  40S  Q 0 00 00C0(0x3rPP h'00  0  ;X00  岀0  " 101Gs~h7  40S0 0C0(0o 1010H   CRB0C00000 `(0 0(00000=000  , R :01 {1 e0@001 PW|'R  g0Grpq瞶 0 1 0100L7SPP7HWX0P7080LW2@$ЍˮA?@AQA%A3AA @@rAt cAA-`p3@P 00(0K0P 000p,  (p@-`P3@P 0; 0(0 `  pG-!=⼐p7# 50`Gp@- PP 1S 0(#(000Ѝ `0/ |'hR    0  + h  ™000 fw0S 00000   0ܵ0  00|'RI00 0 ! h7   Vh72h7h7 M0S5 ) 00@10 @( #RH LQP  6PP    N  0 00H   CR0C00(0 0(00㲐01  - )붑9"@@AAO-@fMP |7h'S000 0 0  ;0h7  9)* S09h7  h72h7|7Sxhgpe\ !PUP00!  ! 90 9O9S!  d!h 90 9?PSH(Q PU$Q0CS*e!0 R` `!  0c ``` 0 Ⱑ PH!h75h71 0l xr08 S0R 0C00 S 0S00J Ѝ0`9@@A A4AFA@-`T1P!pR@MX1\!^0 X1\!1S O200 @E@61 0 6Ѝ@5. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`V1Ѝ@/ЍsAA-0 /2S/p@-@Pa0 6/p@/ 06 08880 8077090(10101/* * '8''@-:@0S 3/ D:S@0/p@-`@0SP0P    00T ,P1S 01BppX cdT@@P0/dP 0!/d@-@ 0@AX c0 R  X cAp@-<@P0S,@T BP@pX cA QA-0@P PS t`lp0FUAT B^R D`0d!!p740!h  i j9k9 0 g901!\0)|7S!=0S* 9'w>0 01 9i9 00\0 |7S 93/1  |7X `S499Ѝ@x829009h72h7ЍT@@X cHA@9A~AAp7/p@-@f_qp@p7/G-P`q夁夑Mw>@VAM VQ V!I|10@|'RJ 5) 6) 7) 8)099!  089 079 069 059000N9 O)PQ R   0 0`VPpx8S   19ЍGd 0: 0@P 0590690790890Ѝ cB@AB@rA@ĄA@B@@-h7"1 @ S|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@PAAO-pM`0`  P>0@0 00P 000 0_o`@ NRPPU!R:"R :"R:0ЍC-MP 0`p` @0 0 00  00P 0 0@M?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`QPJ<1$ 0<0  A,p(QP91$ 0<0  A,p(QP)0'00弐$00 00A,p( < QP0$00 0l0 0`0A00,p0(0< zQP  ,,@ЍB>AA(A!c(A9AC@G-SP Lo `0@4p8à St# 00000SW <0` 01`P1 0n`0 d`{Ѝ@0@T@AJ0^0P0᳐0Y:0!cA@-  0 @!  Q3  4ӏ000 P1#9P00T0nX耖C@BC-P`尀p0@ A0 ഏ0S H P `0` 00 Ѝ!cdAO-P@0TM00p1W:[I (PC 1 0CЍO0S`0 S00qp0少  A$0 e[! P p0PQ`1P  0 nPP0p 0 0Ѝ!cd A$!cKAO-@0P00MP@peP 0S S S 0  RG*101aQ> P jP 0 ⊠001*  0m 0  dl000! PA0 ߎ0S2 ;P 0``M0S# ,P `` G;㤰@J 3Go`!0R p) X@Ѝp0 p 0nm 0 (!cd}A$!cvAAA,AA@-@@4C@@- ,4 4 8 #8# ЍAp@-@0M SЍp@P` 00 0 ЍpA-$M840, (  0 #$Ѝ䄾c@-`plM)@P@ !0 0  ( 0  P0000C0 p0!0 J0 0C0000 0d@S2 001 00@0 (ŭH0L 0 H0L ЭlЍeLdcO-0@!DM 0 0 (Pㅮ@`p\ 0  a0,@($  PO 0  a 40@,@($  N 4 l 0 d    a 80@,@($ PN 0DЍA@ccAA(@{BO-`F,MPp R0 0 0 ]0#ddh&hV *@0 0 0 K,ЍO-0 0S 0S*/-PP $0 0 0 ,ЍO-00C0F>IP 0 0 0 00C0000`P' 0S S SB 0$ 0 0$ 350ZT$S ެ(0, 0 (0, ,%@ P!$˲P 0 01`S0300 000 c P@k k s1,Ѝ0V 0S0S 04S գ2ό @ + 0Sʠ= 3 @ T 0S 4S 0 SR00CSd(p(p((p(0 S奣 ៌"@ @00W004 0 004 b30 R S C80< 0 80< c 0S P`0 0 Pu 00$@0D 0 @0D /0S 0CSc00`0 0S0 004 0 004 3 I0 R S 80< 0 80<   0SjP`0 0  >P" 00ѫ@0D 0 @0D ܫ0SS Sꄾc@c@c0p@-00@4S 3P1 00'R0 0S0St報P 000 01S0H00``Ǣ2@ap p@c@c  BR/ $R/ #/0 0S/c@-P@1S `ph 0 @1 @T  Ѝ0S 0CS0@q 0S0 0S:00 @@c000pp@-@`xPK@P pP/p@-@PP 'p@-@P '\@-U@ 0vFp@-@P''p@BQeO-$M`@Pu "pP u0$ЍT@ @ ` X0@00S @T   [00S 000S00 0T 00vD0P` ` @Z 0 [0 TeD0P0T ^D0P ` 0 0`0/G-pP@/`P 'T 4 06 S H0S 4 R30 ÒPP@P8 0x00PPH0&bZv 05 0W6 06&`SH0Y 0S 0C @\  " >(A!>00000 0/6 0@-MP@ 0Ѝ0/,0/@- 0MP3p0pp=`hP@Y 03  !,,0 , @ 0  Ѝ@- 0#000W2 0,0-Ppi/ 03  !,,00,0 03  ,P,00,0,0 0 0-z-Ѝ8d`(0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@I|`pP1hSl l0p >AD:0P1p00`0101S0@@/lqd@-@Td$,d,lH,l $. O-@pHRH2DM p00 @@60A10bA 7C>  / EF? %`pP%1 00a0,P($@ @@ @J000D1 0<1 00a4,P($@ @ @I1  00a40@,P($@ @@ @I0'40张0  00a80@,P($@@ @PI040p0 00a80@,P($@ @ @PIDЍdAA(%AA(!c/A?A@-@0 0S (P@\0X0S@P d0`0S (!cdp@-P@ᴽ0 0DS P@ 00S \0X0S@pDP 00Sd0`0S D(!c0S 00P0#///0  S /0C\ B /p@-d @dPPRL0$!p@{ 0S  Q@D0R0 1dp@-P@ u0!S <S21pp@-@Pfp@,dp@-@ PwJ00p,d@-@k (9@2(0@s3p@-3@ PD Od@Pp00S0S 0S h0S 0S d0S `0S X0SpD//(!c80S/@-3`A0ASM=pƼDPP@Ѝ@00S%ռ0 00P0 R0050 0003/ᓼPDЍp@-M@`ႼDPP@ូЍp@00Sᑼ0S 3/00005]PD@-@$1@KQvp@-@P 4̆001Pp0S 0SpdB# p@- @P8~#@P@#p@P@8dA-`@Qi#pP000]@P#Ѝ0 000 ` P #Pp o1S0 d g1@0Hp _A0, Y(10(1s#d1i8d0@-@M#00CS0 pЍ0@_# J L K0@PS   (10C(1J#⎭Ѝ08d2idC-0@SM 3/C 0`# P 4$P 00ЍC wp PPXU%ቻ) 0 \  PS U R X fU U ),ddp@-@,0P `0,0ETt x0Rx0t 1x0 0S  0 00 000p@d,dO-@,MR||`SpPp踰 0S YP R R0 00R0P0 008Y PK80SC00004Zʀ !  , ! p !|3x3 t3l300  !ḠW㸠 00踰,ЍY 30S00ø0Ŭ 0SP0 0 00Y00帰X `P帠3 00 0S|24d\0Q\d00\00X0d00`0H04038 $d0S00 0` 00\0X 00h0` 0# 0 3P0PP5 P,R 03 6 'pPR,00,0,P0S  ` 0S{0S  S (( 000 0U$ ",0 pC3S0S00luYL 0I PE 03/A)W@cdddcd,dO-<>PQtM 7 .0S@ >Q Y= @Q==X"26XG0SW`T 0.뚹p =0P@8᯹Vp=X @`\=Q 3C5CQYK RC4 iYE U -Q60S=`V:7p4@ T1<X0 0CX#0X 1CX0`0 0iA  00R 0`BDpP@8^1`Q -`0 @ T` Pgq 0 @[  P߅!>d6 00 H`;X 0 00 RV  00 S DK 2q@:S00S P0 @ q 0⢅| @➅3 P 嗅P 哅 0`0 Y 0  tЍO0 0000 ]9@P 6060X`\00` KJ``O `nY @ 09@X9X&Tp 90S񟗛?(@(?(?(0@(?(C(90 S񟗤=(p?(=(p?(p?(p?(p?($?(p?(p?(=(p?(p?(=(0S`9X6C 0CX0S T80Spi8X0S 0 S0Z T`0`V``Y T` YY P8((XX T8800L 0 0 0弩pP T"%@P7`9 0| 000?8p93 p!>8参000000`7Xn /1CX @70 S`^꣧47`00 0 `0}pPJT1`$p` SA(?(X@(?(?(?(?(A(?(?(TB(?(?(C(60S1| eW `93! \ 3 D 00  03  P  `P p'TppWp`,0,Wp B <OE0t01ؠx0@pt01Wؐp pW0 ؐ 0d$V w % %3 PW`W0  &`WZ V[ 44 PP0Wd00 P`00S 000d00  !QR ` `R` `W00 0 `3 !0S P 0SM   o000T2 (n}W+ ` @0p0S 0S000S 0 /dܠ>pspYp/` p`p`0"X00p003 P R00ᚶV 1X0S00}0S`V|00S1X"0SY$Tr0|`Xk| S   0QN R0`10`YtЍi iii id'i iQAii@i%iߖo?oi@oi!i#i"i,dYdivAP08 P R/ !  /d !  dK8d8dS8dO-MP@Dp + `0@0@@PW۵'P@%1003f 0 D `P H03HD P@۵L0S( D 03 0  Ƶ110@0 Ѝ蹵80S 3/@P ᩵0Z00C?o20S 0S tP @PᎵd0Q(@- 0@R0S 0 R S U `Pr 03 0Qf/dp@-`P 0@0L0`0D00@0 0<0(080,040D00040,000@p8((h(h!(h#(((d$(@-@*@0O-,00pS@(,MP@P 0 0 0"d1d00hS&h;@P  00 ")a! 1 00 $a$" 1040  0PP  0 !H 0 (",0 $  2 .(,(  P! ! 0"8S00 000080Ѝ8@- <0b",4b4#  #$  #(  #< 圩ЍAp@-@0M SЍp@P` "448 #800~ЍpAR=dd!Q 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # B0PpEp@-40 R@  000  B Ѝ@-40@ R  000  + ЍX0 0&-$M840, (  0b $ЍPdC-M 0P`` @yxp0 P 00 00 0 0@m4?o2P0S B~Q Ѝ!cC-PMp@ 0` Xy`0 P  00 000 0@>4?o2P0SP @TP@P T!@P0ЍT c!cO-@`Pp3DM ,@0P 0 0p(`$  83ᄃ 0P,@0P 0 4p(`$  7 0 0 0'!,3 4P0P,@0@ 0 8p(`$ 70 400!2 02 0P,@0@ 0 8p(`$ 70 0 0!2 0P,@0@ 0 8p4`(`$ 70400 0 0!(2 0P,@0@ 0 8p(`$ 70 0 0!1 0140P ,@0@ 0 8p(`$ ~70 400!1 0x1 000P,@0 08p(`$ f70400 0 0! 1 0P,@0@ 0 8p(`$ O7 0400 0 0!00PP ,@0 0  8p(`$ 67 1㐖T@T5DЍAA!cAk(AAAdl(A\k(@{BAAcPddy(ccp@-P $@lh 0S Q 0P @@@040p@Pp@  0c!c!c0 96PdO-PMdv0@0100C0#21 2 P  0S (# 2!12Ѝ 0䥟0`vu01 0 [аK  O XA 0$0$0S аC[  R R  H0,0,0SJ DC[F[ P PM !>800( p<0@D\b0 0p08pX 0 0뜪!u01000[аKᴪ qP V H 0S V[ 04040S аC[V Hym`308080S ذC[ᆪ_ # 0p0p0 \xS Y\  Z  Z RTDSS  S R 0  u0 00 IY <>0s0 cR0 R0001 z@ \t :|H  \n0S`3a `P -`P 0 "00 0S0  "44 0C(",400 000 0 B0  B(00C(00Su50P,0,00  !B P0#$$("(B200 0C00 000PP;# V2!12  \ᾩ  \H/oP" R` 3 2(0([DK ᠩ@c ddLd@- ;04 {a,0?A`"b8"#b ЍQMbO-p`PLM @ a *p`a0(p)`#ttx'xpGW V卓 0$ 0 0$ 嘓_$W$0S 0 3SH0L0Sv@P xEk 0$ 0 0$ vLЍ00C0/P US(0, 0 (0, 00000C00(Sqd@090! !H00CS]{(H|(~(|(|(|(|(|({(8|(}(|(|(|(~(P@4Ѐ 0 0 0 %?P#W 00S00 R0S 004 0 004 pPP0S@P`   0Q ,DD(00830#0S  $3/ h20S 0  ÒH0L 0 H0L 00帒80< 0 80< 00! !庒>@W堒004 0 004 ,20S 0  吒P0T 0 P0T t00 1 0S W0 Cr 00)p'@P  BZ> ;   R # 0 0(P10S #W  R1  0S R 0$,00 00(000(0002P 0S  l`P  8Z0H8 ⠤4\P $ 00 $02屏0 00pP2帏壏0 0 0 宏0 p0#$$ (0"(DRD `P `0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00pA! 0S0!0 pp P MX0\ 0 X0\ XV+ 1S@ @ 7H0L 0 [H0L  `0d 0 `0d :V 0 /V (Y 7Y@ 0P H0@0 0 0 @cc"c@-!>@tPM `0@@p0 0PЍL000cO-=Mm .@P=ЍO XeP 徎 1$!0 1$!ɎX=8@0<0<0S S  1$!0 1$!峎8z ꜎0 0 0 姎80 <   88P儎0 0 0 0S~P@0@S p0 0 0 @ATc 0$ 0 0$ 0T]PP8 0SM0 0 0 ;`( "$`$"",R a(!"4a4##<S3 81, @000@S S)0 0 0 3 ;0S F*P "448#8T(0, 0 (0, d8(S0 0 0 W Q0(0 CG 8 80;00 ,000P 08P 080ݍ1!0 1!30S P8G 80 0001S0_0 R P08 0T 00000S 80 @p0(P0$400010C00STy 90S@r 0l9PPl  lJ080Z Z[ 0S@100 0SRQDZ Z 0 0C0PZ Z nV[0l00m080Sz $0S @E0S [@@D 0p0$l0P0$0Z.@0 lG030 0 0 > 0R* +Z 4 0P $0o$0J*  0$0@K@ poZlm0P0  ro ͢p00000@@@T@ pDP DZo @ nZ0l00m0(0Sz0SL Z| 0R: p>oulJ0PJ0   2o ።0000(0? ᅢpDP@k D oYH00C $RYHY0 #"  02R0= 0IS  S< SU@ @@m000 nfZ0l00m00 0S40p00.P 30S .l0 n "000 n7Z0l00m00 0S  pnl0P0 @E@֡S@T 30S@CA@$@ 0pMl201H0H0S 0CS # 2 P0P0SD0CS/ ҡ 00SI pPkX0\ 0 X0\ E W T  X     L #I0L0L0Q  R W7 hW4 `W1 XW. Q+ H0T0T0S D0C@p#@10S 08S 0 0i嚋X0\ 0 X0\ 奋XL,00 S \ 000S 8 P80S 0 00010qp0t 0 p0t |, 0 @0<01# 083/ 000U@-`Q00pPg8'#TgT%%< @P@ ЍVPl hh00100S 0CS W @#R{P 000 dA-@M`p  X@PP"0 RP00S)T@$ ( U@Pj@P 00jz@ЍHP ;PP$TP>1PP "P000A-p0PS@0S0 P0S 0\ Q i0 0!0;0`P1P 00U 0!A-PS@` h pPl0 A/4@8!< 8!<chP/A-p`0PPQPEU `f @ T T@ @T@  Ni0PEpO-,0,M00@010 44PQ : 01 $000pBpWS屆0 0 0 弆(,Ѝ0000 000000#![ 0C 0 (08#<400 00000@U`Y`Pbs0 0 0 ~U7`PT70`0000x20 00 0$() 000S O000 0-0"> 00$ 000K1 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400@P 0( 000@ 6"$a0 0 0 000], ,0@ 0,0 00800",0@0,0e*0C SV !ql`ׅ0 0 0 0 0 0 VF Z`P@UceO-QM00ذ(0 p@ `G"448#80SZ:0P0(P(00000NC10@00咅x0| 0 x0| 坅X( xS눀,Y 0S 0R k&$V@PuM@Pp,g`P,j ]`0 0 0 k(280XE$Ѝ0S003 3SH0L RP0.PP 0 0C00 0000 =@0g(0@ 0(0g 00"440(",40mH0 00@V0g0 0 02fP0010m0r `lpP$\0 0 0 (0X 3` 0LwPPkτ0 0 0 3`ل(P``@0000\`0TP 0 @0 R s(0, 0S80S 0S `80,3/pP `0 00 0 00S<Z剄0 0 0 0 sR 0 M [K PH LPP @0`000p sR `P3 `SPT2@P H0S iL0 0 0 W(A`P{@0D P0@040 D 0`g0 0X000 0zT@PX#0 0 0 .(0XA``0HP4`S0@0D Lp0@00 0@000D g 0 0` 00,(0 [   U X3`0 0 0 (v0  #R  3 0S#t`P xWƒ014!0 014!̓1`80S t80,3/`P t0 0t P* [ 0S% (`P 00S`P ,0 k,00,0000, "0S 3\ V`k0 0 0 v(= 0S@0XM0S L V6 3 UG@1D!0 @1D!0  XU `9@1D!0 @1D!DT @"44D 8#8Q ( %0%<#*T @1D!0 @1D!+(`:( 0<00 (0(DQ ,   40#0 @0A=cW 0S0 0 0 ,("50 @000`P( RSp݂1 !0 1 !r`0< 0  00` <pP 0`  R 01P/0 03 $30S ( ,0@0,0(!!448,`#8S9 7i04z 0R0  0 0 0 hP|" R  t`23X"X1`00t0$m0 0 0 xUu(=00,0` @ ( ,0@0,0 3  10S 10S ($( ,00,0(0 , 0  `3  10S 10S ( ,00,0 (B`P(3(Q VP0 0 0 V (0  0, `(1`%(1`cec8"cc@cE@5A%c$%cC-Pp@p0M00S0TЍ0S  S` BS0S 0 00000 000B00SQ QR d0 >P R 000*A-PpU@(M \yPP7@4 000,30P0 0CSX( (8(D(T( @P0S@ `x0P #R01@0S  2R`V\y`(Ѝ200S0@0 .@ 0 00S"00 0 tP@* Q& 3S#`0VV;@ aP 0007@00 0  ^ R `1@ 0@ 0S 0 0P@`0  V1@ 1 0 `aR0C000 0⧝S S Q ` -@Vs@-0@ SP& S) S- T 0S000 <Ѝp0SC`\P 0P0@000YP00P 0  0Ld0O-,M00P`Sd@ p&S d6Rh *5P Pa00CS ((d(d(d(d(d((l(l(l(l(l(((((((d(((d(d((d(d(hP j0h0[8 <pP7,Ѝ`  N[`#0Z)[# `V [ZZV0 b `F` ,R 0 yb`hpd@(V%` gbpaP00CS(($(8(L(((((((((((((((((((((((((`(((((t( (((((00000 CR0ŕ0S@@0S@@0S@@0S@@0SKK 0 00+0 0p0Pk0SJJP0SJJ  PV$0S 00 .`$GPL1GP 00BnpP9hP30SSe @\S @Y _P#P0 CRh(((((((h(((((((((((((((((x(((hP, 0 NP 0CS ($(<(P(X(((((((((((((`(4((h(,((D(p(000000D600D1356 R R D0$00  0|np$j  0$ p@-@PP`p0Sp@\0wPp@-@0x`S   !00C000C0PUp@~ R0 0 x ׋pdO- PL`pG@T`@V <00CS @p S0Sĕ0C0S0 h~@0D 0 @0D s~ @1!  |dpdcpd 0O-@pDMP!0l 0 00,@(p$   0!0 0 040,@(p$  0 400!X0_ 0'> 0 080,@(p$ P @DЍpdAAlAp@-@`M0P0@@ @0 _dP  <@@T 0200 R00C1 2"Ѝp@{AEcpdEc@- dP98@xdA-@.0"0R S  B! "2 2R2S0p`P"0#Q00S qPP@UP#00C?o2PApdEc<"cxdO-Mp "44 8"#8!`ǟ C\4LGs}0 0 0 6CS 0C:W 0h  0!"  "? !AT,fT< 0pR4 L}0 0 0 W} Q :lF;}0 0 0 F}; 0C S   !R  Q \  \ @ Q 0}0 4崥 0 4} pP 0}0 0 0 }\< Ѝ   1T! 0 !A  Y"RR$0@P       !<  0 00! 0 0 !000 11S0@0AH4000S0p0 pp0 pWa   R^  !Rb|0 0 0 |0p101X 0 !1R!AQ ڴ! Q Ƞ,Ƞ B! R00: Q   ᒉ! B!  B XY 0R p pp! R p0 0!p DR  B   B j `  pXW+ p 1(",400 000 0 10 0 1C00S,00V(p`o {0 0 0 {d0  0#  p 0p00Y !!AQڴ!Q !! !! B! Rn10C100C0{80< 0 80< {(  fcpdxdpd-//-/-/@-@mk-@-p00d0@ ` P d0 (00  0 ( 0P(CA Ѝ1M  o@-A@-A!p@-@P0S 0S 0Pp0Pp*YP p脒d!>C-@pPM0 0@@ 0 !44 1C 0"440X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ^, 0  02# |0R0@l@ zh0l 0 h0p0l t 0Sp0 t zꄒdPdXC@<(c-/ 0!< 04 0 (   !/@cdddT0M000S ~S 0S/0S001Ѝ/@e\ P/0 !8 0 0 (  , !/@cddd0@-S@ @p0`000S ~S 0S/@ P0P d0  0S %1@ Ѝ00@0@eA-@pP`@PoA-@P@`@p+aY6 l 9&0009T0 Re _  h BP 00000 "0 3SH L0SP0\ 0 <  0CS00S0 0000fSlp0060A Ȕdd A,%cX"cdADA7A(%cD"cd8&cEc@"cH?4%ct"c0%cx"cd$cd Rb ` 0 hpPX w6 @TR  d130p00D1;Sڤ0`1j)40SI0  0$ T 70L00SE S0701pP2T"0P2 1 T"pT0@ 0!0CS103/XP  `0S 0 1 000Cp!0C 0 1R ^T00SP h!\00CS 18008 0S0Q0S 1 S01\P t AQ\l\hVLQy0LSv41 Sr:;So 0SC H!R L10LS2A0``Fp1x!0| x!!| 1!p1!0CS0X1 10C10    BR901!Va0 BR1011 01R(0S ,0S@P40S0#gP ᅅT0  000 0 =!]P 0 m@ i 0R* $4RkX00<0 04000hP] [ 0R 0@oP XElo1!0 1!woD )XoEYo1!0 1!doX0000< 04P$@oX2\"0 X2\"8M(Pll60'c0 Q 0zQwSu* Qq0B AS0Vk80 !$!01 o1!0 10! 00 0 00/ o%\0S `0S ! 1 2 0 @T00T080;(0S0  ; S1 ,0S1100S 0S ,1 0 0;Y01"y01"h0hh {P>00000`0Vsdd@"cEc%c%c(%cD"cd@-0  0'S(P L@i1!0 1!i$0 CMqd 0`( "4`#/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0:0@p@-P!T1PB1Ad"P \|X1+8T@1D01@ xSx0 S 0"; S0Ҳ;ptA,F@EcO-0pMS@(0I S/`;W= P `( 1H`S= `0d ]  S `3`#Q``VO^hPPC ;0S0S0S m PEU ڼ; 0CS0!0; 0CS0!Z@0 0 0R0100 Xʰ\U 4I00P4%4158I00P8%8150<01D00H00S P0S -(`0&T00S 0 0C1!4!R4!480P00L00T00 :04P+  10S0$0|! 0B$00  00!0CS0a-041V`!;p0\00  ;S0J0P 000S V!`0 Spǃ0SH0P @ ;S=1S PC0 PE p3U;8<0S00 08PS]*QU0BAS0U0 $0U.1  D0HS 0 0S *0S\1U*000C?0S2e; 0S1,1 0C?SQ\&0A@SR 0S(0 S<00<0t`0 R P   W :(P30& R0嚿P0S0S0S0s `4J1S `僿P`30 R@P1S\PE80P H0Q8SP}8{0P H08(qD0H S9D!00C S:P9P0 RFP ,9P0SGUP)0!0S01 P4!UP!S414Q0\0P 0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP18 0;!410\ 0C 0C?UPp70Sn$0SX$P gUP!KG$0PEU0p080V PF0p3 PE UVD7p0 0k80 PW0S=0800P000S 0  000CspC 0RUP 0010CS B 010CS>PP98P5|60S`P0  0 !!R: !B\: \~*  B Rx X0S1 {P0;0l0800000S P8P ! 1`P0H&  0z$ &!$$&  @ f1hd40S?0bd 0P `(VA00 00t4p1Hh@1SI  [) 1(00` RA(  `(VA0|   ,0wt,0K |ሁ[%( 6 )X/5`0S 0 00C00 0#Ѝ1 @0 40K, =,  5 4000:g<0U0402 e00S0U0S- 0 0 0 T2e`P 4 00S<07vbe024"0 024"e `)X00/0CS202000000 000000 0 Z00400 1S 1! Z!0 01 01 Px0S0A101QQ0" 3SH L0SP0\ 00"c`"cF@t"c0%cx"c<%c`%cT)AeAF@A4%cd %cEcdF@<  0CU4 00 0000Zp 0 ST S,(S0( ,0(N0 PPd0 0 0 0 0d`P@ 4 00S$0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 004000, (0QEx <0R>x< G+R 8" R   !BRpĠ! U 0 BRU RZ qdX"\ X"\|d (  p@p 0% 0 0   X  `F  !  p @0 "!R 0,S0e!@QP00S"0("(R"" "! BR ! R !!$! 0SO SX 0Smp000Sp00!0 CR001H1S4刄L0H1c004 0 004 cPk 0RVUe0Sb 8P^[Z%p !Je   0r8P0 000 S$0 40< ,0 000 S $040<, (",$("( R,B B!8P 00!0 CR01P 01R 8P Z0;d60G40p0(pS S: /`x8( #<40(p0S&0000 00!0Sh R0 05P P`3 7P 2PAP @PM;SJ>`Saf(00, 00Sbf,0 ,0, 000 0S0P 0ⱄ1 XSq5c0 0 0 0 @0D 0 @0D c0 S,!0 CR,10t00 0080S: !8RP L00SL0L1`(`@-1D @0C100C0 0R100  nj%cȓdA-@0p0!R蔀0 0RP`|hP 1T010`00 0 R 01 @ @! 1%c%c%cȓd@-0 00   00fЍAȓd0 /|10|1/O-4M I F SPPQPU>Q: Q6 @ Q1J0 A\-Pap D D0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qS BPP q*0 GR IQ PUIPGQP0p CR00 0AS0 PP 10CSQ0 CR 00 P 0CS0BS0P 0 BQ000 CR 00%c%cp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R @l1M  40MX @,p@-PUp@`60P 4 G*0Pp` d H Q1Q44!.010p@t"cp@-PUp@`]0P 4 E] Y\0Pp` d H Q1Q44!,]010p@t"c@-0 7DJdd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0  :0p@-T0@00SDP@ t T$3Sp0p@\eeAt"cxQ)@- @Z)A-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R 00PP 00(0 . 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8SYZ:P 000B:000r(\(0, a0 (0, (\@p(@W@~|ad@P 00S X@ 0<1P0 PY 0 00T0 PY 0 8P 0 0x0| 0?P0 0y* <P03 ( 00j 0 0? 0 b긔d0SPTA/(8\ 0$ 0 0$ 踔d 00!/ḔdA-p`*PUAd@T P P (\0 0 0 (\m0:0PPd2S01pp!1S10;`U pt00{W *0G:0 W1Gh"R l2S0qPp2S<0h2S l2S0nHPp2S<0t"cEcDI@$cp@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 (X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS V     82tЍfQt"cE)d@-0S6& ЍS6&mA0b? S /A-P(p1X`8@@ TL3K@D0S@D0Sd@DV$ '0 R0@1:D:0 P1XVL0S*@L0   @T8A%8150S<1*At"c$c0S0 S(00 b/ R /0SA-0`S0MYPW2PqS 0@S0@?oR20S@^ P0@S WB <2 PaQbM _M0000 0 P 0 0 0UP! Q 0`0@S010@Sʲ0T#TT1X%XS !0P90DN0Ѝ  10CSa0Tw00000090P W R0( @Q 0p0Q0 0 P|00S @0G3WS "&!>20 2 0 $0(0 //XE@ C)Ȕdd@W(p@-0P@(X1 01  (p@X긔dA-8pP(`@X1!01@@(AX긔d 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=d@-@P 0;@0:P@c< 04 \3\# D,F@Ec7 0İ  J&m0S S DDkp0P0@00p000 00 06181jf0 0%"440 0 0;#40;000S M ; 0 ;z0 0 B0t 0(( 10 0 00[0+"2& 00!0CS! 0@0 0WH2L"0 H2L"Wm0S000 S0:0WX2\"0 X2\"Wm0S9 SL m0P0S] Sk  mp`00t0000628(P2k0S00 001 h0@d  B0 H8#<400 1 0Hu(4401000 0H)0 )ᴐ1 0HK0崐0`000 00S0UP5 P Ѝ8@PHsZ.0UP (0xeF@AdAd,"c0"cG-@LapHQ5a; (W(2,"0 (2,"3W^$; S# 00尀400P!X* W 2$"0 2$"Wx;0;^G8 V1!0 1!VP 0@$00#.0#A0@.H>@$00#|6 0 00 PU `0S l:?P  4?PPd%@-0@ 0@00 00@@Z$$00S@ ЍAdd%O-4b@=PS}M{Mm0S S8 > t00#.0#8.> p00#`W6 p\V 1  xQ6 V1!0 1!V 7 U00;d1S 0 0A0 0g!P00@0@00=0=U1!0 1!U ЍO-0R:U1 01U 0SH 0 A SS0!\ 0 d%D%cddA-P`ATAAp@O-P |10S@BPX+ 0S01S0!41010$101 100010 X0 S,!0 CR,10t09T1!0 1!DTn@PP000` 0 0X  00d@vcEc<%c4%ct"c0%cx"cQ<4RP0T 0 P0T ?RPT1X! 1C1S01S01S0# 0 1S ;S R0 0 0 R01;S吵P!T11T10P1000110H1;S0;0103/^Ѝ Ѝ@@ȔdO-GM`!XP@D1LqR @Gߍ RP@ S @  R!HoQ 婒Z X 00i 0@Y ,`(p 008P40$@@ @ 0!>4 ,`(p 008P0$@@ @d> 00!T> 0L>4p,`(p008P0$@ @> 00!> ,`(p008P40$@@ @"040= 00!= ,`(p008P0$@@ @x= 00!d= 4,`(p008P0$@@ @(= 00!= ,`(p008P40$@@ @r040< 00!< ,`(p008P0$@ @[ 040< 00!t< ,`(p008P0$@@ @E 0!0< 0<4 ,`(p0@08P0$@ @@ @- 0!;0< ,`(p0L08P40$@ @@ @; 00!x;0<0L 0,P($@@ @ 0 !(;B0 ;L$ 00,P( @ @ 040: 00l!: ,`(p008P0$@ @: 00 !:4 ,`(p008P0$@ @040@: 00!0: ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @|040P9 00D!@9 ,`(p008P0$@ @e0409 00!8 ,`(p008P0$@ @N0408 00!8 ,`(p008P0$@ @70 400!L8 0 <,`(p008P0$@ @@ @ 0408 00!7 ,`(p008P0$@@ @ 0407 00!7 ,`(p008P0$@@ @040`7 00!P7 ,`(p008P0$@@ @0407 00x!6 ,`(p008P0$@ @0 40D0!6 ,`(p$p008P0 @ @040`6 00!P6 ,`(p008P0$@@ @6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @jp5 00!`5 ,`(p008P40$@@ @U$5 00!5 ,`(p008P40$@@ @@4 00!4 ,`(p008P40$@@ @+4 00!|4 ,`(p008P40$@@ @@4 00!04 ,`(p008P40$@@ @3 00!3 ,`(p008P40$@@ @ 0!300T 0a,P($@ @4 0400`S0S=pp0S p@-P%@5p/A-0`SP@p0S9@@+0S ;2XR* 0R_ 001000@07@A-`@pPٙ000S S/@X>1De>4(S 剨@  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOL   `dpdF@dddO-,MBP $X 0 C0 0qW `2`P1!0 1!N0000$0VZ0 S: p0*b 0`& 0 0$0  d1d ! 0!!WPPL ,PB  R;#0R7#0R3 D$P- 4$P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍO@   `dpdF@dddO-$M@ZPP $ЍO!10 R0 01"0 p Wy 0 b0880000 R V R  Qd:^"p 0&O 6"0VIt 0 0 00 H1 !0!!PP4 vP3 = R$#0R  `  b0 C P 1 90C P 190 Q 35 5Uzw   `    4 P000`ddF@dddpdO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D}0 P:v qPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880S000%0 0%00S0 0C00000 00 Ѝ0 P:`dF@\< C-M@pP `؀0S  S*Ѝ% %0 0R q\UP RQ 0RW0 0 0 P0 /`dp@-PP@p`0@`TV@@Q> @%0% P 0 0%0P!0%0C0000}>0`0"#0 0 /01#`00S 0S@@hV=9C =C00 0 0 Mb@BA-P` Ս@|pG L @H(PU@T D0D 0?8cЍ 0@0$@@Hp@-P@>pp@-P`@#2pp@-P`@ &pp@-@`P101/ 000/pLd1S/1%ct) 0O-@P`DM!2 0 0 0`,@(P$  h 0p!t2 0 0 4`0p,@(P$  S40 0 00'!2 0 08`0p,@(P$ @;0 0 0!1 0 08`4@0p,@(P$ @%0400 0 0!l1 0 08`0p,@(P$ @ 0!$1  0 08`4P0p,@(P$ @0400 00!0 00 0 08`0p,@(P$  0!x0 0p0 0 08`40p,@(P$ DЍO9AA%cAA(AAd)A)@{B\ 0 \ /IzC-DlM (`.40 0 0 (84 0Sp * 00QP  00 Qp%p *TGW ( 40 0 0 (4lЍ  P p 0S$ "44 8"TT#8X%XU (30 0 0 (3 S A+0  PP 婳!> 12! P0 P $00S "(P,PHpWh P 0Xp  L0P L0 Qp%p :W 00USx 28 Ⰳt'0 N3T⼄j'04` 0L 0'yp 0(P\j w3(0, 0 (0, <$P2!0$0PP4(]380< 0 80< (h3"$T#PP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX 3 0$ 0 0$ (3 0 Pˡ P,dA@-0S0SP0!0@SP R \\0 00 00ΕЍ 00XE@H)d@W(A-0p0`@XP X/@0S   P0S  7@ЍW0dS*@`@P0S S @d0X p AL\ AL\0A QPV .RP AL\0A-Q \AA\  S^0 B Xe@-`P@M 8p.( .h`( .( `p0*;Ѝ9A0@-ASS0CSL$*t$*$*Sh ))B -Q#*#*#*$*($*)A 0 0 0 B)A 0 0 0" )A 0 0 0 0)A 0$ 0 0(A (0, 0 (0, (A 004 00 00 Q Q(B 0 0 0 (B 0 0 0 @(Q Q Q(B (B (B (B dP/>O-PM'U@|50S p50h5h%h0(000*;|(Uv p0( 㭤(E0/S0㗨@Po ( p ((0K0:00`P\(p)j 2PW 0c`00:0p0PP|1d4p000( :0,PR0 <040 P0#1 PIP0 S$ |!  S |!  W SW pG|!W^4)*T)*t)*0/S0'@PЍH3xtp0=p~P* =340,0( HD  PH0,(PH U 20 SM .pu'p"Pp0n:B0` =k G  RpG|1W2)*)*)***4**T**t******  [ |1 000 000 000 000 000x 000p 000h1!0 1!`0!  ! X 000P 000H 000@ 0008 0000P'cAG@PAX&c%cAO-M P0(`@P݀pPP 060S $60S 0F00V 0S 0P. `$,00.0P7%(8,(0 (8,($0尝B?! !%X:0HS,l=0S 0p. f$0J. `$200- W70SW0H S񟗖8*8*8*d9*8F*XF*F*0G*G*G*9*8*|1H X16*6*(7*800S 000 R0  0ҦP 0 Q`:Y 0<0fPPn 000[ 2D6*6*D6*G*6*/Upo$ 8$(0 8$(z$A|1 000 0040004 0$0[ 0$C [C D$8(0 8(O$(0,0[(0, |1 80<0[80<?PPP @ 0 R 0 3SH0L0S 0 ;`P`@P0 R0  H00P H 0Q:00S U  #88<(0 88 4<($$0 4 $$#T(|1 @0D0@0D[ U%|1X0p t p tئP Mdx | x |M|1 000U#084(0 084(ZD80S U9 U᫦P 0P0 S0%0 * L0ⶥP L0 QD: 000S 70P9`yP+0S00S$ 29`~0S[ 2PP 0  3S H0L RPp\0p0pG4pGWj 900$0$ #44 8#80(00C(0C0S0CS"`p0<000SX SX  0! {`P  eP( B00S S5PP `V0S0`J{ â6$0 SXp\5```P  Ppt$0 S 00CS50i 0S񟗞?*,B*,B*@*:* 0Rp% p *  P0P P0 QtppW 0 X0 f PI YXé(00C 00R0 RQ0I400 \ ?^R# \' R0\4P< 804 P{< 80 00 CR H4 Rk(00CS \eIYb*|^0H40Spep}p8`PPN ՞X((  (0S0  R R)02)024 80s0 (0b"88<(0 88x4<(|$0x4 |$"(GR0嶐 <(0?o2R0S (P`&p7100T0T`Vk 009 ~oF40V07`P2X00PX$0XDHX$0S8 J^~0708 Xp00S(0`S 8 P$008$0gcP P P  0 40S PH0\0\X DH  0001`0``V ~oFdAP'cH@ ADA%c@eXeXedI@hed`p<`5h08)0 280p0xPw 0S(0 0q(0B8 )0 (  00E0 #R HL R\0P  0800B00V0080(00 Y 68100d0dY~I0 $0)8 Y "h hpWDpG006000S 0$0 S0S 00H0l0lpW DpGWV0`1p0p0S~?C0S`040bP P P0  0 80S 0S2<206Jy,0800z0 0 0 400 < 40< P004040CP10! (/(0 0`)c(00(000C0,00,0$  "S  R  0$ ppEpW3( 0Wp ( 0x 4ߡ04pp(p2a|1 H0L0H0L0S|1 P0T0[P0T0US xP 0-[+[|1 X0\0[X0\U_P eXcX|1 `0d0[`0dUGP SSs|1 h0l0[h0l'Ur/P\[Ub00`0S0% % *0 t0*P t 00Q:00S 8$(0 8$( IWߍPp00,W0{ AWC +W_ p0V`0 0 0P 00 Q:``V %PK H帰 00   "bP 0  bP W (3W <W R00  x0⸡P x 0QF:00S  3W Q  Qp R00  |0⚡Px | 0Q(:00So  [00  0⃡Pa 0Q:00SX ,R P ,00l{0@`:0000 00000PpS00,9  92#0Sl  3/g9`V!U d 90S(00  0 `.R( 0 P(g9͞˞0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U ҡpPP`d D;0S(00  0 .( 0⭶P(۵om00KcP0T 0S P0T [ 2 0O-@P`DM!$7 ,@0 0 0`(P$  տ 0:p!6 ,@0 04`0p(P$   0!6 06 004,@0 0 8`0p(P$ 媿H6 00'!06 ,@0 08`40p(P$ 咿0405 00!5 05 ,@0 08`0p(P$ z0405 00!5 ,@0 08`0p(P$ c0 4008!45 ,@ 0 08`0p(P$ L 0400 0 0!4 ,@0 08`0p(P$ 5 0400 0 0!4 ,@0 08`0p(P$ 0400 0 0!(4 ,@0 08`0p(P$ 3 4@,@ 0 08`0p(P$  0403 00!3 ,@0 08`0p(P$ ھ 040<3 00!,3 ,@0 08`0p(P$ þ0402 00!2 ,@0 08`0p(P$ 嬾0㘢40 0 00!2 ,@0 08`0p(P$ 唾040 0 0 0!(2 ,@0 08`0p(P$ }0401 00!1 ,@0 08`0p(P$ f0400 0 0!|1 00 ,@0 08`0p(P$ N0400 0 0! 1,@A00 0 08`0p(P$ 5&F qq0ӛT0ϛq@DЍArA*@{B&cA&c*A'cxA'cAAAAAX'cA%cA&cA%cAAP'cAAAc&cd1*p@-P @l~qh 0S Q0P@@@040p@qPqp@ 0ꀿc%c%cG-S@`pR0 0 0 ] 0  B0 0 0 MX 'R 3SH0L0S(.@PG  0  RV WV R R R R 0S 00) 0,P,0:S) 0R% * 0+P 0 Q% *D/Q  8$(0 8$(Ѝ0 #0C?o231 uP (MQMa  #RH L0S0P  0㚛@0 0 0 o0H   C/R00C00000T 10S q?!.0( 0 (  /R 3SH0L0S0㆛@P  M^ K^(`)p0, 0h`1 01  q({dA&c%c dP'c(H@AO-0p'S(,`(M@P  P ] P ]P  0 ЍO@ЍOЍ@-0  dC-0@p4M|d2`PP Q7P1HpD2DR垚420( p喚V 0SS*4ЍC:p8p 1`1 V@P  ]]P  4ЍX@Ph 400   0 /P G o@T> ppP XX0㤙5@o CpoWT 40 Xpp` dU0030# 0S H0$U0*`B 004 0 004 `Pdp03/@c%ch*dO-ppPX00S . 0` `0000%[ QI$&cP'cXH@qAAA4d@&c)<+H@hH@ AEcXeXe0d@-p@`]0P p@3 Ѝ@-@g @4hp@-dP@g0SA?C p@@'h!R1S A?CSP 0d4d@-@D P0QQ  00S 0R  4Q DA-@p`Z(P@P gu(A-PpJ(A``P@  `WP Uf\(p0S A0dp@-`DP@Tp0S  2PUP $4RPD@A-@p`(P@P \g"(D@-`P0 R R 00SDXp@-@`'P@P 8g'pp@-0PS0S0S 0S, 0S00S% 'A &P@'p`00#d00#h00# l 00#'pA0dp@-P'A`h@PT'p `P0 'pA@0d 0 S 0#/00P/Qp@-@p@ L/$P 0 SRp00k01p9A4H@SRG-M1%p4QP@ $Q !BQ -Pg  `VP_ R R RRQQ`V\$U9  BUU 84U F09  ` $$0 0$0 (0$0(0 ,00,0 000 00P&DFP`o1P&.0P9` $ kP(1PЍ`0@V$( R, R $2p H 8qH mX0  SX \  d `0t0 0x0 $S d R00 00008 900 P!U   $30S DZ  $S0 $00 000 000 00 0^P1XU p H~ 8 X H/ d d 00J&08 0 X RPP?#0  RP P2 J900' d@hAiiikii G-9PQ@`Ma V9Q] ; 6C0CQX 5CjuPio iJi( i i Vi?Pi ߖ>Ni0iKiǯ> ~$ni i ixji >Ydi Ii %i Qi >!i O-pTODP@`UT D P5TX@@0S0 00SDP&O PT v ` Z` `$4R@@00S0 800S DgT@ 4Q@8&c80S/A-3`A0ASHM:p"DPD@$T"4HЍ00S1'b"0 000S)lP% 00000S .`   00 003d0,!G"PaD @0@&cP'cH@AEc@-@9@A-HM`p}"DP@T "|1S  00 0HЍ00S!a"oG00S .` + P P0%0000媛G"PaD@P'cH@A@-@|1@1uQCp@-@P AP ;oppp@-`"WPWW:N t0@0L0`0D00@0 0<0(080,040D00040,000t@pf*,g*f*h*`i*d* e*Pe*p@-P@u0@`01as;laVV Mp@V00000pp@-@P 00000000p@-@ M Ѝp@-@VPVPp@-@0Q$MG 'R`l P'RXo("($( 0t0 5 0 \ *P- R00S"!10!0!0!0!0 0$Ѝ@\@P R000CS1AAA-`pP@!200SD0CS:!X 40GS* S( #S_ KS% Ѝ o\Q\ X ^ QPQ `P H000S D0CV`#0F0 P  P V 00#S0  o`%S000 00 00 00 00 00000V0S  0000%c%cQRI p@-`@M 0 C.^^ P?R1 G 000 C0PU'X XI XU XQXx `0 0<000% $MP`ЍpA ER PPC/C-40@SOM S $ R0#*50S %0OߍC  R |1 0 0 0|1 00 0Oߍ@D  Q :S S #3R t40S h$l0|1 0 0; HT, `P2 p; ⷸ4Bύa`a`001411 0``1P t30S 0t#t|10 0(0 ST#2q12L [PP ` r2P<2034P09}P 20S 0"mXT lPOX20S 0h"lZ,20S 0008"@000000 00000000A 2LP1B110 0141P /P d10S 0!S3"p'qr>\10$0$PU ~_EUWX `p`1` `<1<0@ 0000 0S 0 |T P0 L00S P0\ P$y1(0(PL\^P'cTI@AAADI@H@aI@tA@cwI@AAqAI@I@AA@eXeXe8A A@-@ \4X @b8n*0O-,00( S@(M @P 0<S@P 0b 0 0bx"#2't1040bt' 0傇PP 0 K0( 0",$ h((Q"dhd& @ Q         R/ R !! ,P 2 0!&Ȍ 00 #8S r;Q R r[ Q R Y  R% ZA[ RY Z R Q R R R R rd   PR R R rd   dPR R [m ;/000$ R  2/P [Y P"0R R; R8 R5 ppWp Q0Q-Q*Q'R R R R p W Y  "Z  R W  pR R r $  P R RG-(@Pp,`PM00pxxp'p0S.0S0く RF 0S 0S 0s 0hP' (00 0 P" (00%0PЍ#  ! Q#3 P 0 P 40 X 40 X 0S2 P0S   &"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 06i0SA-6PS0M0S  0Ѝ0S0Ss0SQ@p) 0S0S/1;FP0S@ 0S=0s  RE`0 P1(0@00Ld-0S  !> 000S ZPd010S d0ZP 0 S0S /\'cHH@0SE0@-@8P<$MP 0S$ 0R ȃᵃPᬃP0S0S0s!.0  ⸃P $Ѝ0 xPS0S ,0 @@z/8{O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! * ! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  P0  {R 0  0sRd   @0O-M000S `Ѝ0PS0S/`0S. 0@Sp(00S% 4DP`0SK 0SH0sEd0 0S0S0S0S090sP3#21208S, 00P0<0 P 0 PPQXD XEP W[*0S0S0s0S0sPU nv!>6d0刐 p0(0l 0004bP0S100 0 8,P0PS3 uW,PQ <[ |0,%S 0S0S0S0 0XPm0j0S0S 0sS0SQP 56l0S (0l00L0t0 l6P5g 00000S 70`( "4`4# :000QX  Z 0S100`P6Uy ~ aP `1`0`\'c@c<&cO-hp&h &TT$M 0X ' "%X " A  TpzWpp) PAQTI$Ѝ R R d  &R&R Rzd   0JP 0C @ j018E 0AT 0S0S d0 6S 6Sd0  "P @0S0S d0 6S 6S W d0  P @0S 0S   0S0@@I@0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "A-0@SPM0S0s  0 0h!0IЍP0:taUP1\ Q: 0 CT0C2T* S 5 A%CPU^\Q:ࠃÅ0S:3P50\Q0ࠃÅQ:0CPRQp Å0P0RS5W0P0R^#05W0P0RS5W0^P05 A@p@-@08M S8Ѝp@vP`.q "448 #8008ЍpA 0 /%cx@@- O@(]PZ)ӣ4EDN>A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  008dG-@Q MPp@`I YF 0S A`0d 0 `0d /@ Ѝ  0P 4@@ V G WpA\0 0 0 gA@ H.PH0S |1 X0\0X0\0S/ 0S,0s)  0 ]P T @T  R H0C@Q S``V |1 X0\0X0\~00@dO-x8M#2尀崰1(20[H`00p00DlpSX00Z 0S P |X@PA [@pPUXHT0\00C?o20S, bX@P' [@ZXp00 .ApP`00$0,7 0@00000@P0 0UA_E0UY n1p@ @l0D pP [BZWX* @0S0S0S 0S pplPHvH0X40@p 3pApDH~[(ZXTWL0 T RP WL0 @ZZ@pX5(#2!12ЍZ@aXTzPU @X0S0S0S 0SM  n4t`T6 lTP 1p @pP [pp`[@ `< Hi@PA<0$ R=`0l3t 00x0S/ 8 lQ@P)4 lK@P#8 40R030S `0 H,0P` 0s 0@0P1D0DPU A_EY `T?`X0H` 0 00SHD?`A? 0`S  SVX`5?` 0P0P 0  0S0s 0s 0@0P Sꗤ0@0P0s 0@0P0s 0@0P 0R)T0Ss0<0s0 Xk 0<< R<RZ | r%! !Q$ RnTR  V` 0>` 0SX>0 Rg0 `T R QRM  #  RC H`,0&0P,0;R @c0d8&c&cP P/Q|1 00/X&cp@-@PL0@ 8P| P H@|pp@X&cp@-d0,`P( 0 0@M 0  0"` `P P!PP d0!3d0"44 6cЍp(0 @-HL H s < 8dC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  ?0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H 3oP0H000H00@@cddd8d|10SQp@-HMPH y<0sHЍp$P 0 R0 $1aUH@, TPFPH T@L00PLP P ,$P @ PP ,$P @T-/0U0L0 ꔊmuH8d0-C-@q`^M@P@0D 0 T@0D 11 ƢXp!¢xf?!0HpU . U. PPT 0@@00p@p ^ߍCЍ/0 0 0 m|1 80<080<dH&c&cA*A0O-,00\Mp `0S 0S  0S0S0S5 0S0 5 ~z{\Ѝ50C0( 0MRM.=}h5P0S H5@D<00 ,0<T,{@P+e0 0 0 U0@;z@Pz@PD0 0 0 U 0 u0,(000 H( $>=P H= (00$0 4 U0  $ &=P$ (0R< $ ($=P Hc=(0 0$0 h3 H( =P$ (0HR0@( D0\0* cw<,0 <,H0S |1 000U H0@04`#000Q 20S5 00``'H`3`= =80H SlP r 6<,0 <,AUa (Y 7Y 0 W)P 0  R <,0 <,y=@0HP H0S |1 X0\0X0\@0D 0 @0D 80< 0 80< H0S |1 H0L0H0LZ H0L 0 H0L U yX 00UGZAeAqAcd{AA\&cd-$M840, (  0gno$Ѝd@-(0@ R+`p 0uP3T( PPQQ0SIuPU@ru0 000 3SH L0SP0\ 0 v@ ЍP< 0CU* 0kuPO-LM  l 0@P`p㬌!< 000P,`(p$@ @@ @嫚 0)!X<  0@04P0,`(p$@ @@ @嗚< 004'!< 008P0,`(p$@@ @; 00!; 008P40,`(p$@@ @it; 00!`; 4008P0,`(p$@@ @R 040; 00!; 008P0,`(p$@@ @;*0@ n 040: 00!: 008P0,`(p$@@ @040\: 00!L: 008P0,`(p$@@ @040: 00!9 008P0,`(p$@@ @9 00!94 008P0,`(p$@@ @ڙ040`9 00!P9 008P0,`(p$@@ @Ù040 9 00!8 008P0,`(p$@@ @嬙0408 00!80< 008P0,`(p$@@ @哙040\8 00!L8 008P0,`(p$@@ @|8 00!8 008P4`0,`(p$@@ @f0407 00㬇!7 008P0,`(p$@ @N040d7 00!T7 008P0,`(p$@ @70407 00!7 008P0,`(p$@ @ 0406 00!6 008P0,`(p$@ @ #040h6 00!X6 008P0,`(p$@@ @&0 400!606 0<008P0,`(p$@ @ @٘5 00!5 008P40,`(p$@@ @˜l5 00!\5 008P40,`(p$@@ @嬘0 400!505 0<008P0,`(p$@ @ @哘'0404 00!4 008P0,`(p$@@ @|l4 00!\4 008P40,`(p$@@ @f 0!40<D 008P40,`(p$@ @@ @N 0!3030NPP <,0 <,it|10 0 0BM( `uP q 0 H R> p9)0 9){|1 000^0 0 0 i 0N >(   mt RJF0 0 0 Q|1 0 00 0L19)0 9)R @ %=02F?! !2S28(0 8( 8(0 8(0'S(t0`Q 0 0 0 |1 0 00 KQ6 Q! Q Q^ `00  eP Pd<,0 <,P0 Q $Q Q" Qq90 0 0 |1 0$0 0$ ss_\( \ q Q$Q Qq Q P q Q q Q q 0'S(dsP  0 pR00! !Z0(  sP ><,0 <,I 0` 6P ,0 0 0 5 P 5 P50P090 00S1|1 000fPT9pWP p0 0 0 @0D 0 @0D |1 80<080< r88LD00H00 \0 $0Dr$0pSB p0S00:S{|0S*@37pWG DA+㮸,⪸Wu]h7h'W0S0Ah@ЍOV L @P ?Xc0SP@Ѝ[CPP N@@# 6VR  >3@03430CPN0 30P""##4 R00Ǒ3S86@|0,6 | @I@ T -@ |~@P@\ |~@P 0倅0# 0# 0# 0# 0# 0# 0#01Q5 %0 5 %U5%0 5%0``&0`&0`&0`&0`&0`&0`&`1q\ P $P0S  P PD $P>0S;  U+ . LPc. _00; $ 0P0T|;<3 0&&'0 x000C0吠Z PᐠpWUe 0q`WU4P:7@"Q  <gi c4 MP" $GP|;<3x0S00C0xPp |PP; @pЍv@P9Wڅ+0 @@0 0a@P d0R55-pGWpA+p?+8A+p?+p?+p?+p?+p?+p?+@+@+ A+@+@+A+p?+PA+p?+p?+p?+@+p?+p?+p?+p?+p?+p?+p?+p?+p?+A+0  RW0 d0R88d0D A/0K d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S0S0S  d0R99 d0R55 Pu@P_ A0:Pu@PS A0 -,PY u@P A,= A 0 @`@`T ,@P= 9@`0`0000 0CSC+C+(D+XD+E+ PuP`PP  :P 0)3S10" 0S200S@8 0R;0S8@T5+@1PuPP0  R00sX800 duP0S0ĕ8#2120 000P $0 P @$0( 0 ,0s pB_ P9 x `V 3S100 $8#PpW0 $V P 0S 0 000V $hP p4` uPr408 0<0sp^fDP  O9P O X "PMpWJ X 0X 1PQ pD0S85XpTP05PhJ"P2-0Jt@P0S S Sd04^d044Zd044Vt@P傱WW > 50S+W$,# GR@zğ \ Rv19@ 488`40ⰰ2P 0 `60S .d P63`&`1`00>|h`0d 0 `0d W |1 X0\0X0\V1@SN0D0SMx1S500F00< D06@PPPD0H0b5D0PS<[@P `0d 0 `0d 000BU@ |1 P0T0P0T6@ DL P@ D0 pN/P D`0d 0 `0d 0@0 80= KD0 SC 4@ R<000000> @ 0<01 SP<0SD 3Jύ$ 1T0 P08z[P U`H00XD@v  Xl*Q  [Jύt01P% `$<0R00@ U0<<0 |1 0003SB0 0 0 U |1 X0\0X0\3@3 ^P x1S 0S  @h0S! 30S00S20SX  @ :P $R*X&Q Z X0<V x0S  R SU@0S 0S L0(0@ 1P>LP@0 @L@P@0S `<,0 <,}F (,0V <7 4 [ l@r0 0 0 }(@@cAP'cXL@5AT&c'cd%c$%cedS@D0/ Q0*$ P>P0<10.QS[R0S0Z0S[ 0@0P @ $(  $@1,@@0 3  10S 10S @ ,000,0 $00 @D<Y<0PY20S 20UߍvS A0 0 0 @ X*A0 0 0 Ud |1 h0l0h0l[00S 0(000",4c8<0X00[@00(00S0 0  , @,00 #  # R 30S @ ,000,0@8#8 0 0C40 XU, |1 `0d0`0d#0S ,0R  0    0FUP@ C_`0d 0 `0d j7@`0 `@0,Y@PTECS0 $0g0P00%U?0T0005 P<,10@T ~ODTAEc$y+y+p@-P@0@0d000?00:<0?00 0400S 40S3 !0 0p0u%c0p@-P P@=U0 @@@D@H @Pp@0Sw A-@`pQ@ DR HQ0PP DX=Q$C 0 0 0 .P  01 0S@0@Hp0C Q60+0+`+0+0+Ԅ+Ԅ+Ԅ+Ԅ+Ԅ+Ԅ+Ԅ+Ԅ+0+Q! D R  v 0L S H0`S@A 0 0 0 D0S H LZD R $ ,H0S / 'cdlL@`AAAQ|Q/P/c9p@-@P u$p@?n*0@-@PP0$M @M|1 03/PM$Ѝ0p@-0 M @`NPM|1 0@4/@MU MT06 Ѝpp@-0@SP M 00StP  P0@o Ѝp` 'P 0U   P MM0P 4   H RMM0P/@- Hk@@@-|1@PL2`PM 0CPj 0Pp 7C0CPVP 0P00PЍ1PD (7C 0CPC 0P p0 ]PP 3`PP 6(06 06$0Xp\00p wp,p#M<1P 0P,0S0pW 0W p0'u?0040 0S0$f8 ◝0-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$PLV^Lx00Cx0,Ѝ PP 0 `O-Z@ |1xL@A4P @0SL0/P @o/P/// O-HPM@0`>Y5 ,PU h38@`  P 04#4Ѝ0  2 0` -4 p00 Y Y 3S08@02 804@00Pd0D0S 8P .00 04PH@L@A9AhAA 'cHeASp@-@P@PXP`` P  03/@j T@ P@p*@cO-`QpJp  ZQ- 0CotS"0( 嫲@0, /p1` P0@0@ S@0@$0 0S032@ P) [ 00  N0S 000 0 00 @0@ S@0@$0S032@0@ `&cAdP'cL@gA9AEAQAIAmAAAAAAH@`e  XeG-0P8M ` .K 0 0D8Ѝ` R008ЍGT 03 Xxq@ `P T X8ЍGT .`  00 +~P0`` 00``0@0@0S `p.` `0 pY 0h |1 00T 0H @a~<0 $ ]A@&cXeAP'cL@AEcMb(+`ep@-@D> -PPp@ u}rp@`eO-@Mp`,PP4 0S 0# R @` .pp0.   0"22X" `X XD P~20S "l,D0 00$ 0( 0  0R p0GP p0 QfP FKA 8$(0 8$(,jЍ0S00S t1|a0S .@$P!h@0H!000(1 0R  0FP 0 QP F | R 50 00Sa  l00Sa .@pXl005 `FLX, @0P`0 00`P'cL@gAdAAAA1AA-/1 -$01019/HH@/-/-/-$M840, (  09$Ѝde@-@CC-@-p0`0d 0@0S P(00   0M?@( 0[P(`@%[CC(0, 0 (0,  Ѝ1M  Zde@-@-'u@-80@0SgP G00@{+'c@-@:[@-@[-/p@-@8P8`ᘰ/pPD PP 10SЍU8 0 Sp* ( 0R*T᪟ 06T 1!00 Pᔟ100!L&<X03/6Wp0`A-@Pp`L0 c0 ^ 0Y 0T0 O!0J03/p@-s@(0$003/$0 (03/P(0op00S/'cB@-@?P,00,0$0( @0/@-@/P(0W(0@A-`P`p@P   03/@0 cBG-hP`p@Pj@P L@0 4/@@q0 cB@-TMp@P`00S  D P00@ Z \Z0 D P   ZTЍ0 pɼ'c.cABA-@0, (` 40Lp& 3W R@PQ]0 7/(0LP偈< 5/,0> 0,01 0 ??<⿵3Q#3?P [@P # [P0  R= 080#80C?o2S>^N0 7/,0@ 3 #R(0\\Lp>0 0,00 <0+cEc,B,A-@( 0  R    RA| ` p  P ,]@[  [Li0 8/,0@ (0LP0 5/(0LP0 A/Hf@3B7@-@(0HPۇ 05/0<0(0LPЇ0 5/040 Ѝ07@-(0$  Ѝ0 @ Q 040HP嬇 05/(0HP备0 5/04 0R40 8 Sps@-,0@!;90(0LP儇 05/}_(0H`{0 6/0S'PU 0S , P(0L`f0 ;6/Ѝpp@-,0@ 06/(0L`60 <6/T0 0CSPT&23L Ѝ(0L" 0V8/pWH(0L 0V8/pW@C (0L` ;6/(0L` 0 6/t0@(0L`  x56/(0L`0 6/(0L`; 6/߁ $5(0L؁ 0V8/pW m0S p` $&8Q8 R(0L忁 08/(0L巁 08/(0L寁0 8/(0Hp姁 07/(0Lp埁0 07/(0Hp喁 07/(0Lp厁0 07/t0 (0Hp傁 07/(0Lpz0 07/#:0`VS (0L`i 06/(0H`a 06/(0L`Y0 006/(0L`P0 6/x0@ 7S (0L`B 06/(0L`:7 6/(0LP20 5/?Rd(0L`' <6/(0H` 06/(0L`0 006/t0 (0LP  15/(0HP 05/(0LP0 05/(0LP x15/(0HP 05/(0LP0 05/(0LP؀ 15/(0LPЀ: 5/(0LPȀ0 S (0LP彀 05/(0HP嵀 05/0<0(0LP媀 05/,0 wi@i@i@ i@@  WW Pp Ws@-@(0LP儀9 5/@P(0H`{0 6/0 'PUЍp:A- 0pP(@@pD0(0 `Ha 08/(0HY 08/0@00@0(0HpL 0 7/0  D00D00@0Ѝ D #D  I 0 D00; (0H`/ 06/ D0, R0  R1  R6  R6, 0D00@0 R  R6  R6060D0(0H`0 6/0 D0< D0 -D00D060D0600A- 0`@(P@`D0(0 pH 08/(0H 08/0@00@0(0H` 0 6/  D03D0 ' D0 0 0D0(0H` 06/(0H` 06/0 0 D066D0 D00D0Ѝ0A- 0pP(@@pD0(0 `H 08/(0H 08/0@00@0(0Hpu0 7/0  D00D00@0Ѝ D #D  A 0 D006 (0L`X 06/(0H`P 06/(0L`H 06/D0?, R R  R0 0D00@0 R0D0D066D0 [D00D0 0 00 0A-@40$003/, , R^`P(0L`0 6/(0LP~ <5/(0LP~~ <9/ 2Ro0Sl0 (0{LP,~0 5/`S S P P@PB+02#0S0SL S 0 #Rs$ #o  R "0(0HP} 05/(0HP}0 5/04 0R40" 8 S00S0S 040y@0S S S 00S0 S(0LP} 15/(0HP}0 5/,0  0000<0(0LP}0 905/(0LP} ;5/(0HP}0 5/, 0 ;;#;<;0(0LP}0 #;5/p}@-P j@A-p 0P(@@pD0(0 `Hc} 08/(0H[} 08/0@00@0(0HpN}0 7/0  D00D00@0Ѝ D #D  0- 0 D03 (0H`1} 0 6/0(0H`' &}  06/(0H`} 06/0  D0 6 60 60D0@6  600|0 6/0@D0006G-P}p@`n  <0p 00$pp0(`0,0$003/(00H|0 8/3 03BGj@BBs@-,0@!;90(0LP| 05/__(0H`|0 6/0S}QPU 0S , P(0L`|0 ;6/Ѝps@-P B@ 0R>8N,XM,4M,dN,S8  0"S4 ЍpS  0"S (0HPj| 05/(0LPb|0 ;5/$03 (0H`T| 06/0V>00(0L`H| 06/S  0"Slp@-IP @j@G-PG|p@`9塲  9<0

v0 5/(0LP6v#k 0 0000 R0S @m`2k0@DJ-k 00 @$ Ѝel@Xmds@-@`GkP@k0 0000 'Ѝpp@-P@D`0SpJXP@&kP p@cQ @-/BC-@ 0P`p0 2(000 9/HPH`0S,0,0S  R 2/0`0 ЍeXmd)cC-@ 0P`p0 (000 9/HPH`0S,0,0S  R 2/0`0 ЍeXmd)c0 , /eXmds@-@Pj40 000`0 6/ЍpG-PMpPt `p0P@ 04/p@x2VX %'17V. 7C0CV7 0% 0 & 000@PЍ2V 0tp 0PЍG/1Vk 0CV1V 70V@ 0S R  0CPS0 0 0@4!04/S@00S P 0 p@P0L00(0( 3/@P0 R  2/0 $ R 2/ 0 Y? 0 Y? ! #|8PЍGu@vPWLW`WXW (0Q40S0000//TW@A-p42 M`QP8' @ 2Qw 0Q 0CQ= @ Ѝ1Q: Y177Q o37QPh 08 0 ЍA/pW 0 @P pP  0@P0 @P  ЍA`00S@P 0 @P 0@000T< p$}@P Q\0$p0 03/@0s0S@NW aWMW(OGBO-Pc @![V;i\ 0U40S0000 Ѝ\0 0p ЍOE AT Z0  4p0` ЍOn0p $0 ;/p0  p0p @cTW@0@-MP@hx0S  8P@FP  儝Ѝ0$B@-P 00 0  3 ЍW P/ 0/A-pW0@(`$$0PV`T6/pX8LO8s@-@h40S PU T0(0Ѝp@/0 R ` 6/@TЍp0@D( 02/A-P`phu@ UE01SC  40S 00Su0 00P4P00 0000S  R h R  A@@ 04/#P  e,@-@8h4QT T@0 R@ /P/p@-0@SP` 0P`4 R   p03/P p0S 0004 R   //?o2\0S//Q1S ///40S0/qA-P:@`p400S0T0S0 @QpW 40`S@ 0< 0 000@S @  @EB@-@g40ST   @@sB,A- @!PT`g0S87 S 0AT 0S 0S p`003/0S 03/0 Q   2/8000S 0  2/ 00 0@cep@-8P@0S0T0p]P00e0 0$/)ce0 0 0$0/)cep@-P gPb^`PpaP@0Pa p@7#plB 0     R [$X(\,Y0]4Z< @ 8D 0/0 0 /  $ p@-p0`P@ P p@ jP000PU P@T iPt*c,0 0S/ R  B /0t*c@-@t0, @0 0 S0  0 0t*c*cX0 0S/ R P  R   00/0/t*c8- 0000 00ep@-@PH P`0 0H0 00P0000000p0eC-0`pP 0@5/pV 0 0 ЍC/0 CR3, ,@,,,,8,E0S0C 0 P0PEPE0cUP!009/000P 05/0S0C0 P 5/0 0S0:00 0 0CR 2 5: P 5/0  P0A5/ P/0e; S 0 0//0eQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQ̪,t,ܪ,t,t,,,0 .0!0 .00 .00 .0/5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /A-3A@Q,,,,,,,,4,d0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0V:P 0Up%p%*`Pp@-0@000\P 0\0`P 0`0P y00P s00P m00P g00P a000T@YTe\Q@- /6Q@-/%QJ 4A0&S2&Q/ꌯ,L,t,,D,D,D,D,D, ,D,D,D,4,D,L,D,t,D,D,,D,D,d,D,D,D,D,D,\,T,D,D,D,D,D,D,l,|, @-0 .0!/  /9Q/Q$Q !0AS h00 S 0h0@-$&Q>0AS h00 S 0;Qh0h0 S/1 l 0A!lTX 0 AQ  R 5` R  R  d    BQ / d /G-<0@@`p  d0P3 5/0pW<0@  d03 ЍG/P`]PEUر,,0,,,,(,,,$,$,$,$,$,$,$,$,$,$,$,,0 S0080S0C 0<00<00\0dQ3,3<` S0B P: R  b0CR000X 0 S0 0[ ?o2X0SI <0!0!SM00<00<00P70S3 .01 SXEXQ<0 d 1`Q A02 ":/0 Xd0#0@000:/0 d2!cR00C<000.01!03/5ЍTm@vB0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 R0 R\ 0Q Q Q/W@-@(0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@M6Q 0A R2p7A,Q긷,0,0,0,0,0,,,0,0,0,0,0,ȸ,,0,0,Ը,0,0,0,0,,, ,,0,0,0,0,0,0,0,0,0,0,,0,,,,0,0,0,,S,0,0,H,0,0,0,0,Ĺ,Ĺ,Ĺ,Ĺ,0,Թ,Թ,Թ,p|Qg nQ` oQ00}Q[ ~Q00P( hPlRYp<0<<00000@00D00H00L00P0001010 1010001<0 | 00000@00D00H00L00P01010 1010001<00<0^<0000V\ 0Q00000H00T S?S0C0`0S  0S 0d00 00CR-0+0d0(( hlQ p00(Ap,Ap pp@-PP@ p`E;(0 0 000@$080 -\ P(`dP #    x ЍTe@-P@0 080\0`0d000000_ЍTep@-Q@<0 Q Q <0pQ *Q!R0 ,R0!R0 ,R0!R0 ,R0!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@Q`1`!PEU0T  p07/`0S T  d0Tp D07/`P T0 PP`0S  0S 0d00 00CR00d0A-X`@QP1P!`FV0T p 07/`0S T c0 `TD06/`0S T ~P`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00?P D0R P5/`P  /P0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SB,L,,,H,,,x,,,,,0,0,,,,,,,,D,,,,\,,,,,,,,,,,,0,,,T,,,,,,,P,,,,,,,+SS ʘ+S ʌ+SU  SW $Ѝp+S h8$ЍCT+S ! BS;  SPh`h0S! AP+S7 l$ЍC7Ph`h0S, .PPh`h0S, ]PPh`h0S! RPl$ЍCl$ЍC37 l$ЍCAl0S 8L 0jzQ \PQ R00 P   81 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/\0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRB0@0d0=X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0ld 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍCDlQ3$ЍC{ld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0r Qn\0Cl0S <djl0 S0C BR 0Zl0S SU \$ЍCM\ 0K0HPLPphP@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0Kl 1R41R;,,,,,,, ,,,,,,,,,,,,,,,,,,$,,,,,,4,4,4,4,4,4,4,4,@,,,,,,,,,,, ,aRYRPRBdBQP\pB0w @PR40@0D0HPLPpPPPPPPPPPB R p\$P @ Rt 0$P(pB R p\ P @ RtppR \0 @R00ѫ pl0Sg0@!0 0   8[l0S S SS< 0T 0C 0 S S I A E B ?l0 p S03S0!R 0CQccP)< T0X00XJ?u&p$c>Bl?p$?B|BABBBBBBBBBBp@-PUpU- @\L0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0 BA-@P` 0!0`3/V0p4`e%n 0!0p3/ Wm@p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@o@p@; S 20/ <8#8SA3=8#8SA@A210/</t2>08#8S P2AAP00/<0 /<0 >8#8 S 1A0A`0111Q 0CQ 0CQ 0Q1 A+AQ,0,8,@,H,1111|1 p1Q 0CQAA Q񟗼<,p,L,,`,,,4,D,x,,,110/>08#8 SAA Q,,4,L,`,p,,D,,,,,,$,0000000000x0t0heq@BeBYB/aB]BUBQBMBIB#BBBB}BxBsBEB)BAB-B=B1B9B5BnBiBp 0S -S"0A(0,D R!#(,0/0A-@M(00 00p@P A<00,p$  `< 0PL  D    p A ,(p$00 0< n@Ѝ5B*c=B<0S/@-@0@+cSA-@ S  pp倐lP`pP   03/@"NT@ @AXq@MBc 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@p`Pp@@0S/p@-P @ 00 R PD  u@j 0P 4p*cL,@0S/@-@a@t0@04@ O-D0Z S(@3?:pPa0 S.  S lc`Bv @ p\V`@ 0  >0@0000@X Q@ T`` 0 @)`@X J#@0 800@P 44V (4V 4V@ 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQX3V] 0L3V $@3V X 0 p`P  h P\h X2Vn 0V`P2VA 2Vp 2V |@000000000 0 0 000`1t l00| 0pЍA/g 0     0 0 000l000Af0 0000 0̀`PdA Ѝ? @000000000A00000H0 0000 0娀`P@ 0 R 00ЍA]0-h0 00P0`P5 PЍA ``W W @W@W @W W@W @W@WWW W W W WW*c*c@-@p`V0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0U ЍP R 0 0q`@ @T@@~fvtA-@aP( C0 pA c40( R/$ R R/  /le-4( \0^/leT0Sp@- @RP 0f1l0p0p@//@- @ P@A- PC@PP 0SPPUPX0S PpWP0`P`pPP Pp cD@- 4kCP@T  P  c 0!< 04 0 (   !/@cddd RP RP {//C-QP `M 0q<0 0V@p, 䀖XW Ѝ0 8/P 0S 00p W0 0CW) T ,6W 0WT zh0 0 : STP 5W'= W: =GTTh Tp 0: 0: 0h T 0:: 0h T 099>08#8 S=;G"0C S t,|,|,|,,,,,,,4W00G?o  24W00G?o  2|4W00G?o  2 0T00 0Y  00 e @DoQa Q^ > Q[ QXe @z 0T0 0 0T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T p{' pTP {-t0WppS l00p3/tpT TP 4 @@a0D8#8S @DH$H0S;K; S< S {:< Sx@k1Tp0+ 0k0S0+ 0Ab c0C S@0}p@ 0; 0; S 0 8T .T T!  0@H$H 01AU/0D S0,,,8, , , , , ,,@@0D8#8:S@@DH$H@@01 $'* @-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 04,0 le*cA-PSU@x0S( P$ST`T0V S0 PVPRTpT0 0.l00p3/PPT`TpV@ S 8ډT0SP `yS BB\ P/0 !8 00 (  , !/@cdddp@-@0Sp@P0PS 0p Sd :!J.T0S` 0Sh0T0`!EcMb@-MPNSX0@S `@..x0S 0$ P`V% 00S" 0p0CS00 00P k< p00`  P RHˉ<~U@R0 LЍleEcBBq@Q @-/ Bp@-`P0@ $  `P0(0ple`, ,`,p@-P@PPP(Pple@-Mp`PR0@S 00-C0S$  hPP:TP0S4 S P0 0!! !1Ѝ@-h0U h0TPP @ R 00`SPU0P00 P _R  ЍEcMbBp@-@R000p@-@P6RP@p <8#8S@ /P/ 00S/r@@-Q \,t,,,,<00000000000000000G-0S$@pP`Ẁ0 R UR E F\ ᶠR0S BⲠಠḠᴠᲠ@ TP`ᴀ000P@/ "`Vp`W0C2? 200 *c  Q != ^Q‘ @@HPTlLoV  \Qڰ A<8Bp@-0@SP S`@ ` < Rp؜0000 0O-,M @p P@DQa|뼑t',Ѝ0PU T̆PU0 T 0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `*0Co[ 0 SQڰ  02"^BBp@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`puPPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p,0c@-  001P,0c@-  001PE,0c40 60 0 1PH/,0c/@-P`xܼ@fؼp0lpp000 P$0@@0 P0tp0 ЍB00cp@-PP@0S `ݼ`0Pp0p,0cBs@-PP 0XP\0p0@`0\0p0T0S 00SPQЍp3/ t0S 0 d `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HqO3PV '>C 0CV 0CVP x300 l3V P0ST0S g lpWX` ,3V0t03VV 3V! 6C0CVP 0VlPUQ 0 0RnO0Pi2V`lPpU``PP trttRdpVʀ 0! $ 0   , !0 00 0W 0!d!0   , !$Ѝ0S S S $ЍOPR X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00N\PP $ЍO4P R 00S0<0_P 0 0q`V PP0S 00100  0;/P\p3vt`WW~fdWcW@cddd$ 0,0cp@-`P f`t@P   pPU X0S P0S 0PpppG-PQT@TP `N e`lpWX`UN@ M 8G00S 3/`P\pBB@-@NTT0 TQ S S @Q @-/Bp@-@PXp=PpMP ;P X0SP0Sp@pB 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P#!- \ X:#:^:\:0Qࠃࠓ\^/Ds@A-Pp`@@0@Dp@0@L$<#@`W +P0pG`@A-PlL0pLALA$ `@`W P0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0!`pW:X  QY Q  P 0PDs@S/G-` p P#"Y@PX O0S  P00H@PR/G-PQ0Fh pY@p`V8h P0S h P@pG-Pl @R`T  Vp P匀`#801U 0S  {P0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  JP00pGPp@-@P}0P $R@P SC@ 0 S 0  S@C R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  fP p A f Q0000000PL0cQO-P`p@@DT 0 >p0 SX Ѝ0 )p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@cdddO-px)@4`S0ʀ0!H)0@)8)   !@V`WPpP 400 $e0@04 00$00 , 0 4 00CSP ЍTd4,0P S@0 00 P  [  H ^  L X0STX0 000Wp V `0`p00S`0`p V `d``PpTL o lNLp1qhpPL|00 10000000 P 0 Tp`  0hVÑiɐ LId 00C0ᑓ) 0R 0 0C *020嘐 0RS0C2x05A45t4545454545440Vʄ%04$V pDhTp% RFDHN\A \ \ 0 A0a00 Q3 0BP R X:  \0 c)0C2#8#<4(",$!8Q(L #8"(!PE  ᾐḐ ḐP0 \0 [꾐 ᾐḐ ḐԒ01 `@3 90  BQ RZ    0S Ec@~t( 8o@`pJlh!0V$4?T!0V$4 `FV04 T`    ̈́I 000404040404`T`  ̈́I 00|04x04`04\04d0@cdddlt@B--P-T--- --(BB( -x-- -X -x -<-- -O-@p`( ,M80S:0$0 T0$WpVP` tTP Z Y:10PP PP P$$$~00,ЍT0     $h$+ P$0D0PP0 .0P000CS"-"- -"- - - -"-4<008S88000X[0QaPA3Y3Qa\PA<Z<Qa]AP  YvY`ʠ"0I0q" (0`(020ZX0a0cP]Ws[0Y00cVc\00Sb MSW 0CSJT0SE0 @ SZ0 S001000Mx!x1@PPUET0 wT!T1@PPU:0 000YX0\`[0cZZ3 Z0]0cZ30X00X00X0 S 0P00 YU8#<4 T088 < T0 |w@ABZBrBBe |t@98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-5K/|t@O-@P L0`!P!U1 P Q02 !`V800#0Q00P0qpP b C22   `V8 0x  "  Sw  " 0S  J0P0   w@@ @S/O-p4MP@XA` P^!1 00 V `P0ĉ c02Aq4Ѝ \ DH  ! D H!@$$DL1!DH!@@   1@!!!!P` Px  ` j P D  PR@TāV 0 PN0@`000@T0 @BHBS 1(0 100c 0 0d$000Cs0s 0S0 "<<"$0,04#$(#$,0  R!,,!  $2!""$,0 0#00#00E^a 0 0SP 00S@0#̠$̌(#4 < 0#"̠4̌8"$,00 R ̠$̌(  `2 "̠̌"$,0##4<0 48,0))4 , L<\ 0>00#00#0A0S ( I0`0P^ <T"48"$0,04#$(#4 <  !48!00$31##4<  q  0j3 #  $ (#4 <0 $ !0 $ !00A1@00V@`@P0S 1 0 1000 C00Cs0z 0S M "<<"$,00 2#̠$̌(#4< 0 R0#  #4<0 a31#  #4<,<  <,Ġ 0Y.4<.̠̌0Z 00#€` 00#0R B000 0b$00 S\0S3 0 48 0 02##4<00 S0 b##4<032#$(#4 < X!0!  0S  H0`0@PY   j! 4 8!00 0 00R! 4 8!002#  #4< 48 0 0$30##4<uw@@ @O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? !1pW:Y  ! !QZ ! !Q  G `Aw@@ @O-p4S@,M@0S[60 G[2* `101!P0P P#8",V0!`1 W㜠0P  Rpsʜ%YJ*P0 0t 0c PRx `RQ,Ѝ S $p RÑ{'U$2 0 2 $0Y:0!448#8400p0P!##48 0S0`0P !  " Q  ` P꡿( ;00 B0c 0! 00#0Qa0 !  R hNP"    "\!  qc2 02 $00 p 1bR0YW:0 $"44 8#8$04  p r  (00!Q" "$,    Q\{ u r  "! RH{  ! R  0F 0` PY*P0 0t xp0c PR`0W 0PE0s00 #  "0  SM{  !  " 0S 0`F tFpG0  (0>  P""$,(00!Q"<< 0"$0,000S  `> =H2W @)0 S0``a&0F400Y0`$00000mP] .,<Ѝ$0  000( 哀(0 SE 1,0 0 W320$040C1l00. [(嚼+ W  0C0C [, 00 00! W 0  + $ 000 0SU 0 @cdddBB@-@P 0 R0$岩0審孩 R( 0 奩 eG-P@P7@P7 0Eb`Sp 000  0 kr @V 0S  $02"R0`W 0 R  R0 pP 00 000Ѝ $Q: @B `I V `r`B@@-@0P R8q BR 0b B \0 0 @-,"1AAS)A@T%!0N!R 0S \0@ P  P  P /oS" R/萈@@-0 Q0(@T (0P PL )pL%')`l1& R L1 0S0 + <@D Pr!QbU00PC10c4#P Be" "1Ct p R 00 0C##< #"02#0 dR0 <#/00 0oQ98|7@-P@"l@  0 0 Ѝ00C-M 00Rpx@XPh` (   P  Ѝ R 00 b?( 0S 00S=P   PPX7@- @Pa= 000 # 3 @ `,3 Ѝ00( x00/0 <#<0@00( x0 0/ /@- 8= Ѝp@-P@` ` ` pp@-`@P X0 &U  0 060P000p4 06000p@-@P0`` 0 000pp@-@P 00   00000CS p $p@-0P@ `0%R @h @ 0X  @ 0x0 000p #(h0R@h @ 0X  @ 0x  (h0h0p@-0@SS4H`-`-8`-`-a-`P`P( UPE 0 0000p S`0P( 008#80"$R*0( 0000C@0$0p`XkR`P`P 6<$0V0$0000p @AXeXe<Bp@-@Pik p@[BO-0pM0 0! @@0P 1S 0l0`@ 0Y":0S0  H j0` Rp00 R SPSP2/`0S0S-  R*  8?\0"0,@0/O^@00 C)@C)0c"<3P 00@0@ 0S@P  0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 B (0 @AO-@( $Pp0`ȡ [ :(0$Pp0`0S3000/V"R/ p R+R*xe-$f-(e-e-,f-e-e-e-e-e-e-e-e-e-e-e-e-` pW0( 00$00C$0 Ѝ`  R _j"  `PE  p ; P   PEp`V7 ,0, ```  @AsBXeXe0Sp@-P` U U@ T-AP  @ 8#AP0 <0p/pBBB0-T# ;T@ p&  Ѝ QCM? @ R P? &? H$H`pG@00C Q4#0@CV` pU@D 0 p0P6&0`FS A CR T a DR @DH$H@DX W@;@T@PBc@O-8P@Up=0`P00a040,($@@ @ <ЍBPBcB@- 9 Ѝ@-0 R  b@ @`@ 8ЍЀp@-P@,000 080/0 0 !""##$$00/0 pG-@ MP 8`ЁK\@ 7$P $(` 00 c2s~ C1|8Q ]gFp Ѝ4, RX]X! 0C#000 ?n pP ]g0, 0 0 0S ] 0 gdH `L0 0P0001@00sh0SA 0;  R8 0p 0A a320! r0  P 8 #61S0SS$ 0S 0;`0H @R000@0@v00 NSX000L000)}0L ; eBBB'B eؑ@@ e eP P /TBc!)p@- P7%@P`0S j~DQR ]@-M2000:0pp@-` MR@@P70  `$!1/@P 08SMF@ Ѝp7@-P 0 N@PR@P M00 Ѝ0s@-P@<`#` 0ЍpC-0000`-i0S 0 0R\0  t Q  x 0R| $0R (0RW]hJ``@c@0 R< r9 rq4 $ rq/0 r, rq' r$x r!| r r r8< rqHL rq r "sr 00 CSR-/-//O-@`4M0pS 0S,L Q00( 000S#P Ё QL  0 R0Q0 R H0A0 0kP 4Ѝ0 l1,.4,P 0\EP#QP<Y!L^Qɯ Q  L,  l1 (Q%  $(P$P=P 0 00PE U P - }Z0SU  C-0PMp(`h0S+0 0$ `30 @<121 @)@,)`"30@P4 00$ 0/,0 \*:@Ѝ0 00R0  R!p%* Ip0 7PY IY  i-@I0 0C0000 00C0>C-p@`P800CSʺ0 V0  =# C!G2 R8P 0S = C!P0S c> Pc>O-P 0X&  ( , P B R   ,0 ,0 $ Bn 0 h0 S0 2 20S09(  0C  ?o 2  !0  20 -4S S 200h0SP 0_S [ ᝙.0-400 , <t00SP}`& A 0h @AP0P 00\/@-01"\A@P 4Cc@@-@Q0ST RN^ 0A@D^ \0SQLSQ \03=?00S00Q0S0SࠓࠃQ^\ ?6?000-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` Kx 0R (: {>C 0C"4W0  !1 /@+b! T l0<# \0r#).u%.ppЍ0T00W0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ ]w@Pod-0PЍ耖@-0S00R0100 P @P R0S*@? T .@@D@0 Q RP00耖@G- @P0A S0 00.SR0 .QR 0L0SZ00UЍ P.P Bp0`^;ZSU Q CB \A R^:^0C `4 pC SRQ G\b*R^ 0S00`p Ub 0 B Q  GcR0b~  0V`: X .XQQ0p`bW PV ` B` R00 0S B Q.Q  W ^` Q.  ^ P^ B`_0R_0 0S00P U]c ,(0f V1P UO  Pꀖ@C-@PM0Q s.R R 0E $2S KA p R0 0 2`P 0P 庁.  .  .Y@PPĥߍC-`M@@r PS Pߍ 0?``FW - @ T0@ @D T . . 0. 0`W@F`0! ᲀP XPP zpwWV\ !PV RPPꀖ@C-P@?00CSLM`LЍ@0 `p0R f. b. ^. 0 0S*h0 pS 0 A\0S/Q  '0\ \Q^ AB 0  ("(R ! @ B, ".\ Q?,? Q, ? )  3000Q/@-0Qs.\ \ R 0 #@aAON/0S/S 000/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@OP0 00 @`@O(( Ѝp@ eXcBB@/@-@SS@ e@-Q|L ^DЍC-@$M` u-0pS rXL SUxP@x  !08p 00$0$0 0040X< 0L00!s0X0P0"L0(X0\00M0400X0St  0Pqd 02\0 BXe001@0 @0`_h< 00@0P@ 00$  0 PP 00R$ЍP @,0 H0 0I0 0J0 0L0 0M0X,0\0800sX &L000 00X0S KB HB000\ e!! e@B 0Q0A-` @ P80 rGLppF\P:]pd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\Pu00 00H0 C2 000\0 >0>00C000\ *0ЍABO-@L8`p0,MP 0s H$ [,Ѝ0 0\0S* ppd0Ep7s0GU 0X0XP 000Z\P0c 0GPh  ZpG $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B o0$ % \P0G 0r -P= r 00 0Pd0;0hl0 Q AH0 C2 000 0\P0 0000#SnBp@-@PT P A0 0`f+`hPp e@-P`&@PUO@0 000 001 0!&00>Ѝp e e@-PL&@P4.Ѝ a'&P e e ep@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@ᮝ<N&P$FЍ0 0 e eA-0Px0 0唝lI&@\`FT 0S <ǝЍ &p&P@ e eG-P|@xp(D0"HC \ ! `.V x(x 0 e-   11 1`00C`0`0  0`0 11 1/@- * Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0ts4M(00P000X 8@ERk X0S04 p000 0 0 0JS 0\0 00h00000p XR:0#S(P Y l0d G BT02000Vp`dp2L0.L00 VX0S0 R d0\QV l 0CP 230Y l0CL3000V00R d\01CpS04Ѝq000 0SNW\0S*(P I '$00,0 0[ (P 40(l ,0 B$"P$0, (S:P ꄰ0{0 00^ H0[ (VP Hhlj e h00\ %S/G-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0WPpp`0 00zk)0 {0e)0 x080:4>r0"\!o0C00$D0l `$0 B"0$0`$ 006)0 I0P   qXp.0Sp((5 P ^XЍ褙@;BWBO-R4MXP0r\0@Sm: & 00$0 0(l $p0 B$"`P3( 0 z-3 0 0 1Q+ q1 :CQ0 ( !4 0 (+0(00t0(P 4Ѝ| Z  R 0 0%RP0 0RP ,,P(`@-M`pP0 0 0u@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51:  P0#03Q0#S 1S c0?oAQ1O-P`pR H0p00?\0Ce\ 9g% P 0[* 0R3:U& H0Z 0 0p Aq  o B X0 H0p00$ЍUP11 Aq  o B  X0H0 0p0UP1 1 mNA0C-P@`q嬁,M00T\0S*Q[,Ѝ $00 0 8Y Q  0l 000 0 B"0$0P `K0S s S00 Q0 @0:02#400@00 >0@020000 * 2@$ $0& 80C-@$M0\ S :0P(a`0\0pS*W?5 0 y$xo$WQ 0p0w#PW p 0 p l0  0Cp  $#0eP $ЍW O-X0M@Sp@8` 1hh q h l  l 0 PP ЍL0P!h00h0h0p0l0t0WP X0 Ql00vPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0 P$ 0pXP eM!Ѝ/O-0lM P00L0 `圠  8@0 K@P)0$     CRv     P 0@OoB@lЍ]NP@M@0  4 0.S1R R-0.S*p0Dps 0S7$0S] @0LpS.$0S0bX S B/o" RL ;0000 j0\P+ P2 P0,0 0$`00 C/oQ" 0R pp4 0`(` 0\0<`SLH00 0D0P P PA @  D0,0  ;0l0TP C)CL@H)0c"$<3P<0 L`H0Sj0000000    QQ Wp(`Q@W40SH 40SE  J@P?Wp(` W( 0KK2(0(0@,0010 Wp 0S0 00 0 0 00 8P ,0S  \+P 0 00 d +P08 ,`SRpp pK0p 0B    0C tr  B   C $xL R [ D   pD R`[ W`DppbL0 0Wr LpR$ R v  EJ@PX0[0C?o20S( 90@0b$  R Q R   @v0  J@PX 0 B/oS" R@ 0D$p 0D@P tO-8@LM00`\0pQd :,pA0001 0P 0 \ LЍd \002\0d800000@ pP00lSh0 A)A )0aD@48"03$P4 h0@0P 0 P#H0 0I0 0J0 0L0 0M0 0L0< 0\0<0#800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S c0Sz L0 X0r00L S000 S<0 0P0<0 00]h m04S4 ;d8000@ 9PP,l@ A)A)0aD48"03$$PP4 h00P 0P80 0($ 00 0 I00P 00BPP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PE PPi h/04S& d0@ 7XPl@ A)A)0aD8"03$P 40h 00 0 pG  P  0CO-`8$M000 $@P @DOoB$Ѝl A)A)0a"03$uP0P Y Q ppQ @ 8(P $(P   PqB}BA-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$$PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@W:3ZP#|x0f0 f /o b?od "VR0cl00Fp`8``h0p8`W? l0` 0Cs 800I0 !`P|8p 0`4"Pc y"P] |"PW v"PQ{@s0800S 0\ s S00\ M(0$000 04`P?0T010,000t010(0@1 110 00 10:0000l0$0d0 0gbLЍx|e008P 8P ``8P T P 00BBؙ@B@-0Ms0P@  @PP 10 00 |00 0t@x@`@P Ѝ@P Y  @cl]eoBB@DeC-TPRMs@Ѝ R `  R@ ptx| @|000x00000S03  R0 -@   f@P 0S0 $ 5= 00` 0&000?@VCT0100S 1 @P0S U0@0tPL0@0HMLK50 @`0&00 0f?@#CT 20i0&15 V@@CT0  @P@P Hd5 K@B0$ 0R 7000 0N@c@G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0 SЍ(,0sq 0   0P08< rqHL rqp 000 _W@ 0T?P00 8< rq 0 R 8v$sr 00 T0V HkL0 0L00000s 0 0 DW,0@"?P L000L0000|0s 0 0 'W,0@?P| L00 0L0000ЍG0 r| rSh fC-0@p0S M  RP- 00P S 80 \p`Hb@X!V0 P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`@,M0pS8@,Ѝ 0S@\ Q00S) 衟 PU \  0 R0U0 R H0C200 00 0)PP 000 0 = SP @P 0d hpP R b0S"$   PESQUP!\ P R0R0P0 |@Pl A)A)0a$"03$@P p00 0CS0! 0P5U 0RSU@pO-p P0` S8$M S@ `I  \000 0 P0S@$Ѝ00S\0S0000 @00\0/0S00-p0d P l0  \RQ B01@ 0 @PZ 0 \ v\ >0>00S H0A00 00 0H0  C200000 M@P0S> 0S0\ T000 =0000 Dz000@ 0 0 >0 .0 0A0@P001 0 -  0  H0S 0 dd@Pl _ 0* I(C8RP 吲t000 #8 *(80( 0@P @0 S=$ЍO5@7@5BM!Ѝ/A-0 @p0`SP , PW:-"-G-` P@U,-@P pp, @P 0 -0N0@ ,B@s@-@0P000CSH#SR`88 d0l 0C S c10PQ0`P 0##sr$ 000#sr  Ѝp@?8l A)A0<)a21 #ЍpB@-0P@"XF0@8 4#, #$0FFЍB^B,A00\ <00C S----------- 0 ! /+ 0 0 0TG-0 SS   ЍS P 8pL  PS  P;0S2  I00 > `!]R 0<mO-0tM0$0L0P 0<00S40@ P$08p40!0~0`0S0000 0#200~ 0022 0$0X0S rtL Sq@T0x0ᤂ0X@0h0sL0ld0S A A! a,3 1T 0 0 #0X 0000xx0,, 0`00SD: PPD0 @S  @   0 R50d Q a30RQh 0D0808 p00CS0!@0$0\0HXL00$P0X PP3l\X0 A)A T L)a"31$PPJT L00CS0@08 S  8 T8 000X :P0PD 0T UQ.D(0< 0,0 0004 0C0$0\ 0@T0T0 00 00S U   00-~0 00  0$~tЍQ 0S0  0 0J02p40 @  O 0d00e0|0  0S 0d00e068L00S ldA A! a,3 1T 0 0 #0 0m P$  dl0 dl0 0m0 0n0  :0X400S*Tc?002 0 00 P T PL 0(00,00S ( ,     0 R T{P40t0000?(@,D000@0(@,0@0(@,0PD @A @AA-@pM0@P`00 R@@]00V T0ML0 0L08 0 ! VTF@`00R 50 W@T4@M00N0P #000Ѝ@-0`P pMX0S, \0R@#0*x &P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, a@P  0 000 uЍ80 000 m7@-@Px'P ʄ4 Ѝ080 000 V0C-0@P8`rr eL  h X0S ld0S A A! a,3 T1 2# $0L0!10P  000 00HpX0000(0""p 0 8080F  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL ld0S A A! a,3 1T 2#$0mA-`0M0P@ N80 000p L040S cP3 @PH0 0I0 0J0 0L0 0M0 0L0\ppo800s  |Ѝ=@- `P@@P 0   0L 0 0<031009 0P Ѝpvd@cG-0p` M8P0X0S, \0R@#* 0]@P~x 0PP(0(wl0dT A@! 0C#p00$?+@ p 0{@ 0 00! e XpLP:!0.e2-8640q."@* X @P&0d00t@p0!# 0, $00{@P 0 Ѝ 000 |@P @ 0`( "4`#/p@-@(0Sp0PSP 0 R@TpO- DMhR/@lp0.`p0P00`$,`>@P!$ @P#W$k`Fhp &h$ 0@o V㨂X@P |APᕯ,哯$DЍ @P P0`ራ< 0P0 8 \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PP@H@0 @P M0@SI@H@ R Bᣫ(0W0 ,000,0oB8Cc.C-M8P Qo<0, @`p000o, 0 < 00 0 0 )P 0S000ЍP7꠆A-PPP Up`㽪U@ 0@P0 ZA-0Sp@ܮ@P 0`PP`P0 P٪00`p@-@004P0 pp@-0`S@㣮@P P0S00  }z۪pG-0`@ `Pp@lT Ѝ 4 P0 00@0`@`@EcO-M@p[p0`@P %s= 1PP倁G008  808}0p0 0Pp [?00 0PpP$X8808W808808 08~PP P 0 0#$ "ta0/0 巩t 0lQ  $ . ?8`0SVV<0 O 吩t 0l\Q   . ?7`@cc-eO-20Sd `00@PP0 SC&X02+@ 05:#0P0 @ 00 000 000,00000@pC 0 SQ, 0$R00S 0{  @㌄ 0Sj[ @$!X$$(08L0(0+00, 0?@P,p00ʿW 0!"Т3" R 0P03Px 30p 0d@P 0h" 0"@0  U@ 0(D , P\㰧 0 ,  @ 00 00@,0  0@0 0qT@D$p 0 $0/0 0 !P"$0/0 0 !P (p$,0pW @ 2$ 30p 0'd@P& 0$S !@ 寧H@T0 R大@ X0R 0" 0p! {叧P1T 8@@808 0  ,!1T+Z `t+0S ! 0SfG0p !! A0\ RM 0  8@@808-e@cBT.e1uO-DM,0h08 <00Sy 00P08地3$00S 0SpDЍ00  01 $0, -%Q  0 0\:Q`@(0 0? Q  , DЍO<0 $ ,pP Q1' 80080000070 `P 00 ` K`8S0RP '000pQ QM Q&Ж000800400S 0 Q:p0S0 0 ^pQ Q QVWc0 SR0S S 1H0C200 0040pP  0 P0*% 00000$0 0;00t@Pp1`l 060pP $0 ;cS0!00p 0`$0 0:0 Q@P 060 %pP  >W S00 $0, `$0Y (R   Q\ qG0p$ I QX#Q X *Q Pڸ  Q\  J  00 $0, p H I 0 I R031005 000(0<0040(0X*0( 0R{*  0 $00CY\0X(00 00(0)!00 (0 00 0 0 0(0 % 0`0 %(SR0 (0 0 p0000G010S0|0S8Sz$0p 0 qP 0 ; %0600P 1 [p H   X  R   l40S )!0 0 A000  0 4 0p  \`p9q(0 000S} V 00qw_9rp@c-eCcBO-` V4D`Y2!>3`04\@ 0$p 4/@P 8%8 L(00 09'B P0@@`<<04 @ 04/@P 7 徸Bi000!44 0ЍO-@Pp`LM$@WphT7X ᬨP0 7 |8/P $] LЍ ``  4:/P 07 $G $`D88000`8 `` 0( $;/#PZ@T<P|p0 3/Pt0 Sx0S $0x 00$0BB 0嫩l,.p@-@P% Cp@ 0`( "4`#/G-@P`P000 C4(10S@0  dU. X(4@@0 0U>004000 8Aᜠ4/P#P  p000@PK R> 0R  CU700000008A ᜰ4/@屡#0D?oU20S 0 #T T0S0S0{3T0 P0C0b @0 0C00g te 傡0 T0S$Y @ 1p6儀00008A ᜠ0 4/#P@H  @P #T 0 T0C007S @3P0 00 S00  P  :mx5 0R ,%(10(1PRv5@T vP~$$10$1M 0S0Y @0 0000040S: 8, p44\:# 80   <0L\0C1 01008 T 0`000d0嘚*0<00L 0  !  0003 000 s 00bR0d`0Y   P:dd0 00 0`0BBjBBBB@B,eHCceB,e,e,e'EcB@@T񟗿J.J.`G.`G.H.I.`G.`G.`G.`G.`G.`G.I.`G.`G.`G.J.J.J. J.(J.`G.`G.`G.`G.`G.0J.8J.`G.@J.HJ.@GP;P<@D T񟗖J.`G.`G.G.`G.`G.PJ.`G.`G.XJ.`J.J.0P] 0P0  ቟(0((@P?(00<S<0(0@40S@ pn8'<00#<0040D0SC & @<@j@h@f@d@b@`@^@\@ZB@XE@V ,0TTF@NG@L0  壴@D<@B@@V@> @<,0< @8R, 9981!p`00h0 !0+@ 0`( "4`#/O-p845,8p /? <*Xy([X0Zsd0HSa82 00?FY;00 0S  $0  0 48<8<@|@0(, 0>0P03.: R Q# Q3#8#(, PU0 :8;0 0 0c) 6;0S<Ѝ8< [8    08 08  0`H4@X.eT@@\.e0@-@ P0 M0   0CD T 2P  0 rЍ00@-PM8  @:8;堚0 00 ) Ѝ0@;Ѝ0S O-@$MTP`L Hp RQ7PP0UPPӈ U0@2S  0Q PZ`0QYR'1 1X!pW?W0GYr1 0U/181r3P0PPS P 0,0000t∰q刐! !  *P![& e! ,++:10 0 ֯4 NP !*! 0 0 ů4 =( 40  ++!CEcBBG- MPp  @` ?@T Ѝ Z @0(01ʟZ R00 00@@SeTP0R00PPo $ P0Q\(0 S @0 000O-@,MP0p T0P`X T0 T0 0C S 00   @P %Y? 0 ` P0SR0K|0C!0 SH080@~ A  004005000@@f?D0 S0 ]?;0 U?3@O?--Q P@ 0P 00T 0,Ѝ@0S   0R00   R  @P ~LCcp@-@Pn0 PEp@oO-2MsnQa0S 00$nЍ@āT0S_@n[  PD 00 0n0  $~w! !V$" S R- [03 H0 $0X\ RP(0` R  X000 R 000\n 040 0d$@0HL RP0P R 00 !/ #@c( eDCc0 eEcp@-Q@pP @QD\0@$0@0$0p&n$@cnTp\0$00$0$@p@-Q@pP @QD@p nd 0$ 0S (0, 0@@=nd 0$ 0S (00, @@A-p`P5m@T 0S p4` 00S0C04"0S00  0S00@YAn"@DCc( e@-@ m@"( eB@-T@0S m00#,"0Sm m@"( e0 eA-pM0S S\1 @#P1P!`Ch0 p4Q4h! G#vm R100 0,Z@P mЍ̀PU@0@0` PX0 h00|400q"0@00SP000p`s4G#xm@@@@c( eB(a.DCcB0 e- $\/@-@0P TT)@$0S )1Bԩ@A-@P`pWG0 A/Űp0@-@P0M 0 @0P@Eh0 `0 @0P@;0D 0@0<@@.=P (a+Ѝ0XcB@ eB0eg. B eB@-@) ' @<@ eA-P`p@ @V+0L00唀@0 0L 0h,hd`dPTP7533 0&L 0 @ e`.e0e@c@7@-P0@P J@P000 ; Ѝ0@-@p0PS`8 6008o<080S 0S  V L0 < ЍH`HV 0003 @ e@cp@-P@!0S  0S  0 @QL\PP P 0S0k4p,e0e@ e 0`( "4`#/7@-@00Pk000U  Ѝ0@ Ѝ0lA-$PU0@$041  k` pv1SkA蘩!! @-P 0`S4 R13U  q@Ѝp $`V@ 0@ c@ !00 0C?o2 104A04/@P U- 7T0S 0@0 0 0 0U>0( 0(T (@ T 0@0 0 @0 0 DR2320   (T7T0S  $(0  (@c$B>BO-PMp`HPH4P@0S#   \* P$IV  $  # $  L0Y@2P #101#0 00 #P  #   B d#  P@    - |X  L  R @ R  P " #   0 3SH L0SP0\ 0 a P <  0C S00S       PHFQ4s.s.Pr.\r.s.k  #RHL RP \ "0P0, BR    PBVL0Y@PЍ  #RHL RP \ 0P0, BR V   2 % e,e,e,e-ee,e,e,e@-8@!P(0, 0(00 , @(e-e7@-@ Hi d \P\00P0 D00(0 ,00p0 Ѝ0(e8.B8ARB^B@-4@{HiP(p@(e0/(ep@-PH@i00p@i(e@-Q0   0P0"3 Ff 0ЍA0C-P4 $0# @ 0帥@P y{0  000000) 0㵩@P &2"1ᙥ@P 00' T9@  ί1 4W?o20S 4 j@P 1011 Q 0@4Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ @P1@010@00 @1:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S Y'  000000t "0 R00tp@ሀ@M@Ec@vc-eiBO-P`1 @趺pᐑ吱!@P4|qdVʀ 0! $X!0 P!H!   !,\h0S2h 0! d0    !tT# 000 sg@PO8L/P  R (@- 0@Ec-e@vc@cddd(eewBG-0@@p` ,!4#Q !PPP@0 3SH0L RPP\0PP 0  <\0 0PE[ P1  <0K00<00<0,ex@B@-@W0 (0Aoԅ00Ѝ 0`( "4`#/d0SH /-//s@-`P80Q30 : @0@_(L[ЍpG-w@ Z181[ `$PPWLPP PP W Z181Z1p圀 01PPu4v✂Z ovz#0 ʚEc#Bp@-@0` Pzg@PP ZpG-MP`px @PЍIP = H/o ``"PP.O- 1BG-@dPQTT#Tßʀ`0p!`d `0`p`p`p) ! 0cS0000`V700p `0#g<`pop0 !0   !0 ,pWd2`2T"0?A1cP8< S8080 00SdSd0<00 * R(* 0S?0S<tt0S`t0St 0 $0S?0S<pp0S`p0Sp F (0SC?0 S: SC2 |2 0<0:t0p0x00008|0l 0 0X 00RPk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 04PK0 TPNK!`0  0S9p   0 oEK P0S000006 \0 Pp0p B A  P { K}GUq  o om vk z(@CcBBBB-eEcPCcBG-PR M 0GSd2p`0 V Q 40p /s@P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@ VS  7<$(, 0 00@SD@J q@P6ZJY `0 v@P)Z `ZpJY 0Dv@PZ `000ա@P 000 s@ lJjJhJ@@@cA-1Ms1:P@<P0< !0 0凨BP@P BЍ0( ,)(0$!    {@P  0p0X0 0(0"@P (S( (lK`p0@`=`!(@ T 4j@cl]e|BBPCcBBB@DeB 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P u .0 P k $0 0# Pp 0&p p@cG-p0M0`0@8 ;8 "PPd h"\D00D0D  0oU@ (W 8$ #R Q!0P0000|000A A1(LHL RP \  BQ,L (/PP00$ 0 0 0 0013PP Q 00 0,,PP. %~0Ѝ #RH L0SP0\ 0 y(0000(0 <  0CS00S( 0 00 0 0,00S00  R,0 -e@cO-00\(lMP0@0|0\✀0|0 D 0 p,0 U`<Z 8 F #R6 QC0,@000,0000A A1(LN< 8 Pu Q0,@000,00A A00010(L,uHL RP \  BQ,L ,<`@P v}Pb0 3SH L0SP0\ 0 My<0000<,0 <  0CS00S< ,0 00L 0 ,0< 0M 3SHL0SP0\0D y<0000<,0BHLPP\@  @Q}@ L ,<@PY3P}?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,0 0P<0 U #RE [R ,@  0,00 0K1 1C!  c@004000080 0 J@P <AU 080 X0000CS000% (  APP(  4|@PHL RP \  B[, 0 ,<e@P P 0 0 XPPX0 080 P000CS (  `P(  4Z|@000"8 0\0$300CS000 (   `P(J`X\` E`BHL`='S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0DP`PDp[`$0S0S P00`X0 `?o2X HqP 4{P0%'-e,eO-0dM`00,00 0p0SPdЍ|WH$%圀t00t0 $0   W@ 8G 82 #R" Q/0$P000$0000A A1(L#0SQ?P{ 8080)HL RP \  BQ,L $8IPP _{ 808 #RH L0SP0\ 0 5w800008$0 <  0CS00S8 $0 00 0 $08 C PHLPP\ : $8PP,00(004 00 0P33PP QųW 4( p000CS0(0*  P ! 0z P808i  @Q0$P000$0000A A1 jD"4 0\(@100CS0(0   VP @P T@X@D@'SR0000HS#SR8@@DOoB4( <`000CS0(0  P pP 0 0<P}<`X㜐 0S&T P00X0?o 2P @P 0Rz W808 0X<,00S0U0SPP0%'-e@c,e0 /7@-QP@0 P0 4 8 RP 0H0000 婴 Ѝ0O- 0 `M00000090 00 00CS@0S@ R0.S@ a@P0 0C?oR20SP@0<0000#P0 @ C@P P 00 @LP 004 Q\80 R] X 00 0ḵ <08 : < L  L H $ 0 $0[p8 < 8v #Rf Qs0$@000$00A A1<0(L Xhy?@0 00C?oR20T00S 00@@X@0  ^@T Q009Q8@M @@P0 x|0RP(000Ѝ 0-HL RP \  BQ,L $8@P yu0 3SH L0SP0\ 0 t800008$0 <  0CS00S8 $0 00 0$0<0 Lf80 Z #RJ YW $@  0$0 I1 1C! W0(0400 00 073<=@PU AR 4( 0@P00CS0(0, ,  6pP, # 0x@T!0S3  K.HL RP \  BY,0 $8S@P e}P 0 0@pP@P0[xT0S  4 [0(  00CS0(0 ,  @P,  04K0@?Sp00xH@ p4 (@0 0 0C R (  , @P,@0<0C?oQ20S( W  LP0x@00 <0@P 0w<0[Tp@pg 4( 000CS0(0 ,  @P,  0wT0S  We U`P 0 0@@P@p4@P( 000CS0(0 ,  M@P, P 0 0@@P@Pp0wp唀X @@P b0@ @@P@p W  LeP0swH@L0:e e00 <0$@uTg<0[Tp@pY 4( 000CS0(0 ,  @P, jXP 0 0@@P@p]4@P( 000CS0(0 ,  @P, G5P 0 0@t@P@P:0 ?o2R0St  o0 <0@P0@ @V@P@p U -e@c@-0S00& Ѝs@-P0S`@P F  0Ѝp@-@<0 "K 00CS 0@L܍e@-@08 <6ᰞ0@ 001/@e@-@08<7᝞0@ 001/@e@-@08 <6ኞ0@ 001/@e@-@08<7w0@ 001/@ep@-@PK0 "p@K@-`p PMd@P @ 0@P =0  P030000 A@P0 8Ѝ@cO-@P 0Qf`冋ᨋ`Vc p`0 0S00 0OPNP & @00S(!``0000S 0  0 Ѝ0S- 0 00R0S @ 0S 0  0  00p R W:0L 000@000p0 0 000-e>!B@-@8 0 ,l @VP<BG- P0 Bp`8M0< R..........., 0 @8Ѝ 0S@ T#000D (0W8 `@@$@Q #RA TN0(000(0f000DA AD1(L 2, 3   !  @P A , 4000CS0,0$ 0  `P0  u@HL RP \  BT,L ($@P uP 0 04S`PT  , 000CS0,0 0  `P0 00CSH...\...d.. 0  0 0C?o20 0S 1 0 c># C,0!0 0 0-803!@@P& 0 8ЍG-e@c,e0 X⥸7@-P@0LP! "k0S, ,00 13/_ Ѝ0MB@e,A@-@0S @.C-`M @P- 00 0SS S p0 S2 I00>00 P 0  Z 0@ЍO-p0PDM,sr`lE0V0 $P00P0H $08 `8\ #RL QY0$@000$0000A A1(L80 L #RHL RP \ Co800008$0>;0 P@ QX@ @NT@0T Q@DЍR 0HL RP \  BQ,L $8@P sI,000BS8 $0000 $00R# @06 R S 0(0400 0 0 0423 @P A4( <000CS0(0 ,  `P,  0\s@ T0RSfP 0 0<`P<T04( 000CS0(0 ,  `P, A000 's @$s00S% ,sr! 0S 0T00K 0 @GDЍO000 0SS @8S @V s0@0*-e@cp@-`P@M8  ;8P00 s  08 H@  ` 0 013/Ѝpl@e@-p`@M8 & PỚ   QP009  0H X@ & 0 013/Ѝl@ep@-@ `(MP0k 0 0$00 000 P@P A hr(ЍpO-dM000t/H0p0H0 <D ` $0=X@ 4R 8A #R1 Q>0$P000$0J000A A1(L40^ p Qp #RHL RP \ gm400004$0eHL RP \  BQ,L $4PP q( #RH L0SP0\ 0 m400004$0 <  0CS00S4 $0 00L 0 $0h4 0 3SHL0SP0\0m400004$0,000BS00S4 $0000$0<0040  pu Q? #RHL RP \ 6om400004$04Q #RHL RP \ Xm400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0;00 Q40 pw Q? #RHL RP \ 6m400004$04Q #RHL RP \ l400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6l400004$04Q #RHL RP \ l400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0800,(80<0zs 0ZS40 ~ ? #RHL RP \ 6Fl400004$04Q #RHL RP \ /l400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0408)@&H0L0zs O0ZS40 k #RHL RP \ bk400004$0` #RHL RP \ k400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 k400004$0 <  0CS00S4$ 0000$00,000B S00S4 $0 00 0$040HP4 0k 3SHL0SP0\0bUk400004$0` #RHL RP \ >k400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 k400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$0000(00,00 0 PP QX 0( 圀000CS0(0] 8  w@P8 T ,nPdЍ<  0CS00S4 $0 00 0$0p0 0R01 p0 p0 ( 8@p X0B`HP0s0 $ ?@c-e,e,e@Mb,e 0 0\(p000CS0(0 8   @P8ppPTp kXh@@Dpc'SR0SH#SR8ppGor0( <`000CS0(0 8  @P8 W:P 0 0 0<x@PJ<0X` [W P00`X00P @P , P0%'0 0 0PP`S@P $G-@|0s-P pr`0s 8<0sqHL0sq0s 00~(,圠p|^ 0>0 ^0P3l:0S#S$Pe PPe "؀(0, 00h1 3 vPP!  0  E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s 80 Q3)PPЍP@cO-00#`pT0DM|0T0D  $0/WP 8d 8$ #R Q!0$@000$0<000A A1(LHL RP \  BQ,L $8@P000002(4  3@PIWK4( 000CS0(0 ,  @P, ` P 0lH@F #RH L0SP0\ 0 h800008$0 <  0CS00S8 $0 00 0 $0WA, 4( <000CS0(0 ,  9PP,  0l@DЍP 0 0<PPT 0{lT4( 000CS0(0 ,   @P, u P 0[l?@R@ 0@P -e@cO-0 0p0/PP3LMq:0`/ZP0,0$00P00[^T%X00X0p0$ [ 0 0,0Z@@T 8 < #R, Q90,P000,0000A A1(L@0 ] #RHL RP \ Tg@0000@,0OHL RP \  BQ,L ,@PP k 8LЍ0 3SH L0SP0\ 0 g@0000@,0 <  0CS00S@ ,0 00 0 ,0,000B S@ , 0 00 0,0ZP4 0!000 0<008000 023PP QZDf <0 000CS000 4 0 <@P 8UkPf P4 _P 00 0<0D@PDU8l<0 000CS000 4 0 <@P4 9<0 000CS000 4 0 <@P4 !p0@P8kHP600 0< 0DY@PDP 00<p0P 80j0P8j0Z00 ?o 2R0S0K 0S-e@cO-M800@  `    P0 @0/\`3:< ,0?00,0`SX040H00L000(`40$P$0S`k\+H \00\00tP$0SP1800PS   T0 q,0pSde 0 8> #R. Q;0T`000T0 0A Ay0001 0(Ld0  #RHL RP \ }4fd0000dT0xHL RP \  BQ, TdL `P *j0 480SSF?p@0( V Ѝ0 3SH L0SP0\ 0 ed0000dT0 <  0CS00Sd T0 00 0T0 0 Ld 0 3SHL0SP0\0ed0000dT0,000BS{d T000 0T0@0`` 80S `e HL `P   T\P$ A# d X`P0 0C0000 00C00 0 0>000>  d B00X0 0`00\00 0 006 3`P <a,0S `X p000CS0X0> h X `P5 \Li `<  0CS00Sdd T0000T0LH | T0d,`P 'i08 4F>p@0( $00h h%`X 0PE0 0CS0X0 h X `Ph <ptx |x\R00 D0<0R0 4\R8Hoᨂh lP RpIoᩒ0<0D<`X l000CS0X0 h X `VP`h P 0X 0`0lPR<0lSp D0S+X P00pX0 ?o2 p"P VX` X0 00CS0X0 h X `pP \oh`BP0%'h{UP\_h`2U0PE 00000C0 0000 0S/0 [(0pS SPppe=0 Q0? 0PQ=(p[ P0hH0\"hV$00 X0C$040040| 0 LP0(00 ?oU20Sp $0 E000$0C0000000 0S 0 Q  (0P (0  0YQ ~0X 0`,0†3PP \g`ꀠ,<00C00Sʐ.=qBB-el.@c,eO-dM000%圐080p0p0p0H $ p P $0X` 4F 81 #R! Q.0$@000$0000A A1(LZQ?@xg 8080)HL RP \  BQ,L $4B@P Xg 808 #RH L0SP0\ 0 .c400004$0 <  0CS00S4 $0 00 0 $040p V #RF WS $   0$0,000Gq qG 1800,000(00  0 @P AijX 0( 圀000CS0(0'  `P  ,f @808eHL RP \  BW, 0 $4@P h("0 0\( p000CS0(0   N`P pP TpX`d'SR0000HS#SR8ppGor0(  0 L` 0 @P / 0@QL( 0 L 0 L 0h`L0 0 0 0:-@lЍHL RP \  BQ,L 0@d@P z[ #RH L0SP0\ 0 TW@0000@00 <  0CS00S@ 00 00 0 00@ + PHLPP\ " 0@ @P@0Z  Q- #RHL RP \ $W@0000@00"  @Q00@00000"0A A1 墽,000BS00S@ 0K0000 00;0s@0 F  #RHL RP \ V@0000@00 ,000BS00S@ 0000000;00@ 0? 3SHL0SP0\06V@0000@004 #RHL RP \ {V@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 ;V@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 V@0000@00 <  0CS00S@0 000000008<@ty JTY@0 Q  #RHL RP \ U@0000@00 ,000B S00S@ 00 00 000408@HL@ty TY@0 k #RHL RP \ bU@0000@00` #RHL RP \ U@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 [U@0000@00 <  0CS00S@0 0000000,000B S00S@ 00 00 00040HVPS00CS@ 0k 3SHL0SP0\0bU@0000@00` #RHL RP \ T@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 T@0000@00 <  0CS00S@0 0000000<  0CS00S@ 00000002 0#0<00480 00 02 30@PW T 808Q #RHL RP \ oT@0000@00 ,000BS00S@ 00 00 0001R01y1 0008q@p p1B`hHeP0s0 800C?o200 08, D000CS0,0 0  &pP0 PP) 0 0DЮpPz 0DSp$0S0S P00pX00 00$00p 0?o2X HP 4NLP0%'@T V 800@`3O- 0tMp00,0<00/0圠 `0 l< 00d00d00H $  00 VPHG 8 9 #R Q)H 0@000000000A A1(L咮0SP`K?@P`HL RP \  BRL 0H⿾@P K`, BQ0 3SH L0SP0\ 0 GH0000H00 <  0CS00SH 00 00 0 00H0 D #R4 XA 0  000000H H10 !H0V ~ Lp^ Q, #RHL RP \ #UGH0000H00!HL RP \  BX, 00 H4@P s,000BS00SH 0000000;00JH 0? 3SHL0SP0\06 GH0000H004Q #RHL RP \ FH0000H00 ,000BS00SH0 00000000<  0CS00SH0 00000000H 0 3SHL0SP0\0 FH0000H00 <  0CS00SH0 00000000H 0 3SHL0SP0\0 FH0000H00 <  0CS00SH0 000000008<@tx qTXH0 Q  #RHL RP \ UFH0000H00 ,000B S00SH 00 00 000408c@`HL@tx qTXH0 h #RHL RP \ _FH0000H00] #RHL RP \ FH0000H00 ,000BS00SH0 00000040H0  #RHL RP \ EH0000H00,000BSH0 0000000,000B S00SH 00 00 00040HP<00@0004D 0 05 3>@P AD V04  00CS040 8  6@P8  @IP` V8080<00S0T0S0U i,0043 00 0@P ,0TP0S@WW@tЍ #RHL RP \ 1EH0000H00 ,000BS00SH0 00000040oH 0 3SHL0SP0\0 EH0000H00 <  0CS00SH0 0000000Q #RHL RP \ DH0000H00 ,000BS00SH 00 008" 0000 2000 08@p 1B`HP0s0 !?@cD4 P000CY S040 8  A@P8  @H 0@?SP@HH@ P D 40 0 0C R 4  8 @P800 P0+@PP0VTPT D4 000CS040 8  @P8  @OH P-e,e@c@,eMb,eX[.P D4 000CSST 4 T  ឺ@P@V D4 `000CS040 8  㽹P8  @H @Z 0 0``Pd@P`P P !D 0\4 $100CS040 8  D ㌹P8`d hTPX'S R00$00S#S R8HoD4 Lp000CS040 8 4 DUP8 `P 04 0DLPLpZ㜐 $0SX P00X0?o 2` P$P @GP0%'T  F 00@PpU U gyO-p M0`s0 00S%$@hhAu3 1 H`P 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 04VPP PU 003 00 q 0H@Ѝ000zS0P $᷿B@cB@G-P `Mp嗼PL0S@ ፼P 0003 塘P@( 0U&2־ЍH0S0 RP@OP @ <P0SH0S300 0 CS 8:8ꎾB@cG-P@0 pS kT! S Tfጾ`tW$Pڜ0H0S0S 0 P\@41 3 00000 00 0 *` VV!0S 00   RT 0S  0HT?'0 ;T2T .,Ѝ` @cO-0pdM5A@pdЍl%`000D $08 P@@8@< #R, T90$000$0000DA AD1(Lv80 , #RHL RP \ #A800008$0HL RP \  BT,L $8Ⓒ@P E,000B S8 $ 0( 00 0$0 04000 00 00@P wA4( 地000CS0(0 ,  PP,  0eE@\"4 0\( `100CS0(0 ,   PP,Y`P T`TXQP@D`L'SR0000HS#SR8``Foob4( P0%'4 (P0 00CS0(0 ,  w@P,Pap  ᳭@P (@ i[a$-e,e1u0@-MP@A0 00 98808Ѝ0@- Q@80 h0 3    808 0&8808Ѝ E@c@-0S 00 3 Ѝ@cO-M<0@8pDv040\5SW4ZT 0x0Cx 0 /[ Ht0[E* 0%v\5pSᕱ 0-0吣/ᐂ(啱 x冣`0 C c"0,0T ? 0 L)L2>40)l":  00C 040S4L3,0A`0 : S 0003#0 #L#32024P u0u0<Ѝ衹 00 00u0P !u4P uQTU T@6 Ba B@-003!z?` 0 Ѝ@c B0@-qPM:Ѝ0@@~80@ 3P@z?00`0 Ѝ0@c} BC-M8`0@XP:@DŔ  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`Ѝ B B !BO-p400P@ S` 08`M ?  0儏 0QP_ p(80 00w`(`p Vw &0 &00C030S3 L32  B \%<1R.=S+T @ᢀ0P SXprpppZ ڨ ᑀ0  0 00C00 ST0T00! B!00 0`f `` V"%P80 0SЍU TO-,M 0%!@ 0PP``Zh\%1R=SQh \1R\0 嵟 ڎp1>0S100! 0 $=$S 01000W 00p50 00Tp4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOTU !B.@=!BO-"BE"BA-@P0 S 00 `pW A(00V O-`0,M؅pP P@"g 0@Pr"  0@>PgX 0P@,ЍO HZ TR αpP `@0S7 40S00 T0T3?R\0 0SP `0 S ,ЍOV S @ 0 00J 0 0A >Y @ 0004 ,ЍO,Ѝb@O-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 ~`pVp0 00000ƿP T (we 00 00 0 000"<T0,0 0SD  ?Ip, 00`2@0(0C$0L3T 2 0$PS98$0<4Q4 0000400Sb S<0SD@$! 0 $ 4P |70S l 00`^H00000 00nP TЍ08SL 0 <0 ?D0 0  0/0S 0/< S T0(0i \%6R0ǂ0## 0 /T0 CL    )pC)0c <3.anPL0<00 S 3 S_\%6R=S_ ?᪅800p ST 0`S"80 ϣYc8<0D80N,00 ,Qg A!40Y0C40 A40040( 0T S"80YbT3S   , ( Lk$000Sv h00h0 0 0000S TH A)A)@a #;̠S Rd X8* 00 ǂ !! ^?001>00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ yLP i(4  00$0 kH000$ H0 H0 , W H0 00S  <0D@$0C!d 0 ຄ$ 40`R0 10S  u00p1` 000 0p40UP0`W0080S 00S" 0 0 0U $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<05kH00( C0H0 H0 , H0 00S@~@4X"(, 0S HIi!B!Bn@N"BCc"BTU T"B"B/#BO-p`0P4M 0 ?0@00 !0\%0$01R 00@ ``&!! X0 00*P@? j4*!, ZS QS:lP ,l 00\ Ó\ h4Ѝ $0 R  X   !A,eiT|@U O-P0@Ḡ $Mⵃ0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@Py'lP l 00Q Q h $ЍH  0 0 PiiT@7#BU O-PḰ@ 0$MS0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X:@ 0@P kP l 00Q Q -h $ЍH  0 0 PhT@7#BU C-`PḀ@p 0M 0\Žß0.S\! 00 Q    ` a 00T 40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PP0s40\pdT80< L31)l< QR>QR!<`0d 0001 F g40P 1`dP<040 pL `l\0<726, @ P0Hd,:0000@ (0 00jP0~d0() T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Ep0$0101 0 "p `@ H0P ЍP0805@U50P%P0L05P000T40 `001 0 0p00101 0 0PPd001Pp 0 0T0 C)C)ct00<21 ( 0P0 c0S C\1^1 U  U `  Rd ` < #.36,P Z*85@%00L 0404 00R  Q RI 00TB)\5 S0  11@0p@00 p001P0 0p0$01 0101000040 0@0 0-PhP <0 B2 b061")(!G''0001S 12 f X0P 0 PL< l52>p, ᇱa Q0:1S 000000 0(+iP%1rP 1ec8U@e8 L0PP`P`U1Se 00P000T\5& S0 @qq p0@01 0 0#p0$01 01 01 0` 0Pp@P''000jQ0805@U50P%P0L05P000Tx0 p001 0 0p00101 0 0PP'Q P T A)A0<)a21 ( 0l0000 0(@+Pl00Cl00 01 0g00T11 P  0 p001 P@000 0 0 HzPPx0gd000 000g0T0 C)C) c1062 *(?PPdePP0 0ap0T000400`0  0 F Ϭ 0f2fcd000 00 00  0Pd0- cpG<0S00W0S <0S&0 T 000`p<0嘐l0Xd  0 ` 2( bPdbb< 0(bd0000000%FbfP H0p`d10 `c040" 000 |00S)1S0!0Y8P0 c0S C\1^1 U  U `  Rg ` 4 #.36,P ]*85@%00L p00W00W0SO 00T\5$%S0c 1<00@00 (001 0P 0p0$01 01010000<0 0@0p0 0PP 40 P B2 b061b 0`` 00( ẕ0p !0001S P 1! b X0P 0 PB2 b50>" pPH Q0 :1S1s 1<00B`8U@e8 L0PP`P`U00T<\5' S0 @qq(0@01 0 07p0$01 01 01 0` 0Pp@,Pg0p Q0@558 50P%P0L05P000T0 (001 0 0 p00101 0 0PPP?'Q P T A)A0<)a21 ( 0l0000 0('Pl00Cl00 01Sb00T1 P  0 p001 P<000 0 0 @ PPx0d000 000p`0T0x` C)C)ct02160" *(PPdbPP0 0a0T00|0400`8PL0d000000(0!dPPrd00H0H 0ql0L R 0P00 +ax0PT40<@P daR00TO1P Pl0R 0 H0P 00 0 0K<@<0@ 00 (0 0><@p001 P 000 0<00@00 0PPp4ph0400 0000T0 C)C)ct0201<" ("BPP4 d`4p80slpx`40V>:[ h04Ch0h4yaPP480L s0H 8001d ia4pP0`Z(a1P0Or`Pw00TH0 010l02H0 0 0p001 01 0000 0PP W4 ppt0p!R  !  0  T B)B1) b072  0(PP 40040l0 2H0H qd1`iI`1S) !00h  0 0(cPP m 0T0() C C")0c7#10 0 d 000"00  ( PHd0s ἐ?00T0 `C0)0c VQQ? Qz/" \5 DS 0?!>0  0 F Ϭ 0f2f`d000 00 00  0EPd0, `pG80S00W0S 80S%T08 000`p80嘐l0Xd  0 ` 2( Pd__8 0(bd0000000%FcPd0H 00dH`|040 000?600O-@PNjp(,`PT: [0 S0S SPZ@V 0000000@@000@ @O-pTM`@ W0S^ TЍ@T@Y@T  r"! ( 0  (04 0D \ 0S,0@0H*0 0:00@0圠<0 08000  RȰ%d*}P# P `2@S8NSLQ0 P@UP!PŸI͠ӈ$ P 1/PD$0   0 U$ 0 y$080\< 0/P\00 T0 P@ \0 A!. a4,AS ?0$0 00AQP0 $a_?o2Y0S000@Q9  @ PQ;Ã9ʁ0ˁY @0 R 0@@DT@~@@@88%@5L0@vc@ycAO-p|M00-P `v븰[ 000zP|Ѝ0800 00\@000S/ : +P0X00 \00&2T00PT@p00h@l00<0 h0@S < `\P/0 d U 4 Q4 @P0080\0000P n9Π ^RQR.L N @n 18E \H$@@NU0@@$0@$ ((0, IY! ? Z40 0 Zů 00:@   ^aPU@5 ]K$@@@ @L @ Q  N. n*< 0Π U , D   L @   D  H   @HNa$ LP@% 0@D TT{ 0(0 X PP@][]n@P)P@yc@-0 ^ R*@p5 R@4#B000S -/0   R Q   -//@-P`00S-@! < @P@P 0@0 0 P]@ 0S R u@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 寭@P 0ST 0S@Pu@PL .0pI@p p G pp j뼰0@0 0  @p 00 @W  A KS@K0P L" l1. Q*  P0 S 0 S00@$Ѝ 0p@ 0 ׈ pӈ ! ͈  w  …@P m  z  xw弰帀Z  @-@@A-P@00S= 00CS9< PP0Sk@p?oV20#S 00W: 0R R 0000@0` R _@@-A-P`00SE 00SC 00A0 崬@P 0S 0S@Ѝx@Pp ~뼀 0@0 0 Tp ]@ @ A HeHp ЍAm-@@@O-lM@0P800(00 0080<0000Q.80S(005 0 8(zv@Pd0`0p00 00 p 0 P6d0 45#T20T20$ ;60 0R<t ?0:# 80@0(0P0)#00傳dY`Pd `P dB[lЍd0000S0 0(0 0?`L0<0S``V$` 0d00 $0͊@00t R[d[0$ `0S$0 00 04T0?X0t0pC  0@DpH@ 0S00040t 01,0@0D SP0H 06L0 R00S 00Sp 0 1p0 0 800(0C0 0u T0 C)Crq)0c9s400 p@i  R !00 R,  ) 080S06 S600S @" 00 00T00S01 0, A0T 0 0X 0 00 pG00040 040D00SD0H00H0,00C,0{Sڤ0 00\0C00 T0 C)C) c0<;2 0 40@P\ 0T0V0S$0 S<0S d [S @0$Oo(0BO<0S@dZV @c#BA-`P!0[ @pk0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    O-`0Mpp@P$ w  R  p0@ 00@pp\%1R,5S0 0 0 yt0 o."\哞p1`Z 0 ?  Ϡ ,2 0 `x 0Zt`0 C c00T0 ` C)Cba0)0c03"\0P   \Ŕ P\x 0@/t W Z0Ѝ0  ~t,Y0 TTO-`0@[M80  ,00  C0CSR [ߍZ 1 0P  ;10Rh  $  $  ( \%R\ R @uD%p/L/pt{W  Ð!&4$00S$0(0?(01  0 So 0?R0:$0( 0QSc00S(ps 0)QQ 0000  L  R 0 \0\&/ 0\ &/0 00 0Pt  PP8ŕ0 @L ,Q-Y!0ZS 0Ջ 0)R 0X:0 0 0001 000$0 0S0 0hP0  c2# S,P!Q RQG S1ZQZ3PR> 08u< p0 H0pß 0YW0  0Ë$0 010 0 W00 0 P 10 0X 7"#H0 p ~p. ? 0 咋0 S$0 0100k P w08%Sw 0圠000S0  0 ;000/SP0 0 c SRQR3,00Y$0,0, 000 0Yt H0L 0SP0 0SX04800T\` p BW, W pq0S*0xp(p$ Q0 ^!((AP (( 0 ( C 0[00 0 0pQy1(( R@ 0pPn1XXϠ R 0 00p0 0R       0 00,0I{0P0[0 S0&t ( 00Sh00Sl0Sp0t\%0R  H ! H04  1/ 040@  p 0T0< C)C)c208<" `0 (0P(040<S" 00 0000S0( @08D 0/@0D pW* p040$04 S000$00 rs \%L5R$00 0!! 0 $0 S000 P,0 A pa1^8970':00圠000S0 00$0 S000 P0, C pc3^09:00SX7"66 00Q00Sy 0\P 0 b32 R0Z1Q SZ ☐ pBᜰ b<  YS:0 B z'z b~3p2z0W p11 0 PS0  0H0 p55C20000 0G0 0=0 p ~p0Y$0 0(4 X%0'00 $0哮P 0 S$0 0100qP 8@ŕ L 0  !pt(APn i1ptpt1p 0140S(0#Sz0[ # 00p\%X0R !0 !09 4P L8 l0 ^85@50%00L508Q Q0(010 0S 0 01@0D 0/@0D 40pW08@5L085@00L0T#B$BA^T΄8P* P' @0D 0 @0D 0 圠0 0@R    0D Rh  Bh    R  @000S1 ?@0D 0p@0DpO 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"@P 000 `9SsU@ЍRG-p0 `$PS@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000=RPVC-0P0`pd@T 0 Wp P ЍT80< @31)` Q0R 0008<Ĕ?jP0 C c00 0 ĝP  dϮ 0# 0 h 0S400 0`,``000˧0008 1 010I> 0008<ĔB?jP0 C c0 , 0偝P `卮V0L"l0 0$ 40h00000R@c8$B\$B$B$B$BB0G-p0`@ PU 000W Gh R 00 0h Rhg9S000kB0O-P0@@P `N00C-8`pPP8 ^ U A 8YY L @ሀ@,@@0` RZ0Z0Z0Z0P/! 0 P  C1  1 @-묳@$B0` R[0[0`[0P[0o/ 10#/C!000P/@-彮븳@$B0` R(\0 \0[0[0  /  /C! C!/! !/@-嗮ȳ@$B0` R\0\0\0|\0  /  /C! C!/! !/@-qճ@$B$Ő\/RO-ࠡ@lPapPGSh$eppX!W@@đ@@ T'B^!B ɑP%P@DpNU"N  R Q^PQ! B!T!0B1$5S P#1 [ @  R PE  R0Cp@-0@ PR 0 0.48<00Vl `V  PVH0 08Vp0Q000p%BI%B%B %BP@- P `5\P PP,L0P@׫ I\P0P ACc_0%Bd.e&B B @-00@YT/ 0O-; 0!0 0 040p,@(`$  p*; 0!0 0 040`,@(`$  p;000d0 00!T0 0  04,@(`$ p;<ЍA&BZ5E&BS&Bb&BCcp&BG-@`T~00040000 0= !` 3S B2 b051R$ TPP$TĖ0 @2!)` Q\.QP\qPp<0D@$!d 0 gP P#0p!*PUp PP$p ,00S 004 X4$0 80< @0D 0 $n sO-@0$Mp0\5`0 0 f0_,"x1P R  0 ?<#΋ 0Px 0f`0 C c00T0 P C)CRQ0)0c"034OP) P fp0@ "(, Q ѥ K0`0(00 P0i $ЍTd.e|.eP@G-pM  {!` tPP @尩ZR뜠0P S ť PЍ  0 $t\%0R,5S0 00 )~* \\\wS80(@@d.et.ex.eTO-\M<  08 0 p,0X3a0 `@0+PP $<,PP $ `\Ѝ<0@)0R0 S㰐@Ԁ`l0h 0 0 a $P@岫P0PaSm h0S0s#%*000P0 hQt  0 &hQp  00 Qd0X00i` qr ,0P( p t!8 <0#,00 00 R l0P0\%L1RHr$#P 0L <)}*<\\\R0(@@j 0 ФPᤰ 0|#B00S Th!Фl夰 0!Q j !h@d@~&Bt.ex.eT&B 'Bh VR#3 RQa0 0 B P\BY4L \Q/0@-8<$Q0QG Q0QA ,Q0\Q; \^x" RQ0^PQ 0QT^8P@0T`@^0H~0L ~0RQU00R  S "0@/0T R P/@0  0S/d0SH /// p@-MP`@@ 0@ 2@P!n@P   00!0 ЍpvdA-p`\%1R=@S0PS3,y0 " " "00/30#\/30#4/0$4/ 0 $04/$04$84/(0<$@4/0D$/H4L$ 5 s10 5L5cs0P50 00(\%0R,5S `pS>`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPx p$`W0@: ,0W0:F,Ѝ\0Q.0c 08T @)@)`"30VLPd 00\ Ó\ HxH0哸+0[0: 0 GTU p0Sp/0@-@0M 0@0@ @@@2|P|0 0@0@ @@@$L0 00@@ @@@  Ѝ0@7Cc"'Bd.e)'B2'B8 p00CSp0/@- @D 啢哢@萢Ccd.e-M }PvoЍ;'B@-0 R  @ @0b ` 0wЍЀO-0,M G P00L0 kp'W PP@?n /h+p+ 0 $+4KP ̍  0w % ! % G4\%R0004\5 P  ᳍ ,Ѝtl4RR  ᥍h0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3gw  ႍ000S0P0,(5 0S0 @0@00T`0#S> ) %> 1S 0DD@30V0P4T$0X4S E>0X4(40`A[L V$5S0P=$dt $.d`P ȌPyP/ m800pH0S40LpHT0 C)C)0c"03JPO  0v  1G80`$%!0, R0 j0PPl \aἠ_<#| YP  0 ?<#Ή p 0Px 0a`0 C c00T0P C)CRQ 0)0c03"kJPP ߋP$c"   Fϋeq@S'B8 TTD'B^'BA'B0O- ) %> 1S0T$0P40X4S E>0X4PPh04 SF4P0P0040000,8T0<P C)C4)0c"03PqIPP440$ R:0E0400 5 0 0C?o200004PAZ$%,0RQ0 0偋L0Zg$5S0Pŏ, H`4dS944S@040T3$0`15d1,10 1(5 0S0@0@00P :>0 $  * RPPz$0p0,0 0t0D0t 0b0?o0cH0T0 0CL0804P8PP0埻0SH 0 <Ѝ0(($20Vȣ0703PJ80 00S0 C40HL T0 C)C4)0c"03HPP*40 0 t4(E80 4Pj$%0 , Rk\4S  5  0 !000V0 ~0P LˊT0PP14P DV PPP:0h尊P 㪊(᥊00P|@8 TT 8TA&BD'B^'BA'B@-0S0oP@ b@P щ Ѝ 070@P ``070d`0u/Pp_0Y V1BC^B`m@cl]eoBA&B@DeA-P00`SP pwa@P oa@PH后0  `j@ЍċcC-@p3$M/P++  h0$+4`P6Tu0h 0s0 51 50@0\%R=S04, 030304040 50s0" " 200(0\5WD`$Ѝ4BT8 O-,M@40APXp PL30U/o[" R ,Ѝ800`H0S40L`GT0 C)C$ `)0c"03=P$ 0ns0$000S~D8 PAG-$MR Rp`P/oAQ" R@   hP V 0*L)4 _@P0 R@k0pP V 0S 0 0R\P喈0M0 @P0&00 0嚗@WT:040 0 00 0 k@P,V,`T``Z @8T0ᲁ f0@᱁Tp`| ; q+K)p`=S0 @P=04=S:0 0SX0SO@(0 ^@PP 0 0S 50ó 5v=S  0  @P Ѝ0 5< 0P!P000V<1 &@000C?o20000\4S Tu/VA> 5 0 5=S# U‡T@=S 0 6C>00x0SUTf010@U@S@c@D'B'BA'B'BA-@`L1pPP 00' pPB=TSAP 0 u<=0S hO= S傗)$%0,RL1hP އFIׇ000:0@cO-@P`=MS =S  ̢^U㐱P ^pP$^U 00T R8d R5NTp =SB 00!6CnAPЍU ߋ P ӆ؋P 0   Z0PᨆU\pp @P啙ꬶ@"(BXl0p@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0%P 9 ;909  000&00PP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0dMP00 0 $0) 0\&(0 0 00 )( S RT 0S0,0, (0 0 0 ^0y:,0S,A 00(p地0$0 P =<00004000@0D0000^P࠱8<œH lU?P(8, PP PH L^EpP n7~ ^y[xQ[ W9 n0 ^U QU^YW0  Pp WU(  0$t40 00000 U 0 0 P40S  #0 H0 .P^pP ? $0:T0$09X00S T0S X 峥 00080P<œ0 pPEUP!U$<0S j #0( H08<Ŝ  ß   . ?඘t8PLY"Hࠣ࠳Yࠣ^  pR0@P} 0sxi Z pR0 0s40  0000 hP9H0 C2 0000$0 0n'"R0 07sZD0Sj0)C( 0C8RP_  <100 #8 )(80(0APM ,000$ 00 )dЍ *Q@pR0Pᚪ00 0 4  @  1/ᗪZ 0\ s\!p@- @Pb Pp0p@0@-@PpR9S ʰ;S  0"`PQ 0 SL0L0堙"c0P0 0 咙 Ѝl.ep.eh.eO-pLMP4  P3r:Po R00`5L:dP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@P:0@(,,0N X !$[0$ [ $ C:8@\BP80& @DXT $@0,0 $hP 8>080[ 0 0 0 \$  0 $ R0 8P > 4LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<BO-@P `R0 pM0 ЍO? 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  ᙣ) R 0P0 1R H0C200 00 0% P ЍO-需,0 0/\*0 ,\0 0 ) (q,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` f@P 4=" 0 @P<Ѝ8e@5``L0`(04S 9>oobT`V 00 0S;=@-P`a@P0 0@P   0 00P0 ⇓ЍpvdG-0`P0 XM00 0S  XЍG ?X p pY 0 00000.0>000 㭕@P: W000 08@P-$5 0S)n 0 )@@T0S3b 00S00@P  0  0@3 100XЍ2 :pP 0   006:@Td@cvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-`0E&0S R #6:RAƠ 0401$0|PEP0W(0,0ů _G]t1 000040 0 0垏pP >$|LЍ0x 0 | P ( 01/P(0@ 0 p 01/(H4QPwpUp(6*C/Q @ ?QD   00ã 0Q+ON7O\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-`p@P M9S$ 9S000S0(0)9+ 00000 0000 8/9 ?o209S# 0 R h0 "V_@0 V_"@ @@@P3$(Q Ѝ0 @)B 'B@-0,@00V@"4/Ѝ77m)B0@-@0@000@@PD @DPPP0 0 P: 08S00P0000)B)B)B)B)Bp@-@`P(0P0  e P bQ000@09#60pO-P@p0KMP0`@`0/U0:Kߍ0 0 P 0 ~0!"R Q0:V&0'0S(.\S(,0S\ PQ)0.SP PO-P10DMp @0! 0B{ 01 0;{ 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 8@P0 h 40R 0 h`F ` l 0z zDЍDcO- p0M`,00P, $00@000000L000$ t0倊@P#L0980 00 00CS@,00|00000 :P |0S080,0@OoB@Ѝ*PM@`00`0|0S0800 0X0000C\0X0S?80SF 0000X40@0 H0X0  @00@0C 0?d00 ?`0 0`0O0P00<00000008#8D00Ch0X0P tS-40S0X0T0 P00400ST[ ?[ :\ X =040  t   @P 0X\0X P40X t00?@PlY Y 00<000t0T0000ഀXT X& R  (0 P(0I Z( " Ra H HQU BRX R0Z< <  r  < R  A0 ( R* H R8 R# l0iPl0H RY  R+ 4 \RX0g=X0@U%X(0h0D0C(0(X @@  X 0S  7 BR  X0\00080P00tP 3X0S^ 0S 08 88C?oR20S 9ST0,00 1;4 \RX0=X0@@@@@)R0*#D0@圀0S0@ @000Ti380S 0S`0X 0c0T0(0(儠0" SRxx`,0x000 :80S> 9S; L0$  ɈP@`Y 0d `0N0000 L@X0 0@f?@DP@@Eᝈ0S 0@0@ @C0 00@0 R000Sk@)0S:X 0(0@00BL0(0儠0" SR xx`$ xpk@P9  0 $0 0$`p屇P @w x0Vy@Px0, 0@0SbL0$  GP@(0(儠0" SR@  x03y@Px0, 0# x0%y@PDDc)B)B@A-M`@ p0- 0?PP$ 0 T 9 0C8C890000b0TP00 0 9S00003/Ѝ0 B?PP0Q   A-Mp`0@8PP$0  @@  9 0C8C8900000H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?Z@Pm@00$0@T  R@@@@@`ᴰK [00S S% gP[ᴀǑ"$$哒 @ `@ T@ 0P@@@@@B Pa0[ᴀǑ@Ƒ`0S "440 =a 偆0@P00 R ?R *  1/,Ѝͽ@)B)BO- 4MPRX0U0 `0删00Jp ((00 T @?4/@P7 0 00\ 00000)d@ "4400 00C0 0    `@ nY0 00P05/T@4Ѝ 4ЍOܽ@)B-DMLH ,  0嫘DЍ@@-0"!P Ѝ@-0 \ 0 00\ЍA- MP8@<`P^0yᨀPPP)0P p@` Ѝ 0 *@-)@0$ Ѝ@- @ 0  0)0 Ѝs@-`@0 0KPPPP L0 00 ЍpO-`9@:#:0*&0  ˁ@@P@$A-`@0P00p0 7/"!""9:#:0900 000""00S00C=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SZ0sW!srS"srO00sL(srH0sEx0sB|p q`0$E @10000! DLQ# 0 K#0 0 p@PX0|0#880'00 Rd0X00,$00|0 *P\PL4Ѝ {G 00圀z㬠* ᠘00*0 p帀@P0嬠0S0t0娰0S0p000*P\P4"sr# AQ񟗪000000000z 00娰@[@P#sr` $sr&srxG@x00w0F= 0 U@@ 0 pI@Pc#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P 20010 P *00)0 p@P 9  :(090*P\P[3-@@@@A-`p0S t 0d0 0 0P0 LS@P90VoЍ@oO-`p M✐t@PPd1)R:̂@t:<1 0G0 0@P<9 08C890 000000@04/@P ܄  0 @L@ TጂЍ9 0C8C890000|y@.eC-p @`0圀T0L T* T20S-@ Ѝ贐 善P@00@ Y  bkE 00 0` @娄 070 @.e*BO-34M`)R@#*p0 Pሐ0p 0/q@P 0.t@P0 !o0p4ЍpP0 000900 0 00Qd0X09 08C890 000000@04/@Pd 0I2(0 0(0$00S0Ӻ20Ӿ1ш000      01/@PA/ᘐ 0Q  000)] 00KY~@P&0 0009/@P ̃ 0 0L 0 @ T{m9 0C8C8900000 90000enY$@.eC-p P`UO 0SP9S B@Pn Ѝ00"nP 0!@0 @@ 0L@P  0I29 0C8C8900009 0C8C8900000 00 -  01/ 0$2n@nO-`0 P\MS0000 00cp_[? 00 A 0#3*pGp W00n@000880DP4p<@@HpeQ0L 0800P 05/PP n\ЍHP0PG0 0tn  0[$0 2 #0P @0 00 0U *Y0 SiIPS,@ 0 DQP000 00S U0 0 0 0 8n5n0 0 0\00#0300S00 0 0  000,0$0 S:00( W ( ,0A  aC 0000000S  1!  0@0PPkꫪ@- 0 RR@ @Th R( fQ@ @p  R0  0@/@-0`0CSxˆ8<)Q\8PP P*(Ѝp#sr$ 0BP<0S(P`PP0V0 ": 0S``V <P 4003/P $ 40 <#1/P %PP$ 40 P0<#5/PP 0:0(*BTd@-`0P@ "6000 "40"i)`e) P*_0S< <00 13/(SЍp;*Bc*Bz*B@e,A0   000 0 01/@e0   0:0 0 01/@ep@-P@iPڈ000`0 6/ 0p@0 1/l@e0 0000 001/@e0 0:00 001/@ep@-P@iPڈ000`0 6/ 0p@0 1/l@e00CS&0\0\00D0 0P0P0\0P080D0P0\0\0,0 0X / 0, 0 0* 0+ 0 0/0)H7@-@`P9#61S0 S 00S0( '0S (0, 0C00000 @00D0@Ѝp@O-M@P D`pI R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !@UP `0S/0SS 000/A-(M @  0P$HpLP`!ЍNT T h000@0 4/0V0/oS" R(Ѝ000@*BC- 0 M0p0L P)P IR@`0 R"0 S (pU0 `0 R ` 0`0)HY0   00}Ѝ 0 0 0<000 0 @}T j@QA   /@-@0(0$S, , ,0( @c@-@ P 0800,0$ @R(( ,,0c.eS/S  !!0/G-``pP  @P= P P (k000 Qpq0$0 PkP jP jP jj (X 015@/ec?e@-! @P  !2@- $MD40< 0 4 40 , 00 0@ '}$Ѝc0 0/e*Bp@-@ PQjj j$0@sjp@ G/eA- HP0D`p0C ##R@`V( 01S P  `0D1X  Q R 1P  `0Sp@-@PDA@ p@*0! 000CS00Sg @0T:00p@G-HPp0SЍG0 0 0S8 0S4 `` d<T@P 00 P ``0=`P T 0000C0T B >00C0 0 A<j<< 0D0 0p*B*Bp@-P@ iP$0$0p 00 $0Cp@A-@P`"vI$0S000000AG-0P@Sp`P0p0S(W! !R 0 VR:0S(!0PE  1  BS !!  100C000CS0*O-`@$PMpT T0@0 0 TЍ 0 0S  F0 ' 0K# 0@ 0 0S  `G0  0K `0`  `R` V  0 0 V  ^ @G-H`傊p  V@ P B5^:4\P`R  \ #RP  gV 0S*0S  y  0 D@PH00000  u#P0S .v PPLI0<0zz=0S00000000C0GD  !! !R   1   0 S  B!=00CS0000$00Cs0 DR0HPD0cA-P$0@S`p000$00Cs0 A4000O-P`H@,MD00Pp 0pG'60&6`'v00 `0 B`F$0s w  BrU R$00Cs0 ,ЍXC0I0D$00Cs0  0[f[ +h 10$00Cs` h`hh g 0SZ000_ PpVS g g g^ 0[0$0 qF0@s  sP0 $ 0$  dP `F!=  YP0S 000D$00Cs R0 B $0Kjo 101P g g eV gZ  g 0S0S 0U  00pCA  !VQ  ! OQ0PC0Q <0 0 !>Q 0V$0JY0$00 P 0Q JgGg Dg0Is >g 010 0C1P0S 1$00 1 00 Q Q <0 0$0 0P 0V$0!Y0$00 0GD0 !P ^< $`R0 Bl 0K$0 P 0 PC0$`0 0KC-P`dMpG1āȑ@0%T00S{dЍ,0(@0P,0Ѓ(0,0(0SX , X00(P\0P0 _(0SX@ @S , , , P0X0S\ , \ 0LP0SP[0! 0 R00R0S"000P0000S (0X@S, , , 0X0S\ , \ 0UPc.e*B 0 !6/ ! !5Pp@-PS`@!V 01P 0  0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P`t0S00p@S000 p@0j /-@ $M0 4  *( 0 0 00Dx$Ѝ1*B1e @-JzP001eA-P@T* 0S' 0p0 0S `Pf8@w0 L[ 0S 0 ; 000C0K*B p@-@K P p pP MPh啀 PP ` P0 0: 8787V 3p*B@-@ PO0 0p@-@PT+ 0S Q 0`00C000 0 00Bp@ Ly 0 0 0p@7 0S/1e3ep@-P@ 0 0 0=7Pp@ 0s/ W0( $ A\ @-4 00A A"1S@ ^\10,0//O-(0p7p"AR0PF4`0AAbATW& Ar@Pp 1PQS0@ @A :`p YZ PQW`p V000p@V00C00S0S $  s,0!qp@cO-tMp0圀P@`@, ` o90 S6 ?9P h90 `oᩒ tЍ(P,0PU0%VZZ_9 00`0 < 0>9 V@90J0 0~9P "SR 0 !r6&90S ~9 0J0 00p 9 `$6:00@ 000R  0  0 07P<Y% 8  OcY PbN6V 8 !;98h0S#9 0Jp@0 00`v*B*B1G-p VZ`'v' dA0$pp P(00@0?o2X0S0( )0Y  0Q @1@AS8 80< <@@GX 0@p@0 $ AP0 pB"   40iY0X d(00(0Hrc$p@p P(jc,V 3e<@H3e@cc@/0@-`0ML@T LPL   @A嵿0 0,0 0X0@@oЍ03e@c +B @-MP@MO-`$ lM@ ^0@pP 1@N@pP0 * 0t?|$p @v$zF  lЍP@p 7 I0 0008P7(, Q   57P 7(P, ZY Zll} Y b5 -5 n5 R ( ,"&~ o5+BU+BX@]+B A-?P@ M     6  %:&p@`V `0 ЍO!554+5 0D0 07O-$MH L $P!AYpZ `4!C20(2>B"  YV] xf$ЍOP-0 AT   SPP QPUR QP  RQ  R R  0R6q0@P 0 L000 A`P X0P`@ď T0,0 PL`@$Ѝ3e@c 0s/@-@dM, TP2,@]804`S< (q< # 哾 6K 0`7PP60  O $0AQ0%4 0W.HadЍ6 0  36(0,#6fW4,a@cl+BG-q @QU|@x|@8PU q3"AR0C4 R=yU001S B YXP Q00P VU,0!Y00X0S `"V0P `7@c@cO-@M ` @VsC f %  ! . R  m6  x0SI`!P:5f    BR - 00> U$!*0  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ S>P F3 3 R3X    0 ,  4 @, P3e>G- P@ U `D`(00@0$V0:Pp$01S<0 H0L 0 H0P0L T 0P0 T %R0XP5\p5s`P(0pt+B|+BP3eO-4MX傉 Dd娉0:hR 0P?)v%t(0$ 0AT,0@T3 0B!0U QY (@ 0`0DC3f0S   $0P#0* 0 [$0(0S, , " 80S< < # 0P 02($ Q( ((,(A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0`09 0 *"*0 # 30 #6: ,00$0 0! 0 0*h0 d!4l!0 \    ,  d . 01/pP6 4Ѝ 0`0DC3fd0 R  R Z  ,d3#xk7d0$0 6 000 #p,0W 0h 0 0,00P3eEc+B>O- 00S #6:(00l  $ (01/#P1 0B!0S@(060G`Z``0T:0 <Ѝ0@s 0,  u1J0S$ 0,$03P0, 080$0   0 ,91,1,0,C1, Y 00 0 V 2P,,20N$60P3eEc+B0@-(A(Q0 M}+p^P ) h^0,0,  P0 CT0$$ ( 0R*0 000|`0& P `Py ,#004 ,0  ,,Ѝ0@lTP3eDc`@+Bx3e#Dc+B(1t+B/O-pP@0 9: Ep 8[: W P8D0 0   XЍ c,X m  X tp.,++8, D  .X[ LV  0DAU  0 9BpMp p@c3,B!,B*,Bp@-P0`Q@ P0! ^   PPp  00CS050000 V$P y PB Pp O-`pAM$ P@\.0h0i0j00$0Xp0D>0S 8.882<082$1<0S$10$1C(:,B@T,BEcJ,B_,Bs,Bi,B@C- @ pPP)p 0QR0S U mZP  YP 0@0S 7`P '''JT 305:U J Ѝ~,Bp@-@P`y  p@AQG-@ 0S`pPU@# * 0 @P U  ZX 0 DcX 0DcA-@p@`@P9 ΄0 a@Dc@- .    Ѝ0.   Rp@-P@ 000Yp@00@- 80000  0 ;  g0ЍDc,B3e 0 /i3e 0 )i3e 0 Ri3e / /A-D0Dp0Pc00S@0000ZA@c@yc @-,0@ ,0,0t ,0 1,*,*?&& 00S:5&0@ 6, P0T|c|c@-`0`PCᲠ0h0L0a,ὠ2,@,0 @cEc`@,B0 s2@c@-$@]5@-@0S?oP O)+0  %35fgK") 8K1'B7 : yЍ3e,BD?e?,BO-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! S7`PE000 pP  VDc4 0S/(0(0 S;3S8#0/Dcl?eA-pb@MPA  p101U00 001 000! P un 0 0 P$P(0P 0P0<1 000  P  0 ! )1BPPpB`000P P0:PP00 k}P00PP~0 00x(0x0)0:00 T PJ}p@ЍDc5e?5e>',B5e-B6e9-B6e@?eTR7P7bxB :eRA-, N0RǠȠ̌' @N@  0 `p0PP ||m000URP(0 i00 0 P mЍľ@>-Bi-BO-p`1P 10@@@A0 pT0dWgO 0$P $K <% @ `X $$FJgPp35eDc>3e-BG-@ᔠ@MT:@Ѝ! PPpZW``U`#VE W@Ppo4$`>@-. .   Ѝp@-N@N@`P@ m p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 08$`0S T,P )0  L%0P 0S  $0`,Ѝ zI J#@0 j5eDc>-BO-N@N$M@0`/{PP$p`AfX0000   %0PV l)`0 P  |{$Ѝ H #@0 Mz>-BDcp@-P`N40@N@ 0 p@W{Dc>p@-8PPp|@|0P3#pDc@-@ 01 v  0R ? 01G-p`䐟V@0᙭ 0SP%PU! 0B0 0S0S 0  B;  00S 0S0S#U `FPP0 -BA-P`pWX &%A0S0S)p#000<#y#pX  %0 0@0p@-0P~p0 #@G#0S #P##Rp@-@P fU b p@O-dM,$00[ @dЍ,0L\D0$0H0,0P0PHPX PDPz@0 S 0 0CA4H0XPP(0( 00C\ S\05$0 000 [ 0P00T0\000D040H0S 0`(00 R0F0H0S DP97SX a 4IpP[ 0@ P 0  Q 0S X0D$ Ho@a000p<X0 HD P r #R4 0/p Zo $0 K 6$0d@0S X0HDE0 S@y0S.u"000A"~"@ 0S ` X0R $@Hp50Q D@FX0 ( I @,0< <0@ 1/PV DX0@ (,0 I @< 01/P #P2 |0/ ~D0WX <0 @< 0 'X XH 0DAP' D < !<!<!< Y 00 0 0 0<PP  PY< 0  !9< 0 <00X0 B H@1 0}!pP0 pp0p 0"pP 0D00 0!r!U!!00@q000嬫l0\0 DID&DP T U H!Ec-Bi,B$=e-BO-4M$0X0 P\!1$@hX0T)X0 `CV6`  $ ?0\0q* 0 ,  p 0,`1/P #X$ T \o4Ѝ ,X  ZX , !#!  "0 / +@Ec-B/=p@-,P,@0 qp@@c$=eԾ@@-`@ 0 ````!PP " 0@0 0 00 0  0S   "ЍpC-`M 0 ````p!@P 4 P"gd# W' 0`0C0@ 0; 0n o" 0WD0 0tW1 0S1  T 000Ѝ 0; 0[ p@cc 0S:0P//0 R:P3#//p@- P@000=`p@i ^b@=e0 @0 'p@- ` H0@SP`B   DD00 $p@h@p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`:<Ѝ舧1 PBDc$u1-BG-M 0p` @`)7P0 P 00 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0[P Dc0A /R0Ca 000/P @-zaP010@=ep@-@P` 0P ,6,P R0C P 0C0060@* 0 0T 0P3#pP 0Q pp3e 0R  S01 R  S0100S/0/- 00#R0 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B 10Sp@A-Pp`d@P L60H10@0P 0A!&0D<$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```20X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`f0S #S P^0S ]ᔨ000@cp@-P@P 0S p000p6030/@c@-0P  c-@ $M0 * , 000 00P ^$Ѝ-BEc@=eA-P`pP @{50 1000000 @ 0@AA-P`puP @]5010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-M00@P`U@PT 0@`[ P

P R*0S*VPP0S0S:00P0 PSP 0O-, 0 0O-M8P@`@0T@1<0 V`!T1! jPX ЍT p:X Z0x 0 S*0 S 0Z R:Z 0S*0S @0S  p@ R  0R*Z R*XL@0S00  80$0S 0 `G 0 S*0 S  0S*0S @00@040S  0R* S R:@ @00C@0@Z 0 S@Z 0S:0 3@0Z Q:X ,ce@0S @080 P R0@  B@ 0Z R:TX> ;@00CS@0I p@cA-P@UPP0` 0p00 @0S . PU000ЍPP00`V  D#&R 4 R @ R  00B X $6SV T130tPPV40S @0S00 80$0S0 0 0g@00@0 P@0S P080 BP }04 R@  B@  0VP`U140S @00CS@0  `3e@cO-P@4M0U<0UP!@0, T@1T@!0S p,` 0 Upp2300 000C0Uf0  p4ЍQ @ R p U 0 R H$Z 0  0 U01 C0q0 0C00[ C$ U1Y ( ,p  [0Qp   D @J0@@ 1/p @ `D $ o0P P  $R  0S0S 0S  M  Y0 S K\P 0o 0  BR ;@c@-` Pp-P@0P  Ѝ\ 0S400@ T:p@-@P0F80000pA8O-H0S@10 p0`$0 PpCL \ SN P00U  R* HQ Q0 Q11!$Q44P88P<<P22P@@PX  ( R,Q RV  R0 R SW H0S 0S00 S10!$0S4 40R8 80R< <0R2 20R@ @0RX3 (0, 0 RSV200S5000 S000S0000C0 00 {V D0D0H0H000000[H0SV  :P M 3P F3/V2HQOV  "P' U   U    B    5V D D H H 0  0  PN Ѝ2/LA-@lpP`e)00LP0PP@/L 00C100L0 @  0L0 ! 0L0000FN `@l r0 S0 S00P0$00 0 0H000s 00pЍ 0FR 00SP3Z 0 !EPP`@GPh@@<@@-@pP`M  0pU P Ѝ@|ЍG-0@P0`Sp0S 00S R 3/000& <@  < 0 000SX@`@@ P@ I  Y0 S b00P0(4000000@00080PP 0S*80U0S  XT00(00 0PPX @ P0 0P00<00 S?00 0 0 000 @$y0S 0Z  I 0 BD @P 0D 00  0 00C0 QS00$P0$ 00S 3/(,00(,000 00080408 400408080<0 <00@0H 0PHD D B"&*@0DA20 20<0S10010(00(000C0S @@ 0  R*8Q RP0@H\PPR$4T00(0 00@T*@np 40 00R0 R0%400P0P@ 0S* TX@@XT/ $W Y  TP-@\ЍW 0 @P0   0P000C0 00 $W Y  U $@TP ,0S @3eO-P`@Mp@0 0<0V`!@0 T@1T@!8P 00 0S*0T* @00Z R:㈱Q0 Z8Y $ Q\  M 00S  04S0 08pY40 K004 000 uO00 $0 S40 A0 @0 W 00 0 KP  @Z 0V}Ѝ @@-0f ЍA-` <@"# p0 &0P@00T@T 20S R 3/Ѝ<0S 11Ķ1ܶ11 00 0C0 @00 0 0 b ]00P 000H0S 0@0S 0 0@ H0R S hS 080 40 000000 &00P 000HP 0 D B"&0~0D0H000 $00S 3/0 $00"00000DcO-2*M00P`0T  0pP 08/pЍ@4 R @ RH0  8 $ RS  B0㴁0 0 0 13刁0H0S!  DJ0P$H0[00 80 P[ H  H0S r DJ0P  0  0j000&j` 0H08/H0000p $0 03/ 0, `F(00 0 v1Ps1@cXs1p@-@P0S@ S dV003/p@ `$00CS0MrS .B- 0 ^: 0R:   0\ P00O-.BEcF.BM.BT.B_.BFcq.BFcj.BpO-M$(04P, 1/f ?00/0 0 D/00 m/0 0 /000 0/40$ (0/0, 00/04 80/(0< H0/,0L /T P0<0DX0/@0\ p/`0d 0 Ht&xL|TX\      0/1!" # A# 0/1!  @ A)  F A* *! A/ "< A/ # @ A   A @ %- A, &- A. '. A0./p21t"/|"x212/ 1"2/1"2/1"2/1"2/1"2/ 1"2/$1"2/(1"/2" $ /$ 0/281"/3#J? 32= C A@D5 $ÍH! L(#,PT04Xa\8c<`! d1@# 0 0D3hqlHsL( ) 08@ 0  00 2 R"` T#0h0?Ux0 0S?#x03@$ 030303005ߍ3e[eC-MP@P`` p.#0  P峕H1 R*Q, ! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221cc3eEc0a/Q/0S //C-Mp0@`00 0` P"0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0S^ 0 B 10^ 1300,0堰0#3[ * :#:SX  ^80@.4 620 0 0 fP Y 0 03/^X&  0!  0D %6SP0S 0P 46S0 00 0Pu0 o>@c3e-0ʠ,ʠ 0C0^0@< 0#03P03 Q03S>0 0>0^0 s: O-0$MZ0%ZU@ N@>00R*1 000!7$6 0 0U@#* 0pC0 W|#FG Pe @7$Ѝ Z PX RU:Z 1 0 $`  pR0S 0 0000S Z@<0J0HY DV ?0SV 叻Y 勻YV 0 (,0 D 0 P  DDMP 0S J @T0 @PPv@ꄾ@O- 0LM\$  ,040LЍT  j&j R@ DN@@N@ 0C*,0"*R0 @< # 3 S:P03:RT0P0 008040  VQpP 0 0(0S 00 0<00800400 0 @00Fc|cC-0$M@؄SP`p0 0Lp@07/p ` P ,0 `00000 p00N$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 0*$ЍO-$MPT0`@LpP$f R R C< i S X:<0SYPZ 0H00_ 0 ! 0L @0 ."    !P@@ 0 ATQQ@H   ^T3e4eEcT?e5e.B@-X0S:0 0B00 (JR0\ 3e.BA-`Pp@P@PUPD0S TJ P  P4e.BA-$aP0AS 0!>00000000 81Pn 6810`U 0CS*JJ뤀p0WW000N@N@W\0uЍP< 0 JEcT?e3e/B@?eE/B>r/BO- B 2p A`P LD PeU@@!pJ!P@*P%(0崁!S00@0D 00P@061A@0U0C@@@ r0 ᄠ0S 0- HP@0   S0P  P  @uP 0>0000000x (0D0 , PPEt $뛥*@c@c/B3e4eB}EcT?eEc/p@-`P@k.0`P @ pT?e0@4ep@-PU@Ip@x0@QX00 1Ġ  S0 Rp@iI@c/B3e/B  @-0pt0S[es@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6n U 0p] P(,`0x S 0: h S 0; 0ቊ`P`?z@<@@-@`P0p00:0偲0 p, Ѝ0 /@-@0:00M0 Ѝ/"&*C6D0S/ 0S/ 00CS0/@-@N3e@-@ P@ @-0@SG 0003e0S/@-@ P@ 0׉Pp@-0P0@*Љp@͉ˉ@-0@ R0 @00@Q A-@ P ""&*C60S7 0⪉ P * 0; 00   0:0 08$0 00S) 0SA0S 0 00C0 \ 0 ; 0(0m 0 00 0S0SPU 0iP `V' 0S 0x0U 0  :0V081` 0 >>⣂Rq P A0S 0 `(0`% 0p 0s1Q'9 0 6 &! R  010@ 0"61@ 0"601008 00000?3e@cc4e3e0cO-M 0pDP@Hز2 a 00'603S P0 PZZ@H yGZ  PQ d"($($( @0  S  G "0` "zᮈ 0(p @,0@00 +   |40L PZ 0 P0 PMU ЍP  04PZ:T  0(p,0 @@ 0`_ 0(p @,0@00 R * ፈ P F ၈ (R +@c3e#0B cc@<@G-Pp`ᔐVUG8A0Ds 0 0 0 0Pu 0  0 0U`0 00 <4ep@-0P R@00` :0 R p@30000 R *Upp@| 00!Tp00U l @-@@p@-@P0p@@- X @- P @ @- 0S Q 결P0Sp@- 0 P@ pqP U  0Rpp@000 //000/ S0/000/G-P0 `0LS#&@"&A6 @|pYx` @`Q*6/OoB0000Ѝ@Yp?e3ecO-`0M  R0 Q @K V@pP Z)0S W  Ѝ Ppᬭ PU ( ,"&#@Pp@p 0Wp 10 R0PPር0 0200 0[00S ,V 0@>WH  0 Q00SB =V 0 R 0 05 V  R 0  0 00000uD0W  P  0 ( ,"6  0@ @0 0YLe 0@ez V;$qfV 4e3e@-0  Ѝ>O-DM `@f PpEVZ)W 0   P0  ( ,"&i 000 V0 ք*!DЍ0 C-@P`؀Y$7p97P P0@@ p᪄D!<@U@DOoPB@p,pՄT 0 EcTdc?e3eW0Bp@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0p3eQJdVUUU?e7@-@L0SBPU0#L0Rp00SdA`0@AX X 00 0,0 004A Ѝ0@4e`0Bc@c3e0BEc?e 5e3e@-X0 < PD!@@0\@0PKPP3ec 5e3ep@-`Vp(U@QpCU 4  10 10  z000p3eP/@-aXmT?H0, P<G@(,@ R >0 03ec3e 5e?eA- @R0`0pS `VPIP!᫫᪃ 0R PV S PV փPˬ X ̃P 0 P ; B 0心X 0 p@- 0@ P P 0 0Fp p(0, #6 P rO-EM Fq8 5@4 `p`P A4D#4射L 0 0d. 0S 0SE0SBd40x$0t%000 p 0WV ` pl000@00 0S%1:05p^0#*\ 0!03 ^P0#PP 0G900H < R80L0|0@H@H0,ЍO艀\ :0W+P0 000[e@c?ec?e@-8@*00(< R@@ 8L @ <00@]@c?eO-hdbd<@T 10P0 1 P F< @0R "80L0@0< 40!S<018 L 0!4 @0 pW, ̡0 S(fP 0S I!0000 SPP0S 31$A<J~000000@~3S Ec@c@c@-p@ l\ `h Tt H < 0 @@c0B0B0B0B0B0B0B/////// 01>.2h !0S000C0< 0S0 00 00000/4e0c@-@P R00 O-\MP0 `S`S@#@2T@U U0!:3 U`0A0C 0000@0 0Y`V0#0#60n((0, 0P0Ço60S \'(0, 0P0$@#v0#6(00#6C0#60c400,0P 0P00 ,0S $0SC@i\Ѝ0K,0Px+(0Sq0Wm*"@?P@!@1#(0S`1`!@D @@0S80*PJW@1@!@D @P`10@0S 400C $ 00C 0@0D < B Q < R80CY 0D0@ @D0 Y A@0@000I00$0Y k0S pP0T00Pp#6$000c0000c(0|0I640 6,0P @x@X 0 ppppP$ 08 0P0S0P0T0P0 @S00R0SL  00`g 60C04 0PD PEP PUP1UP10S> (00UP1X(0@0@0T@!T@!, 0DS0%#`F :0U*080  $ 80 R:0`F$0 S,00T: Y@PY@PP(U|0FS@1$0  0l  0@R0T0 0P8 00000 R0T0 08 0): @00@0P00S Vj0P p`T0S*[&*PP U P10S!1E pX*P Z PHEY p`W e[P1 P!P1oE 0  pW PPP@`A I@T3e41B?e-1B T{?e08 Q/P @- 90c=1B/0@/c/0 \/у0P1cp@-@`PH1ƒQL"^!^D*Q p`V`F`P9 E@V P^@o#PpA@AQ`V`F` V P L@pcb1Bp@-P@x2 Q*    0R p`VH^9`F`V @ LPpcb1BO-1M0SB9`Pp U@S70 @L7J7W00Ѝ-  Uڌ2Sᅢ \ J 2PW@` P @ K3e1Bc1B1B2B0@-@X0S0/"R\:@\*QL0@0C?0c@- pP 02 0  Ѝcp <0 P 0 D R 2 P///c4e@-P@-PA@-P 0c@-P 0c@-P 0c@-P 0c02P 00 /c02/c02 /c@-@P02 cO-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000ypc3e@-@PL0"D0S 03>4000,02Ѝ0004e12B?ec@2B0@-d@M 0R0`Sr]00 00@0P0@0  Ѝcs@-P0@D0S 700Sx TlP: X7`A P<74`P@Ѝp4e,@M2B3e1By2B2B2Bc0O-M`  00P0ll500ЍpW8< 044Q0D0BS0S W7*7P .0yP W`V70`F`@V @ DD0S@pp h @p 0p0C 0P 06# 08 P 00C 0>@2B3B4ec83Bb1Bc3eO-,MP`@` V.P 0pP@00㜠N@T ,ЍX PPE%&$ $    01/加 00P@0/@- P00  QP@- P@? Q0 .S 0!  U06P`0!R0P`!R AQ:R 00P`0S6#P `0 S 8P`P`P `0 Ѝ U000S0QRA- p$@P`0vw6 00J_Ѝp0 P/0S  4\Q 8< Q < < 8H  BH /80Ce3e P00S/P 0 (Q, Q/8Ce0P  /xEcp@-0@` PU` S R   P00 `800h <0@8@@H00H0pQ 0 P0S  00"Ce3e@-T0@T00  0 @ST0@@CeG-@0Q00P00CP0wXP'P""R,40Hq0S)454140P !o* IwL00CL0$ T00CT048P5 `7w000P00P0ow`0``FV`_G``^w, (D00 @ w `3e@cCe@DeT@}3BxEcp@-0@P v4wvT00T0-wP00p 0 GCe@-TpMP@`ٞ40 00` 8x@$Ѝ(Ced&4C2@-XpMP@`ᾞ<0 060`0 x@Ѝ(Ced&4C200@-  啒0 0000 0&@P0 S 0 | P$d6p\IP =@0S  & $0P000CStxL2P2P2P2L2P2K2h`P0S %h V$0T T0,0h0X 00$\,9`P hO@h@pJ0S@0P5 4ᱼs`PtP9t@ *b.t zPu? `0s04p00S 00  , #sP t01s RO@ s$A 0$ 0P0 F2 !\340XY Y' `0P  30X !&!&`P szs0 ss @g9p ?4; fj0S0F0Yt 00 2(20X020 0 4C#"#04>0CYC 09[  I/ /ı*!(0@@P0S( T!0S"     l d!~CP XX1!hm&`Pp0 0 (0S00,2(0,`(0r0000|0L L P P `NxrP\s@0@s `@@3e(CexEc0cWe@De4B/4B@cu5BM4BԚe^4B4B4B4BCe 4B4BHC2v@4B(1 0S/O-qH0S@ `g/婚r찟PUZ/r ЍO@T P 0! 4 wR r R `7/8 <0R<00# H00CH08@ ЍxEc3e5B(Ce@cCeB&5BG-0H0SG0P SQ@ 00TrpW R00S0 00@T p 0# 0 0S0p` #R<00# 0800X<0@800 00 0T0 0T0^r(08@ Wr3e@cCe@-T@L0S@ D rdX40 0P@T@@0 0 @-@oH0 0@pꠋc*&O-$MPH0TQ@`LpP0#0@ 00S 0S%増0S R0  0`P60 0 H00\XTPLp$ЍO%e|O-Mp80PL@D  \ 0*WAD 0!   0 00  * @ ۍ0LSA-@`pP(  pu q mЍA-`pv@1 @P@00#)/_<0 0|0ᦑPPD0 !00F? 0嬑PP 0 0%0vЍ5B5BO-`@㠀AM pQ`@dH1 h0L1l01Jp0pph  m`q \`000kl0 `001 0$00l*)('&%0z 0.`0$pS8 `@P0pc80X$0`0D8`9WP0@@Qk|pW@ VqE@P k 0T ;SiP @ 03/ i 0 ipbp3`0l3W* 4!L3d00@C@Sp@8C|`h0x00(9t@iPN@P003Aߍ( 4\40  @` 4/@iTp2Wh|㇢  0#03" 0H 001p $0ZiPN@W  ( 8TpIiP (0  @8 4/@PiT 0 3/@ EiT00S @ 0\ 0@ @@  iP 0  @4/@&iT`V ࠟ 0S0S` hP  0S 00 :/iZ` xhP  0 ;/ h[ @ @c5BcELF(@c4 cpi2PcA-0`p0 Pc#!c!00=R?c#!$c$" 0 R0 0 0C 0hPN@Ѝ @0 4/@hThP  0 8/@h@cA-@`Q@Mpz 0@H1(0L1,00 @64000@68006<0卌@P@ahP  03/jh뤀ThPN@@Ѝ @0 4/@WhT e@P<`9hP  0  3/@Ahc@ccr20000/0Ce000/-AM 0 R 'R R, R 08P#8S$  8 00C8#8SAߍ 0Ce0A- '@pP` '\  \ \"S* Q@0 S: Q@0 pPS*S*Q0S*00Ce O-p0Ms0@D00S PC0c PA0\Z%Z 7PA`@Π0@a?@``0IP0 S%:00N@@, R 0 `0 B>00 0 0RЍTd ` 04 ` BP܍222P Q /(DDFcC-`|M@Px Dqh0Sh             ($  ( 0 040 080(2<0}>@00   1DH0 0LP00 0TX0\0/S G0h``0d0@ 宆P 0000S l0`0G0`p`h0l0d`@ ᔆP@p`@ |Ѝ`s@-@P`mBP Ѝp@sЍp@- L@ P 0S 1(S3 SP5BO-0M3S P@P1S S  2S T$$P $Ѝ22$0 00$00 0$pP $F$ 0`00,080402S300l0`0V L0L00 06/PL0?Y00` 0` SE V!3P Q*I I`F`00A $0Sz "R'0&b00CS$ I 0000 0$DP $z400CP $p` "R"V`10 ` " 0VL000`8` `2$S0K0S,0 40s0n`n`4`800XpSD 00t`D00V P t`0t0A0S1   0 l0 0  ALp<040S07/D040 p 0 0'Z (O  0, Rbc^pPS01 P([)D0<s0D0D P0a B 0 D0H0 0 4D0P-d 0HR:0R050B0005D00D00 p0 . Q 0 0A B40 00C Y (   0,`1!00 000L000H0 V 08 S00 02 02000p0h`|0l0$03/P$ 0@H0  0`02lv2A-PpU@` U RP  Q 0P  R@T P Z4@0O-x02 CMR@#2` 0b 00 00 0$]@P S  p2 S OoK BA F Ѝ0S%P U"0P0 0$8P PEPPE0PPEw@ U @-P@`pP  0 00҉PX0@0X0 ЍG-X0 P `Ѝ0@S `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ Pp  ׿Z`    ̿`{p 0k00X $p0 $0X  0 0U=`PX0 X 0 <` X0V X  !X0`P 0X0 0\0j 00dX0"Up]W L ! LpP E5BP P P?4@// 00. 0.0 0 (03100 >0#60ЍЀ@cA-`@V pp 00000 PP 00PhFcA- $0p0 $0 0@R`P:    U@` P (00 00$00hFcx @0D0@0D0S/p@-@P`0S000p P PhFcA-0S@Ѝ` -0) Pp!I@P0t 0000 q 0  0 0(@P 003/@@-$Ma01@00 0000 \PP0p  ϤW 0 00 .  00tP$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000P$P,ЍA-X0!P 0S00@0#,$04@ R1D@C(2Dp<@`C0B` R 0 00000D0Hs 0 0000 000H0@ 000 0 @@ЍhFc2$0 0!0 00 /@cddd@-0`iM0 0 0EP 0 iߍ@P p0 tpPd  U00> !0WeWeWeWeedAO-Az 4M(b$sS0S b 3 D PD202 000*0PP -!Q0  <900 倲倢 0  p.AT \(X&DcwP`<DP)~P\DP D0/S]0`00FD@-0` 0`Q s0!00  "0VPU ` P]0 T | 0 00P<P;0 0C4/,P000埼 P0@P@ 8 8P<`$P#$ ,C00   P0T0P0S PvAT00h Ѝ6Bc0De@5B "6Bd5B5Bh@I6BS6B2TA?9AA6B6B6Ba6Bu6B6B@-<0DT 0 !0  !@c0@- ! 0 !@- @0S 0@hWeWep@-T0PO`d !0DUF Ϡd 0!;T@!pl?e0@-0dM0@ 0 Q00 P00Z  @`T#ʸ @Q  S 4/0 0 &#: 4/?&6 :  \ 4/dЍ0@D0De7*A'7B+A.cA+AAFcA7*A)Ad[Al?e27BE7B0O-P`p'DM,00> 0 00P(`$ pv0,0> 0> 0 00P(`$ pc'0 !d> ,0  00P(`$  pN 0 ,00!> 0 > 0>00P 0(`$ p8 0 ,00!=0= 00 0 00P(`$ ! 0,!t t= 0 00P(`$ ` 0,0 ,= 0  00P(`$  p0,0< 0 00P(`$  p0,0< 0 00P(`$  pЬ0 ,00!D< 0 00P(`$  p弬0,0< 00!;0<$ 0 00P(` p奬S0,0 0$!; 0; 00P 0(` 厬0 ,00!P; 0 00P(`$  pz0 ,00!ʟ: 0 0 0P(`$ d0,0: 00!: 0: 0 00P(`$ pN0 ,00!`:0X: 0 00P(`$ 9 0,0: 0 00P(`$  p% 0R!9 ,0 00P(`$  `R`: 00,!t9 $0 04P0p(` pR, 0 00!90 $0 04P(` pR00$,0 0 00!8 0 04P(` pɫ%0,0p8 0 00P(`$  p嵫&0+,00! 8 0 00P(`$  p填(0,07 0 00P(`$  p卫)0,07 0 00P(`$  py*0,0@7 0 00P(`$  pe+0,06 0 00P(`$  pQ,0 ,00!6 0 00P(`$  p=-0,0;$0\6 00!H60@6 0 00P(` &.0,06 00!6 0 00P(`$ p10+,00!5 0 00P(`$  p20,0|5 00!l5 0 00P(`$ p30 ,00! 5 05 00P 0(`$ Ҫ60 ,00!4$ 04 00P 0(` 廪70 ,00!4 0x4 0 00P(`$ p妪90(,00!44 0 00P(`$  p咪<0,0$3 0  00P(`$  p~>0,03 0 00P(`$  pj?0 ,00!P3 0 00P(`$  pV0,03 0 00P(`$  pB@0 ,00!2 02 0 00P(`$ `-A0 ,00!l2 0d2 0 00P(`$ pB0,0<$2 0  00P(`$  pC0,01 0  00P(`$  pD0,01 0  00P(`$  pܩE0,0L@1 0  00P(`$  `ꀾ27B27BEc7B7B27Bpt,:hBZ57B7B7B7B7B4De7B27B7B8BEc28B(2oB6B8B8B8B%8B-8B=8BE8BR8BZ8Bh8Bz8B}cе28BP}c8B8B @8B̷28B,2B2vB8B8B8B8B8B2A28B8B 9B9B*9B79B H9Bcb9BT2p9B`29B29B9B9BDDe9BGc2N6B9B9B2YA9B*A9B*A9B$29BpfF0,00 0  00P(`$  pRG0,00 0  00P(`$  p>H0,0 1 00!01 0 00P(`$ p)J0 ,00!x1 01 0 00P(`$ pK0 ,00!101 0 0 0P(`$ O0 ,00!2 0 2 0 00P(`$ 0!`2 ,0<00P(`$  `Ԩ 0!2 0<0 (,P$  `¨0$02 00!2< 03 (0 0,P p嬨;(8$0 0 00!T3<0`3 0 0,P 啨0(0; 0 0 0!3< 0  0,P$ p~0 (00!3 0 00P,(`$  p=4 00!4 0 00P,(`$ )5 00!(5 0 00P,(`$  0!h5 0p5 0 00P,(`$ pDЍO- 1+0H`9000 00 0@ 0 $0P?o2P0S 0000 0 PPP0SP +H0,|ЍO-P|M @p``  +0H`0 00@ 000 0?o2P@@TP0SP +H0P|ЍC-|Mp@P` `0X X@- XϜ@&@XX H%p0S X0000դ0 0000 00p00፡X@H|ЍJd@cC-@|MpP`` 1T0 T@<Y00?(P @2 (V(RXX @H R Y 0D@ @ T0 00 0000p009X@H[|ЍJd@cG-pP`0M 0` @$0 P 00 000 0@ ?o2P0S  H0R0RS*00Ѝ"3ucEc NMb@-1P3@l `qe0VN P0 ! 0p:01 00$00$00$0PD $00$0T0(00,0 0S00@000H8p0900S  @ⶱ0VH00L0H0 H00P00T0< 000\X00`00d0`0h0$Ql Ѝ0 `ڧ 0 H0ӧ l Ѝ@˲@c|@@@@BA-`MPp@q 0` r0 P 00 0000@[?o2P0Sq0PЍG-@Q0Mp000` @`D0 ` 00 0 0 `@.?o2P0S, 000 0000 P 0R ⿪<0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 oЍEcɚ;6eA-M@P`pê(0` 0 000000X00ٟЍC-`0M@0 0p` P0 P 00 000 0P幟?o2P0S@0S@T0i&K  5PR000n@PPЍEcDcG-`RMAxp oP` ($1 0 1 010P 0@Hpw?o2P0S"ЍC-鄐|M@P`` piH0X 00 000000K|Ѝl]es@-P`t00@0S 0 㗑ЍpWeO-PM@`Ȱ0qU0s 0ȰĠp@ЍO蜢X0UT@@ p.wXV2U`010# 0YC L R?0!P PVV|pWV,V~Z[$bFrFV  P  ~ &cV| RV~# W!`JKq@hVXQ 0`FV`G: EVbpP(V  忠 ;?0~`rVV .VU010#`| 0YdVx~Z[ F FUV 4 P V|0S Y1`JK@ꂠ Ѝ0 M@ ccO-PR`@$MB @prU0 RV_@D @$Ѝ Z X       {DV  (UZ0 H @p ꌏcp]ecO-t"00a,$@ @@ @P} 0(00 00a,$@ @@ @Pl 0(0l0 00a,$@ @@ @P[4Ѝ:B,B:BڝAAUmA;BB:B PB:BgB:BP ƒ #60 P *R  P 0 / 0CA-P0@`P GP(0p, UP1p1:PUp0S S0 0!d 0 GP*0d0L0 0!d 0 2P:00 HDesc:B:B@-L@P 0S  00P 0000HDeA-Wz@p `PUpPz?00ST~z<0 80x5z:BTDeHDesc:BEc:B0000 "zHDe0@-M 0000P 0`(@PP8 a@P 0 @@0@ 0 @P /Ѝ0S  @!!S@P @0Dp?  @SpU!@@DpK@Pp y_0S 0000@P O0S 80p 0 0z>@P@ zHDe:B2TDeO-䒟M0S@ X y0Su,0 a,0zXQ08 0(tQ0(@8(0H> C'R(@H(!,QL H L 0P BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP 8!_ ($ ,W!@0<Q}x|$Q[0* 100S% ,(XQ?0 00000000 00 @0X P D,0a0Oy ЍЏ 0HDe@BEcEcc ;BTDeO-MQ@L @pP `VTP%@ЍH0 0D00@00 01/PP P@ `p@-P,0@TpP @(sc@-@ @/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  Po` ЍX/\/RA-PR`@\p 0!SPVmPP@  d!@X@@-X^ :S\!@ Yn s@-D0`P J@P`00Ѝp\De@-@0h\De 0 \De0 \De@ @ R D0\ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W +P0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/@cA-pP ` V@P PwP wV  @000V 0 `@ 0S 0 00 P000 @  w`De(sc0@-@PMLw0@0@ @@@0 G     t d T  D $4(Ѝ0\De&;BEc.;BD;B%B];Bv;B;B;B;BP/D0 R\0 R\(scp@-@`Plv(@PT CJ " IIXI?@X> R;H4H`P @ 0 0=02  l@P1 ԺHH!FQ. 1  @P0S 0  mHTH@W Ѝ\ꢺ0S @> T@ 8P@0SD@T80 &L0  00S 00D000H000<0 8/0(000 00 $00#1 03/@cDDeGcA3AU101?1?11` P@V@@pp@-@HPF@080C@00S  0 KFp@Fc@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PE;E @0 PUFtttp0@00\PS 0  P@E403 EEpJdcEcQ 0 "Rq0 o`/O-M AQ( <0@@|eЍOQ_(0pS<0(000 00?o 2?P0ISM0 $00I?oR20SC0I?or20S<YD`xW01x0#L0D4`P(000U  L0S:Z0S7 $0S`0$ S0D0@0 P 0@ET`?D0\m`P E `=,0D1 @4008040 0S`,DDDmP80[80m 0T0T@Th YT3$ 0Ra 0 S030#R0S 0H0D`0H0433Y`x `qV`@d0X `X@\`3 0lVh0(0p000t040x00儀0X00X \`V 0$ 0唀 )0夀0(0SJ嬀0020 S030#R0S0 0000Cs  00 0zX00X \` )0X X00\`ߓ(0SX 0\`X00ӓ"+0V0000000X00X \`H00 00 0000|09D,7DL00 `@`,CV800Y00000C000$0Yx x@00S0`000HD<DR(0S 0 '" <0 Ѝ`Wecc\sc@cO-3M3/XX`3@03?P0ЍV0@/T3 044004@ˆPP 0Fd0C\CX3Xp`V L0S4Z0S1 C0 0000` 0PCU?0lP C @= 0cC1P$00,0$0 0S CtUCkU)`, 0S,  0808@T  BC00S $ 0R yC0000?S0G0 nC lC*C~k PA00S0000[CpG|XCp~d13W@ ( $(0S1 0H0 0L00P00T00X0 0`0$0d0(0h0,0l000p040t080x0(0S<0|00< |⡒ $C@0 P0@p@0C00$00 H⌒0 <⇒<0 PL00ဒ0 T{PcP@ccWecc\scO-@HQ  !:Y  pW P(P1SQP`4?00o?Up00002q EŠ0 3 1@cDcO-13A1Lp<giPP\7넁`pU0^U O8 ܷQ020?SP !011QPk?QQ? ᾷ ?10 ЍO[ 00P 0SW ( R 尐U =P00 Ѝ@cDcs@-0Sa @1S@ @A1S1S Pk?P10``1SЍp0S  R R    uPQ @cp@-@T 0PQT@dpT \Y>JPH >@p>pT 0d3 JPpvtc@c1MR  !Ѝ/1MR  !Ѝ/G-p@l3a PP    UI@c@-M@`Pp0P @" W#!!  0@@ @ 0  @S  0  @PЍ@cO-%upWpMH@Pl3졓1 0 00S?M`s = 210030 10 .11 R`` =%+ Z- TaX 0\P0 03 BV Ѝ3 =0P x r= }@c g;!(0,0(0,唍 H  ۩ 0R1!0CQS B0 00 VP t.S1! B0C 0p;0  4i{cP(3cEcpcH23`scc4De@xFe=B>=BA-P~`P p吀H0L,A0 U P#H0LTp0    0S;;|03/0S:@`sccc@-<0DT 0 !0  !@cp@-00P@00.pc0@- ! 0 !A-p@xP `M0 S S R00S0C0CT0J$ h0l0h0lAc`sc@-00@0c@-"0 @0 0Ѝp@-PHM` P @ (WP Ph@]:(  (ܨ $   Ҩ:HЍpc0@-A4MP000S 9:\0S)  BR/*  tč00 000X!h0l0h0l810000SG0P=P4Ѝ0 Rn4Ѝ0@@: ,aR !0Bc:>BO-DM8pV0 ,00P!3娃 03 0P($  O0 00p'N`!P#P3 0` 0@,P(p$ 9 0! #3P  0 0,P(p$ ( 0`!2" 02P0 0,P(p$  0!2x"P02B 0 0,P(p$ 0 00!$"@2 0 0,P(p$ `0 00!!1 0 0,P(p$ `0 00!!1 0 0,P(p$ `0 00!@!h1 0 0,P(p$ `0 00! 1 0 0,P($ ` %3P$-IK21 S,AT0 00 <8E 8ⓡDЍ8t@z>B>=B`scFe>B>B;3>BX<3>Bc>B>B>B>B>B>B>B,3 -3c@- ``l\0PPL 0  040 P $uЍu53c?B;?B-3E?B/d 0 0// 0"/// Bp@- ` pP@TLpA-P@0`Q ¾P@ptcA-`PD0@XppQ ᩾P P@FeRp@-P@ R!  0t  0!R4 0 R R\ 0\ 0\00`00  0t0$0p\0 0`0000 0?Bp@-P@@:2tPw2pp@-@`PP.2'00p`t0h2pp@-@PP 2(0, 0@@Y2pp@-P@@2$PN2Upp@-d0Q@P  @0, 1S @@(0p`1 @01S, (0 @@,2C- M` Ѝ0 SpA" S) S /0㍪P@D10@ 0`01 ݄ 0!0 UTV20 n?P@0 eP@`S@T0P@`FV`@Tp0P@00 zP0 0 000000ʚ;@Bʚ;7@-RP@ R8 0+ pLX0 0X0 0Q 00 0@00C@0X0 0X00"fP 0p`00q 0 0\0 0" Ѝ008  @?BX3p@-@P)1@081@05p@a1p@-X0@@pP 0X0p0PX00 0@008@0$p@)*p@-@PP0(0, 0 (0, `q p幔p@/1p@-P@@0p@$1p@-P@P00`01p@ᶔዔ(cp@"Luc@-P0<@P1`Ѝp0x0t0 0@ 0000`P 0 ` 0d@ 0 0\00\010Q0c@c@-`(@P |0@-@|0@O-X`M@``x0p0x00P000 00@PT``t dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 00᾽0X005 \`$0`0/(00,  ;0@0#?0 u0 /0-0!0 000p 06`P ^0 \0 `10S0 0!#4#0 !Al⌞ @0//x00CSx08ЍT ^[ ` @cA-pP `P' 0   ( H e@ /h8)`0@@@%+3 1 0{3pЍ@OB@cA-PU@d0p00`h0/(/\@p@-@d0`P/(p@/p@-@Px0Sp8UpA-@P pPz/X0 @ 0P  /x0S/ r@0x`X03V00  ///@cA-R@P` |pJ/h003//h 0 + !01 0 R)p3/X0% @00C@0 0R 00 X00X0a/ _/h00 ljA!#4#0!10  F/p@-@`P @0 1p0@00F=00`'t`DG pA-A@ `p.@0Q0@'/@c #K #L P 402 /,0P/0 0R03 0@2#/ptcFep@- @`>0PT 0T@)0,P@P"VPP@ 00tVdVP ,<<V0P@ p V@k FeA-P` p@0U @TP ]. A-P0@(PP3paK.I.@01@0.1S1S |.6.8`:(H1 Q  PP10SP@ch0 0///@-@LM@  00\00`00PPS P:Q PLЍ(`P 㗑pp-0p``00q 0 0"!.0 喑LucX3@-U@ FeDQ3];BO-P 0pQS hA`UP&P 8 V0 sP V Q$ PS PS0P P+ E [    P(  S% B0T 0EC1 00  V00UFeFep@-@P 0S ]UP |Up@P\UpPU @Up PP  PUpFeA-P4-hAT h0pS ``(-\0$ 20S$0 ]-@AX-@A-Ppᘀ-ATAK-h0S ``-\ $00$0  qP$00$0$0S --@@G-p㔀oATPP,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101-0S 0h0/p@O-M( 0$0 B0P 0 (0S $ Pߍ3S 3 083/PP803 000000 0S 0S (0 P $ 00S0#003 @04/PP0`3,00:00 pp `TP 0SL TP3S 90?00P03 @#04/PP30C3000$ Y T P P  (,1 1 RA!Y @Ր0< d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>a0!#4# 11 | p+h003/PP@0pP |,0 0P+X00X0+09 P+X0@00X0X0 R)0X008 0@@0@@0@0$$0 R 0R @TT0i ~ 0P+X0@C +P y+Q 0#$# AT S Q Q @ ? 11 0R!rVP|+0@N+X0@0X07300+ SZ @0X06300x0S(  p+k+ )+ PtxSW Z U0@,0@`S 0 0C 000|H+| +000h0 0S 0040*h P 5/P40,+U (+ &+ 0\00`0 PP3S0W L5310 0P3S5 H@X0p 3 C pPpӀ h⪣0`0xP*00@015w  8@P@0!S&3S XHpP@st@ #T *@ 0S 03# @04/3 0C( P0@0p00h t0 p00*萍0k*i*0@hTX x" S 8m*8*@  S 8^*Z*l Q   h T8I3 Ss*~X  X " X @  B@ a*|00* 0V**X0 0Z!0X0@00C@00h0 0S[  0 @0 0X0N @ X ! 0@0#X00 @00C@0!* )) 0S@08** 0#03 @04/@))0萍000 0[  T RI 'R 00'@ 8)) 3/  $!0X0@00C@0 !00 00X0 0 0@@@Fe@@c@-,0 00000 00Ѝ@p@-P@Tp`OP v@G-`p3aM\)1 PUG)P J)@cp@-P@``A) 0@I @p@z)p@-@PP4) 09 0p@n)00/A-@P@pET|`")h0000h0Z)@@00/0 S  0S o/p@-@PP(X0d`)P5)kX00X0F+)p@()0 E@-@LaPP@h@-@X0 0dX0h$`03$!$H@Z LpP tP @@cFe 0'zFe 0zFeO-p`@嘰  HQ:/PDPWe \   0JP ?P Ѝ0S 40A3/0`@00@`WeO-dMZ@$ ` +К0T L0P $0(`T i`P8p$p* dЍ P`P$0p$p? 1 00ᤓ`P /层P0Sx@!lPPs!(|PPm00h( 0;0!PP^P1 00 0000 0 PPM0$ 0C0:P01T01 R ! ` !l  2/`PH0T S*P S:00S18 ,0 0Rn pP ptP tX ZxP Pv`SPucFeG-M@` 8p)YP+0P@@0/S WἙЍI0 0 S?@# ,* b墳0 C /  C1$@ iO00<`00 )` OV@ k`F ၳ0W@C0`F`O-`4Md@qȔ 0L0 ?06OX) kd堙|4LP0 0/0 0,0p p00 000.P i㚏,0/pt0Q0*#P,00 0`PPs,0L 0P0P000 PhP|P0ӟ0(0L0 C5<0X0pPtPlPxPğ N >_PP X0H(``QdX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S l20` \(0,PPUd1, 0d1d1`l H(0000C01\1 $  BX! 0D 0TRk:D04Ѝ(PH! E'b$ *$ R!0 R $0/a$0P(P`10`1Q\`X00X0 P\`X00X0X0 0dX0@$#!$Y$ H P pP tP \xN<tNX0 0R0U0S  Fe|Bj@BcX5X5Wexc00S/ P 3/DcA-P0 `p00l 0 0010 (@0CP Ѝ CP'0!HP 0@00 0 0CS 0CP`V pZCPp CP'0GP 00@0G-PM" @@M a0 @@9 ,vQ1 010;0 @00d!PpL(@T `X-W0AU2@P 000` S'Ѝ 00S S S 00@0P0p 01@ 01p@ 00P!0 R cEcDcFeTuct@B}@BPuc @AC-@PM> (0S; $ X7 `V6 d0Ԑp03/ @0^P00^P 00` 0 U`P 003/Ѝ b Df0 ֈ(0p`003/Dc@B@ycP/(0S/P/ R  00/G-Q @DL08( Q!P( U  Mp PU PU ^Lp R(0 % @` jpP PU *\L(0P(@S0`(`(@0S   0 cPucxucG-PQ pfL@(`T `(耟VLU$t! 0S$@0S LPPp$dLv"(@T 0Q S   0 T`@ccPuc@A-@`PpU 0S A  0S SP@-@:bgP5]"_#hP lP 0@|A-@8`400Sʬ0#Ѝ0 0 0PPR0 0,0pp00 00 0P ,0/pt0Q0!*8cEcO-@Pw@T ,0〠X2 P?@PP  P< P` X !P P`@#0SKL}IV 0U> :$@s$ >@PN i`0V):c `V 0[0 ` >@P0 00# $ 00`00@PQ  $?@0@,Ѝ 0S S +$0C@P$($ `X g}Eccx3|0S/@-@h3/0|0h0O-a4M00PS@o!!0S 0081S OX0T P30_,00000>0#6040080>0#60D0>0#6000<00@0080S SXO0!0/1000L09L0e!5@ 0 0  s0PhpcW'gpbWL0<L0X0P . .`1Sp 2pP0  M0  M9p8W  p/:q/:!0R  p!U;T0    [0 x 000[  [ 0T6p30pGor0 pPGg l0 0,03/l00S 3/Kl0 0$K(0Sw [u Yr 00Lp @07/ 0 03/3 0000  0 0WpP 01Q 0 03/LHZHH X h# aHX tpP tP 0S F*p)W   R 2/pP+$R [    pttr/H`D1S i 1l0q 00S p0S?$@G$0p  $@G0tp0P e 1S 8 R l S 2/l0 000S 3/l0 0 1l !D03/<10S ,ZGZ,GZ%0"# " pQ #RKP0. pl 000p@ p p $pPM"0 0Z000C0/mXk0 &3` 0S L9p4ЍWWec@ccFej@B|Bc0@-_MP P@P0 |_ߍ0@-(000000 0Ѝx3@- $0000000Ѝx3O-dlQ/t1S 'd R 01501 a 0Z0C000000Cl bV [(e0 0 BO\l\|  Yi <u&  +\1 P 0P^ 0S 0S5p@ 5 =5Jl0Q QM00pO `<C?;x0S `\8De@Bcce@c@Bc@Bp@-a@PP0   DO-M00SP؀  ᮓX ᨓ`\63q80S0r ZYY1 `x0  $ S,0O 0 0 0P,*pD P $0S,02 H0S5 `[,0Z R3 RW ,@/0SRP0O 1P00000C0X000_T-0S00S% `P (%@H0S PS0,0,@T V5  Y4M &P0 Z0S 0W 0 P0P0l0 `0 0ЍB ,@Z0S0S5@ 0000C0X ?005@000`PV``0,0 ,0p0WZ0S000VP0830NP0 Z0S000W 0 P0mP p0W 0  0`P cVa `5lP@ 0U 5 =5P@UH2PH0@S 0  0zK {x|p(<(X<((X<0S X (X (00020Z00S   00C0p0St t ' `%D% a P,a=(k?P 6D9 LH rpDA|%0 S Q R0 400``0 o0ZQ"04P B+ 0 0` ac@cc@c8Dec0@-q@M QaT0P0` ,0 2TP X oЍ00@-P0dM 0 0@S0 0S0 Q  6?o 2Q0S X 6dЍ00@-@P0 SMS0R  0 0 0000Q P 6Q P  6?o2Q0S 6Sߍ0p@-5lP@0U5Pp@0`P * P5<50 Spp@@-X0C50S[0  K? 00S @0S@cWeO-`$10|0L048<0L0 !80 !!L0?! 0  ?  0 0 ?002P DP  qD <0<0 2,0S;,0[0000[` P055 l`0<10x080C4P P0$(, 0P0KT0T0(q= ( fd 4R =0c?0h0d  0400h0$  0`00,00?. 40!! 140S  3/B10 0S [0[00[0x0Sp p0t (0x@tH05A ARX B0BSl|505 V@ R ilx~$j:mB0BS  R`0@1d0Sd d0h 0d@h02 R @0@}[ 1\D03/2022! X! ! ! X! !20C22S X 20S QP1211S T0  qp(Ji?p4P0) 0 0Z 00400 [`00005A ARX B0BS5(A0AS hPIx 04pZ0YB0BS  Rp@0S5D0DS Y Y +IL4IcEcucGeAB PB#AB*ABB@B8De03cc@ccWe@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC 1娸@Jh@00@00 00 !!0400000, !  !d==P 0 V@0 e=P;=P3S @cJdddd@-@0M 00000 p0[P `6P00P0D00S 0 022201Ѝ3ABP3;AB@vcA-`|p0PS d$ @P U f= p0S0@U@` =ucH3p@-P`@0`S LټT G=PUTpp@=0 3/ucH3@-@0=.=Gep@-PP@ )=0S   Upp@s= 0uc@-0@0S R 2/uc 0vc@-(@ P0S   uc$0 0S/ R0/0uc 0_vccc zvc 0OvcGeGe jGevc 0>Ge vcGep@-X@P0`S @78<@Tp@ <03/@ucH3Ge 0vc_@-0@T0 3/@ucA-Pp `4 @P  p `/o00 (R $@ @0@0ucUABvc R 0$0 1 ucPA-@`!PP0q$0开0PU(0(0SAS 0 0 3/00PTp PDU(0 S 0 0 3/Puc@ABABAp@-`P㨷@  `  n0000p@-@P&@㊷0S   傷G-@`X %0p013 0PUPU'1Y P 9/0SYP  0  A0PSU0P6P PP@cA-Pp`&@ ``p0S0@@PA-P`@p~0S 0S   A00 00SD0 3R W@ pA@cp@-@PP@Tp@-@ <@fGeABO-`0Sp,M@PTX bP ` x` 000000 00P0 00<00 @@0`P a,ЍZ  囶$ \0 $$0w[?p`p  cU 0S $  0P 212 2<22@022 02UY 00wc@yc@-0C0P $p!Qdz2  TLP1S  < ,$M@cABABGeGeBB0@-@H0018,@0S ЍGeGep@-40CpP0[;P0UEMp@cp@-@00S^P00#;#P0mTpp@2M@c-0 0/@c(BB 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd00S/A-@`7ăPq3PX`00S .P P  P4 0,,( $ ke@ccPBB0@[BBiBA3?B0 0 0/cGeO-`PC1(S 01O000O~㌐0I0SOa岀p @n0S p0I0SOa岀a OL@ccDcG-餀PopWUpP@@ t@]!8R#8 @L A@ 0B072S S B! 0B0+@cc0@o/c 0P/, @c0@- 0D0R@00,$00P v @cC-p0MP0 0`` @ƞ0 P 00 000 0@Y?o2P0S  R ЍDc@-@08M@@t0 00@ 00@@0@8**0|0 0000,00 (00!P0 0H0$@ @000'> @00t]8Ѝ@c03L3xBBcDc3~BB@-p p@p@0@@SC 1X01t@ Ht@@ <<80,@0@c@vcwcc4BBwcBB(wc@ycA- 0b@SPpb~b0@X4100S R0 !!04L0H0@000, !  !@cddd@-@Q't T 03100|P0BPЍvx 00SP 00S t T0 #!R`0S@cc@-P 00Sp@-P@PpTUp7@-P@t~00 Ѝ07@-P@j~00 Ѝ0@k7@-@00PP 000U [ Ѝ000/0@-P0M0@ 000TЍ0C0 0 @=P 0 P QRp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@R?0S P00 0000@-@ 0  R0Q@R  R 0CS3T333@3@3330S@$d0  6p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3S}@#,@cp@-PP@W j PpP0 b  BR,3333,33338P08P0P0 Q8P0>Pp@-@`Q6 P08P0Z0S P0S 0 000C0 p@]Q41041/41!0CS41/p@-@Q p@Dp@-01Q@101`41Sp PP/@P/|0S/@-P1SO-餓MsQ[0`J`V  00 0C0`>8ATN@ 0`` 081S.8AZ/ kNh`0 !0L @0;/2 00  00p`P PЍz 8APU 0R `0SNPXPܡ  2/0@ ! * 0 0p`P Xܱ  2/ `0*i`P { 0*'rXű 0000@ :0<`00S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10<2020 20C22S) O&@c#Dc#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S 3v20{0u1 00$_V;0 0 `!`0  0 0 0 004 00 0(0001S ! !! 1 00C000C00100C0 p]  P g P3;0S :Zrp0S YP 00$P ɰW5\W,0 eЍG@yc@cccO-PM`pDT 3RU e@u,0 \ *00 0 0P 0P u6 #@T  ᠰ5/ԅL h Q4p 3 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S L0P0<P0wFp pZ20H0S@'1 1u[X@00#A[ ̻@p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S 0P 00=P 00S t |2 x p@0@@SC 1\0100e 1<0SЍ3/@ycc4BBBB@ c@cc A-0p3a 8Q@T0S 00(o ቯ081 0*oX}@@cDc03hl2/@cU@-@1 0S@oA-Q 2@s 0  BR 800 1@0S 3/ᠧDgo 5P0PS P0   1hS!!1 !   P01 P  !\> @P0#f0$ 0P+t00C00S   zGUWM0 _ lLX(1S,1S |`V ;k:La僕@ccBBBBG-@QdqMP00`P  衔2 ~P03P0(f ᶼF7S  x>PY p@ ᩴ 00C0 F 0  L $  0 000P00P0Ѝ O-`pA000,P0   P   W| Ps 01P90\+ W !W V$ 0QU  0OW(!0 R (R3 \!Q, QB V:  R \S; Y.  ϿPW P (1 S0(100C00,1 R0,1(10X 0C010hu \  0R P剿PPu PPA- Pp`3@2::P@1@!<`JpPP    0@D@P0Q @@p@-@P0p@S@p``FSPP  }@  B PR / t0Q   0RL     / Q xcGep@-P00@Tp0 P @xcp@- P0Sp8 P`@N0 QV E Pp!!0p@-P@9@0$P0pGe@-@000P %@@!GeC-MP00`0p0 0` @0 P 00 000 0@Q?o2P0S R0 Ѝ7@-D 0`P0PP0@EU Ѝ05WBB0/Ge-@-,00 ЍЍ/BB,AO-P`С,M @TpPP VPp FP @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #c0S 0 PP 0x P a0 000!R00! 0V0C0@xcBBGeFCBCBO-0p@!T?Tr :P `1 !R  !1 `Vp〱Y `10 V$PQ0T0< `  Q      YG@10Q@Dp0 劔P* `0   `P 0 0 Y0V `P `T@̫ Ѝ`D@xcGeX@CB7@-P p 0.@P X Ѝ0Q000 $!@ CBCBCB5DB-@-<00S 0,0 ЍЍ/cqDB,AG-`2Q " @PpX  p$0S00SpQp @W 003/pP  X 03/p80S 8V$0S I0 0C0!R 00! 0S% P $`X!P  Y0000000@0@@000000!00C0DBDBDBDBDBDBGeEBxc=EBG-4Q4q `#,@T /W 垼@$0S- 0* |<0P000@03/ P R00S $ 70S (0, 0 @Y"P<000 @ 0"  Gexc3eHeEccREBpEB0 /$/@-@RP` Ѝp@C\0 0 00 0P Ѝp@-Q`M IP0 ( 000@P @P Ѝ藹Xp PU@ 0  @P0P S  !  00C0xcGeO-DMB,0RbS20,0ѻ 0"0@ 0 R"0 0 0000|"| tt圷pBT:0(00p<`@PD"0  < 0A (0p,`$  ?o2P0S 0000 0&P0S0 0Ѝ@-p0 0  ^8 0@0000@00C@0Dcc@-@TZ0S[00[0''d@ p@-81M@T-  TQ Y 0  P@@  `  t!00P E 륷0 x0@Q 0l0300@ @@ DDЍp@葦@cIeDc0uc@ycOBEch@4OBX4];B0O- a 000p(P$@ @A0찟,00 000p(P$@ @ @PA/0,00 000p(P$@ @ @PA00,0`0 0X0000p(P$@ @ @PA<Ѝ{cC4OBIe\n4 PBOBi4OB000/00CS0 HKp@-@$P,DU ᑘTpp@(㋘c A-0 0 2#@T 0PSpW Ax$`p0S RpP$ 0RA~@TAYDcce@-M`pk@P00b 0 0  00@00T0S@1 0 0S r@Ѝm 0S 1S Dc@-@P0`0b 0 0  0 0 @00T0S@e 0Su@Ѝp1S1S Dcp@-P`d  0 0@0T 0R0S 0S @P4Pp@QG 0ScDc @>D 0  !"P/ R0S//DcQp@-@ @PXTd0P1@0P !0@@T@Ipcp@-P(@p`:pcp@-`P,b\ T `@00  RAP @ppcDc `0S  0  /Dc 0 Iep@-@Td0QDSh h h0d 010Sp@p@ecA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR O-S0@` (`p0Y,#0 0+Z  R` R8 LP P`Q l TV7Q R pP Z RL  \d PW ᰖ ЍQ@ZSP0QS  Rz Pv QV >P(጖oYQcVZ U Z RY Z&PU V000 ` @ $   1 00001@ [00[0`0`p `p  d Rhhh d!QPP Rdd h@hu PVu $V (#PpPIcDce@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0cp@-L0@3P1S P0 00SfP000pp@cp@-P0PSA,00S 7aPpp@@c}cG-0PPpa|@P @T P03P0ATAU [YL0<L0FWᔣTG菣@c 0  Ie08Ie0@KIes@-xR   @ 8 | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/Z  0 R0d1`0S00#0H1``0S/00 /0 f/6& *P 1:f@ 0$j0`0/0? ?,0l`00000d@嚱t0*|`P4  IЍp@Y@ycB@B@vcIeycDccc{c@|cEcEcDc}cJe>PMe0@図Ie@-H0 70@Z07 pY@Ie 0 @壳Ie0 @巳Ies@-@P_`\VX`YVW`XV 00N \P0SЍpBp@-P: R@*B B00CSY4Y4 Y4Y4Y4Y4Y4Y4Y4Y4Y4Y4Y4Y4\Y4 B # p`V@Tpd02S SL0 <000CPPp@ycEcp@-L0@P P`Pp@N+ p@0.x 03/@pcO-TM@  0 000N  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Pv 0?@P ?0 QF S  QR03@0B  x0p00p0P >p00p0>p00p0[>p00p0T>p00p0`0t0<1x0JEJE@Co(0B(-R #办- . A. 001Vq1`00` Fd`>1 1mR2| qV.|00 0 Z &h!Z|2x1[k1"04P B+ 000 0z H 1 H0/h2p0l"/`2 Z0Sz pCSWppp'pr00 $! ! ! ! r"&" 0r &0B28V0V/p2t"0 0p0`00` d`> 0,h1P=p00p0T0000 0S00@00ip0j10S  bG0V100`00` d`=00  % |0 S)W 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0q{ PNm{10S7 $0 |01f0010 0Sh00h0100Sh00h01JG1 0=[0 100S R  V 0X00\0`00` Xd`x=Z 0BRS000#0s-( (!!( 0!!0 000X 080`00101 01(01({` @"D !HL  $ (,8"04<(X0h\ l00  ` p  R00=9B =C00P20T2Ѝ0`` d`< 0` `00d`<$0` (`00d`<(0` 0`00d`<,0` 8`00d`<00` @`00d`<40` H`00d`<1` P0d``00< 0%(0` ``00d`<q qqqqqqq  ppppppppp1p00@@@ @4@@@@B@-`P@v1S0 PЍpwP`L0 00000 00㴞PP v 0cO-Q4MX@dp|4ЍOy8QT@@Z`PF J[o@QZ7 @PG >0 0O0$@ 0a;00 #V@ T VJ 0 Z 01s1@P0Z@@y 0}̏6  l@P DATy j@64ЍEvV 0X01 B1@P0X@@y M6l P% [00 @@0 0 P@ 3 VJ0700Z0 CSRL0 @꒟ mP@0J0 2@P Z$0,0 0000@0 00 0p`5@c C4C-M p @P0S !PU  A&` 0 :s@P`P Ѝ@@-@0 000 0@0㌝oЍO-LM00|0 P<0H<@3pp U%`v <0 p|000xtpLЍO@70$00S$0SVh SV000 0`0S0000 00S$0U `VUU00U@誯00 005 㧎P 㢎1L0:p@ 0@A400(0080T(0Sy :ATu 0(0L0SZ0S 0 000<0@ 0P ! @ `VQ\q4p4q4q4$q4u4u4u4v4`PP110$[0x0S 10 R 0S(0S6 0S0p0p@ ,00S.0$ 0S0R0S&  $0SY ! 0 000 {c00 uc qcY 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@QcH0YH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0 d0d0h0h0l0l0p0p0t0t0x0x0|0|0000Y0000000000000 0000000Y0000000 00000--....////1Y1 1111 1 111111111 1 1$1$1JυJ?Y$ 8181<1<1@1@1D1D1 RRYw1 1QwY 11222/Y22!2? !. (2(2,2,2 0, |0 S 0!4 <.T[ ,0SFS 10 Rx ?RQ X 3( P(00 )9  Xb0  90  90 90 90  90$ $90( (90, ,800 0804 4808 880d d80l l80p p80x x80| |80 80 80 80 80 80 80A/A80B/B80C/C80.80E/@8@0F/F1080G/G80.80N/N8<1Q/Q<1@1@10y80/s82@0@ 0 Dk80g8(2/(20`8 0, Q00C040 040 00C 080 080,0S @T00 V0S  400C0 08 S * @800 U=0 2 LЍ0S   @ccc1`00/1`<10/1<10/p@-@$Pa?100zpcp@-PP`@1V11 P@ 10$00@apcp@-PL`@V11 P@ 100@Ipc@-@Up@-P@MLp@-@E@-@Bp@-P@:9p@-@2p@-@`PZ PpR0p@rpp@-@Q0` L`00p R0Q`R >/O-MP`8MpXu@;vux fM  Puv\ܖP Ku ϖP ˖OO널I–iO OƖx Ŗvc _  ᮖP @ ᪖P  0 ]P[  ЍᑖPvxቖP ၖUv }Px  rP  nPePx|uvr ]Pn Θux] c  IPf   EP_u :Pv O-MP`8凘pu@'vex :   PuvLP ᅘu x vg c  P @ P  0 媘P^ c ЍPvxܕP I3ѕUIv ͕Px  •P  ᾕPᵕPxuv ᭕P~ ux᭕ s  ᙕPv   ᕕPou ንPv o@- 0  x Ѝ"0@-00 n Ѝ@-0t`q`@u]PX$0P 000S Ѝ7@- 0   Ѝ"0@-00  Ѝ@-0t`q7@u4P/$0P 000 Ѝ71L0#400/s@-@`l00 0PI@PЍp@ʗAЍp@-@PT@#D`qM1  s Ѝc0A-a(M 000` 0Pᚗ@P p0 @P ?T@(Ѝu1P0 ` $0R  bP 0p0z/`00 ݢ0 00>cOB(0310S/00S/㞷@cJd@-d03" " R @" B"2S @'@T*P @cp@-P@Tp 㪈000000@p@-\03Q0S m@T 00@ ㏈T9p@cG-@`PT1 TG TGUE h1*FRA:0CU= op81P3  1 0SP| % P$ V* W%003A } @T@ 0V00CS  @G@@ -@00E "@@c|cA- P@`N70 0S\Z0S=Ɍ ͌pWX 0 S RQ   ЍS@-M p@`P 70 0S ^0S PQ S 00U0Us00Ѝ@-pP`# @P∀ 0 |0| 0 00 h0 R\0Q _K0 M$3S@c`WeAc4Dec ket.  l.00 0 4,p(P . 0!0. 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>͟ 84 0 0<0@,p(P$ . 0!/>4, D40  0<8@0@,p(P$ u. 0 !, 0   84@0@,p(P$  _. 0!/>x̟x 80  0<4@0@,p(P$ H. 0!/>$ D0  0<8@4@0@,p(P$ 1.0 400 !+ 0   80@,p(P$  .0 400!/>\˟\ 80  0<0@,p(P$ .0 400!/> D0  0<8@0@,p(P$ - 0 !* 0 4  80@,p(P$  - 0!/>LʟL 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !) 0   80@,p(P$  - 0!/>4ɟ4 840  0<0@,p(P$ w- 0!/> D40  0<8@0@,p(P$ _- 04  !( 0   80@,p(P$  H- 04 !/>ȟ 80  0<0@,p(P$ 0- 04 !/> D0  0<8@0@,p(P$ - 04  !t' 0   80@,p(P$  - 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/> D0  0<8@0@,p(P$ , 04  !\& 0   80@,p(P$  , 04 !/>ş 80  0<0@,p(P$ , 04 !/>| D0  0<8@0@,p(P$ , 04  !D% 0   80@,p(P$  s, 04 !/>ğ 80  0<0@,p(P$ [, 04 !/>h` D0  0<8@0@,p(P$ C, 0 !4$ 0   84P0@,p(P$  -, 0!/>ß 80  0<4P0@,p(P$ , 0!/>\T D0  0<8@4P0@,p(P$ + 04  ! # 0   80@,p(P$  + 04 !/>Ÿ 80  0<0@,p(P$ + 04 !/><4 D0  0<8@0@,p(P$ + 04  !" 0   80@,p(P$  +8 40/xx! 0  <0@,p(P$ + 0,$4F! 0 <8@0@,p(P$ s+ 0!/> 00  0  4,p(P$  @\+ 00/! 0   4,p(P$  @G+ ꘌ4];BPBdWel4%PB48B.PB5PB=PB̯4BPBGPBPPBYPBcPBPBpPB7B}PBPBPB~BB4PBPBPB0! 0 0  4,p(P$  @+DЍA-AP,p`0S S% S=V Q@TAV HP )@0S)T @D@!d0T@V`)@\0PU L0S `峍P1T@PccA-`Qp@H0S S0 STT PUQ 8 @q,oT P= PU@. @WT"dPTc0PU L0SW0P =P r@4T ,/X*@&@cc@-` V@Q,  Hk Ѝp@-@P80< 00 #3  0 0 0 004 00  23 48<0@S- 0KHL 0 P030 0 0S 0 @0 D R0 0``#`0  00000 0 Ѝp@sO-`ᑿ0|0@0C0000   0 S p@vcEcC-@`Pᰐ1qS21 0! 28. h R R R ' 帗EX0@00P0#*1S0Ap@0 0@00002S000000SP ЍC D000@PBJd@-@_0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@F`　T`W p W 3U  G%1P 0SJd|c@cp@-@P p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0Bp@-TPCu%0C0\0(@T@ 0S 0AMCdXp@c@- 0!0@@@c0  /QB0/000S/@- 0 00| Ѝ keLBb|cd@00/00//O-H`Q@S 0p0202  [X0F3" B"2S1 ЍOp `00S<<0 2X <0 40<V 00S 0 Ѝ@ct@G-0P@s ppE EY  UPa<`P WVV `XüE 0G<E0 XE0 @cQA-Ppp `D0@c`  TE@@cA-PE`@ @V` <pX0# @< S" V@0 A<<p@-P @H0c   0S@HEp0 S p@cP/0# S/P/ 00@o/@cP/P/ /p@-@Pz@0000p]Ӆp@-@P z@P 0000p]Ӆ$m@-@D)mPD@%z/O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` c0 P 00 000 0@?o2P0SH00S 0 00,,忒03/P 坔tWe|c@XQBsQB@-啔QB@-P P d``夒PTL埒 Ѝ (,啒吒xWeQB@QBQB@-e儒@QB@-@ xx{t4Qڀ  !P H@, ! _@QB@cdddRBA-@M0s' p`P@T#0@400000 ,00(00!0$@ @ @00 000'>0<0!@P h@@ЍaP p@<0W(0 00PSP|ctWe$4xWeA- @M,F(1 000p<`@P0<0A0,p(`$  !0P  @Ѝ<     '.A 0 ,p(`$00 0! P P\ΑPT@<`PppP  ‘PU@xWe#RB@+RB|cZRBiRB|cRBs@-`P 0@T.T0@T  S  0D 0 0 "P $Ѝp 剑tWexWe|c @RBh0#(1< /@ ρP PQ00@0!!#/@c 0S(0, 0 (0, (0, 0/ B@- @ 偄P 0S,031!10P@cp@-P`|@Tpa 0SP0 `00C0kA@- RMp@-Q@Z0S P0S00C0>0 0O60 Hp@T \/ Wep@-@dP:F#p@tp@-@803Q 0dP 0 0)Fdp@cp@-@00C"0!300 P p !A\  Q` xa000PUR0(00@@@#p$0P @- /We0S co `/P0`o@`/0@-@0M 000@0@@@+0xP 0l00@0@ @@xDPW7 07 ((Ѝ0@豄4SBcSBcd44];Bp@-4` Q[ ipT0國@  0P8+``cp@-@[AiPpAo0p@ 妋cp@-4`8SpP0P k@  S+`084@p@c0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@c@p@-@T 0 R X0 ݊PP T x @`0000@pt K0c0 0S/0 cG-PPp@U3P @T( 0`S 0V00 U00 t  _V  0W` S `0W P x `K0p0p@-@0PQp R00  㕊c@-@P`P" RS . 0 000 00 000 00 0 VPP  E2 1"  yP0E"0A 30Ѝp0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@Mh04`pP(0 000"!       P0?S$P(P,P0P4  L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ@@-Pa@? i?,10!(1T00!41  1 00000110010 0 p@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0i A"10101A-0P`q S( j@ T  0,@P 010 10010-A!  !!! 1P $P ^A-@ 0S Pp`P0 8P0@0D"0!!#  0SW00S@ p0>S? 00CS'444,4,444T P@G  0 S 0 0000@S P@@ -@@O-Z0M0C21@S FP4 q<00Jp"@03 [P`+ q`P -PPP  !QP PЍ! 1 0S P 1PS01ą`$ 0 00 0  (  0S @1S Z RP Rp Q+  孿0P pQ   BV 'V  `P [0  ᒿ@P7 gPP> 0 B "Vx1Sp` 0;] 0p!x!ZR|||!xȅuZ0S*P0SU =|@T@P`?o22PP V Z  R ; 1UP0/1P0X Z  R  ZS 0Z0P0U1P0Q 0Sl 00C00 0P?o20SA Z1UP0 @ccG-P葐tp@LU" PX1@T, L0S` ZR`: 0  ``GPX Pi@T P^Ѝ@TVU `0SL``  0  ``P X Z0 CSRxP4d@ccp@-xM@?x ` PG0U0000`0 01~(0$(P lP, 000P0 KxЍp@-P0@1P00Z00l 0000l@ ÄA-`pP@T L0SP0S@0SPUAK2cccG-1`pAZ0PS&\W Pki0SP0SP<0S|PP0S G0 fQU 2@ccc0@-|M@t P!G00P. i|Ѝ07@-P0@60#R00SP  0$100\ P P P $ Ѝ0@=A-P`p@TW [0  d@p@-xM@`Pt F0 0 0`xЍp01 10/O-1M`p0ApPpXP0  @4WSO54c@㇒) l 0R[0"? R (`pap0` 1R[  PZ 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOYP k` 0 K 0 0  2vqЍOmЍcSBO-p1唑|MSA僿P0  ZlXXO @X岋%@M8|ЍOI R (alS ? t E0! Rp 40堀尐1!` p$VZ0  [Wphp`0STP 1`@T 0c/ 4/|Ѝy@ccSBp@-@HP`50S p@@!p@{cO-`PA$MZ0S P R 3Z 0 1SW [i?Z!00!00000!00000!00 0000pPWJ?Zn @3         0000  00000 000 000YP'&P04P06 ` ta$ЍfP @ p `3 `X2         000긕@  5@0goG 0J"0!!#V p Q; p0` 1RiY J2  p  RT Z [ [  l P V1    ? ᰠOP. `0 !402S S1 pX 㨑D0HL1`0S" W[0  lP 0 E?ⰠP0  1P0!\Z c@A-`@Q` 4R{pnD~2! !! ! ! !! !0 0F"0Q!V31 $0110102A@p@-@P0` $͈` 埇p@ SBSB@-APP0  %P08P0嵻3q͉  iS!p' :P0|`V0S 0 00# 800C0VP08P0a7P0|ᇻ/000X C 1XHqL1# (%P"  03/`.00S$ P (zz?V` 0 `KP0 :P05`L;P02P0V SBSB@cP}c@b@C-@1PC|MT!atR 40T!md2cX0d201S" H1Sx  vC` RW1嬁p0P  1 ` X 0 8/qY* gP  0  ~|Ѝ@cp@-@ 314020SS`@P`Pp 03/p@S p@0@ccTBp@-@P@`cPN@  03/@kpcp@-@P@`OPN@  03/@Wpcp@-@P@`;PN@  03/@Cpcp@-@P@`'PN@  03/@/p@c0A-PpZ0P01P0?`0Sl 00C0|@T᰹ 0SP0 ό Rb AV  Z ` p000G-`1SxMpA 1 0t B001Wpp00 0 0$00(00,0@ 0pB0( S :|P0  ᠽ0 R (! xЍ%@ SY`40` 㠐p0`1RV WP 1 `@T 0c/ 4/@c!TBA-Pp@ ᦹ0`V S R @0ᕹXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/@cdddA-D`DpP@O0S 00U@`00c|We00/p@-0@00S00P00R -  P 0Q 0 p@$bb 0 {&0C0d03-P K030 0`Lp@@p@-P@fU ?Op@-TC\  P 0 P  &{`@]3@cp@-@P R` P0==Q`PP0  p@P0=P0/C-1Qpc0S@ XP0E 4< <> P0P<7 P0P000# #$ "X  q {P 01 QP 14020+0S   Ѝ<WP0 @0P0+00l00 W+P0@ #@cWe@A-P@`pQ 0嬀S @TAp@-@P Tpp@@-@ᇷ0S ,0R@蒷P0@0P0@sP@p@- @dPVʀ0!` 0X P   !wuTU p@cdddpQx0tS|0|I 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddG-pc~ࡖ 101APU0 0 0 0 XP0 0 0 0S@00:#003/@cG-@`pPԠ ,1{?R 勃@P @ zO |fP`P\00S 0x,!##)" !qaZWe@c0TB5Jdp@-T`@,QPP g 0\$V ,10 p@@cWe!80<080</A-`@Qqv_X` AO-x@P$M0H0`00@00 0 00 00000pP 0h 0 0 $  |01[0p 0 0 \ @ @0![0 d00 $ЍOpTB4zTBtTB3?BTBC-Q` xAR0\>0>00@LPL߀?9ATBA*uB UBUBAJAUBA-83@M` TV 0  n30S& *PP B0 rs #eOPP  <0"0 !& 0! "ɀ @PPLPC`LP>PLP9D2,b0`L@L7:!#:  : 000@0QwP1qL喃bLPLP LP?a⁃xЍ>@DT>Tz HL kO`Ps?LP@4De0cWe8c UBUB*uBJA@c+UB.A,Azd@&UBO-@0pSM800880S OP8 830:PP>@VHPP t8l.OP0ST KP//00 000 `@ hT KKP KPKPa 0?oT20S K 0{0LQگ0 0RA*S 0 0B00 0+PP 0 00 0"PP & $00PKPC 0"OY NKHF0`P;Y H&0 *t6 006 #:: 0( ,0 `586000S ~?CS 8e/00%000b#a 100@KP;KPV0lNPG   (00`P l", `500Y7L H~0%P8 $LNP50J@PcJJPJP JPP4?a4PD`D R NP hPP0NPP00NP 0&G0P D R~30S ~P0MPD R 0{~0h000.q~p30S ЍPTUET5 fJ MPP.UJbPdR)JP$JPLJ0w0  cRW >J 106!#: : 0000P,J)J 6#::0K (0jPPa& "  J@PWJ6JP6JP x1JP41h?a P1 LP p}PUv^ 0P0000i p0 02220l0ʮ@0#0$@0 1S3x0 02P22 0S P @pSeTTp0 0 0SP 2S(@LQ222@0#0 0@0xQ282 @cc\}cWe@-0C6@ @c@-(0C+282@@cG-pȁȡCRU 0S ,Q t!@0D0@0D,2@ ,dVʀ 0! $!0!!   !0S0S B 000FP10 0 0 u282202+20C2@cdddd20C22S/|@-$02020CT@c@-P@[0@cp@- @0BQS$H'5'5H'5'5'5'5'5l'55@ ?0S Y000 R 0 0p@P08P00009s|{2R 0 0p@M0 Ҭ`'0 0Pp@EVBA- 1aq@T. L0SL00 1@Z R  BRl  00Z0|PU 3S ŬP0 P R {Qͬ8@, `T  @Aecc@cO-$3$#$c[3$M10100S0#0妼2@T L0S坼0p|P0U0"W50a 0S0z/` 0@yļ@P0Ih40\ 0S؃0$! 0Pz/ 22 y40T000T00S P0  0S 0CS M0!Q500 |* {Gd00500pQ0S,0 P: ^:pz_Pp0` y`0 QxQ   G0S LrP$ЍO000404  R4  000@>1t A 0st@@@ 0P 0?P8D. !  11W000PPP Ѐ 0 ( W# W W 000P`1PP0@p400 80<8`PP  8oYߍЀ԰10804 P00D0p<0,VP@B?P H1R0!sR u oPP1 00 400@ 808`cP8` `404SR40 8✦$@TR4`Sto` `0Yp8p @T2]@P @XPq0Sp1S X@T01X0| <?@Pt  ?X@070l@ j+00 0@0QS P0S p0 0R  R 0$0S !0(0, 0P$0 , ?+$0 ! ?$0Y 0(0 0 0S[ X Q B & 0 0C 0! 01PB(     P0SQ 0 P0S@nsP 0 0,YBHYBYBYBwYB-C-M0000P Uy 0  0 !0s  0PE( 000  0o@P iT@ЍCЍ/X X` p *4X001 ``\    p @`$0$@VBPP804 \@\CRQ f%PU Q@R0 0P,@@`  R XP T0@;$?@P 0$ X> 0 X@' ?@A-`t1V`04S %nAPp`8@T 00S8@P .4p0p8pPPUV  0P 0p0 XP Xp`@4 802#T*0 R0 R P8@Wep}cYBG-P0 m0 p堀堐堠 RGm sA S shmT  m@m@0p`C m@ZBBXB3AEZB=@-@[B1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0|0 0|0/p@-H0@PP0P0G0 0 0P0 R00p؁cO-@P`pLM @3 P,P0p[  R0P0LЍR 0P00R0[0S@p[V$00 000P`(H000S S S@ p 0R 00@ p@p 0 000``8L00 @Tp@O@p@ p 0 0 T0# 0 $ 0 # $0 0 0 0 +0(00 0 R 03# (0, 0S (0, (0 0S(0, $0 S, 0 0 0 0 "^8wP0 Re0 0000 0SY 0 0 \0 RL000 RE00000 0S 0 ;؁cdɚ;6eʚ;0 p@-d@ 0$ 0S 0pP PV0S $000SJFp@冪Ze؁cZep@- x6p0p@Q0}/’\ \#3$0SPc5 8@#41i03/p@0/ZeEcMbZe@B؁cj[B0S0/0C-DM@`p(00<  0 80a0,$@ @@ @PmP00H0000'>a0,($@ @ @<08 ZDЍ[Bt5[BC-Mp 0@P`` 堐L7t0 00  00P 0 02?oY20S 0S0ńЍ者c80< 0S 800< /_p@-@᫩@0`0@0_,PU 80< 0 ܩ^p@蓩_P^@-@PP@M@-P@ဩp0S 444a 0S@0 Z( 0R0000 ᤩ^0 a㎖^ 0S 00"#! "#1^P03 $103$!={0 3/60 00000@000@ccMbdEc@-g[B0p@-`Q@P0 =30`, eup430` p@eꆚA5B0H-@`,M0P0S@ XX$PU? ,ZU80< 0 80< . `P @ ^H D?Rp pӷ1 000P1D H吕p̨W  ` !0  t]@0 ]p00 0P00000p^p>ۨ器0Sᔨ 0R 0(0 0 ,P0$  R 0(00$P 0ᾨ>P^嶨tv Q 0   Px^d[B[Bv5Ec[BC-@,MP` P0 $0(  ,0p@0000 HPD` @j]?U  t000000 T0 PP T]&,Ѝ%002^_[B\Bx5p@-@`PPK PpPK00p@-@X0M 0@0@ @@@ ^^  00@@Ѝ@\Bd(Zed0SA-@p`@T`iK Ps@P `aKH0V P@Ƨ@0T@SP P0PT TPX0\ P0 X0\ U `=K@@H V P@(Zed@-@l坧X0\ 0S X00\  @@ҧP04ST T % ʧT@`Kd0SA-"<p8`wPU 岧J0@!`R R0S rRJ Ѝ0V PPP0UPS 0 |0@ 0@0 T0 0 {T KRJP V P(Zedu5{5s5,Ze@-@p!0 0S 00  @DV08S   NTR@Jdp@-@QP Rpp@-@PUR@p0-@- p@ 0P` 0c0`00\PЍ@Ѝ/s@-P@Ӧ00`V  `[ 0  0Ѝp@y[w5\Bp@-@8P塖 3 $!尖=\00p@c0S/p@-P@<ឦ,0S  (0 0@0(0\p@Φ0 0R0000 000 @0S  Sp@-0P@0u 0R 0(0 0 嫦<Pv\pp/p@-@PPp0Sp|[@-@X0HSi@ jip0S/ R/h l00h0Zed @-($ 0   >0d0Ze5d0 ,P100S// dHdA-xMp`@T:xЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x t0000x0(0\0\P0 c0Ze0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0U0 0000 0@0WP H0L 0P0S 0003/(@ʚ;0Ze0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0SP 08jH \0AQ00\0`0S;,Ѝ0 p@-PH 0@   S%0S@#p H@@- 坥PdT@-@ hP &Ѝ \Q?/ɚ;0@-@MP P0 Ѝ0P@-@ P P0 L0S003: 0 Pʚ;ʚ;@-@ PQ  ЍO-`DM00  0hpiPP <UW 0 00 PDЍ 0S0 0W@0@C@0 #PP ?o2W0SuPP 5hPP 0$  0P0 ( BR %0Sk) ,0 0SHUJiP ʸPQ( ^0S (0 AQ 0S00  00S000 PQ ^0Q 0 AQ0S000  00Q00!\Bʚ;0@-@,MP P0S00 0EPQ 0 P,Ѝ0p@-@(MP` 0P 0S000$ PQ 00 00(Ѝp 0P @- R R S12S1`01 0 Ѝ@-0@SM 0Q  00   P Ѝ0@-R@P$M 1` laT U  P  @04 S#*/00$Ѝ0)\B@B@-0 ЍA-@QP  Qa0!`Ap0 R pW=) -` p`劣UFP0 S00 10\00 1 p 00 00\ @@S0P S0."? A^`HeZe@BZ{c /0Ze?B0p@-0M 00000` 0PU@PP  0P@0S!Q Q  @0ЍppC-P `0EQ@P XP\ ` z HUp0Sp0 0@S((0,0,0p0 pL50Ze8Ze0`0X00CS/@-@8X0S000S(0S, , " d@-@X00CS@P0@-@00S &R, l00& 00@F0ZeA-X0@0CS8WPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0dʚ;ɚ;6ep@-P^H0L A 0S PH0L P$0NSQP8@<`0@0SP0 HP80P00SP0UZ, @T` P H@L` 1ppʚ;@-P8@X0 CR3   R* S q0 RS ^0S 0 AQ0S00  00 +S0 00!Ѝp 0S 0ll RR H0L`00P` Q00 ʚ;ɚ;6eA-@T`P3V`8  0((bS \J S HL PH LP Q H !L P R 0@ 0aS \/ S9`p1S d`$V0SF 0SC0S@0S=0AzDHLp P Q 0HLp P Q 0HL PH TLP Q H < L P  R  0 Aɚ;6eQG-PЍP(0p`V W`'DX@ p 5/PP Dp0SSt00C>SDm $\RgD#P0SRX Wp W xt 0xt00  0xt00W W @ _ 0 00⌠A3 OPH@@-0 Ѝ A-1`PU 0FS0!RX00CS 0S 0SxxS 0mHHL@LpH@L@PPp^P@HL@P0ɚ;6eG-0MpP0X@0Ѝ0@SP`dPdPđġPAT@V 8H0L 0P0SJ X 0BQ!SCR  HdP H0L 0H P0L 0 SP0, HL 0P0%BS! e HdP H0L 0SH0 PL AQP0SH0`0 L 0P0$ P0S p@ S0 $0ɚ;6eʚ;p@-@HM` LP P1U(P0 0VPU (QHЍpp@-`V 0@S@@P!P pzp@-@ M P , Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 3!!04 ?A3c00?A3c0/Mb0@-@Q$M   P м$Ѝ0O-QM ЍP`cPc@Pp0 0[W 01S 100[%T B@W@pU0 @ U 0  0t pxP 00匀P@@Ϡ0H0L0P #0 RQ @ U U' p AT A!HcP H L H PL  QP H LPɚ;6eH@C-`PV@p,M0S,Ѝ  P0S K p00PV10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@Ecp@-@`Pĝ0SpG-1C0(q川@@XP`X R00G 00 CQ;Q Q 0d 010d0 0 01 C40dC?10d8 0C?Q C80d?10d0 0?#<d?10d8 0? 0000 0 00 喝 8/R @R 0@G@cA-0p @P  0 0S0 0 \00X00\0@\@Ag (aU0 000000墝P ` 000000\00X00\0@\@F@cO-@`pP0T! 3R V"0< 00800 80<  d 0 `j 0t ` W  ЍOМ 0p 0 ` 000 Ѝ@cP@b\B@-V<0 XX \   ` R`d00(@d@c@-(APT2 ,@@70-XX0\0 `0000Sm p0  gY ,`p0pt10 \ [Y L0`8i1:xP(A Ѝ (($0P[\Bb\B\B45'dj\B 00(1 (  S !$00/@c@d00/A-@p`Ptp ` Ap@-P@i p@p@-@a0 0  P00b%pp@-@PP0 0  0000 T  ,03R pBp@cp@-@`P/` Pp@6@-@(@1$A@@-@0@@%@-@@@@@-@ @A@@-@000@ p@-t1(Aě 0XP0 0!` \ \\dPd\`dP:C$ `ȑC\ \\dȑPdȑ\`dR&C!*`\ \\dPd\`dQ#0P0   pP   R    0Z HY  hH>A `0p%0%0Uꈅc@c@Jd`B!aB)aB7aBCaBQaB`aBY|BiaBraBp@-@P`0Pp p@0/p@-@`PV 0  6/0SPp A-0Mp00`00000 ,PUUЍ@0SP X 0S 0CSP  0R ,PP  @ꈅcZeA-`0P@p- Q A 0P1 P P ~0@-M@P Ѝ00A-P```pM0 000@TЍP@ c@@cp@-$@Pᢋ00d0Ap@ۋXZeA-X`P6X A/p/@,勋0p P0@@AꈅcXZe@-@<{P0 SP T0 0< X @T@<@@謋XZecp@-40SXJP`.@4Z00(0P `D  @D@p@莋aBXZecp@-h0P0Sp@/`.@4:00(0` PL  @L@p@ncXZec@-@L'P00CSP0 T X0,R( X0<0X0T (A@TXZeZecA-P`p @TApEV0  4 R S   6 03/.0@XZep@-@$P@Hp@ꈅcA-׊`p刀H@Tpx R0L0  P 03/<0IH.ᴊXZecaBA-0P0`SxpP@ 6/P0S 0S @T%.@T0` P0TXZecG-=P儊A威80S-彊Q0SL`PPULV0\a0PPJiCT1@0 X (c0S (PG囊T1TG!  G~= @0R:<R0P!``!6/Р8pW 6//0t"#0? 6/Tp3/P0 3/P` R0T0  -XZecMb@4DeaBAAaBEc787aBA,A$0$$08S 0  4De5`ZeXZep@-@PHT 0S 0AT 0 0 @&p@Jd@-@Lw.G-P`؉։Up夀0S@  0 @T 0 0d0S\0S #S`0S $>᫉XZe@Jd@cZeG-P `p@P8H 0S0 010SH 10SD FVCBH=bI01,XJ}0 03/DdL\r?0埉1 [P`嘉V<0H;SH H IW 7/pP 0R  FP0 4S 0S p@bBXZecxbBcZeaBȅcZeqbBbBA- Mp` P @P 0 P@ ЍU H00S <00S EF5/01,HXZec@A@-$M@P8 `p0 #$Ѝp@-PM ` @P 0S0 0,0 03/8墈00\0> ܈nЍpXZeZeȅc L0)-XZeG-@pᅈbP0S`PU23`0幈tu0 0 \寈LmP`P{>8娈P0=PP 埈Ѝb 00 0唈50S0S<0K 0SH 3/PPD0e0<00<0:x!L0,ht>4P 0(0S 3/,Y.0S   H0`0(>U 0U0C 0   S($0S%p-P  FP  0R P 0S0 4S  +00XZe@c@JdZecAbBp@-@Pp@>@-@P 4@-@P +Ѝs@- P`@P 0 0@Ѝp?GbB@-@P @-@qP@@-000 Ѝ5@-000 Ѝ5@-000 Ѝ؋=@-000 Ѝ= 0Q/P /@-00 0P Ѝ5@-00 0P Ѝ5@-00 0P Ѝ؋=@-00 0P Ѝ=0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0<0`0<00Sʸ0Sp@<;@-@0P|0S@/|/A-`@pȀ<0P 0S#Q003P0 000;00C0<@cp@-@Pᘆ00CS00<p@Ά//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0h@S qe)0`S0Z 3 #pG Shl`T  P) P0!!00A-P@l`hpT1S S@ R Th@l@A!)1GQ @p@-P @nP|0P $    $  PU  U p@p塅Q P  80R 0 Q P 80R 0 @Jdcp@-P?0 0S S, S@@qp@P`F``V80S@@P``` 0V80S@@Jdp@-P`@P P p@@-0@Sl00@G-A_P 0p倀0|` `@lT CP CP @CbBMB@[eMB@-@9@y@-@0幄,0@T $  B B $ @@Jdcp@-M` P@P U , >DЍp R 0 R H0 QS0  (PPPP ꈅcbBp@-MP` P@ Ѝp U @P C-Mp `@T ЍTPP<88@T V p P0 W 0 Rp@T Vp@V + +  S}0 ST  `ۍЍXT 040 0G#P@03/fdB`[exccdBdB0/0/0/0/p@-@P0Pp$ P p@-@4P 03/  00C 0p@#`[e0/p@-P@Ppp@-@P$ \ b40 0pdB@-@Z@4p@-0 P@U0000@0@00p@p@-@PE`0S0S00 R00 00C0p@qW4A-@`p(000cV P00CS0'5TP U P0 3/0PP0`$0 0!0 00 /@cdddA-`@MP3 `0Hp @00;tp" k"07 P <m=8 h1 S(0Z?00ЍtTBdBdBTd"0P 101S@0T<@0 @0<) 0 @  P011 R@0 0@0<@000Q@  S  R@ 0  R S0S 0S09T 0S@0@0@0T @0 00000 0 0SЍT 0S 0R;`P嬰  0:p6Z:@Y q Wh`:V HPZ/ЍO:@:Jd@cYeBBeBeBTeBOeB%ZAceBcA,AeBeB-PÑx|0x|120C22S@c@-82cM0S-$$] cߍbpTUʀ 0! $!0!!   !.W@ 1200Tcߍ@-|!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`-B(xJdc[e@cdddh[e0c@-$008 @sM$M ЍJd@-0( 0 08 <MM ЍJd@-(0  08 @MMЍJd @-!{ 0JdJd@-$@{0 @T{JdJdO-|2,M@T@ hPd{50S L@{%@,Ѝ05040 408080<0rH<0@0@00$` RS0 {@HQ ',A BR $ Q* \c"T0H0HLL$ p0Cc#H00H000W:0HZzP WPHL0 0S 0  BR %0Sk) ,0 0 0{ 0h?B3cPÿZ 0$ 0 'p,z(@OocJdJdMbA-\P@`Tdz50SA<z$0  B2#Hp PDPJdJdp@-<0@P4Hz50S DQp@zJdJdp@-80P@04z5@Tozp@JdJdp@-PP0P`!z5@@$U@T ,Yzp  QzpJdJdA-@`Ppz500#T0S l=z$ R$ .Hd0.z HU 0JdJdA-`x0pPpy5@$V@@T Lz0S0 z$ W%H7 zJdJdp@-80@`0Py50Sp@ypJdJdp@-00@P(y50Sp@yBJdJd0000/@ycP/0S/-0\0000C00S\ 1 !L0 @0C000P0 p@- R 0@ Rʠ8PQ BP P0 h00R Pp00000C00 0C000 0 peBeB> S# @-0@(M0T (Ѝ@ih03100P (Ѝ@0 00 !0 0 0  (Ѝ/>@c@yc S% @-0@(M0T (Ѝ@@c@ycG-p@ࠟW `PU0``0C00S 0UP!R ]0S0 P0pG0000C00 0C000 0  e> 0S\* A //O-ZQ& @`PU P` 0T p1p!Q  0R `P 0PE0J0@DTZ Ѝ   >@-P`p@P0 @ Ѝ@-P`p߅@P0 +@ ЍA-@`p(xPPdbx@Ѝxἅ@Vx,TxT0 @c\ C\ ; G-`p0S0 0@P202@P0 S(@20C22S 1 0t@c/؜////M0P PЍ/  /M0PЍ/@- @ P P R:H0R 0R  0RЍTVRPA- `pP@T X@0 8/P Ѝ00/@- 0  00 Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-1oP/P/@-%oM0 Ѝ/   /@-M Pp`0 o@PV 04/Ѝ@-0 0 0  00 ЍЍeBA-pP@ `81 410RTQ`P1 10R0#Q0` TIPp 0  04 0 + 0! Q0P HWTL@0 00   0!TcXcccp]e@-@ dv@+p]efBO-M @ 8PRP@: u`Uv0ZTQ pP 000V 0S000S000Q0 SQS-@ /o"/P$ !R @4_vЍ($ 1S0S 4 33R* 0 S42 @# 1SV0S 3 3l3RL 0 SVhh2 @1SS   R 0좟 0S YP  в 0R MP 2 !)2<0p 01S 7 0  a1SS   R 0衟0S P ܱ 0R P 1 !1<0p 0Y@   010 0 0!0 S @- P%  S! "+0 0Pn8 K㄰0 P 00 P 0 0 0 0  ꌏccp]eXcc@Tc@fB@c@4fBcp@-@P`u0p@:up]eqp/<0M 40000P0000Ѝ/TcXcqp/<0M 40000P0000Ѝ/cc@-T0@00@ 0   PЍ  Q TcXc@-T0@00@ 0   PЍ  Q ꌟcc@-@tT00Sڰ001S 000 \^  R @Pt@ 0DP8AT @tp]eTcXccccc@-@P@PPtL0H0 0P@\@t 0p]ecc@-@P@P3tL0H0 0P@\@dt 0p]eccO-PP' `@pt0S000Z. ' .P% 0 R 0 B RPUl1tPh00S\001S V  N0@0Dt Ѝpp]eccTcXcO-PP' `@ps0S000Z.  P% 0 R 0 B RPUlsPh00S\001S V  0@0Ds Ѝpp]eccccp@-P@ Ts00S001S 00 0P\ 0S @P@lsPp 0\ RP !R P< J4L @sp]eccccTcXcp@-P@ T:s00S001S 00 0P\ 0S @P@l]sPp 0\ RP !R P< J4L @Dsp]eTcXcccccqpO-M Ta dP3<1@0V ,1000V3PЍ00 0 010pW 0 000S aV b3 @T 4/p PV x R3`$@P @00 0;/ 0PS  @TcXcp]eA-pP`P ^ 0pA/A-pP`P p0A/@- w@P00$0 0000/cA-pP`eP p0A/A-pP`SP p0A/@-EP(@-?P(@-@90P 0S @/A-aP*P a0A/p@-P@Pp 0Sp3/pp$Ppp@^qpO-M Ta dP2<1@0V ,100*0V2PЍ00 0 010pW 0000S aV n20@T 4/p PV x ^2`4@P @00 0;/00PS @ccp]eA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`~P p0A/@- @ mP@0/@-@c0P 0S @/p@-P`UP 0p@/pA-pP`FP p$0A/p@-P80P p@(0/pA-aP+P a,0A/@-P8@-P8p@-P@Pp00Sp3/pp4Ppp@;/ 0 6/O-@M(0嘱p#09ᡱ ⃡P@Dlqa` dE.`q0\!PT100 0@7/$08`cPP @ @P@PWJd@-@p" ``P`= @` @`@PT=IDP MD /0@BG-M0S` QPPRp`100Ѝ  \U1#H1@ U00T0S `*  =H000P040h080p0<00@00D0#""$(, X\ 0$0 0 #%@D `d 80<0(00 , h00 l00p00 t00x00|000嬀`P0pJ00@^e^e@cO-@Pp$M~0`VPΊ@$ЍZ0SW@@`  QU   ˻@ { R gPP0p@I 0  0峻^e@c 0SP// 0SP//G- 8M0@`p\,00 0000a0($@ @ @Pz0,00 0000a 0($@ @ @h 0,0\0 0T0000a00($@ @ @PT8Ѝ^e$6iB\6 iB(6iBp@-P<ԉ80@T$%pP @^e@cA-p`PN@\P ap`H}ᰉ0000 @  000^e@cp@-dP0SX9 @┉ 0<R8 00, 00C0މp@^eiB^e@cp@-@P$`x .p@ȉ^e0@-@,MP4x0 |  R0 0CS 0 R=9 =  0 0R0 00?!0  0 0  8 R00=9B =C0x@,Ѝ0@BA-@(M`Px p0 | U0GS  0 R=9 =  0 R 0B000?0  0 0   R00=9B =C0xh0l PUp0P0GS 0PU=9 =P 0 0R0 00?0  0 0  8 R00=9B =C0h@(Ѝ@B@-@,MP`p{X h0l R0p 0CS 0 R=9 =  0 0B000?h0  0 0  R00=9B =C0hV W? 8 < 0# 0$ 0 0$ ,Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /@-@pT0T 0PS10~`V q03/v@T Ѝ@c`Lds@-`RP1`0@c0_Ѝp@tЍp@- <`80, $01000 Ѝ^e@Kd6uA>iBp@-@H`PS0S(0p @Jd`Ldp@-@PT`_L0!RQ41``p@ T`@^e@KdBiBs@-d000S `@8P0d0?oT0cЍp!C13/@c@KdA-@`TPp WPhd圀PVpʀ 0! $ 0    ! 0!d!0    !@cddd 0 Jd0G-P0p@|0|`cP@  ȄP  Z0 0 0 ZUPG `Ld@Ldp@-`<0@@P@kUp0p@/@cp@-P(0@00C0\Up0p@/Jds@-P@00O0SЍp`ؙ`VT@@-@PH`H0@0 @^40A生띡Ѝp@2_^eX5@Kdp@-@P@y0T00  0pdLd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd G-0 M P   @p X@`lP X 0000 ЍG@1  @PdLdHc^eA-X`PpW0S8 Aq P@m@Hc^eziBp@-@P0 p@dLdp@-@0PD@TpdLd@p@-@PsDPpnUp@00@p00S:#{/dLd00S:4|/dLd00 R !dLd0 dLd0 dLd0 zdLd"111/"111/ 211/ -L0!0\Q S0dLd,0 0R/Q0 /dLd@-0 odLdD0 0R/- 0RdLd <0Q/1S co `/ dLd -@0^1 0 co ` dLd40@0\/- 0\ dLd40@0\/- 0\  dLd40@0\/- 0\ dLdA-@`P$0pW绷@PdLd 2 2A-P`@$p0SQ @dLdA-P`@$p0SQ o@dLdA-P`@(p0SQ w@dLdO-`pPа$M @T$Ѝ0S:?T@#Q; P 0 ?0@4'V`1  L     9 T: 0I37|c@-@0@T t0Ѝ@\P0 1 8*b0 ~PЍNdLd =ep@-P@P  p-0t  B^\  ŠP0 !.0 . 㐮NdLd =ep@-8`8P0+[$@ 0*TpLd8@Nd/-s@-`0 0@P0 0Ѝp@Ѝ/A-pP`Z@k0P U @0p@-@`PX@P  00p@-@P6@|PB /R/rN/@-jBN/@-jB@-jB@-jBN/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-`P@0 0/0 p@p@-@`[PP 0 000 p@[0@-@0as@-@0 PЀ `[0 <-L-u[0 000Ѝpꈭ6zp@-@`P0S Y[0 0S 00 _[p@/^eG-`MpP@ᰐP!0 3 0000X0P3/H3 00P00 Ѝ^e@cjBjB7,AFkBp@-DPt` 0 Q@Z0 Q Q 00B0C0/T(0@,  +[p^e^ep@-@$P`Z@ @@[p^ep@-TP`Z @T@ 0 001`00 0R@@[p^ea0^e@-$0P 0 0P Ѝ^ep@-@ `PZSp@Z^ep@-A@ <`PZ0 0RS@ Zp^e^ep@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PfZ0P$PBU 0PZPp p@$0 p@|f~f^e^e_eA-pMP`EZ| 0R) p@T1 00S 0E0C@S@1T( T@# 00S0 S_Z @@ZT W 4QZ#@ЍC@P FZ^e^e8_ep@-@T P,0,h0Y S4Zpp@^e_eG-頁@0MS㠠P# px1 R0S! 5S-@Z@W 00@ ZY ` P@U`1ZV @B0@0Ѝ 0`` '0  00  00P 0 0@PEUP!U @ w0@S 0 UT0p`FP@^ea0WeQ/p@-P0 @AlP Q PP O @ 00H0p^ea0O-@p@-QU@`PpV 01p`U 1S 0 ,>A-P0QppU@`P `U1S0 V ,>G-pMS`f@Q03/ЍG@Q 00000 ` 0PЍ1 G@\ 1Q  013/ Pq181@c6-1R001@ 1S ; @ 1S/ 4@-(0@tQ 0 @@c,>1 2/ O-P@}80 S2Ԁ<0t`̠Wʀ ! , !8!<+ @0pGI(pt0 7t  @@p W $ 00(0 0C0CY(W 0t  0! Yb P U |Q0$ SPY0 (00pYW 0l ``g X17#0 0J00000000T0 xO|000SOp`V`00@@ llP`0`00@@0SxO0S O0\00`0@0\@@S ЍOOЍ蠆ccd_ePclBXc@ mBh_eX_ePcG- H^O <ZO88p @,a,,QF0 9 @`0 P@pW` @G0` 0P@0 |0 P0@0 0 @P0@0 d`0 @P0@08 DЍX_ed_e=mB\_efeFmBTcPmBEcXgeZmBHhecmB8iejmB(jedh /A-x`@pNS|PL P0R/d0SU 0S ]jP  e 000OPOd0h3/NL P0R:p00p0p00S pP 0St l  P ("(R   PU! ! !   B "P"PH  BH L  L !R  B R R 0 0 ! ("(!@R R R 0 0 0S0000H 00,0R:< 40R*N n  6iPUNl (( RA@tmBA-p0@ p W x`|POp0   x@\NNW*:p Pp0 xPNX003/`P t0@PPP W xMp0 :p0W xM0$pS0P0P00`01t0@D000"00!0 ("(!00S0H0@0Ht$ 02S0SP<0 |0S<00000p0:p0  R  0S*#@-@H ,0R:< 40R(VpP p@-PQ1Sp1@S0 1 01Dr<0 00000!!""00040p(jeh@A-0@xp0M 0`YMt0 )  `tPPPU+ 0V  0S" P0St02 0 0FCq@ 0P: l $$ X @PP 0 Ul   P;P0# 01 0l  0S0``10C1000H00H0L00CL00Sp0P 0p0|!@0R1 , H 0BS:<04S8S00R 0S000 M )0Ѝ0S   0S0P0P00CR0S   0S0P0P0P@mB@mB@mBp@-P`@Tp0S   t0@&7@-@ LQT0S; R!0 0+R +LX pL\ `0RX `00`0\ X LbLX 00CS0X ULtxPLTL00QL|pBL Ѝ0 j )X_ePcd_e\_eO-@Q` 1 `lPp@ 0S 0>S @T`臁 13/ pXgeHheG-p0 @0 0 P  (`,q(0, 0/X(0, 0Q ?000C00Ѝ 0$ 0 0$ P@  13/P lV 0 GPh@>A-@Px`K@pPEPE804P"8%< 40R:AKlp@-@Px`KH0,PU< 40R*p@Kp@-@Px`K0Pp@KA-`@xPpzK? 00+0`@`PPPEP0pE8AK//\00S /@-X <!t  L  R0S Pcp@-P@K@|KpX_eO-PP@4M?p4ЍO/lR` pR cR sR SR0 RS 0S# 0,0,pW4/X0Z0l $ $00 0000000L0 0H00<0 0 4/4Ѝ0`t(X4/X L4/<0D0804 ,4/P0,0@$4/4/0 0-4/X 0S 4/ 0S 4/ 0S 4/{0SH4/V4/W P` 0FNQ  0 `$0P ZP4/ 0@4/4/Y 4/̀QȐȠU{  4/`p0W:P4/ r 0 4/p` 4/mBmBmBmB)nBknBnBnBnBoB;oBOoBboBxoB,AoBoBoBoBpB4pB%pBoBp@-P` 0@Tp @PcA-Pxp+J`V  `V`V@_J ,@P` $@P` @P`A-8p C  1@0@/Q Qq QaUB  JU # 3Q R.Zp W 0S8U: 0 S00R0S0&W8 p0 @CT20S(U* 0 @DS00R0ST `x4Yw7   ᭳P0 JZ 00,    Q  [ p B[ RU  KR  Q R|[X} U p0@  00`w0%G P0JD*0J&``  00``0@ "8`; `7 0`01@ ,G000 0i0SQ000IB 00  J R(0S0P103/LЍ  pQ   j[puX  R%U  /o"QQ 0P RP P E  ,0,0KG  0 00 ,0  ,0W0  0 0pGZp0  0 0J W  Tp  @D@;pB@c-0@-M P0$@ @ @800S @ @Ѝ0@Ѝ/_e-@-T031[  1 0S 00 00 ЍЍ/@c-@-T031[  1 0S 00 00 ЍЍ/@c-@-0 000Ѝ Ѝ/s@-P@`J0 `{Ѝp@I-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@ ke@-@P`00 `*TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <u!1 @P >h`Ѝ c00 U00S`C 0S. z,@T@p T @@⑕ 0R#T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG ?@1c  p U 0 3AcgfffBpB@-m@ @@ 0 4 00"  |@c ke @ s@-@Q@U-?@-@PH0 @ @ @u800S @ @k;NЍ0@ Ѝ/_e0Q   QpBipB@-`@P 0 PK000S   A$Ѝp_e-?@-@P@P 0  000+Ѝ0@ Ѝ/ 0S HP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@M0 4 0 000 Ѝ@ Ѝ/A@-P`|10S A3S a l6gPT 4#T212@00@00A0S<$10SA0 00S 0 0Q00o0 Z#p0 Pa 0 pp0 [0S `0` 0Q01@]P.0 `t@vc@c0ke kec _e^ea0pBPp@-@> @00/A-@Pp` l00$0@p#0 uA@cA-P@`wp U0S00  0S00 [x0SAWA-@PpY` 700@000#0 ?A[@cA-0P@`xpx00Q ` 0 ? 0S0Ѝ> ZM>[Jdt!7?/0 0 1PS/ /@- @=00@-pBG-@R`pp= 0SP!R PPb Q PQ = XP0 00 0q=P$7p@-@P=0S` p@=0U* `V 0a@-@@ =p@-`P=@Tp00=`0S   0S=p@  p`p@-@`Pn=@T 0S@A @=pP/0S /O-p`PQ=0S R 1 ЍO==@=@X:{= 10@/=@T R Ae=c=  ЍO R !  R   F=D=T  Ѝ&qB@- M@ ҏ 0 R0 00CS0 R=9 = 0 Ѝ@- M@ ᰏ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ g0 0S 0  AQ0S00  00 Ѝʚ;p@-P@P@Ep@-M pP@<0 `\0`^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  007ʚ;A-qP M3 BH<T t13AT \<@ ЍG@5<000 ^l<j<0 000@0 04@P! /00B! 0㨀!!3Ba <T +PA<p@/^:2TP Ѝ000 @ 00@- X( b0A*(P Ѝ䠈c@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-P@2 X0P4 R0* 40 Q Ѝ0@W0U -,^ :!!<  12X0 0(ꠈcX 0 p@-@PU2`Qp@21S$A-@pP`@20 00@v2ЍO-c,M@0pPW`$ 0)p B2 2  2400#C8."<`Yw#?NW4 `Ï2`8<000Td0a@PZ `h 1d0H0> T`X` 0圌P0PP0C1p@W U P!T0L0X0$ P0\0 \0q``a a,Q嶪1011410Q&3*`5WpF&8!U. P0`Pd PR0 㘪 0 PSD d0 $UP= =@,Ѝp\I  B(pz`1QES 0 @APc h00<  W0O< @@ Q]? P q`F pఃd0 cLW1( @,0,@SI$1((0(11ꠈcle teGqBPQ7R7LqBmëc@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 0z$Ѝ leTR7P7SqBd1c1[qBcEceqB-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-clqB00@-M00|0|@| 0x00c00PP  TTLN <奔80 0 Ѝ0@c`@leI7vqB@qBC7Ec,,00 C#' ,00/JdEc00 Q0000$  B',#  /@cEcA-@PM` p]00 0 0! 0?P W 0  \ \0P  PP ?0iЍ$ 0  0 PtTB$\7Ap@-P@-0 P;h0YA-@P"0t0 3R 0SP` p;!VU AK0S/0@cG-0P3x0@ l/p `V 00 0(0`03/V/0 0 0 @c@-@G@Q@cs@-0PQ0 7 0@S /000`ЃЄ 0S // @Ѝp@.@cd[7O-0Pp,0 `0@ `F`! P (0P@0 0 PP PUP@Ec@cp@-P@]/000PPgp@//G-O/P@p0S 00 `@/ 6/>/ 0$ 0 0$  $0RP?T@Pd@cDPd@-L@L03/@ /`0d 0 RS`0d D%@Q/@PdPdA-`pP/@"^\Up `0 0 P0 @0 00AT%/D0 000  0@Pd@cDPd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd0@S@-00 /qB@-@q`PMU:,A0 m s. 0 @b @h.D g }g  xg sg0  00K0 0t0D00dl0 0T00000<0Ѝc@PdqBqB_7qBqBAqBqB^7\00S/QA-H@H@`PQ.p"R0:AU.;JdPd@Pd 0h 1uh@PdG-pP.@@X\`&V\U0 X0LL0PTp/P 0`XPh0\`(.  Pd@PdJdPdA-` p PR0S @5/Ѝ|3B!"5/3A"@$ABS Ġ 0  ЍAJd@c0@- @r^7A-P`pQ0 R @5/t3B!"5/3A"@$ABR Ġ  Ad AXJd@cp@-@Q8@TphP` L P0RP0 0P0L ᥛQt rD-p@(ep@-`xMV 0@S x P #000(`(0.- _h-xЍpcO-M` 0100 R$ 1S 0S 8PU00Ѝp-@0p 0T/ Z H0 SI0X 4- 0X?LP0QP0 0P0L 0LP0@L0 040D0C0TQ 00CS0TZpL@TW000S  X H0 S00,PW㼀H@T U0S0 L@L P0RP0 0L P0 0@ H80,qBrB@cn7O-828`3 DMQ$200S#pDЍ@  HpP 0?S0S 0S 0SX 0S S= S p8@TX +0S2+V5 $0@  8P80IP p@@ 000HT`+0P 0R:++H RL0+80S/P L 0VP0@0L@ @00000z+~V@c cee e aO-LlM3q0@0D08P80<0N+(08 q'+00C+@TN @L P0RP0 0P0L 则00C0o+3`0\ 0SP0   H  $X0L ` < &} 0@ 80H<I+00T` $Vc 8+'P *+\  H 09/L X[ B @  \   0 P    0  0 ' } [  b   r 0  X7I*JYE#@cee rBeO-X$"0X2 P00S# Ѝ80S 8`a0Z@0 Z  P  <  P0$ BGP0?S0S10!p0GPP0 /*00CS0+ g*  0!0PP0X*UZ P0S00[0S [ 7;*T  ceeC-M 0`p` @UP0 P 00 00 0 0@;r?o2P0S RR! %*Ѝ cC-M 0`p` @%P0 P  00 00 0 0@ r?o2P0S RR Ѝ cO-![  c 0 03/@PF0X0>B  zE@< W10 PP@ @ЍZ P@P N AD@P  OWP@ LE@Y X` `  $D@P Y  `W 77Ѐ7@7L7`77`7`7`7`7`7777707L7l7t7 0,Q *Q : c@  0  @001 001 000       @#000 S 0( 00C 2 0 0 00 3/@P 0  "  00 0 0 3/@P 00 3/q @ @00 0 0t 3/@P 0 0 0 0< 0 3/ ,10 0 0 0 03/ 0@0 0 0 03/@= (0pS10 0ᾑP@0+H@# 0 03/0 0 0 0 00 @Ec~f}f3{f@|f@-@P %p p@-@P0P @ 003/@p@-@M P DЍp@-`@0P @ 040S-@  3/@\p@-$M{@P @, 00`V-@% 0 10 !0S! S S@ 1 000 00p q* 0 006/@%$Ѝ0A-@PAP @ 08Q-@ b00 0`01/@ Ѝ@-0@0! Ѝ@-@  pP0000Ѝ7@-@P pP CP Ѝ0@-"0`p SB@ pP P`0 @  G-@`p W T0#03V0SP (0S0P p(0SV @ 1!H  @@ PU @P-dM"h0 (00@#0 00 ,8KdЍ䈈7A-0P`p@0 TЍ@- #W0@-PG-P1p SB@>(21X`1U @ T 1P Ѝ@-050 ЍO-`0x#MPܰ" 0$00P @Ѝ(0S#P (0S00SS @@S V X_ @T    Ap0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  &@P 0 00000 00 b-P@|  @u0  @P @k0  @PP (d[1 01  010r 0PPQ`e0 @ @[ XTꈈ7Ep@-0PS@`M  @P0 Ѝp0000 O-14M`P@X0`0CS*q-P  (0SX\00X0 00 ` X 4Ѝv#  0#[ i#0 #@O-0p IR@4M, [P  I@@P!@T  ?@@P @  @0` @P "BA@ 4Ѝ?@-@!#p0t 0 0x0* (@T#p@-d0@P &r"0@3@#p#&r"0@3@#<#p@-d0@P h0l (00@@, p"h0l (0, 0@@!#p@-l0@QP 1CQ 1CQ p"h0l 00010#p00f@p@-d0@P0S S p80`h0pP""p0@`@@p@-@d0P"@p@"p@-@d0P"p@"p@-P@P @z" pp@-@P` _o"&'00F= 00'`P000@0 "pp@-P@I"A` h0l 0H0E`P &r0`1:0@9q"p@cG-0SP'@  pHPP srF "h0l Y^:0 h0l t$A'A"ЍX#x0S `6"P000p0t 0 p0t !p0t `0Sp0x0 t S PP #`PA-0SP-@ `!phl 0 y0S 0Q h0lt $@!  ШPX!x0S P!Ѝp0t 0 p0t p0t P0Sp0x0 t S PP #PG-50S`5 Pc`P-00p 0 0(00 0@ \!x X@V00y0hl`0t%+  @ (0300Ѝ@jrBrrB@c0 0R0,00 0 0/s@-P`00@t  FPЍpp@-P@H`!U88P@P PP@ @F!pQdQdQds@-@`00P EhFPЍpQ@-@ @ י@-@%P@oЍ0P :0Q:///0/P$ Qp@-$PP $@* p@  0/P$ Qp@-$Pp@ P $@*  C-@`00PUH@ P ( ЍC Ď0S 0S00 T5 0`y 840S$p p (PU j *v P U S }^@ ЍCꅎ EEP ЍQdQdQdA-P0`!Qp# `!0   IPP   PP0S ,Ѝ@@P! P0 0$pP  08(04P(Px,00SddT0`0 pP4`+ 0S G# P@crBQdQdQdG-SPM@gM PP#@D V x0St@P:0  00 0 , R0 0300`  f@P (,H4@L@$ P  #@P ,(PЍ(,0( 4<08@ 80,0 (@Ps$H0Sx 40Su UVw PP0  RS< QQ: (<(xv4@0SD  D 040S8:g(#(a@P0S 0AQ 0S 0 P  (,]#PPH0S 40S(4 |0 _(,&Pxɚ;6eċrBʚ;ˆO-`pP(@T 0(  Y $Z   @ IPW(@ X $[  @T 0( g p,0H0@0,0PPf0@-@M0@\ QP#!0  ᜅP@   _@ Ѝ0@cA-PR  p@P `VP $a0 pvP(0PЍ@P/@-MP@`ᅦP V0 ! 000Ѝ"RS+ P `V $p$aP2U0!L0P  RR   $GfAP2U0!,P!SSp@-,@,P ₦p@~Qd@QdO-,MpP S  T P%  X`\P Y 87h7L7777L7L7L777P00\XT  ,ЍO0P ,ЍO50P 0 $07JY )XP@/ [, $ N@P&$P Y 0 0 0` $`P P ,Ѝ`P#@@`P0\0XT  00J/&>2  d+& &bR0@p 0S4#,S  @P @PP `10࣋#h0S00 0 ^@Pa Y 1Ꜩ77x777 $0D@PR$ 0RUp 00 0p[7 *k"*A 0 BQ꼨7Ȩ7777 0  ! 0C?o2S 0S0S000  p S00S00S  pP BpN@ArB0@- 0@SP$M  9P 0 P     $Ѝ0 0 R  //p@-`Q0Q@0 . Pp00p 0@-@ 0P  :P z:ЍC-@$MP V9P 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V hPPP^X V  rB@BrB@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P R tT00#T0S@D0PE0S 0 @VP0PL4Ѝ@cWe@-P@`gP 0: Ѝp0 ` O-R@|M MPP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@` 8@P V  8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @ Vо (( R LP0UP Ṿ ᙨ@@cWe0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h3 LP 0PED00S 0 @UX0P?4Ѝ@ccWe@-P@`YP 0, Ѝp0 ` O-R|M@ ?PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@`  w7@P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  093 Ks (0X0B 0 R  @T᳽ (( R LP0TP ᜽ |@@cWec0@-0 0I ЍO-1M@`0P 0[ @Pf#΅"^0@@A-QPp Q! Q`+p`@Z2` R`   Q`02@A20}C-Pp`42 n Ѝ S @ R0P0@A\0 00}\(0  #i 0R P A-`Pp S@"@Q  0" R0Q@D0 00K\ 0@  "iЍG-`VP:Pp W @ V 0 8PP$!i2 02PP 0 ( h @  &a\ e M00Ѝ"X $@,@G-` R P0S0R@9@ 0+8@P)V  U @$P0p 8@P|P`@ P0 Z@ gpW عչO-0TM00S\77D777 0,3@P#@TЍ0 0Q8@P0d 03@Px003 @@3 1P00`@$PSpW$0X3X$p^sቹᅹPYZ43Y4P0U0,0) U 1 #$, 3,0@PU00P00S W 1 !, 3,0@ U00P00S V 1, 3@GDTpp 04p3|0$00P ß``p0p$pP ``  Fp R<  <  F=p P T R , (u( $ , 0 0@P00 0$0000u  p R<  <  Fp P T R , (H( $ , 0 0@P00 0$00NlP@hrP 0 03/@zNT@O@N@@cxcxccesB B @-k00S/A-@P`p 00P0000 0n?@r?v_`BE 'A-@PpA` $0SH0( `@ $ 0R`0P @cp@-P80@T ,PpAQd0O-"LM@!2Pp`0 < 00p0,`(P$@ @@ @<D@a10< 0D0<0p,`(P$@ @@ @P`D0SU '`Q`1 P0D 0<,p(`$@@ @`0 010D 0<,p(`$@@ @`0 000D 0<,p(`$@@ @` 0 000D 0<,p(`$@@ @`d0P00<,p(`$@ P@ @D `LЍ osBysB(csBsBsBsBsB Q 0 NRdp@-@PBoPPUP 㗷(P'%p@z㉷ R00 A-d0@3`q00CS0 <0PRU @cA-@p Z0` 5PP QЍ@PP0 PP 0PP  P1S!!1! pW020 ( P WmRdp@-@PM TP0WPP+@@q@`V& WP0@0@ @@@0  tP|0 @KT@pW PPPSL0Ѝp80q@<04l@QdsBEcRd7%Bep@-@P`0P ( R  pU  @@p@-pPPM @P Ѝ 0@P0S00C>S@0`S 0S@ xe10-\0@-@M P P PI 0Ѝ0@-PM /@P p@P0`S  .0000"Q  0@ЍO-@$M 0Hp,0` 4PP #zPP<@ڨ3 Pր@P  J (  , ^ !$ R W  RR R0R Pz@ L@w8t0j/ 0S(A P? 0W`0" ⮟1 00 0 100嬡@(`pP= @b  ]P $D1 00? 0@0 4<00000 P < Py0 005 pL0 T# $Ѝ0S@!P^vod`rτn0X@Sk/1!p @@PFV0(c@sBsBo QdRd0p@-P @`M P  .PAЍp/O-M p8`bPP @nod 0 S/ (PЍ"V   0PP  `0 200P"  P#PPP |Ѝcp@-@aP1S @T 0S 0QU00001501 0S pPPO-03pP*@`ᄠTH P 0 S E @ 0SaPP02P0[@c$@C-p`$MRP0P P0C3P0 4P0A%@ RP0 0  0@P $Ѝx0x E0 ` Ep@ #P U<@ @U  *@c$@sB@-`PV  *@P  ` 0S  @QЍp i@P 0 +\C-T;M0 0H S@#* paVP_P *@P U UЍ6@A-p@WqC0P /@P ?T0003a I@P  *@%{$q$Q W@@c@-0P@3UQaw PP ЍpW$Q  hc  0R # /@c@-0S@vP _+ЍG-pW@ PP F0`0SQk \@P0S QNo@/p@-@1P 0c⎚ i⊚$ Q$180pzfp@-`R" 0P1S 0@S  P2 pP0  + 00p$ p////// B 0@Ps //Q 0S P 40 P0@1S///eA-@ t03@`P |0S 0 R0`h d0P0U TpH 0AD0Q00C0 R0 QJd@ccceG-0@`p @M(0 0 <0a0,$@ @@ @P<@X<0S% 0 00< 00a000'>,0(0$@ @XX00P000a0,0($@ @ @< X@ЍsBep7sBt73BC-M@pV 㶯0 P `㬀嬐0 V:V 6T` V 1 *@`嘯VЍ0`1S 0 + fsBJdesBC-M 0@p` PW$a0 P 00 000 0P=T?o2P0S@.0S@*QVPU@$ N@ pU*0!R0X H@P 6@$  /@VЍeJd@-808@ P 3  @莼Ece7%B0@-M 000 00 0pჽ@P@,P 0R `f 0 S |  @ R \@0`80  @])@P ЍeJd@-0 000 0 000@APЍ@{Ѝ0C-Mp0 000p0 0)PTa V  0RD@P0P dG XD @ЍwP w3pU W @0U/ @ PU0pPpU#  Q  (@0S P ӬP d T @ Q0S 2N2 Q@cJdcc@0G-M 00 00 0p᪼P @Ѝ  `P p @y`1`3P@刐 0S S 0  @u `u`a t` *P @L@@'Z |PU Z | Q  ^(@V 1S +0ሐ01pQs q Jd@cc0"!S/ 00/P /A-L0C@1S`H1P @ATAJ pAx`@@cO-TMxT$ ,0Y〰CR|0S |@1 00 00H1|4R00L1L1,0P10(00Y@1<10 @4 0/00/000810000x0#S' Pp0ԣ`$0Sd岀FPO0P #FDV 003/ Rp` @ pPTP,0 0`,33 0偂000008000#p h /oX b 0$0Q5W 20S000 0H1n 000 0` 00$  0R   8 RUP6 881SQ00BRUbPEQᆢBDU"XOW[YgP @Pa X g `%0Pe Z  00XWYPELD  F%0P P 0  9%0P P  -%0P P   !%0PT P   %0PrT P   %0PdT P  W < $0PY 7  $0P0 01 0 100/oX" R0  %0/oW" R  %0/oY" R_  ᕰ %0X ᦀ  ᢀ@cL@p@-P@U`0M  $PPP  $P P 000Ѝp@-@PP4M  $P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PP M$@P81 00HA@P U%@ U ̪Eߍ@c@@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M   $PP P  $P0(ЍpE/08!PR/p@-SP@Ha&uP@10D1@A `0p 0 pO-0@SP ^0S 0`Q X280SP81X0S =`0@ 0 B0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!%&00   0 >VU@ ЍXU  0 L0Z#  P21p ppp pp \ 0R 081<10<1    (PB(    ЍOs P `~RdT@A-`唀p?`@T|@0C0୩P@PEPL= 0 F0 f021@& 0@@ARdEc@-@( ~@p@-@0Sp 0P R @1S@  0S00p@@-0M?SV1``0@SP T;8pP @ S @Ѝ$pW00SZ@@D@ @ @@0p 00㶷@P@T 5@Tt T T0 d0 Ѝ@.60@cp@-@xMP` x d~` n"P0 xЍpp@-P@xM`x N~001`0 0宴0$ txЍp@-n@PqeM  5~E 3 Q#eߍ0p@-MaP. -"@P 0@ )  4@cT@ލpO-p0A$M>SHL0&0R00`A 0 0S9 S7 ZZ 1SL0  3 [( L0  3Z P[0g30S x3 [0t0[0뭷Z Z[1S W4P0S 31@0r } " ) 0     X P   P L  `Q((L Q`Q''L pHp Hᢲ"!    Q QpR RGE 00000 0 0 00 o2XP1 01 1007[0b ZZ[Y 10SuTAW4P  (}2 020契0V000aPh0S 1$ЍP101 1R 0  02P P0 4P0 PZ[etBcc@c0@-P@P+1Q>C/1C  Pp@-X1QE 1CQ [?0Q Pp@u0S1::8C81Ppf0 S10011000000S0S: R :SP0C BS000;LMP s@s@,`0(@$ <08 @DЍecuB>8+8;BjuBquBWSBuuB{uBB@c -8uB- B 1011 S!1 0 !q 0$z.@cep@-@PX0U00 00@1B  7p3Pe@-@$0  (@p@-@P LQ 8Q  _? = 0>;0p0<0k|Q hɩ$p@p@-@P  5c/0000`0001S 0V (~p嵨edmdc eA-P`p0| @@ @@1B  lAT 4/0 #P@P ep@-@0P#PP@ Qm pEce@- @$B^}eG-Da@ Q8# 0 4 0 T 4 T ( ,8q X( ,:T% U' . 8 < 8 $ < $  @ !    0P @14 0 LS0000 ?X#!D1  L0S81  UP hP000@1 t1S 3/P0000  P   +) 9R0\0[S < SEK1 C/oS" R 0Sw rX <0SP@4ePR? V1 C/oS" R   ^KH090KW1 S S R D15 q0L s `D15D1G!S3  U@n P; P1 C/oS" RQ1 S S R VBP1 S S  b0 :  8T!U1R3R1 C/oS" R Vv  & U1 C/oS" R 0<0喀T1PSPSPUT1 C/oS" R D15D10<0 U  P,M1 S S R# _ 0 R P /  *Q 000S0>;9 H L1 C/oS" RP N1CoSQ/ q P P ph p0a P P lyp0Q P P V  "@ Z1 S S R :L 00 S   | 1R0&,`( dP"YE U_ H1S I1S J1S+ ) U' 0 08L*0  :/0H1PC_oSRPU  P PEUP#U PE0 S = e4@p@-@AK `P @!pe@-D1 M2D10@9000 00B P090 Ѝ@-D1@ D1L 0X1SY1SG-@LAP` p VW 0 Q(P6@QBYP1PVW) ``&@1B  U!!|0R W PP Q xV s| 1RWP 0@1B  $PW 0ep@-@pP ?P,00(@@p0A?P(,00@@veO-0DM S @0 P`#48@3 @(00D 91 Q/[ , S) \4P[01 0S,>pDЍ8 "03Kp'W`<0}Yq00WX03QHp=0K Pp # d/ bQ8!  TP h P  @! t!R 2/P   "Q8 SQY0wB@0T 0R2 @A0.@!B +@) Dp Q \B("008  R(00C?2cO 0@CdB$@GSYL0S800ڄ0)T0S 0  |#pR 0]pTX!R#W W#W[ BfSQQP 0 S W] 0pPXf?0H SQ00Q00SHW uptW>Q; 0S  R5 HQ IQ JQ  R(`!`@cecEcgfffQMbO-M|>@QP`q P\>Q 4P>0S%D>Q 8>U9 ,>U1, N=|.23i 3!1P =U Y-23=QЍOG=0S=Q%>C0CQ X=Udl=U0 GL=Q Kk0CQ=0CQ(=0S =U& =U2<U<0 S| P 0 :/zh| P 0  9/TX<Q P<U 000<Qw $<Qs <U4 <UQ Y_/ P]  { T;0SV[ ] SZ 1 0SV [0S PN G\   D ? 8;ZP5 5 Ѝo ;Uq0CU::U< LQ0CU' ? 0CU %40cSr\:*0#Vl:Ut 0CUPuG p 1 0Rd[0a PP? S4f8d8d8d84f8d8xi8d8d8|n8:0S$i8i8d8j8d8d8d8h89U908p 0;9U 0CU 0U %40cS KS V0CSt9U l90SX9UG 0CU1 @9 I0CU00 C0U %40cScU 8U  0U0{0p8UEPP[ 0Sq l00 3/ 03/P\  8/ =@8U 7UL@ 0}P  ! R[   Q!0(03/G7UD >0UR >C0CU, %40cS vS<70Sl70S PP7U *p0p p1S 3/P HX0S00004  |000| 0C0;PUPP8v80 0R01 ST 0H0HS^PP' 0D 80< 0P@dP ^!$˟$J^Z @Z 00\T 0< sg0S ! S f[0 0S00c0P1 0R[0 0S00LA1 0S[  $05@19@1e|00@1$0\1(0S`1 x3U D1"    2D1 0R810<1D1  0;; 0D!"0D1 sy=i0 8P # D12D1o Pk\0D!  %<D!0 0<0nzD10S 0RS P100100@[00[0NP xPP0S ! S,[0) UUXeFPP 1 0RwP5PQvj0 a [Pb 0S ЍO7&ЍO& Retrtht@|ft,@e@c0^t tBt @utt@cuBcuBtCt gtcEcf@t nt ot st@jt@wt@HtH~ft,dmd$e5Bp@-P@U0  @  @1B  !0@p006PeH/H!/81 , p@-U1@ S S R 0\ <0 uP 03/pT1 S S R 0<0l1S (l13/#/#pe/p@-P,0@TpvP @Xc/@-@PD0@PP  80P  R 00 0e\cp@-PPL0@T 0S 408 CTT 00 0p@eXcc@-@P(j$08 TT 00C 0@e\cA-@|tP/VpPP` pvPa00|0p @R 0{PQ 00400S  R  0?e@Xc@-$PP 巨\cuBcuB@-@XT08 CTT 0S 0E0S   ;ec/\c 8080 1l1S 0 0//̉c 8080 1l1S 040//̉c 0 601/̉cp@-PX X0X` 601@0003/000lQp̉ceA-pt`P@@@ @L0 @  ARSD1 WH@@@S@P0/@(0, P00Ce0 /@-P0 @"6 0<  $0000P0@j̉cp@-0 PQ"6 0 A X0 0 X0p 0` X0 0$^0Ip$Vp@@̉cO-0lMS 2P"0 & q`될@@, 0 XY 0X0L o@P@  ,Q,#N$plЍ YY 0PY03 lЍOo| R  @ X>  @P   io@T0@@ @phdRd #e@P o@T 0@ ?o 2R0S@@#@@̉ceO-@`2P"0|M & tr< 000 0 @  c L Rh00+  0Su 0X#00l ,TdRd #AQ@!@1 oPi_ @``Q` @P R LP8p UXU<`D!L"$ L\ "P R (Am ( 2/&@T R R TdR`1d`#U 6oP@h @0``DC  8<Yn 000 |Ѝ̉ceG-`!1  60QpA@0 @ |Q   XP YQ Y.S  Y SQ@@@@ @S @ Q YQ 0@L  Q S 0 T @\QD  @̉cep@-@p p0 601 R R p@ Ph p04h p 0P̉c@e@p@-@ Pp`S0rp@ep@-@ Pp`Fep@eA-p`tP7 @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @ý@WGe@-p0Q0A T 0SlAOoB@ 8T 0SlAOoB@ '̉cHeA-q`0S3@Thhy0VT@ PQ\00TS@O R P!(t0@@ ;01S`3@0Pl01S TX`0ẢcuBmBHeA-@0` F@PP x0x0q@jl1S XPH0@`l1̀0003/D1;D1PỦce`v8Qp@-4Pp@$D0S@@~p̉cHe@-@ $,T@ Έ0Hẻc,sr/p@-Pl0@"6 0\ \ a $7" 0$/0p@F̉ceA-\A0` F@pPP840101@0@$l 1810<10D1K<@1=`1\1l1S000( 0 03/P @ 0P \PЍ00   0PP0C0 ẻc+p@-PP0 601P003/@@ep̉cO-졟p3`!1 ر 60P@ @` w1 Q[  S%L0S> xq8L0SI@T @k@VT L0S8L` VMP1 0S [ x@ @P k< tf#@ X2@P]T @l1S 0 03/@@c̉cEceG-`$$ 4 6 0Q 4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;oP `3R X3Vl 9>C1CV %83Vm 0 $p 07/pp{ 0 ppr0o 2 Rk0S Y`w2V, 1\0CVh||t2V" 0CV 0LR 0 00($2V0CV 20S0S00 0R 0 py00u 0R 0 0P0E>SpOD1Sh0 000?|00D1  0 1V '1V 0CV X0@0X000S80 @  UQTQR+ X @0 X 0!p0V T00SRX @0  X ̉c`t@8ft_t u wt@ept tttut 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-`@P?U VB6P0P0 0`p@-@P %P 0SB000p@-@0SP  \P 00BS0Q3\000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP p0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 PSpS 0S}  P0000`P  BR1 " 0010 0000S000pvBO-`QM@p0 SB S0S5 000 0R4P 0PPC PE0UP o R A00N \ᡡ:50C010 `F000p0S000Vl  P \ Ѝ@ ࡡ0030c00 [ &vB0PPQ/@P - Q^00@S0\3Le X0P/-0^  0CS0\3 Lep@-@ RP 0 BS 0 \0C0P 0CS0Q3\R  pp@-@PDpp4031[  10 P /@c-[  \ Ǖ@- @ [0  P p Q  Q\1P!  S[ @ [ @@腕@@at cp@-`d0@31[  10 PU 8Q0 @.p@@cp@-`d0@31[  10 PU 820 @p@@cp@-0@1[  10 PU 0 :@p@O-@DM p`\0@ <00  <0,(p$@ @@ @`Pp-*0 L 0  `<4,(p$@ @@ @^-DЍPeA@vB7@-@00P000U  Ѝ0@' Ѝ0@-@H$0S 4 0 S   0  PeG-Pp堠堐 M@T |`  j  R; $0SlP$v Ѝ@Pe؉cEvBxc0S/؉c8A-tp@h{P`V U0PD 0 p@lP`؉cPe h000@-@AM,P CYLA jQ j, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01v"PLaPU 0S 3/P 㨃 㥃0$L1cN/@-PAM@zU 0SAߍ@, _`P  Aߍ ``0pP` u0PS 0S j j0 L1S0Sp0LQ:03/PU`P I F$NO-MRQB 0$P|ߍO+Q0S 0 S0  pL\000 0*뱟`P* pߍ~3@00T 00PS+ (0S(pW% 0 S!0 00S0 000$0p 0埑P [030#Z0Ss M00S@0000S 0 0`0x23 -0PX0 H 0L000P0@0T00XH 0P40@pD01 X00& 'QI x l0S QD   xl ) @X ? 0"0 2" 2" 2" -0pἜXPU000 W A0 K =00Js 0( 0(P,.0( @(p,.0x0H0y001H010( ( ,s.0( (00,k.0( *(00,c.0( (00,[.p$Ξ0S02)c@c@cp@-D@(P/B,B0 G-MⰠ P`p ` @i0P00SS-ЍS000 000000@#?o2P0SQ $0S S S h 0QQP<0H o80(0f$00Ec؍e&@EcEcC-釟M|@P` p9Tp0p $  ᩆ0` h2 020202HX00#ߍ؍e8p@-1@SHP™L0S0L0 UIHLqP UpH@0100p@ DCIUH  L00L0H0P @0` 2T^ p@X0\ /vB؍e 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-$M`0@TdPp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P  0S 3/ .10@c@c@e؍e 0O-DM!3Pp'`0< C (PP00p 0,`$  &3 0P(P?0l380  04p,`$  &03 (P?03<0  04p0,`$  &0 000'Ȳ!2 (P 0  04p,`$ }&0 000x!t2 (P 0  04p,`$ g& 0'!$$2 (P 0 0 4p0,`$ P&0 000!1 01 0<(P04p 0,`$ 9&0 000!|1 0< (P04p 0,`$  #&<1 041 08 0 1 0@ 0<  咑 厑0P &R+3'! P<0 傑 TH0$y<0DЍOsꞑB؍e@vB@vB`8EcvBEcvBEcwBЮ8@{BwB,8"wB'wB\8l?e&@A-@`(pP$M!$[A`؍eP 0 0S/p@-X0PP L@@P 0 H@Q000 0p؍e@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` PP0L00H@40 400;\00T0X0؍eG-0MZ勗0 S 0pWЍ@L\ T 0E0 0 tP@T 0H0 0E0 0 D pa` `FV`!  ,fpG@0-wBHwBuwBP/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ/\/0 ASQ/p@-@TPPpP@p$00$/$0 S$ /0S /@-@p@-$PUp@Qp@@-@0 ( 00@Pp@-@s0 0P0 p!R \100 vB؍e RA-@P;bS`:pe@P PU0P SA-@P;bS`:pa@P PUn0(PPp@-P IP@ X0@p p@-@PPlTp00 00FS0d 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 hd0@DJ0000CS0000`VTT`p؍eO-pPUK `V#:S`F#V@`B @P< 0< 0 !000 000HLmH0H0`0000%PH0 }@P 2V2(0 0C(000(( 0 > P(@- c0O-rMP`@0 ``(`0 0`S`F 80000U V0  ( R(PE0Sv80 0pfW &R Y < Q<&0G 3SL <P 0F 3SH0L RP \0 = >R 3SH L0S P0\ 0  0CS fW< < 0CSSp10U 1 !N0 P H00 < 0CSH L0S,00 BW 1U  1N@rPp@ppWt 0q 3SH0L0SjU 0< pP7Ѝ<ppP U(0% =0S0%8000T   #RH L R!Y B/o" RY0@ 0C0pfV00 `g000 ; Y 1S  0 t 00IAQ00@0Wp!S  b000P`V PU @P@-P   Ѝ@-0000 ЍP/@-PPQp@-pp弓`P@Pp0 0` U Pe@wB@-@P@Ѝ@-  sP  Ѝ0bSG-@9p`PP2 0 i0 0  I,b0W`!V`! V `!0 1b0pGI0000CS0000@TWW@yP؍eO-PR``Ap0PPPM 0j@P 2 (`200V [ ?@P Q Ѝ00pJWp!fW\  W 1+#  a @PZP`F R[ 000R000 p؍eA-0@S" `;(0 S8ʸS C< 0CPHP[`P (00 A2(0000PP 0 06@ ya.pP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP 5apA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` 0l hQPp000D vVQ@%U 0SPpGW0pUv    0  P@ 0ЍS* v(`  B'(00C(0  B 0E 0S000 0 00HLziH0H00v p`F0Sp0P v B R ! 0 3SH L0SP0\ 00<0Cv S0!0  BR ! Y`wBo@wBwB@-L Ѝ@-F ЍO-Pi RP@  Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP_pJ^  \ RU [ #RHL RP \  $ #RH L0S0P 0 , B!R \  0 I0000H  0CS  B00Q 0    _  B PPZ0 1AP? ` q_00C0 00 000<00q@AG-0P p@P: 3  0 0  000HL%hH0H0`夀V0_xPP P  0  0 00HLhH0H0`_r@@ xB/-/-/-//-/-/-/@-@ZX-@-A-PUp1p!0@W`DS W c c+ePW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  IXP  g^W`P  ^^`G-4pPPP8 `@P 00 00 `Ph@ЍG-$P0 Sp`M 3Q0S Ѝ@50TZ @ 00040"0P 0  0SC20@T D@DT ]D2W? @02W+ WS M0PG1W0To 0Tl x u *H00@f0p @TV100C?o270 T:0 nAxTd@P# /0 Z* 0 0S0"7  + 3@ 0S L I Diiip@-@PPPU@` ]]`Pp Bp@- P`8@2<0P p/@0PppPp@- p 0Pd00S P0pDP<@80 @ti0@@SdeTdp@-P`0` 0@ 0AT 0S`0S@ 00 0pTd@SdA-@Pp jH, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0t"`P@@A-P@pM0`,PVU  AfVG-41p!,10RC*Q`= RY PP<*P00 /R0S /(ZPPr@ )`Dr@ |00PP 0,`8$0 PaU~<X~@<7$Ue@P?@Sd c%xB@-@P vr00@-@<o7l-= 0S \0LS   !,P 0Xr@DPr@SdSdp@- 0@0CS 0P upp@40,0Sp@-@P 0S 80 31R00 p@cp@-P40@AT ,ZP}p@@Sd@-0 00 0~P Ѝ0A-0SPp` x_@dTPP (0S ῌ@J 00 0@PSd0@- P,0@S uЍ@2pt ᚌЍ@-@ P$0 0\  *Ѝs@-` @P$@P,0PS E@U n(0SU 7Ѝp@X #!Q *@Ѝp0v@@c07@- e@PP$0sT@ 0$0(0S ԃ Ѝ0O-@PDM TP\DЍOlQ @A@AH1  g @00~,ap0 !@(0 0 <00,p$@ @@ @0 00< 000'>,0(p0$@@ @0\00 P0< 0,(p$@@ @@~PP DЍ@SdTd8%Be*xB c0xB^B@p@-@P8p0 o@P pp0s@-`PP .@=TePЍpPP` YhW0\S   @00C@0J 0SE"40040Td@SdA-p MaP 3/@Pٌ@P 0 (00 0<1R 0ᬌ@ Ѝ0 @P  圌  P0Q" #Ȁ!0 n@BP 0 @0@ 0QPQT 00 803/@P  PL@DRSP@cSdTd@Sd@-00 0 Ѝ䄔 O-pP0$M 0*@P_@P $Ѝ0 (00 01R 0 -@ L P03/@Pe `QO` ^VZ: UPH000 PP H q  l >P  @PP \ 0 0 0V  `ɋ #P *|0!0R:C P@1P `0S1@01@200 P@@Sd cTd@- 0000 00[Ѝ䄔 A-M` pgP&# Ѝ(0 ( W  R  0@P  V #@(0 (0@P0C(0P$P @@$0 0@-@MP P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0 M P A1Tpp 0p@STW qq 0Sqt0S? 0t 00:904#02@cA-pPl`@0 0S@0d00T T0T H0'&@P*${P @ec3eDc$e@-@ 0@DcO-3ܐܠ`̰PUV 9|N{0 0`0HP0\@P `N@@ p @@D\0 $`$0 ,09~U ec$e>܍eO-LMP0D0p0D 00RZ(Y`t    ""20x0x \20\2p0S@t0p@3080X00t004086 P x4S @t  $V .DpLЍ00 ?o2Y0S 9@00SL 40 S R08TC0PI@ZD Nt00001`7 DR   Y;4 10R0 D0p 3/0@S000Y1;ò10PD0Y[pYY T0P t0   ~ PayP00 R0S D0(0D0S 0c 0`(0 0003 R80 R00S3Q. `# ,  , R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6<00 $@ 0S@@ [fYu0o Ti h2 0{b W p00 KK@C0`H01`90 @$06@0<0S,0$ 0H`\p:XP#:0 P000L !4040T 00 0C0000 00C00 R0000C0 0SK (0p`D(00(0p'TY(`t0000 Y p{ [ p p0WpS@@T 0[00Sx  @@0 p04/'@(@#@ @p0c>e8I0O-@`'~X<\sZsXs0p@ cvDe R4400440(0$800<0$08/0 $Q(\A/8< Q$<  < 8 $ /0\A/0BS@-@`p P`X0$0X00sX0 P0 PtX0  ,0 0 Ѝ@/ Ѝ@1M/ ! ! ! !  /7 $0M/ Xp@-1 P@ 00U1! $ (0R0  qp@sL!: ,L!!00 !0p@A /sp@@-@10800s@@-@10>0zs@! !@-@msks@hs P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,05d0 0!!T0    !/@cddd$cDe@-0 @Q# ЍhQ:!<P, i` @%P 00@H 0TD@D0<0RH0@cDe$cG-RpP`0<  ( 07`{ 0R<8 P0D @R, @ BPS@P P {PP 0L00H@40B300\00T0X00 W 00 JX0ST0S@L@T@PxBG-@R`1 0)!{XPP2  IT@(0 0(0PQpXT0S@L@Tp0pWP0@ppQPt@T7xBA-@R0 zp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PxBA-`@PpTXUd 0000 0R'X 0S UQ 1QT0S0T0@1Q U? 0 @P@?0P00@pU. 0#! RQ  3SHL0SP0\00<0CR1Q0I 00080 080L@ATxxB@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@hQ/T RT 0 0SXp@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@.p@-PL@Q``UQV 80y`0S0C0000800C80Q 0S L`L0SP0  RpT0pPE4{.L`xB@-@@0S87@-@P1 < @#0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0cp@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `2@P 00000111010044P0P041418181@1@1D1D1H1H1>00 P -00111100!1.01 0.000003/P %V 101~Wp@-L@Q0L00P0T0aPL0SO-(ppP U [  v@`(@P U U ůPP  H@L BÌ\PTX0&( 000P 2 G2@yB@-P `@P   KGЍp7@-P@000T Ѝ000@ù0s@-X,`0 ( P@\  o0@00U Ѝpo@-P0P@-P/ R/@- @@T@芹0(00M  XЍp5nyB|yBp@-P@e Pp00Fp@-@ 000S0S P A-@pP`V fp壯CRp0S 0`V`x` 0S G 0S 0SDC@NeA0~6P APecde@-@5p@-0@SP 0S%Q㹯0S 0S PRP0@Pp0S@`Ư00d m P p(cPeyB@-@P,80 S 08  @< @cPep@-@PpP֮ 0  p@(0 S 000Pep@-@P΅400C40 p@l\ep@-@`Pwu 0 ` mAp@=1M/ @- ^  0S 0S00!m)yBA-@`pPP 00S0pO-n@PmcSc0S 0S 3 cpWp倓pW[^Pmc<0880}X9qH &[p0 Rq  o4Rl 8 Ri m( RcpW`  2Q[ X  R  @ 0  0 ?=d 0 5 Y k [ 0SXpБWQ{(帑X 0娑X  8   8  0 0忭    %  B 0 R d0S 0 0@000000hkᕭp0Wp. 00 刭(0S 00S 8 R4 S 0 0S ᶭ pyBcPeEcde@c|c`90S p@-0S pP@1` 0 T 0S 刭/O-PM0S@i@0%@e@`0@0  p :0e`PR 0,0X000`]4,%@P B@T ,bPOO20@עj@00@0(O@i10@0$0 00D0, @0_@P O\ TK0 0$pbO@00@0Ѝ @O-pDM@0%@(@0@0P'r ,:0`P @ T0,00` ]4$@P  v @00@0DЍ0S&@!_@P勬`VƬ=@ 0R 徬)@HO 崬001 0P @`0S $$ 9$0$0@0@01`0D0[H[@0L0@0@0 DD9@00@0 `@P 00S p@0@ 0 v 0Sln/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ Pm0 00!'> 0`,`0 08p4($ PV0 00!'> ,`0  0 8p40P($ P? 0!'>X ,` 0 08p40P($ P( 0!1 ,` 0 04p0($ P0 00!0 ,`0 04p0($ P )``$@` @0`@<P (jDЍAPe(c(AyByByBb9yB0@-00PSUP`- P!0 C  SJ,10SF @P0S S S  @0R00 @0R 0 0@0@ Ѝ @0R00p0S S S *@@0@ D@@00S @*@(cO-pM00CS@z#0a0N P$@01 Rr $Q[ ! Pi@P 0& [T^j(@T R 0P 0 P Y0 00- ;j X)+ ⩝   0  cl  ll Tj  ᘪ4  B4 Ӫbh0[$@N 0  Bm#Ѝ@(@\eP/ t`9O-@S4MP` 53100S 1/ 4Ѝ x5Rp0WWpG'10 000@585{5 0 SpP 7  # 0pp01Q+ 00n@ 0S*#j 0p1qp00S0[7 phP (0Snh$O $  (3( 0,,'0044$ 0 00Gh[ &   @0 L00T X 40000 H@ 0C00P\0 00SP 0S0S @ p  X@ @ @0 0@0 ӧP d" 03/@ ۧT  ?P @0 ,00!0C00!, 0 (00  C@0 ( T 5 1R0 S8X P 0S ==S 0S=9pP0!@0Wp  09@0@0 jP  03/@ r0 )P7 10 10S h0S Sk{x(g9@c(cEc\eyBc@yBP P// R0@-@d !0  000R  0 /0@-cMPa/@Pcߍ0R@-@ 0S R0a/@-@!0  R 0  /0@-R@cMPa/ cߍ0P0P0S p@-@`P4OPu 1^P*^ps@-P` !@P @*KЍp00@00@s@-P`f@P0 @fЍp@-KP00KA-@`p PZ@P <O 1^@]@-P` pR!@P0 @J Ѝ0@-00 Ѝ@0@-00 Ѝ@s@-P`f@P @6fЍpA-@`p\PO 1(^@|]T @@-P` p @P0 @qJ Ѝ0@-00 Ѝ@0@-00 Ѝ@s@-P`.f@P @eЍpA-@p`7 P@Pi 1]@/@-P` p @P0 @J Ѝ0@-00 Ѝ@0@-00 Ѝ@s@-P`e@P @eЍp0@4SQ@-e0/yB 0(Xxe(00gxe`O-QM0 | @ЍЍOQe0R 0 0p hW01h0#0@T_WPUY b^P^PPE0PbF|带P@T d2`SPL.0 @ [030#Z0S@x 23Ph  0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP+#%$%U  0&H & 'L ')(ᝦ  nPVU0S' 00S 0/ 勦m0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#PlxeUdTdHUd@c0P R0 z/G- P@ U `D`00@0$V0:Pp 01S )0 H0L 0 H0P0L T 0P0 T %R0XP5\p5v`Pl0pyBzBxeTd0P @-P 8P/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd/P 0%%#3/xe| `0R 2"-D | 1# H LH RH P LR P Tdp@-P`@TQb00_Qh b_000S<@@ @DD  S d C F0SpP!p@cxezB(zBDc@-P3 0xeO-3#CDM   @Z0S00   8 < 8P`cP$PP3 00@3 YPP PP00#3V[003 PP PP00H[ pRԢ(kHg V""0&5a V00 S"0  0 ,1T!Yp0YW0P<"[x 02`  2!>L0 ,00! ! (0 0 00`$ @p'1少 01 00` 0,p(@$ @l 0lQ!h1 00` 0,p(@$ P @y 0E 0 0!1 00` 0,p(@$ @y0E 0 0!0 0 00`,p(@$ @yDЍO>0  c9xeTdUdBzBDcJzBl?ejzBpzBeXcvzB}zBHcUde`9FzB,eDc9zBezBzBzB9yB  @-*0Pb@9xezB000V-P @P\^\ lxep@-@P0  pYp@-``BBp ,ʠ,V P\ 0$000 0T00p帣T00T0p@9@-@P`XHX 0"00000 00 t00 0zBzB!CeUdG-p`DRDX($0 S*ţ [@P8 j000up S R E0$ 0C#2 BS*p@TX@( 0`00hY2003 D卣B?,G D00 0?P0` |@TX 0#0L0R    X@mX 00 000$0l0 PSp  p p0l U *&=Tdxe@c4eep@-40P (aZ@P <UP00pxe@-@ X`@Xp@-@000pX05000  ΢00;00)000 Q :00`P =>09#900S? ) 0R9ڜ  I S `P 40083/咢0` =V0 %%ĢX 0S 1pp@|Q t  | x x |000900000 0S"qXw0p@ ZxS0000 |  @|    , 0C1p@IXꔐeTd0UdxeUdp@-@P`0Mp@jTdp@-@%0  `<00 01H PU 0 0N0p@/0 Ep@Xp@  P8 9l0Sp p p0l O  @P  0!P ?x E4 PllpA d0ic1p0 !DP00Tdxe@-pM(pp@,`PP+ 0  0V060000T0#T20T20SrP V0 0 0 V0S PЍ0S P 0 0 0 rPrP@c@- (pP @ P@P $0 7<`P Ѝ`U0@0O-0Dp`8 P @ Pw븀4@<0Y尞@P@0 <`P Ѝ [P ᚞ 10 VR@`0@0TdA-P`p@ 09@P 0 p 0 0(90jAEAbTd0/xe202/@o/ 0R:****1//p@-@|P0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@!Ud@-P`pAT 0S *1P A030#A(0000S  ЍA- P$`@ZV Z Q+ a 0R010 ` '៝0 S(0 1D 0 (00a@00C@0͝U *AA 0R010 0A UUdDVd@-@0Mdq`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4W*0 00000Ѝ@@Vd@c8eEcDVdep@-]@L &Pp@ PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0UdEcDVd20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0i "!W]03 0NP D!00000  `sD!000$YX)00`V`W`V D!@000t @SD!@000g ?`EV D! 00 0D!@000Q80DVd@c@-900pЍO-0$ML0  82p 0S *("D!000,$Ѝ@ FH0]`V =P z@ 1s z6 1sP` @N0S2  1 I00>0000@001 :#:0 1!rd 0N P U  MD!(00(0P` 0~P@ U 8D!000$pW.D!000V UH0PpD!000DVd@cO-d2P 0$MS ao@p&H0S< 1su@2~K@M0S2  1 I00>00ġL001:#:0 1!c 0M P HD! @(00(0\$ЍA81T 7 !D!$00$0K2 @ *0.SY Y+0.S (0000S X 0 0CX:00"@ *&( [>@T X0 0000$ D! 00 0 DVd@cO-Mp80 0 0S:RP0b00T @ 0 Sy`0cV`V``FHZS嫚Ws oR` $@ 0 80)0  *' P:#V 3#|E P0(  0P0D00`0D0yDwT a_0W 0 W9 .R6 .R3  ! `1s ЍOo 0=0P0 Q L  L 00 L0`V*= ;N*=!R 01a@ЍDVdUdEcG-`0 S@Pap ZPp` Qq a G0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ@@-0)  0?Ѝ@@- 0  Ѝ@@-@10,(p$@ `@ @<08 8DЍeN{BU{Blc]{Be{Bm{BA-@P0S`Pp0S  ! IJQPW\PQ 0L 0000 0C00S  ! +J긙elcp@-@TpP`Pz⁗ 04R00 0 巗J00peeȘep@-@`T dH@ 0 StPz\0S 0R00 0 0 8000R 0P0@儗@pȘeeep@-@P900C0p@sꨚeO-`40@SPp0I  0SBQ  0RPCS 4 ! I$0 0S1z1000 0PS+9Gp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 00 0R000긙elceeA-@p`PUddG0Pp `P00S 0 000$ 000 00PelcA-@ `PY00pQ*U0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAt{Blcp@-@0PS`#00\ p0S0S 0S0 0S0/P: P/O-EM0@1 `Q1P$ @1100(0,0`V4`990S00,0V@,0S  C, /  C@ UK0@TK@0(S,0 0P 8U 88Eߍ880 =P@@p@@0, (p@W=0S K@T P`= I@Pp@11 00S  pI@P xK0(0 :@0 0D02< (H00L0R C0\ST@{B{B{B{Bp@-P@@0Sp0700P 0S!!//O-1@P P 0+ӯPP@ pQ@-@@P 0E@-0@S 1000p@-PPEUPp@1PpO-M<00`$008, 0000 $0 @0C@0000wP@ <0$@S x?0S 00@0;00 800000@T 0S 0   f?C0 P 00P 00001$@@Y 0 >00@ /Q 0S  @/0  P 0S  @ 0 0T 0 P /0P /0圝00#0S 0p- 0PP 0 pQ  01 P 1PRx 0 upRn oj0 D@00 00 R000 0: 00 00 0 /R RH@D  0Dp@T0P 0 0000`0"P0     -: 0 000C0+  Q  000T0 `0P `PO0 00  ' RR T哴/ D ` H [aH0S R 0S 00 C0H DPMH00D000S 0S0*000 0S C0S ..00000050SM /P 0`0` R   W~ UeT<`P .0`0 0 000` PH ` -[^ DP C Rf .      $0 R   000 000000$00$0 10 0K0S `00S`0SP0`  G/P`  R Q0  `P6/P 0P 0-/TӳY[.DP` -[H <C00DH0D 3TP G.SO009   R C R C0.0D00H0C0S 0C0A 000 00C 080S0S 000(07S0$0 S$ 3000 (0@ i>P @DP -- .L0 `00K&0Lp`t0P@dp@f(0` k@@[ .px~.,0S50S 1 40n.,0/@ 0 P@R 0  {R P0X@}T }@' 0/T 0X k@/Th HP`40  [ */T P P 0 X0S 0X0SM 0X0Sa 0X0S 0X0S 0X0S 0X0S 0X0S 0X0S' 0X0SC 0X0S] 0Xu0Sr Pl:96/T0X @/T tP  [:*/T lPP/@/T0X2 5@/T2 0ZP* 3 0 S* 0/T P P200/@0XO0S    -0 0 S%:-?/@/Tj 0X @/T T P D  [ */T( P P=/@/TT0X @/T P40 1  [ */TPP/@/T: 0X @/T pP `  [ */TD P P/@/T$ 0X @/T P0 0 S* 0/T P P0l/@/T 0X 4@/T1 P)  [ l*/TlPP/@Ԛe@c|BWe@c9:B|B1:B|B :BXeXe9B+AgB|B*A:BWeWe9B+A›B|BA՛B|B/T0X @/T DpP980\  TF  [ .*/TP PT/@/T0X @/T NP9o80  TE  [ */TP/@/T0X @/T  @.P_9W8/@/T0X @ 0/@ /@/@@ 0}T {  R00Ǘ0 L00 0 D_,0( 0 00/S+00S0 00 .R  .R0/S0 0 00+(0 0 /RC 0D0+0H00 00S D0H 0 090H@DT{ 0TP C0S8 U+0C00D0d+ Hy+0D0SY P) H  Q   4 RK 0CSHC0SC 2+( 0 00 00C0>><:6+L3+1+   R& 0CS#H$+000000sC0S +H+00000000S: 0CS_F++00 RH R=0C00D0@P *D@D00H00 0S $0 Ѝ H R /&@-(0M00    0 00  i@ Ѝ0@-0M(0000 000000000  M@ ЍA-0@P0MP?PX/PPPR`(p,0P0,004P 0`,0P:48 (P@p`$0^:PP2804 Q0C00 0,0ɀ,.Q .R: :9,0i*0 0PS 2=00U P `0P000@0Ѝ2*0S P **P ,0 \*/ R0S ,0 0 -`P *VA- 00S : E0pP`900@   0S P )@00WP@.@P )|B|B0@- DMP ^@, 0^ 0^ ^P  LE 00 0>7U4PP00DЍ0@ @}BA-P`p@P P 0 P0 A-P`p@P0 @Ѝ0 G-P`ሀ#pᓆ@0T00/ 0P0TƆ傆1)P 弆@ ,PV  6/P 00S0P00P0塆"*P07@- 0PH @P  V C Ѝ0+}Bp@-P```@ P@9 @5AH  / + 0!pVde@-@aP\<0(H0P @B"긚ep@-P^"@@ b"@pbp@-PS"P@@@ Q"@pQ@-@H"@A-P`P 00묀p@T00 0S0PPP@ 0S@%V P@ᶅVdep@-@Q `P @ P00S Pp ` @V opp講ep@-P`'@叅0 R000@00P0…@pp@-@%P 0Pw 0R 00/ 0P0嫅p@'0A-`@VPQpZ0000@@@呅VA pI 0R 00/ UPO-`M@'$Pرء$00W8PS8@!OCAd@ 0|P p?oU20SR XPUPrN0 S   '* pW ,PÚ `9pP : 'WP#( !<8p :WX R0 R (P H%P ڔ  BR*('W ЍEc@cgfff@-@iA0 !!|0x0t0l000, !  ! 40 @P@AT}B@cddd4keBB 0 F긚e0F긚e0(F긚ep@-P`6 '0P0P0P@0PP0`_ L0 0@0D偄p@WdeA-Pp70`Vq@ Y@P h`00 N/ V?U 0WI=.zPd0$0d0NPP @Wdxc0(hF긚e 0 (F긚e0 (F긚e0@-0MS@PW@P@ 0  gWP W@P@ B&Ѝ00@-@P0VP0S# S  Ѝ0`@P 3qp  0uP 8`&VUP0P (`@0@ R/"A-P` ⑃1@S0101p F@ 01$@} 0Sh巃AqAXA豃 Q PQ1@010긚eVdĚep@-P&000@ 00O,0$ R @@0@元@pVde@-@P H49 0$R 0 p@&Vde;s@-P`@P !0R!0RЍpA-`pP@PЍU$R0*XPP*R0*C-cMP P P8 P/d3qpTyAH3 sr* <"( "gAS QP* 5@8T m?Ѝk e?@2@PP( PPR D0Sd00Cd0L 3/d0@P0Cd0G4Pb@H0 4R90d00d0 @Pd Arv@T8専n0SK婂U ?bQ@TA圂? ? P(1x ?d?O@ PQ,* b5 8%D0S d0 0d0qD03/ ,d0X0Cd0 Bbh@h0P>h@0 P $ 00$0%0$0@嗁Sl]ef}B@c}B}B@De}B~BD~B(cAe~BxcWd~B~BA,A~B~Bl~B|c8Dep@-Pv%`@P,P `ށ 0`  @@p@VdeO-0dM`删匐0@ p0 3@P dЍ0S @  @<PP @03 00 00@PM80 gpPp 0剁 @PT0P00L@$@(01T$@T8P >$@P  @0S 1$@@@0!@P 8$$0 8000a0A8P$!P^  PB62 RB L0S=$Y: V V4@a V  V l P $ V \ V # # N [ # @,0V# # 00 #0W7;,@P #0 0  hP0400W )BcBcep@-P`嬀\0@T Q   4 p@.$ R R @VdeG-@UpP3 P000兀`@00  50'00& PP( 0@`000`A`0奀W 0P440PP !PP 0净0`0V0PW_pW <k4>zV  #MBVB7@-`0P @P  P N?U.00,V? ? Ѝ0긚ezBnBO-pP0$M`! 90@P $  ] P N?U.0  V? >p V  V<V X<X L<s@P $Ѝ踚eBAzBBB@-@s< @B@-$0C00S@@c ked0P0S R 0 R 0S 0S/00긚e@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0yЍp@-@H0  9PH0 0\10H00A PA00Q00@@@pؚec"0O-DM 00(00!1@p`0< 0800p,`$@ @@ @? 0'Q!18 P0<0,p(`$@@ @)0 00!018 0<0,p(`$@@ @0 00!08 0<0,p(`$@@ @ 0!0P8 0<0,p(`$@ P@ @  "0 T @j~%DЍO0 0@0ؚeHBcAB!B*BeO-phQ`PM@8SP 04PP$W H~d@T`@T!~ 2P P 0 < tP { h~ PЍA @0 < tP03 0<300N~0 ~% @ Td O-`P0M@ B2 b061(" pN 0 00@ 0 H4pP}ؠd@T`@T~)R0t0 D 70P s t0~0pЍ  @)R0t 0 D 0P  @Td A-`00V@YPᘥ 0 P3p@}dPU}V 0t  <300} 0&R0S fP ЍPe}T0SdP}U2Td4Bp@-P@N P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0Po Ѝ0O-P`㸀M v 0UЍ'J0J@V@ V d;   0PP Pz  Q1PBp@-@P`|p@/}eH0 /p@-@DP|H09H00 Q1  . p@}ؚeep@-l t0@SP Sxxtx0t H0; Sd0S0000p@!CeUdp@- t0PS@ Sxxtx0t H0; S `@0St t0x Px@pd0S 0\`S S PP  0S 0@ d@z!Cec@-0@  R  R / R      + 8 R QWؚec0;0/O-,MP0S`0Q@`,` p0|0PU WI@@hP  V   0'04` V`pL|@,Ѝd dA| ` {d V Bd 0p@IWdxcG-Q-PBM:p(1SP5R`<1@0zN@P@)@ `vO?P@DK . XP :Ġ Z P 2@Dn2@Bߍ   ๙PP ⳙPP | Tt @Xd@- @x000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`PD Ѝp講ep@-M`P@0(@0 0`P. Ѝp講eP0/@jB@-@aM |q0U d40 H0`0L 0/0 4 O $70$S-! !Q p 7\0 0X07T00" "7= 70 00dt7`P`0FSX7 4L7aߍ7@t@OAABrB~Ad3ABBހBBB,A1B@-@P (}70Sv7@0Ad3Ap@-PHzD0@T0zpPh@d00d0Wdxc0P/p@-P@ p 1Fx01000.%/&.%/&  N+VU +# + 1|0pO-`$ML@PpH NP0VN 1U㬁$10SI  @?0P 0H<\00  ᑢY  $ЍP P1 ! V0[ V I08/P 0V+cW p 0V8/P  H0UNR@4PP0 05/P +` =Ԛe0@-p0MPU U@ UPЍ0Ѝ0@ /00Ѝ0@DWd0    4 6::0070/0/0/ؚe00/@-/0 0/00/00/00/00/0 0/O-QMp0a@PBy0` |a0S@l@@T&WXH!D1 @婹4y0  0S80 S 00BQ0Bb03!P 0S T( y '!P0   - .y0S T !yꐋcؚe@cEce 7B-0/0040/0H0/-L/0P0/T0S000/p@-P $0D@$@@T@px$@ @T@)yep@-P@xOp@yep@-@,Px 0 0 0OypeQ3XO-M  @ (R0巕@PBU1# (pU< ` P``0 ]@P 0嬖@P( 0外@P  ,垖@P@  ☖@`0V 0U ߍ`PC-$M@`100 00(00@ 0 ( 0P1 0  !00 p0p1.p 0z.pP  # 8$ЍT    9p 9@p@-P@`M$ !|`}+Ѝpp@-@P`M< u!! j+@-Ѝp@-DMp `P>@P 0P,@@00PH(4@P DЍ .@C-p`M!)+PP*0@S+   0P0`'0[*PK0  000`0&0M*PK0S@! @+Ph-ЍyKxA-Pp@Pdu` 0/S 76@P0 Ѝ0 sdu@ 0/S 5@-pPdw`k@ Ѝ0/S 6@P000W0@/S 5A-pMpP`@PE?`00\@4@80'4d@P PpЍHPJ0S@0!0000 00!0$0100! `(0 `r,@P E*@P 0`F0`@-Mq` P9@P 0,00000@0B'4x@P 0S ,L,0P@Ѝ@00@0$0, 00:#:D0@0)@Pz@-P !M`#q @P 0,00@0000&4/@P @T ,,T ec@ЍG@0@0$0 0 00+8+D 00, @0l+@PE.@c G-M⨀`P p@P @P0@0&@@P($pY ,H0SD00 SD0 .R0.S 0t00Sp280x00L0 0P0~&L|@P0d``PSx08x0V +0tS00.S @cS0 .R0.Sm 0W@V0T03/@PP0 `@P@U `PUX @5 0R'S)XD X 0S#YH 0RD @P 0 8 *0@X03/  ЍS@@UV r+p+0X03/ +zU v8 + qo@@@8 @-DMPp @P`P @DЍ0,00000@0%4@PP0!0S U@0SU  @ , e*@o @, )@,*UC-1@3p MaYP9+ 0J@P,e@P'L10S 8 Bկ0<00@00000d%D@P (0S" ,<q*,(0P(@{Ѝ  SP @PD0P0$0,( <0P0T0< P0*@P(,@cWe1B@-@K@ teO-LM05@`pP$ P.A8. $00pY[XX |0S0oS  %(p0|0|0H S4*| ` }PA 0S z$P6Y( LЍV0 (⚖P Tx4Q (`(Pf0((0pP 00 ((q(pP$P `! `G |0S 5$P @ 00P00:&P0 P0 t0 M850|0j 0M( QtZ[| 0  |0 P0Bs0S J5ts $0  @2 0   0S 0p0 0%PT PO0s M8M( 0% 000010! 0 000 |0PV  p Z ( M(  A +#R"0sZTU 0 xP V90040z   R +Un 0 \Pf V000|00 `0$PS `-@@@'Bew]@BhB@- 0 0 0000 ЍA-pPMx@P 0@00<@@0#D/@P EPЍ(`?P(0 @@0P 0%@P 0 0@ Y@T(Pr0S jIses@-`y@PЍp0rP @00!*0@P000rC-P@ЀАpM0 0T `P hQ! T@ ]/0 /!bR0 ֲ0SPU 0@ Ѝ 8:׿AQEcB@-@-3\M` @P 0P0 SR:R:@S:tS:S:T:0T:`T:T:T:T:8U:dU:U:, `E@P,  1\Ѝ P5 @P R@$ P$ @P$ ( P !@P  @P(  p@P(  @P  @P@ `@P@ @ @Pp@ `ߎ@P @P@ 0000 p@ `Ǝ@Pv @Pp  ӏ`@ ⴎ@Pd @p=+`ᤎ@P 5P x@{Z@D@@-@M 劎P ЍG-@!MS$ ` p! WP0O80-[PP%W$! P?@0Sp 0S<P0@0 P ᝙U Ѝ ^P@ Ȑ  bP00/S S 80SP +4@+  Ԛe|B@-PX0M`p k@P 0 0 0{@ Ѝ@p@-@`L 0P@P @xp @-PM p`/@P  04 00#0G@=/Ѝ@cp@-@`LS 0P@P ˎ@Dp O-1MP`@0D4`@ p>0 0kP*[0$0P 00 00PU@ @0 3/0P@UT@H0@00.x0ЍUT*0 0 0P@0 3/0P zP P@ |B@-0 000Ѝ G-p`.@P.0 . 0S@ !u#PPY %$@@0S&   0P  PfP @z.Ѝ @ T  Z@ TG-0Pq$@!@`P  PPP%}!$@! G}@c0@-Mp 00000` 0!@Pi.@P 0lP0S r%@.Ѝ@!"@e%Tp@-@MP `@P U?000,@@04@P @Ѝp000S@@!"@P4%/0s@- Q@P $P@`R300壗Ѝp0 0p@-M 00000P 0`G!@P0 @P?ЍpG-5(M@L` CP@ q$$/P 0 00000 0H  0 00 0@P $ .(Ѝ $0R  .$0  0P$00PzP$$  . C-p0MR`P0' mP 0 3/@mNT T+ 0du40000 000@S -n@ @P0/S V-@P0  Ѝc@-p0@ @`PP @ (0 Q@ Ѝ@c@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR0`00BS 400S03P R30Ѝp'! ! C- pሐP@``V`31P01 0@PP  ЍB0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@~ `PP00S!3 T` TSh @Pb0p@-`M 0000 0P@P @P T0P00L@$@(0T$@P `Ѝp8`p@nT  ◊@P`0 0S030夋@P 0S@3:嚋@O-P0!M0#q` 0000 0|@PcUPd  bO-@PX  a@PF@T0SG  m@P  S @P  -P 0S-@*# 0$  @P  0m0X  X Wm 0 P@P" 0  ,Ѝ-@@@c@- x Ѝ@-M pP 0`@P @P`@Td@Ѝ@-M@ 0P يЍA-M P` 0p@P @Pp@T 00 00@dЍs@-P@P 0`00@P 喊@ Ѝp O-P0M 0000p0 `w@P   @PpP @Ѝ0@00@<0D@PN(`V@P$0 0АԀ0:#:T0: S"  S-  S0 @,<!,P6 V, ) S  S0xy,P0 P0< ( 0,-(P0< P@P ( 0 ,<C"@P ,<v!,y @-@# Ѝ@@iЍ@- c Ѝ@-!  Ѝ0 cT cp@-HMP\0  1 1 0+@P+X@P$0`800 @4`0 <F@P 0$S@0S 0R@4 k @$d!$uqHЍp@4!$ 0Pf PL@@@-; 000c0 Ѝ@- 0;0 00Ѝ0 c1 0c+0(00@-DM @P$P0@,P00004W@P m0S00, 0P P X@DЍ0  ,f!@P ,  0c 00 c@-0S@`@P)0P @ 0,Q@ 0P000 1/@b)ЍpC-pM`~)PP 0Q) @Ѝ 0,Q !!1/@P N@@4)00@-MA0 0@NЍ0C-pM`F)PP 0) @Ѝ 0,Q !!1/@P xO@@(00@-MA0 0@OЍ0C-SDM@`p- ` U_E_@P"00P,@@0|Q4 JP 4P@P zWDЍpX@ cl`@`  @P N@0@-0 c Ѝ@- 00 Ѝp@-@M` Pe@P0P,@@00Po4@P 1@ЍpP@ @-0 c Ѝ0@-MPP @@0cP Ѝ00@-MPP @0cP Ѝ00@- 0MP 00P@3P ӇЍ0@00@- 00 cn Ѝ@- 00f Ѝs@-P@0` @P u@_ Ѝp@@-P`B(@P 0 p`@L' Ѝs@-P@0` @P J@4 Ѝp@s@-P0` D0D0 0@P B@0 Ѝp@@0@-0 c Ѝs@-P`'@P0 %@'Ѝp@- 00 Ѝs@-P@0` }@P  @ Ѝp@@-P$0` L0L0 0t@P@0 )@ Ѝp@@0@-000 c Ѝ@-PH0` B@P00 0@ Ѝp@@-P` '@P @0@5'Ѝp@-00 00 Ѝ@-P` l'@P 0 00@'Ѝp@-PD0` @P@0 @ s Ѝp@@-PH0` @P00 0@ \ Ѝp@G-M0`@S11\p @Tz0s_r 0s0Sp 0PPp?X0!(PP 0 SP? P0UPP(0 s` 0 s pUZ0!(00PW  0S  PP Ѝ 0sP0PP@@p@-PM`&@P @0 @0c0 f@K&Ѝp@-  00 0 0030 SЍ@-0 cHЍC-LM@hPP$ l0S (⪄P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` /&@P @0  00@%Ѝp0@-0  Ѝp@- 0MS@$P0` @Px20S@ b@P!@P #!@ Ѝp@p@-P@%0P @ 0<Q-@ 1/@%pp@-PM%@P0L` 0 0 v@l%ЍpG-PM%@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  7@-%Ѝ@p@-PMg%@P0L` 0 0 @i %Ѝp0@-c 000, Ѝ0@-00$ Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp%@P 0 @ 0 @@P0 04@0@0S 0 00$ЍWe@-,0@31!$ `@cp@-P`Mt y@Tf0@&0S00P0@PSЍp07@-<P T@P@ Ѝ0@O- ` 0M&J0 S1 0C 0 p $@P 0  @ PT 0S@  0 @/$@Ѝ@G- `@ 0p%J0!S B   a$@P 0  @ PP 0S@  0@_ #Ѝ@@-@(e$0S( ( (0$ @eWd@-@, a0qe,0$ @R$$ ((0eWde0S ( #P QS//@cA-@OexPx` 0S0hP 0X` %p0S Q R$0]YWdee0@-@ 0 %5@aeeWd00CS0/@-@P $ 600C0@ e0M, 0S00Ѝ/ep@-Pp0 0AT 0S P 0SP@p0S000 @eA-p䀟3AT d`Pe0S @000dPU PPhdX0 $3`U3@103 P000 @@cWde@031SQ  R R0/0@cA-`@P 0pS00%P P 00 7%4%V L_dDPD`P 0$0 dxWde@-@M @;d@ 6da|^$0l 0 ` `0 X 00  , $0 ЍWdeBB :H:EcB1S/p@-P`t dAT`Hd\@Q p0S `` ```@` $+WdeA-p` wP0@p@pPP0PPPc 0 0! AdWdep@-P@`c0P 0 1S 01  0S 0 0000p@cWde * ' $G-PP0S0C00q0S A$0SB b$c00Gc`c3}?@T cV @ $` R   R  R R R @ 0S  B 00 0003``}?00G$eWde@c@-P0S003@oѠ@c@-P003@o@cO-`P@& PpW@! ̀c `#뼐崠@TW030V@ @00 |=@P WdP;c0U 0S  3R  P $@eWd@cee@-K0@-E@cWdp@-00S-@ `P4@P V\ McP#@b@P (bp@@ @꬛eWdA-@t`pb0@00Lb+Pp `B0S0P0P0`Wdp@-@P`b@b)PXIp0S0 R S   B3pWdG-0 PP;0`0SF6P ,10S00@S00" 0S) #2b`p 0S00ibpW`0;00S0C0" 0S "pb0l0XPb500" 0 3/`Pp0"꬛eWdee7@-P-P00@1S  DP[T Ѝ0@-@-  RA-P`@Pp  #V@ @A80V@H034,e0P R05/p@-@@P0SSpP@-@ P T@pP P p@-PX0 0ATp 0R 0R>P @,eG- P@( $U `D` 00@0$V0:Pp Wa01S a0 H0L 0 H0P0L T 0P0 T %R0XP5\p5ޣ`P0p꾃BŃB,eXdA-0@S`; Q@*aԀpX<`R0SN ؀0V0@0@@000,1@g A 0R1@D^0S  B2 S3* 00"#R 301%0@00P-R00- `0S00C0 00@0@@V0@"AaXd,eEcEcMb@XdփB@-@`Q00CS5ya ⬈U}7@0@ t,ep@-0 t@- ⍈/a0p P"W7T@PM0P00 00""00?p,e@hBXd0P/- R  0 RP <04Q0 4R/00C-@2 TMc刀pZ0S @600l`('`H0   . b?H0<9H0Y`m 00@SPP0S ` uP>`L0 000P T 4P 80S -40)89/0 x00CS3dn`P !0SP H`0S h`_0  1S01  0S00_0U 4_t0 0000_0HP00a%_TЍ@cXdH@݃B,eeeP0M0Ѝ/O-@P`㤓夣夳M 0R0S P00 1p V 屇U _$S_Y`P _AP00pQ! PⲄ WvPX0S "P0S&V 假U g_#_PP00`1S  FP≄VaVK0S\0S~HЍL Q00U 1P 8_^U P U PP0 0 0oH0 0 V hP_̆^`YH0   . b?H0 T0 0C04Ѝ@-4M@L p  P  `H0 0 $ 0p  p0T @4Ѝ(+ p0G @ A-`Pp\0 ' -P@0 00+ @VЍ0 001/ᴛep@-@`PP `!PP p0R X00X002SC-@ M0 0  PP唐Y0`!aY0 ЍCЍp@-@`PR 00@T p@R>@ A-p᠀PR R @  0@* @R@AR V  p `0 @R W`G-P8M`@\`pgU+ 000 00@T"P0!(@,00 0 ! X  ? Y 00 (0 D00 !8Ѝ@ 0fB@- @dqP HiP ,aP  [PqByBBB(00S/@-@A@ WeBO-4Md`pXP\[ 1 00000YS@) P)@&0 00U@! P1$ P00(00 T妌1 00 0@ E`0  4ЍBA-`PpX 1-P1 00@ЍO-P 0RP  0  V@ @@-PGM`p0 &s@P@P  @0 0 0@TGߍ@-PGM`p0 s@PP0 -@P  @0 0 0@Gߍ@@-PGM`p0 r@PP0  @P  @0 0 0@Gߍ@@-PGM`p0 r@PE@P 0 0 0@Gߍ@-PGM`p0 r@PL0 @P 0 0 0@>Gߍ@@-PGM`p0 }r@PL0 @P 0 0 0@Gߍ@p@-PBM`0 \r@P @P0 T@Bߍpp@-PBM`0 @r@P@0 h@P0 7@Bߍp@p@-PBM`0 "r@P@0 J@P0 @Bߍp@@-PM`p@P 00E@;Ѝ@-PP0M`p @P00-@Ѝ@@-PP0M`p @P00@{Ѝ@@-PGMp`0 q@P0 @P60p 000 0 00[@ST0 -T0V@0Gߍ@@-PGMp`0 q@P0 @P0p 000 0 00,@$T0 -T0V@0Gߍ@@-PGMp`0 \q@P @P0@0p 000 000 @ T0 -T0V@0Gߍ@-PGM`p0 .q@P\0 V@P 000 >@-TV@Gߍ@@-PGM`p0 q@P\0 0@P 000 @-TV@Gߍ@@-PGM`p0 p@Ph @P0@^ 000 @ -TV@GߍA-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00I Ѝ@C-TV@@A-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00 Ѝ@-TV@@G-P M @P&0 000 @PV0`W0 pG00 0sP P!00b  Ѝ@\ -TV@p@-PBM`0 p@PP0 6@P 0 @-TV@Bߍp@p@-PBM`0 o@PP0 @P h0 @-TV@Bߍp@p@-PBM`0 o@PP @P 0@F0 @ -TV@Bߍpp@-`0@#2000FSPVPp0PpV00p@-@P[M0 #p@Mp@-@PMM00PPMp0@-P0M 0 0P@P0 03/@Ѝ0@@-000 03/Ѝ@@-000 03/Ѝ@@-M0<00  3/@PЍ@@-M@000  3/@PЍ4@@-4000 03/@P~ЍP@0@-0M00 03/@{TP PL<0 0R 0G#LЍ0l@e@-000 03/Ѝ@@-000 $03/Ѝ@@-000 (03/Ѝ@C-0M p08@P% 0"sr`@ P`~L $L0 ,03/VP T 0"Y0 3:UЍ`@@-M@0000  3/@PЍ@G-M ` 0@P P 0 p6L $rLP0403/ 0` Zp@@T Y0P3ЍPp@@-( "!0 803/Ѝ0@@-( "!0 <03/ЍL@@- 000 @03/Ѝh@@- 000 D03/Ѝ@0@-P0M 0 0PO@P0 H03/@#Ѝ0@0@-P0M 0 0P7@P0 L03/@ Ѝ0@@- 0 00P03/Ѝ@0@-T0M0 0 P @P0T03/@Ѝ0@-00$M0"!#!0 X03/$Ѝ@0@-,M\!#!@0 00P @P0\03/@,Ѝ0,@0@-P0M ( @P Z000`03/PP T 0BK T 0}KЍ0T 02K 0!H@@-@000 d03/@PЍd@0@-,M080\ 0<0 $0 0P @P0 h03/@W,Ѝ0@@-M@00l0  3/@PЍ@0@-P0M( @P 0 p03/PP T 0J0KЍ0`T 0J0D!@@-M 0400 t03/@PEЍ@-$M0(000,0 00 x03/$Ѝ@@-000 |03/Ѝ @0@-P0M 0 0P@P0 03/@Ѝ0(@@- 0 0003/ЍD@@-000 03/ Ѝ`@p@-0M` 00@  00 PP 0 0@03/0P0T0SP Ѝp|@7@-00P00 03/@} Ѝ0@0@-,M!80\ 0<00@0P 00 @P003/@_,Ѝ0@@- 0 0003/Ѝ@0@-L0M 00P h@P003/@<Ѝ0@@-000 03/ Ѝ@@-000 03/Ѝ$@@- 000 03/Ѝ@@@-000 03/Ѝ\@-,M 00H0400800<00@0 0D0$00 03/,Ѝx@-$M "!00 00 03/$Ѝ@0@-X$M 0 0P @P0 03/@$Ѝ0@@-M@000  3/@PЍ@0@-X$M 0 0P @P0 03/@$Ѝ0@@-000 03/Ѝ@-$M0(000,0 00 03/$Ѝ @-$M0(000,0 00 03/$Ѝ<@@- 0 0003/ЍX@@-(000  3/Ѝt@@- 000 03/Ѝ@@-#Bp@-P@`P00@000000 0(0P0Ppe 0 //00// //0/@-z@-u@-@P 0P hdP u@-@0$ @ 塦@->?B@-0p$0@@-0p// // 1R *1 4SHP// 0 //0S  0S 0@-@@0S  00S  /00C St:::::::::: 0$ /, 0 007@-@00PH000U  Ѝ0@; Ѝ0LHp@-0@ R R p PT `h 0pPAX0n0`S` 0`V,0&f j1 Sd080P0 P?!00(0S50(0XC1P@CU\400 # (0(*40803/PPN 0S0h0 j" R 0 0S  0R di 0S40S   X0?o2P00 W,0"&0:808 01@0P0 000@0000 0$0P 0S $@jP 0R d,<@ p0& 0S P@` 0P0 0d0S8 00<08 `PS$0Pp @4\  0P 0SW 00, `YWpp$0VpW @d >00P0 0000000,0&0P 0S, j0pL00LPS 000 $0 T0h731|0X0S  0P\0| L06D00D pW,0P0UpPR0pD0 0\0$pp00X0&PS&60DL 00Sl`,`000W 0 V,0"&0:H00H 1 0@l 0 0c60 RZQZ3l0000000 l0PPh 000 X0S 00S ǝPL\喻`0U00S 40S 0| D0  D / ,01/PPiL0SiP ڡ 0Sv iU  %6`1f 0@ \0 _0jF P00|`00 W`001:# `  H pW H {Pl 0 0/, A a3!<0S W 0# . RP HH L P! @=*V"*PU SP0t00x0*sr2\0 C 00040St 2n`0x >0 `S 0&fjh0H 40V Li0`0t`xpGP0 0, RS00W00S0  00  F 00)0 C cl00182T TVT0 b8 QSQT S10 8<00P 00 0兹P 0S P 0S hP h 0X p0 ?o2"@  8 VPWY" 0@ ᠸ 0  `0ShP $0@!ꇶz9ᑶ 0D0 0 /P -WB@c2O-CM@001< @041 0810,09309L0081 0D000H00p$0ᓱ0`S H000 @H0  d0S(U@W $0S 408 03/c ^hPCߍW5812 0 SpKPP) Jh Gh`>눀X `A$00 g0p$08P 81 40/03/PP )0070 (0l 81 0SD7  01 V 0d 81 0S0 0 80'0<`@400 0 0kPP "R 0[P?X H0  0S0000 0S 3/H0  P d0S g(0, 0#R00SjH`?i`V`fmWY $0S 408 03/5010 8S0 080D0S ,0S  L0jP0ҁP (`,g:⶷ 1g 0`! 0  <1S<1P P0  S ,0(`,S Xj➷(g $մ(0 L0,0P0吷000 ܂X `P @ p 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030 000p0*V0\000\ R Xp0A!\X00CP1  pp0\B?l1Ph0 aX  0S 0S#6:RNƠ 0X00 000p0*X000j\ X0 0X00(0`0 T0X0S5X2 \ (`,0C6` ïf0X p0P 05/P _fUX (04 ``X 0S00`*04``L0pPX0\p0X 0P 0  <0P@0 R T0S  R M  Y`00S   80 0 S 3  M0 S\ 101T0S@` T0S  e@c4eBB3e@-0 000! Ѝ 0  /A-@0MPb N,0F00 00YЍ2A-@0MPb 5,0F00 00@Ѝ2O-X2$@LM3@P1`00 p     0 n 0AOoBBLЍ06 ?\0e@@e0 0 0 PPpJe 0S@>ReQ (T 1 0@  @& (  6, ?(#<@$8 0(@P8 R  T 0@ P 0R 09EP@cG-@0(MP3 聓0bံFa @Z 000 0  .p0 P(0 S00 ,40ʊP1~pp p,00 00pG<010801 1!&ኍXK:8}|1 0(0` 000 :#: 000 z8}0 R ,囊XF00000C00 000 0C03DH8 40P*qp& D8 40 ?y#p{00H <F{ 04 H&z>B8cDc3eH;p@-@P;0 2p@;G-P`$0@p3/@PZ@00@800 4/@P 40T00SOp0Vz S P$03/@P P 0Sg P H @0SI00S@0SP 00L0D 8/PP H0U00S @@ 0W5 V5 P 0S  0P P  0S 0R PP 0S P P <0 P0 ЍP PPSSA-`Pp@ TW AO-P @`TU   T0 0 06/@ ЍA-P0P`0C?o20S@  UAp W U XUO-DM,00000l h 0  @DЍQpPሐ$0 3/@P`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Uu L8680 R R<SP )<0S 80R PU8<P @88`< V0S@; x0S@7U l0 0Rl0 @P*   03/@P0 @t 4/ 0tP`@P 000,0` 0@ 0 t4/@900S3 0 `P @@400 @ 0 t4/@PN40S80 0,0B 0<0 0p0@000l0P00 @T4 P1 /<0 0p0 000l0@080 0,0008`<P  0 4P qPd mbZ 0RES@@0 t4/PB@ @0  4/@Pt0 @ 4/ 0Pt`+0t@Pr000p0@0l0 0,0 0@ 0t4/@P`00 0 0XS@TA-P `@0p0S 0W 0T0S A0-   Q  O-pM0<0P0H00P0 8`@DL 0:@P& W0V04 P0Y04  0 ЍO  P0S P @Ѝ /A-@` PpP W $0 Ax<@- 00 00! 0!""##$$ @-88Qp@-@ Q  88PRPpp@LJp‡B@p@-Q@pP @Q\0@$0@0$0p^8$@8Tp\0$00$0$@p@-Q@pP @Q pD8 0"8 0"p@-Q@pP @Q@p,8d 0$ 0S (0, 0@@^8d 0$ 0S (00, @@pY 0S/S 0 / E/0S//0S-/@-ׇB//@- _G-p@0S 00s  r M`p 0 r 0 PU S SZ` VȀ- //@-!0  @-   L`  x`o    `_/@- _@- 0   (`  T`o    _e_@- _@-@M[`PN`P/@-0_p@-@P?_@p=_  ? Ra0 ? /0S S S00 /$0@-h0pW0@0@D@___`_`A-`p@ PTP @A=: <900   jP1 @0<03<O-@`MЍ0S S S+ 0 / 0 ///0@-P M 0*@P 00Ѝ0P/00@-DM000,00(0H0 00@0P<0A$  <0< !DЍ0B/p@-0P@T `@pp@-P`ᅮ@P @ᜮpA-pP@r`P$ `ቮV000000 0 0!!!!""""####$$$$|0|0役 /@-p@ P`{] 0000 0CS 0 rp` 0@Ppe  0` ЍC-MPp`04@P  0 $ 01/@T 00Ѝ   @P  @P A-`pPۭ@P  0 ̺@T 00Ѝ @P @P 0岺-/9 0T0/ 0X0/O-`DM@ 00 0 刀匠00  ``b pP 01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0a 0 DЍU P \ PU˰p [ P 0 8p Wʠ@ BG- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`W  1@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0 0SS 0 /S 00/p@-0` P 00CS0@003/@P 0 2X00X02pp@-0@` 0P2X00CX020p@00/ 0@-0@00CS0@000/<P /0 0000/p@-@PS0003/@P 000/pp@-@PT` 0R@80003/TP P 000pp@-@P"0003/@P 000pp@-@`0P 0003/@pA-@P0圀p`0S001X X00CX042PP 0  01/@-0 BA-$0@@@P0`00ZpZY0S 04 0 13/@ Z@x@0     0 1/@-Y@ R0R0#3/ 0 / 0 /0S  0S 0@-@@0S  00S  /O-`p1@PpW  z{   Pu  VPp1 Ѝ@@@-7@- 0 R R A@ & Ѝ0A@ (Bp@-P0S0@0 0S p@y0\03/-Ppp@-@04400 # #$0ЍEB00C ShX;X;X;X;X;|X;X;X;X;X; 00 /, 0 0 00 00ğs@-000S @D0 SJ0311p0S0 0S-00 0Q 0 00{;nz000C0 00C 0 R  S \0pH000S<(00000 3pPz  Ѝ<10# 3R0 0 Pk 3R0 0 p^L700L0D4q0Z0ꄾꖾ@ccep]eUBsBes@-P`00@T H0{P4 (Ѝp@K0 DxUTЍpp]eep@-`MP  @P t0R R3000 0 僾 0@Ѝp3000 0 tw@cB@- Y@Pᐽ0ЍO-84PTM3p؀ 00`S 0Q Q @PD/Q Q8崳0S 00 0000 @Px p/) 0S#0S 0S00 0P0/0S ~P000C @P U/@TЍ0"弲S(4001 00 0 0 :JP@ `L/ h@H/T @!4( l/ d ዼd`P]003 0D p(06/PR@O@cp]eeBxcV6hd R6d@O-`|M[ 3#0S S@ h X TP 0 T0k r |Ѝ 0S0 0"X0PKl@ TLTH㐠H2@X1100140PĤ0j80?<00 0S 4;j0$D0?H0? @080t{p<0 @00D$00U, (0KD0 SH0 ?X1!U3T0000 0  00 0@ 0L哏LP[T0( p0,0pDWp!$ Wp! -T͋[0SW04 n0!#?0 0APT000 0 0@7PE}@chd BO-2`P#0DMS Sz@ OP 0 L0 DЍ0S\ 0S0 0l! 0APK4@ TLTHĔi?0?00 ᠄0偋J0DpQ1! T 0 00 0@0 0D X !ᚴP 9000 0 0@廎P pW U0Z0SX꣋ @chd ÈB0@-PM@ P@ 0S 00 30@Ѝ00@c@-`P @P 0S-@ @0Ѝp@-0P 0@P` V $0@0  " ᅺV@Ѝp@P D D0 4S 40 60CpS//@0S@-0P/@- @  U;;BӈBeG-pG`CP,"? !@T0@@0 @@@AP0p0 0`0l0,TG0 R\ \ @0@0   p]eeO-`Pq(2?0q l,@ T, 0R SRZ,P [|,,0@V 000S ,00@;,y,P,0@踛ep]ep@-`P,,0 @T 0?ST Th_,pP@T P @ ,J,P@pp]ee00/0@-M@ P PT0@ D0D 30000⃹P+(⛆Ѝ0@czd@A-P@`+  Q 00C0 0 , |+tPtp0S`0 2?0!0S 0 0 A+ 0p]eep@-0@HP+0`0@,0D0+T"p@p]e P  800P////p@-d 0@P .0 p/pO-P2S 0}*` @PP X@@}>w0K*}.0Pd 0΂+"[! |*!/#1S%P @ LP WZ 0* (!P 000P@  P 000@P QZp 㰠夰m@_pW0: 00C@_2 < 2 ,2! Q Ѝ:;,mnO-Q`0p"@ pP 0v <2 S\02@P? h ":#@TP0!\p!9#@TP0!P!dƒ1#. @TP2,! 0)"0|| pP 0 0 T  (0TPp@0T@PpP 0 0 TpȠȐTP0I 0@P ?T @.0 @0< Ѝ:QO::mnP/O-$0(P`Т@p(0FQ< 0R00$00S ?⃁X *;#$+4P Uc): 0$ᤢ0@0D Ѝ(P U8`<:$ 0Ꮲ (001r00 &! 6!@-0@00$00͇Pp@-@P`R/㕢PP`_ WPp@-@ )0!( :@ @-0@0!80@z)A-P?@ `!tpRr) W\00\0  WX00X0%0S`00S 3/050)A-@`PP pN)O៩)p@-0@pP=)喩@x)Tp@-0PS@p 0x 0000G\`)0 $A&U)0@ Ѝ@#jA,A0/G-P`t@(U 1P0L0SG0)0S0p 0SڬP嬐U9PP )03/( Z#Z P &Ѹ˸00C0Z $00((@cp@-@PPpp@p@-@P(00P 00$00嵆p@(O-M00pQ  (@`TB  0 ; : 04 3㲳t 0U0Ѝ0 @00D0 0( 0S<0pP@3T 316T !7T 26T PT  T  PTT CAAT !T T A!AT X2Ts 7C0CT 0R550P< T742Tf/⫟E/-p℀&0 700CPP1 TT! *60 00!00 &P070&c`10S 0R889SvE/@o&PP P&0$07 0SP3 0IPP,PR&@T00&Ȧ00&᭦v{dЀ~d(gdmdydvdedAd@d@hd gdedg~O-@P`tpM -!%6000!0 0%pP Pt` t(0S00 3/y0&  0ЍO0 (p(P  Wpt UPT<$',P* 㴠8SЍR 0#2Q  P0t~ $5 "S*0 0  a kB BBrB>BO-@p?t`嘐PQ4%0SU`V`% Ѝ`0S 0U%0\5 X0X \0  X0X0%0``0$Q 00 0 01/`P 50 0.0 8S0SU/A-@PHMkMG-`p$@0P `PO00kx*,%01h%a[r0  0 rͭ  0 t% x00Cx00S  . t:%dTL 0!400?M$L@@BĜeA-@|`8 P X0 0 1@01?::0 5:1<,@pQ `0q0` iWp00q50@ޯ0A 㴶A-P@᠀X0 )P9`tp$lLdPL$B )$$;]00/AĜe 冚DcG-(pP`,@렐X Ll0P0PP*>:2<.`DpP/0 p80Pp ЍP@-p@-`Pp0S0X0S C\ c0RC BPTP1#p&UBO-M`8 HQH$tP 0PY+ἰ$,0( ]P( ,0H/ x00Cx00S  . d  匠 H00\ ! ቭx hH cHY H@\H=P+ ($G 0 4IHx00Cx00S  . & N G 000 0RPpP{UWv  00, G<Ѝ5Bd;L,A:BĜeDcBA-@`@GPp吀0T:GU0QU P TừP 0嵫P嫕GA@ĜeA-0MP00p 00!t0  00 g|@T`x00Ѝ0SP*  ( z 8000 y*, y[y (Z`2垖V 00 0@G-Pp"G@ᤐ夠0SqGT ᅖ0aV X 1P T §忧 0 P@ĜeiBG-@pPF@ T:t=G@aV X 0P,+G@T@@9Ĝep@-TF@HPH`0Sp@0G0Q 0S l@ĜeBA-AQF FP ⍐PP ; F`P帀PpU:AFQ  R 00 00 0\ S ĜeDcBȊBԢBBȢBМeԜe41L0S/0@-@ QM VF } P7 P0/ P  FЍ0 I P R PU 03/P   P ,PDcĜe$BLB{BМeBыBO-M00P{h`pl0S6 0l0p0 040  0z&  8 0 <0$0 00  <0(,p8 y@ %~0Sl00Cl0  UЍ  0*@T0O-@p04PE܀0SET  Ѝ0aV! R R ḩP 0WS8ZY T >;  4P@ᕓĜeBp@-@l妨Pd彨`0$4SS @pDD$@P ?P 0@”@@Dc 0`( "4`#/O-M p}90000 0 -PPr00 +4 40#400$"44 8##<004 8 40 80 < 0 0`$"440#4 0 0$"44 0#4 0 04 8 4 0 8 00 $"448#8=Sp1=p#'40p0("(W$3[L X0!<30C(r*0 0r;p0C0Cs V `dlP0@[2 zЍA 0P$( c 0 $ (   0 $$ "$   $$ "$ pR0Cs WPp00 00$}PP !440"440-* ' P$PT!TXX\\``ddhhllp pt 1tQ00 0uP t0uPIP`1 QP崩!"44!1"44!1"441 $0$Q 0RP ( 0 v v  8  v(PP0T8 5P 0 ,00ER(BPM`BpB@@&UBzBBO-X`@fuM | X0`p#00 0?PP*0P X呯0P P! R R0wX8&  ⶄ,T P00S CPmyuߍ XX 5 ,4L HZp*PFS Qy3 0带PE{pX P NΠ0 n :1 .fPP  0#w P 0`☲cᡄ P X Ⓞ& 0J& XF  /0 0P070㚳#, u u $(0, 0 0S 1!3S$ ?6.~`0S S*Q #?0000.V A00 Z00 Xu P 6XP.  Q#?0000Q 00 u Xu z PpX0 aoR 000X00 0@VdPb P@BB&BcBBB\@AzB܍BBT0Tp@- 60@彐@PP `PUPTpcA-@Pf/pv<(00`S3 #01 1@ ##:!#0<,8  s00 s0 H0<0 0008|0X``00``m8 C(0 0<0`0,0$0@000(040,0AUcڈBWEVG- 1( @"6 0QPP 0S00GCx꤀(00CS$00 08 pRvW00 BR`!`1P0W  y W 00C0;cA-` P &0)`@P@ |p UT00T0  UP00P0%0SX0 @DP@PSceG-`<1 0/R-/00R>0/P}ft,@|f{f@~fp@-@L P & 0 pEP$ p,0 60S0!L0fP   ڞo RQ 0Qd 0pS  Ѝ0~pS DPP Z%ZjeV`! 0 U0pcY ࢞gVYY R Z R 0 R0S000S 0S00i 00 Q #zbYdYd>p@-l` d<0 h@H0P*0V,PY  0@hpDcYd>Yd0 60S#3//0 R@#0 Q /R0h0//p@0( #&0  R /E/00S/კO-M`H0 00000P-@P= 0 @@@@#p _PĀĐ@TT ,JPZ ЍOq T1# ם@PW01 uIYP0 EP @Ѝe@c4!  \ / u: ꊎBe$0 0!0 00 /@cddd0S  0 00/p@-0pPd3@1`00[0/(0, 6Q 0/(0, "R0@@Vp@c@-@?0 00R 0(0,000@rp@-P`㽹@P @ `T`%0S $0CS@ R(08 8@@Sp耝ep@-PU @`00p`h0P"@pp@p@-@pPPp@0A-APp0S$0C@PoobT  R*  R Pf$ R8@ (@T $0DS R @TP8 R8 0 RP`V耝ep@-40@SP 4-\0',0S S 00 008@Tp`0 6/@ꀝe@-@P P  @ A-Plr@`qTH1x`31`00b50S 0 0 0   P0 0000( H/o6"Q R  R   0 0 pPP #P 0SPU  P P @cO-1DM00P`p0 <0 a0,(P$  @<_<0 SB 400 ,00  0000a000'>(P0$ 0 _<0400 ,00 0000a0(P 0$ _<0400 ,0X0 0P000a0(P 0$ _DЍ薎Bc`;B;@{B;BO-QdM@0 | PdЍdЍO_Q0 00000`0 MPPPV0/op"/8A  @T@DHX01H0#0T*0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H ym X  0P `J@ GrpT @DPꀝeO-造Mx@P` pቋ0` 00l j,1 0(10$10 1H00XZ 1?o2P0SЍ耝eT;C-M 0P`` @۟|p0 P 00 00 0 0@Z?o2P0S  BP Ѝcp@-@P?@T $@DT`w\\ 0S(@0 80 0AKP p@ b뀝e\@ʎB;BA-0pP@TU,`T`1 z@DP0BD0S/0@-0 H ЍA-@`p`P0(@S$0CS8 R (0S $0C `PAꀝeBp@-@P T-p\P P@!<0@ @㘽$  p耝eB Ydc(e@-<0DT 0 !'0  !@c0@- ! 0 !A-@`XpPUA00`0S 00  03/N<(ep@-@P0 0 0 0 00 0 00  p@O-pp34M1`00#212G@T  0"0#!"4Ѝ00 030 o d`P0S @D R 9 R9;;;;;;;;;;; PP  C\0 : 70 @0S ( <X0000< 3SH L0SP0\ 0304 sR k "Pt"P\"PH"P4PPE_o$"RQ 707;?<  0C S0! 0͗P00 R _7 7  zP( U 0S40S 41  00000C0( @D0P0*J;(  + ޝ80S 40S 0 @PU 0 =PP220:00lpX 7/U P @p03/@c YdeeeA-P40,a @T @DT@T $@DTA`0S 0SjTQ@0S&$008P0(00S GpP TPI<ၳ080|00:(@ꀝe YdO-@,M,00@T `88@DT,ЍT <0RUSL ( 庺0 0 0 ź P0PP9 Vb000pppG垺0 0 Y ``0 妺0V` F/ 0 PPP# 0S,z0 0 0 兺`00@T @DSP0P P060S500C?o2 0 0 Laq 3/ 0``S ꀝeMbA-@p `PBM 2SJ@ @(@0 0@S  02 100 0 0P`5Bߍ;@-0  Q:0 0(0 0QS Q   ЍR>;00@-AM@0 0 0 0P00! ! 0@P 9Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp p" A5#RH L0S0P  w9-CM       rCߍG-P<p @|`y PPl00P(P$P,P0$008P$S( (0 | 0 pGꀝe Ydp@-@,00,0PS0|0,P@8PUp`0 6/PO-(@4M3p1P`00350Sx r050i`V :W 729 ` 00 90p9W 1C7CW 0SY 00#212\ 900pWr `$pGWAr#2!128W M8W4 0CW8W 8W0CW  0W `4Ѝp80 S; ; ; ; ;;`; ; ;; ; ; ;;(8W 0Wd 0S 00.`7W ~;C?>CW_ >0W >C 0CW H4ЍO7W  ;CW0CWx7W8 0S  ⤚`@7W H4ЍO6WJ 57W >C0CW`즟 W 6W`VlX 㘰0 W@0}Pd0  `3{DV2 0 V fD6W+ #17W 6W\ 000 RV 0 E0 0A0CS…Q5pW $pGW`5W ;00  0S0Sh%0 R01 5:S 000  ` XX  ( `)P  P {`xPl  `00`x 2 Yq 0S 4 R7`P0400 R0S 0 S& `00  0  [*` 0 (00pW $pG`,c0 . 0S R0P `b 3S R (PU $PEU` 0 B R`2X1 .`P,0(S(0S卯P 凯P`` 倯7`F 0S S 6000(p YP1XL*1`}@?P 01 l1} P 0S 0 00( , 0 !(00,000600008000S080<00S<0{0@0x@0 0D04`000(<VX  P040Q -L@cwt@HpB@f@pB{B@EcEczBe YdoB@|B@~B fB@oB@}fkB@|fvtgBBfBwBc@BB/P/@- མ0`( "4`# Ѝ0M0000# Ѝ/î®/Q02 //000SCQ00A\% 0\ -^0Q  Q0 8<0 0(, 0  /0\ L\ @-0 AS/0S 0 /000S000/AP/C-Q@ P`@A0pSS񟗓x;;;;;;0;;;;;;L;;;;;;;;;;4;;;;;;T;<;;;@;;;;;;;8;;;;;\;$;;;;;;;;;;;;;;;d;0;;;;;;;;;;d; ;;;;;D;;;T;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;$;;;;;;;;;;;;;;;;0;;;;Pm@S S S @S S 0SYS <0SQ$ 0,p(`80gOPP0 00!10 ,p(`$ 80< TOP@ <0< $  00,p(`BOPg 1000<0 ,p(`$  0O0PU     '. ,p(`$0 @ 0< OPD @01Q[P1S ~?S?11S1O@pqM;MCaaq n!%a ab傽bXT! 0$ $18!0 и  0R200 `p00S0p SV p`p02P0Q:0"PSop`W !&`"0 AЍA0\cYd@Yd0e!B)B@-@m@0A- P @0L ^U 0S 0~`pk@hpT K 0S0@A9l0S ⑇P ~Y@@eP`dV .X0PCP Ѝ< <0  PS_0SCDP `sXP Uڐ P7P0PEɺDPp  뿺p <⩻~`XP `v ѺUڐ PPPE⡺D?< 冻44)454P$SN $#(u (PPL\0S$PP4 <P <sL0$3/PP 0S- <@P 3|`|0<P03/P |` @S"0<#S 80#S %'B BS #S #S#V6 0 0 0P 0婫P* (q"S  S "S "S's |"Sx"p"S l$'a S `M BS[ BS302 P0S- cP[ `0 ` 6/ iNZ0 0(`06/  "  U`e# Z  R @a4P/  03/=[  Y 0T{ S#B%B}e Sb O!"'S s[ SX *.l33&i@c@c@cczixi@eYdxi 0e`<iiiii{iFi@ui niiiccIii7iiiG-PpG~`@|T l0 S 50S0 0JP80 N~k@@eP0880R 3p0`N`H0@0< !N D!0/H0L 0/QP @0D P @㺚qP 0?S@ Ѝ@0S``iui vi iiiG-x Qp`PM \1Q-@UVDD垵_0 00 00;@P ލ@M3T @P  0R !뇷DPP1@ ᢷ 0Q D @P W14 (0W-@ 41i i@BC-qM@`P)  03/PNU# 0S   Pp@0S   no  0SЍ:1PpP  ܃@cx0/p@-`Q@P R 0 0 0 )! 7p000SP0PP00p@*R !0 0 0 s`0SP0P0P0gp@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P0#3 R`M3  nR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP $Ppp@-@PPp0@-@0M0S0L@P  TЍ0ϖoBp@-Ph@ᔠ1 01  hp@蝠@-p0$M03`A0AS P R R R0 3/@ I MRY R ނ@ ق000 S""44 0 #RH L0S0P  * 0 001   01^000000000 0 00000 006@P #T@$Ѝ3  3#0P0C@0@ 001 0 S 0 x< 0"448#80CS=10 001   `1100000000<1000 005@P @j0 w 0H   C Rw0C0000 0S(  (  ( 0   &0T0 0 0 @P{ Qw 6@t2@7@B33@-3A0@S AS S 9<2@S 3/4P@,O-Q,M0 #21 2@P0 40S `0` " !",Ѝ0Sbb20ؗpHD2V HΗbVRUHo0 0X0\L90PPU:0嫗0 00 ၁ }P0@cp@-P`@Tp ệP േP @A-0PXMP- 00 0XЍA/`@p K1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍ(e\00@-:PL@0 R 00 C0.APAAꫪ@ Xe0@-PQ@M 0 %040060000 $0T l00p0 200P000 %U 0 00#0_0PR,R02t0HLR0h00 P(05/L 0 5 /DЍ0ဖBE<\C<A \0 S?0aN^ >9QC< A(.S,S :S 0S70/00@-0C QAC^9S000@N TAPNU>9^C<7A@-@ 0R R% RB 0  R    ^           R R  R  R P D3          /@@@JB@-`P͕@H:  `P*0& 0# " &P 00 0  0 024`S 0 0B02H02MЍp`HGT ᔕ@-@HP  a`P "@P 00CS 004`S  0 2H0C2mЍp`H</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@P1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S>703P pLPpp@FPpL2!4<010 " $"S $2p@p@F8"Rp0S 0 0 8Pvpi1iii2i(#iX8i(i @ 2 @-$2@0$2 P$20$2/(2S@-$2@ 0$2 P$20$2/G-@ၔpP(ᰀH(20(2p02P0H02!(Z p@2S,`Yp`V v H(20C(2,2S0S,2?02HW B p 3/`P  0S0S0 0"p@-@Hj,2&jPUHp R&U R?,"02(2H0C(2@2S(2Swbp 0S0S0 0"P 3/A-@` Pp0H   CR0C0000T7@@#RH L0S0P  @0(00(00S)@P  P|0'  $ ! "$& $ "$ (?Q0@ a060@@-0S 0 P P Ѝ0 $"$# &  $ "$  $"$# & {0C-M 03P 0 SP0ht`0开cS0 x00044@X 0@ DC5(00X 0  R:0 3  00FP  @0P<<00   0:00h(`(0, O 0@,@(0hj0#:0#X00S(DD KP `0#DDH$H#  3  0 0P0 0 A P0S `0#DDH$H  3:#:SZ2T Tr & 1T (0Sp0 00C SF0 ^  N 0:01T7?T+ @P  _|481@ R  P0-yp'  H/o"!20T  T  0T00S 0@000x0@000 04Ѝx rXeG@ Zdd5݆%cĿcc1O-0Q@00`pDM(00 0<0a0,$@ @@ @<@:000< 0a0 ,($@ @ @: 0$0\00T0000'>a0,0( P @< :DЍ@XeQBHJ<%AS࠳ࠣo\p^ 0$0\@X`}8pP@X@\`u80T`!C`<0@0o$0@(0$$ʤ@`xpeEc  0 400 ,p$@ ` @+T00L00 ,p($@ ` @400 +<ЍBP<ɳA"0000( $ #0 0A-@P`p/ 00  Q:00 ^ Q0SA P 0` `0S: 0  000 @ ``A@G-(r@P0T@`RT` P(PЍTV Fi Di0Z* sR Q HX TT BLV 0  P  qPP 0PP  0@ 0 2V mi 0 bpQ` 崚PV *0`S R0B1 08C80 00 00008C8 QHR 0ecXB@p@-@Q`P 0 d0P @pqPTp0SpPO-P0M`Q@0  EpP ` @Ѝp0 0@S0VV0p; 0-Q V Q P  P P [[90   P QPP V@  `    pR5PUP 0S(0S' RP0S000  P0SP00S 0 SQPPUVy 0Sv p0S00R0SpPUea0 S0 0 P媙QV 00 0PJP3PpꅒBA-P@k`P p   BoP TO  fP@ 0@@T  R Q 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@-Q '  BR  \R\Q 0 Sl!0 SD 0S0S0 0 S0Q00 R Q RSR ט0Q `U P0P0 RPPQ AQ  0 값BԒBe BB0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ j~0P@  pecA-@`pp S( `0PX 0 0`0d0(0 0 0P0000 0e<<,<<0S p@-@PpS0P 0p@/pp@-Q0S   Q S Pp4P@$XP0   [S 000P:hP`P` @TpP@ 0 00}e=BcWBec_BiBA-Pp`@ )SPP000q10S0@@`p@-P@0`S   00B(P}0S p@AēBΓBPe֓B0eAEc$<(e/A-P`p@T0S  0 0S   0R0 0 8k03/0S0C0+0eB/A-Pp`@T`@P70S0@S   0R 0 0  0S0C0p( .NPs'`p0S 0 @ P 00@ @ 0000eBYW T/80 R\P/40//pep@-P@PPpPpp@-0@SP  Q  ,pP pp@-P@Qp`Pp 0` C ppeA-@pP`P %P U00P AP U000 "꨹P 0֊(PwUP$pPPW@0 `@0@ UTVax 0(hVPP$pPPW`7@7@0@ 808 0  0S+@P34 1`0L0D ` x0LL@QRZ(T303 @P`@V`$pW0@ pP0 (0SU 0V1a"01lP 0`\L 0PR AoVQ P`0R0t0P0S 0$ST0S 0$S0( 00 0P}`P9X0S P0X@Pp X KVDXp00CS"<<<<0<0<0<@P0$`S- P0 ^PX0S0S;@0Sp S S $L"@P $0X\X\ (, /  X\ 0?0::SL PP $0P`H R R: `$! p7/` Fr450",p 00 aV F $ 0LTpP- EKP0P0<@K@i|!$0P000T00X0 p 0$L@Pn 0SPQ @f-@db@`@^ LZ x^`000SW pWPRU 01VP00H0a WVaAYܿ@c @Aec\ P/0 !8 0 0 (  , !/@cdddO-QM 0 ~ЍO\ Ѝ\Q|x0 0|P Om| x |  0d  h 0l bp t0dpWWWh R   0SK GR&7YD RA| R=d ` EP 0S U d FPdP`&V4004 0UB43!" @40$0$`0 0V1 ~oF0V# P xl 0p lS tA0Q 3fh0S "S]2(0(0SX DSV <0 00 00d0Pt0嘐S, PU) p0S&W W W<PJP@C<B030SB 2 030 @0 0tP/t00t0嗉P2,0,@T D@DT*᱉0000凉<@1808`V} ~oFyd P PB P 0 d5/Y NYY<q0S 0 0S#P{0W00000D000 d0%P.t R R pQ;PPH0404@ ,4 Q㸐 QԐ0Pt Pt00t0PPu4<.P 0 0 d3/dPPZY  00/@!b f< @@c@e@cccgfffA-P`,k,pp@%t `P Wk0040 0(0 0EZ 0@00ec@pD0W H0L P0 H0L oA0 `0<0SP@0P8P0h03` ,1`0p02640h00x0x0FcFcc!@O@"B@c@c0@- 0E Ѝ@-? Ѝ0@-  8 Ѝ@000S/-PP500` 0PPH`40"@0 `7ЍO-@plPLM,  D00p($@ @@ @`<D@0 0000@<4p0@,P($@ @ @0(0(0$0H0 0@000<0,p0@ @`D {LЍ<9B@e@{B@-@@1"4 40 ((D0XP蘍c9B<!!00 !"44 # /0@-PM @ =  0b0032 R0 D 0C@0C!s  RЍ0@-OG8!8!=*0848#1#3= 09#9#2##4#0!@ ec!0# 0#!0@-A0S, !@p@- Q A a\@$.0##p@-40 "44 8#Ƞ#<R$0 ꈎc-w@-0 @$@"44 8#8$04  ^ Ѝp@ Ѝ/P`P^  \ # 4 00@ 0@0  0 0 00 00 00 00 00 0 / e 0P/ጎc0/ጎc0/ጎcP/PP/0S0 00/0 S0 00/-$M840, (  0$Ѝ e@-@PHpM`M45,10#U00S 0š440L  40" ^0`Ѝ R 0 0 0 0' ee0  Q0000/O- LM2 5 0@`pP!5 0P 0 0p,@(`$   0!l5 0PD0 4p0,@(`$  D08p40U 000 00'!5 0 0,@(`$ @D08p40 000 00!4 0 0,@(`$ @D08p40 000 00!H4 0 0,@(`$ @D08p40 000 00!3 0 0,@(`$ @uD08p40 000 00!3 0 0,@(`$ @]D08p40 000!<3  P0 0,@(`$ @FD08p40 00$0 00!2 0 0,@(`$ @.D08p40 00(0 020  0 ,@(`$ @D08p40 000!,2 0$2 00 0,@ 0(`$ D08p40 00H0 00!1 0 0,@(`$ @D08p40 00L0 00!l1 0 0,@(`$ @D08p40 00P0 00!1 0 0,@(`$ @D08p40 000!0TP  P0 0,@(`$ @nxPt0  0LЍOx1=ZdABcFBOB\BiBvBBBAX =@{BBBBA ec!>00000 0/p@-&@0@ PM R00P w`?$1Ѝp@1p@-x P 0MS`  0S0 0 0 @T  @  0PG0ЍpLd-l 0/O-M`p8PPK 405S0(F@ :40 S;000050< 0NZ0<0 ~  N N d@N`00dl0 0 00  00  il 0 Ѝ e7@-P`@LX0010P @P Ѝ00S 0S 00 dA-@p`܁P@P 1@-`0P P: ЍGJ GPP!ЍG|40!  $#21240 0 P 0  Q 0S (!4||3"(Ѝ5Z:400204048<0S0H|P4074040 0 0H00&y0PtPT0 0H00&40740(0L0S @B@cƖBHe@-`S`PR@ P$1 03/PЍpO-`0Mأp P@P 6ᬀ 6S5 K@Ѝ3 V@433 b$1 0@4/@X T06-@Hi0 0 0 Si@%(P0! {@P  .$1 03/@|T0@ 0 8ЍO eB @ݖBBO-M0( $$0P0$0p@0T0H ^`PH Lh`0d 0 `0d h$$0PP 3" (SK6 ,MK$00  XLh004 0 004 h(,[Z Hvh~0 0 H 000@T @DT)Y Z"v~ 50R( @kh@0D 0 @0D h( p5 0 Dp {T \╽  Q Q 44@(\ >@P ~`P! \r8~` @5 %QP【"|jUhh0l 0 h0l `h( pLp0 z(J~>hX0\ 0 X0\ Ihx0 #448#80(0Soȹ(hP0T 0 P0T 3h`V`ZhH0L 0 H0L $ht9X0S``V (0Y SY$00 9 06 $)P` V PP40"p ` ` 8 Vp  0 0Wp0  lp80Qz 00?0 08 Sgp0t 0 p0t g7X0S( p 00$0p $z,0SC Stgg(0, 0 (0, g(0Y S  Y~87X0S``V(0S Yr(p 0`Pk$1 0`6/`[ V06 00 5 PP 0 0Ǵ6(0A Y] 6ᬰ  Z   PH LH , ,    Z'?\κ{ 50R`X  e dB5BcAlBBBBėBKB~BG-aqQ姺@PG0;ye0 0 0 e0S@PD 3{LP 04 S Ioᩒ I{peX0\ 0 X0\ {eBꐐY 8{Y ]e80< 0 80< 00SR@P  "44X ;C R.540@P吢H0 0@X0xT DdP< d~`PH00`VMxU 0bh@Sw Yt  $09/ MyЍ 0 X S R 000h  ,$y0SDT0 ix $09/Y@Ѝ`0< 0C`00(|<0S `V0S @P 0 h@v\wZd(ep@-H僵DP@`L@T403L0$j@P 峵p[dZd@c[dp@-$@@Ph0DL0ukp@衵Zd0L03@o/Zd@c0 0 0 /@-@ XO-p 0M !P``  @BP0嚆 0\ a0 000000@P?o2P0SЍF=O-,`tWʀ 0! $!0     !_@ȐPU_ 0! t0 x   !00C0 00 0S0д03/  eg@cdddAF=Bq@#BNBG=BA-Pp`&_@0S 0 0 0 A*_eP 0@p 00S 0 0R000⠄Q @-s/UB@-Lcop@-`$PK @P@pcBp@-@P@D@ pp@-P`@PU`U`/*U,M=M=M=dM=M=M=M=M=M=M=M=M=M=M=M=M=|M=M=M=M=M=M=M=N=M=M=N=M=T p@DT@DTTp%@DT @D@DT @D@DT @D'Tp@-@`P@T`T`/*T,N=N=N=N=N=N=N=N=N=N=N=N=N=N=N=N=PEUN=N=N=N=O=O=O=O=O=O=O=O=O=N=N= p PEU pp@-P`@JPU`U`*UO=O=O=O=O=LP=O=pP=P= P=O=0P=O=P=P=@P=TP=hP=@D T T Tp+T p@DTTT*T!@DT%TTT@ T@D&@DT,@DT @D@DT#Tp@-@P@TP TP 221#pp@-@P@TPTP *TlQ=lQ=lQ=xQ=xQ=lQ=lQ=lQ=lQ=lQ=LQ=LQ=lQ=lQ=lQ=lQ=lQ=lQ=lQ=00CS p pp@-@PP 0p.! " pp 0O-@plPDM(00 0<00,p$@ @@ @`00<0 @,(p$@ @@ @P0 0H0000,0(p$@@ @`< DЍkBBrB|B/@- [c@ |Uc tpPc hdKc \ XFc PLAc @@0 P 00 0 0 p@?o2P0S 0 S$  Q0ЍPe8De 0O-DM(0 0P`! 2 ,`0800P$  @80 <00!1 0<0 (`,P$  x 0'!0tqt< (`0 0 ,P$  pb 0!80 (`,P$  pQ0 00!08 00 (`0 0,P$ <'(` `08! 0 ,P $  p`( 0 ,00 ! 0 0P($ DЍkBB[BV='B|B@- R0R0 &*R#Z=lZ=lZ=lZ=lZ=\Z=lZ=lZ=Z=lZ=Z=0Z=Z=lZ=lZ=lZ=lZ=lZ=lZ=lZ=Z=\" \ 00SX `\ \ `00SH00S0 80Q L\00SPe R0 Rp@-0@P&* R#4[=[=[=[=[=[=[=[=[=P[=dP@D T00SpT X,P X0P0 SpSp$00S000SPe 0 /Pe@- ttap@ lh a `\a T Pa HD` 88`Y=%BPeT=];BU=v;B|U=;BZ=;BV=;B@-0@ aa aaa@`PeP@- P0@ P@ dd d0 0X aA@P HrlЍ0A@P elPe@P @Ei 88 (00(>@P @Ѝ蘥eJBBٛBB///0S/!  @-@'00A-@`PpW0PV0SASW 0003s0#0S0  " \ R0@-#10lS0! @. TBo0PP P. /0S/p@-0@S`P `UFUp t9 $00#00p@ f9 $00#00~PE@-@0M 0@$ Z$Z ZnZ ZP ?P Z$Z ZYZ ZSZ Z q?P ߍ Z$Z ZiP & ZcP  Z/Z{ Z{\ M?P Zr$Zl ZHP & ZBP Z^ Z ZX ZX *?P ZO$ZI Z%P ZA ZA x?P Z7$Z1 ZZ+ ZPZ# Z# >P Z$Z ZPx & ZPr  ZPlZ Z >P` Z#Z ZPU & ZPO Z ZPG Z Z >P; Z#Z Z >P+ Z#Z ZjZ Zd >P Z#Z ZP & Z}P  Z m>P Z#Z ZZ Z X>P Z}#Zw ZwZq ZZk Zk @=>P @@@ @@,@<@L@\@l@|@@@ P0C /-P, 0C C-Q`@PLM 0 6/|0 p10 0萟耟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ 6/  00\H0 00A00A 6/ǟB@AP/Q //  00  00  00  00$  (00,  0004  80<0/@-@M@P @ "C-PXp@DMp P` 0@DS DЍ@`#M@ WpO-0Pp@<4U 0 i I3il8`Y`( ZU0D0 ЍIP\80S   U@IyU@DDAD@\ZU@DDAD@P C-\MpT@T @DT00\Ѝ``HPP@LP000//o/00//p@-@M P@`@^L@T@@L@T*@Ѝp@-@M@@`PpaP(00 0 Ѝ@-O 000ЍG-@XM`@@`P>p@@@DT00XЍ P@ DLPPU @Dt@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP9T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 01dPEU/QO-R@MZ `p@0 U ሰ V:t% @ 0:/P0Px(@ 0:/P00S0    D   DAR CRP`Fⅰ V* PRr(t+%D H R V0C B Ѝt( @ 0:/P0u% PER P @ D0:/P0H  R/@-0n Ѝ~= 0 R/R 0@0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P#0908R0* \ A/Q :@/Q* @-0@-Q K @\@ ,0CS @PUT S @CP U\0^ PL_UQ@A,à0@ 0@ 0@ 0CSQ S`0\\QPAQ00@0000 0@0 ! 0#2 /UUUU3333 @-// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00b/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-0o @-@oQPO-(p@@@, P`T @.`VPW:/@P WRQp@-@@P@T@ P`Q@c.PPPpQPp@-``` P@S.@T`PpQPA-`` p@PA.W PU`@@@-0 0(0000 0P 0@Ѝ =@-0 0(0000 0P 0@Ѝ4=@-$0000 0vP Ѝ =O-pP.` lG@P Z 0 E1@ Ѝ 0<10 71  RGQ p@-8R@P$3U @2C AQ   0 0#01R,# p 0 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,J0 0##Ƞ#\#40Q <1̌ .0#,B/@0A-@R0@P0`?S  S *S R :[S0^\PP^1(R$#R& `0Sp0 R0 P P P`0SW pЍp]^ S -^ pQ[W 0]S RW00P0B?o2^Lo  S0p@- "!A0 P#.. "P!Q" Q Q00#&" p`04`@N8<#<# "^@E!10@("$"[@-@  /Ѝ@-@P $/@ ( 0"AO-@0$M(`00p 00P0$00D2 0@00  ~/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0A, AA-pP@, $`QK ?PU(7  08R(#)8 bQ `.`6`0pPDa(!"$a$"  .0Vh 5Ѝ@R )@ b+8 7 ) 0(0G-PR0 p@q?p` @g(U: . 0$ 0 @PE 0$ (P`p(*?XG?0?PU  (u. 0$ Q0 0$  0$ @H< 0$ @ _.  0$ @H< 0$ ?XG ^@-@P $I.@ ( 0" A J@-@P @ (5. P 0$$!A0O-P \M@00 0 0$8`00,@0D 0 #@0D  H0L 0 H0L PEPP`pPS%,@0DQ0#@0D H0L 0 H0L @0D ;  SD @0*H0L 0 H0L 倀HXG0PU  P+@0D Q0 #@0D  +@0D ;  SD @0*H0L 0 H0L 倐IY Gp@-`P@ ;P P @U 3p@-@P @ (+ P' 0$$#AVyp@-`P@ P P0U  pO-M@ `+0Oϟ0800000000 0<00<<0\0`0c$c< 0\ 0?8  " < " daa `!8 8 ahpaTa Pa.e!PPPlPede\ Pba. P`PgQ`&`pP`mete\ P@P@pbQ PpptbQ%Pntn pa bqx .btb, ]pfaa!&p| a!" `t` pe&aq ata $$p-npe.p`e!ftfl `(`(p ba.peqP``&`ete\ P,P`Pbq Ppbq'pnTn 0maQ b PP%Pbb,  4 4}faa!& a!" `` ]g&a -eQaa g% g. aDa b%g! $@ ,,@`,bA @σbA$ P @M,(P, P,Pn  _bQ@ ,P), a͌P% P%/oD `n!!  n!" ` 0-`&o&Hd! ?n1 @04l0#0#d,)?# 0 8;  +!!b,dq$@.( @`((b O@@O @( + p*i * p' n'ϠLσb $ ,뭊 "/"/"i.O@ ,(0@͌ @  $kA.i @$,@j4M )**k _,P_P )0P䝉P._%_%la 0k`& `4dAm . .$.(l$ +潋   i$ l fa͌ ..i&4 (@썈 (@  OP@kA&iq @$@DplM''' p kq,p'韃 pH`}o&$o&o&`h,oka) D`dA睉o&o&o&h$毠D毃 H+ ,, Pg$ *,齋_HP_hQ @Pi뭊_%(_%_%P_PL@g) ($@ꍈ!!kA)g @$@@jkq*_!_%_%p'@ $pLM!)})L?h*k1!,0/# 0/"0?"d! 0h!d1  6 0-   $gdg$h(, ((aaTag`d`@0mO O$bO$Xba g(p4͌ p $p nq(bqn(paqPp !p!!fqnqf pbq4 p"''lQ/4 l!f!P/n!PP ]"( +`/+, /P `!l!, /f! `D /" `/"`/"aa `aa! `ola H`-,$`,,eaaae o`aD`͌ ,*na*0Dean0`oaaH` l! )bA )Hbn@e@P@M!(P!!lbnL䍈!!0!`l`b@ o"o&o&dq/@ d!`!p/l!$pL h}", ! !/, h!d! /`! T ͌/" /"/" n!h!n /d!$@X /"/"/" g!n!gA @ /h!@T lM_"0 _%_%/0 l!g!/n!X 䍈/"/"`/"l L?`g1(p40dA`$?#p)?#p?# 0 p2lqPp,,,ph$,`q4 pn͌ ''ha.4 `&`Pm   POi.hA ! D@lO$O$O$ @i,O@(H@.ፈ..$fA,i@$@DaM.++fQ! HP%P,) ])h!!σf " @dAha$, `&-,$,,`!m!!e$ᯃh.@ b!(yZnܼb((pe"p(,@pO$O$$((@f" OeA0@nfq._$ @p' _%_%O@pL @}O"$ O$ O$h!.䯃f "0` `-&(`**ha 꿃`&L `m.._.g 埃h.4 b!((,gA"쏃P@$@   f"!g p4Mn!p !!$Pf!. "P /"(P/"/"80?d!. "f10 =00000`10<0d1 0\000Ѝ000,00(00$0 0 00000/#EgܺvT2A-0p! @` :   1?0 ?RP @Pc0 &:?0S:00 GA&-@P@-@ P0`S  !00"S  tpp0~? S U 0 # !1" 0S Ѝ ۟B$A0A0CR/00L0#40L00L00L 0O-p0LM 0@084Q0Q\<0 8 0 p 0%00#0(<$ $ !l(a8 $  , ǁ@ #  " (b%  0!00#p0<, ! pa " ,ǁ(p #  " b% 0!00#,p0<, !0a4p)NON " ,Dǁ #  " (b%0 : #R?0V FA#E@P7@-@P + !? 7R8 bx b8   X  Ѝ0@$A0`( a!"$,a c"/G-P`8 p#T0.@``T%0  C! Z0DD 6ੑ  cZ&1000DDD0DpW@@@%Te-M Ѝp@-@ P` !LN! !@ApA-`PP#*pᆋ@P P  ŲPP ᙋ0PPW` +*Pኋ`)ᄋPဋV@-MP@@@`@pT:Ѝ Pp0P00 EԢBBXc00yara0tcid 0 c 0 cyara 0 ctcid\ 0/\ 0/yara\ 0/tcid0S 0 w/c0S 0 l/cyara0S 0 `/ctcid@-0p3A+`P @ O0*.P 0e@PP 2@P0( Ѝ@c /p@-@9Pz)0PPptcidp@-@-Pn) 0Ppploob@-@@ @-@@ @-@@, @-@ @C @-@@Z @-@@f @-@@a @-@@\ @-@@W @-@@R @-@@M @-@@` @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ p@-@P((0P pP pgntsp@-@`P(@0P pP TpatadA-pzP(X0P `@P  P @gntsp@-@RP PC(pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P3 p@p@-@PI p@!P0/T$AA@-ZZ@@P\DTPP P" P; P\ÀP0 P P\(:P0P0P 0P 0 P@\0 0 P@ :\0:`0` SP$0 S 57$00$0/@-(0$ @ BR00C#$0$0,0(0@-@$ P *  L!PP$00$0Ѝ  p@-PQp, @Rp$0( 0CQp$ >!Pp00@-S@ @$0,,0<000G-@P8MeY@ , `0a0000P SF SF Sl40 0 YPP`P@pWK FW Z:W =W *W # i@ Q l ` $0SR00#  C R00  R00  CT$@8Ѝd3`3 S R 0C# 0   Q b@0S00S > #@ 0  0 SbW fW ?R0@SQ(0?S R  P  c5S CP2QPm C0  PU "q  ?Rw0@St` b6b` B@S8a8  C# c,1 c0 0FWP;  0  Y=  0 fP0U0@  0R< XS,=W 0  Q  @U& 0S# Y @0  0S  0 P  @v $0S&R00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` .Pp-@-@`P "P@ Ѝ/p@-@P EPp-@-@`P  P@ Ѝ/A-@`Pp P-@-@`P P@ Ѝ/00/c0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-P0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;04 8T`. 00" <0," @" Dp" HP"$ L@"P(  ", !X0#\`&`+d*h(lp'pP%t@$x "|)0#`&+*(p'P%@$ ")0#`&+а*(p'P%@$ ")᫿ +! ! +$ό, ό. . ,᢯*p0?0#`P@$pP% ` /`&pP_pPXP\` "P!`+q~Q^D`XP@P`,\pP.s%}S&]P``PpdpP% ``&u%{U&[`PP`,pP.wxWX`PP`*pP"zuZU$`@P P`*DpP"~%r^&R`P0Pdp`!4P&~P+r%^RP`Pp`% Pp,P%yvYVPHPp$`"LPtምP*{T[P`PppP% ``&q%Q&_`QPqp$P#g%iW'Y(pp#৒}rpp崐!p娛p+{tppȐ"p(p*'t|ᤀpp$p#'t(|ᄐppph "tp.l*|s,#,੪ሥᨊቅ .),( 娀!଀+ !)x #|媼 $ᩜና帐< .༐ ,஑ጞΌP0#T@$#:$68@P0 1. @ @$.$JA@@D 0$000.0@0@D010$0 10.0 1@$1@00$ 0D00.$0 1$@00$(00.,0PX0@\0 `00$00d00.40X0@0\P00$80 0.<00@0X00$@0\00.D0`0 @d0 00$H000.L0P`00d 0#P0 0*T00,0X0 0#\00,0`0 0#d000 ,h 00#l00 "0p 00#t0 0 0 "0#x |0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 00  0#000"0 1 10 " !0#0!0 00 " 0#0 1 10 " !0#0!1 10 " 0#0!0 00 " ! 0#00  "$0# , !1Sw000 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|0000000000000000000000000000000000000PKߍ$A%A-@-(00S L ЍЍ/ ke@-@ / ?!BC @p@-P(>@P !0P0 0p谥e%A00@-@0 0 hL@`嬍000S DЍ0$ݍTP j갥eeeA-P`0pS 5@P ` pt~lgT` !P嵍E< @@ 婍8c=eee@- @ P 谥e%AP 0R @-0,QSho//᯴Ap@-` @P"P &"P p@"p 0S " %AHA-pD@P 6PƂ`P'!@B` P-@- p$0 0I@P Ѝ@Ѝ/`ᦂPP  $00I RA@-@@ Ep@-@P@p X0R0 zPP  0Q p@%%AAp@-@P L0R aPP (0Q p@ p%AAP/ 0R /%AP/ ,0R0/0P//%AA\ ?o@-L2^0S0  Q 0Q0 /%AAP/ 0R/%Ap@-@PPp 40R PP 0Q}%AAP/ 0R0P//%AAA-@PЍPo0 RQ R0 ` 0`ˁpP  H0R Q0 , H `pPԁ%AAd[AA-@PЍ 0R0 p 0Pᜁ`P 0< S0p, H P`Pꨁ%AAd[A0P -?o42 ^0S0 S /%AP/ 00R@- 0Po/%AAP ?oH 2\0S 0S0QS/%AAfP 0R0P/%AAf@-(0pSM W`@V `0P PP 00 0P S (Ѝ`0S 0 "R00   CPٙAP 0 0#/-0 S RS R RP/$0S @-2@ ce=H긦e@-! (M@ d  `0P\   G Db P(ЍP  >BjB^*B%Ap@- @PSt=p踦e@- @ Ɗ h踦e%A 00 S  \: P03#/S  \ P0///p@-P0S  2咊2@P ʊNJ;@P tT{LPP 4峊0 =@pV@c=eeЦe &A@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@\ &A /P/ 0R" 0 !SR* R0:/-0  ^: P*0  S :/@/ //@  &AP 0R// &AP 0R// &AP/ X0R0  S *<C<0/  \ :// &AP/ X0R0   S *8C80/ɓ \ :// &AP/ \0R!  R0 * /-0 ^04 / &AP/ \0R!  R0 * /-0 ^04 / &AP/ 00R!  S // &AyP/ L0R0   S *00/ S :// &AP/ P0R0  S *8#80/S :// &AP/ 40R ! \0# %// &AP/ 40R ! \0# %// &AP/ 40R !   /S// &A0P -?o42 ^0S0 S/ &AP/@\   JQ\// &AP/D\  Q/S/Q\// &A@-@pMPW  ``0S$(0S!0+ C 00 0S0xSW  000000SЍ  wPCB0BR"SO-G@`0P pE UWpp-UPp` +UP`00UE00XS 0 A B0C QRP@`T@@Ŀ 0  000E ^aE\WEAE\ 7E T0S0:0QP00\00S 0!0PT@ @0 pY ЍY S F8&ATB0BR"SO-``F@`0P pE UWpp-UPp` +UP`00UK00XS 0 A B0C QRP@`T@@ğW 09 p 0 j 0h000E Xa0ESW0EA0ES>70ET;W% P=Q PPS^3 .QPT@ @6 0  0 \Q PPS^ .[ ^F Ѝ[A&ATBH-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@`pPS2U @R'SP U @0C @g@OoU0@d08D/o?o0CS c"U@SB BU  V 0f0?o c0B0C8/oo@p !1 Q  a4Π81@0 @V@TΏPO0QU  @@a4.Ό8?o/o0CS 0  0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/Q3 /p@-M@bP PPP$PPP(P0fS^ "S4 [S. + Ch 00C S9dtS3 {S]1S/  P3/P0 0 P0 S`PT PU 0S  ` H1000"S0(0 10rS PP0 +P$ލp0uS0eS 0  00( 0aS0lS0sS0eS 0+0Cd0 0`P6/0 0`0 6/Pm 004$>;>8=/>x=Q@- o/@-IM@pQ`V P0P P Iߍ 0P PP 0P5/0 0P0 5/P 00  0p3/P 0 0p0 P `L&AA-`Q@Pp p0<S 0S !S0-S0E?o 2-R0SP/S8PEU0SP ,P 0B0S*\30HV0 S vP0/S0(0U0(00>S0>S000 0$0P>R/R R0S 0S  0 A R^"C "R R0  0 "Q 0@$00>Sy=Q QrQoO-0S` 0p@P0S "S \S0@0%uP mP bP /P \P "P n@P >P >P >P > >P > > >fP 0000@V 0c XPU 0 0 0 P ;8#8 S:0Z Z 0͕x S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 PUcYPW@ Ѝ0S <SK &S@ aQmQ#pQd;Qa@V X\0 lQ gQ0tSR0;SO>0@0tSI0;SF<0@pQA0oS>0sS;0;S8'0@qQ30uS00oS-0tS*0;S'"0@Y G-`WpWU P fP 0>SSS0 P0S 0SPP4Px$S0S EP  ?PP P PPxP(0SP 0p P V` P PP   PhBnB}BwB7Bx RC/A 0\R#R! R/Ao/0 P R   //p@-`P `xPP@p\3@Prx<3@P P(⍪0 P`000e&Aǂ갨e$0S @- *@{ceL>@- @ j  e&AG-@pP`VU@ 0@焑uPU@ `F¦`@-@◪@蔪p@-P@@6sPሪpp@-PP T0Rw@P@p,00$0040P00 0&A4>> &A0 0C0#s@-@P 0U S wl4Ѝp1PP`P 0 0gPP0 0C0PPeA-` pPw@P W @` !> @`wC-P0pS`@M>0}S "S w00Ѝ000"S 00  0>P 00S80"S0:S@@0 P  {P 0 P ,0S7ACSAp@-@P `\0 R@VP9 PPPV @p⃩&AO-P0p@S쁟0Sq ЍO P@c ЍkP `P 00 0;P> U LL0 S G P0R 8P [  0P 0S& P 0  03/P  0R1#&P P 00C 0 P ,K@P }A&A&A2TA0,S<S63Ȩeee@-@ 质ep@-P@Pㄨ 0 0 0p@ӨG-@P 0R@ pmPP`Ὠ@ 0冡ᆁ!v t 0冁 0` 00V:000&A0P ,0R@-P000/&Ap@-@P5000p@腨p@-@P ,0R@P"@vp&Ap@-@P L0R@P`0S@#*+@\p&Ap@-@P@NpA-@P x0RPp0S `7VP 0J`P p&Ap@-@P @0R@ P`ç v@p&A P /o00"\ RP0\`/&AO-@Pi pt2 R0ᖧ  /PP @p@L0S ' !PP 0Q=P8/ P,U<UU xY0P` hj  @PP 4PP c.PU@ᐧ ЍN` V P 0p000000 H P [K !E 0P0 F@ B! 8 0 P 0 0@&AcL>eeȨeee&AG- p`WPt 00@ >Pt0S0,S  0 G 0P -?o<2 ^0S0P S/&A@-@P+ 0R'P`㩦0 ?P 0 0 B! 00C0000 Ѝ@ݦ Ѝ&A0P/?o( 2\0S/0P S/&A0P -?o42 ^0S0 S*/&AP/ 0R/&A0P -?o42 ^0S0 S /&APG-@6 @`TPp P* , )0 S @yw  S 000 01 0 01 $0 0P@ @0SA-pP`x@P (Q@s0P@ A/&Ap@-P(.@P 0P0 0p蘫eL'AP 0RR @-o//0Sb G- 0PSGtk h@PR  pPWW(G08 0"!00 Pa#f<`P%c?P6 0\P0 `0VP* P0PP$ pGP唀W%10``CP R0P&RP0:P Wa<`=00P =+P/l'AL'A@-@0P s/蘫eO-Pp @`QU A R<QYm L[" =QX ,PC Y '>'> (>X(>U T8*@U0 W- @ " @U0 W @ ! @U T*0@00@0`<S S CR=S Q"0S 0CSR30 R Y Y( 0<S@(0@S|'AA-p`PV@P]rPP  P `PQp@-@@0PPdrP`@r@P0p  0P @ PQPp@-@PP@PP @p@-@P H0R00S z @P000@L'AP/ 0R /L'AP/ 0R/L'A\ ?o@-H 2^0S0 RRQ 0 /L'Ap@-@P <0R Pp P qPP  L'A0P -?o42 ^0S0 S/L'AP/@-@@T ?o 2^0SoL'AA-0S6 (P@U2pP& 08!P( $0S%  h$ 00 R`tqPP 00  0tP q 0iPЍ 0V dP V lqPP P^qP `-AA/P/?o4 2\0S0SP//'Ap@-P00S $" @U 0D@zp c.>ep@-,@,Pj0 0ep般e'A R0A'A@-@P 0R@T'AP/ 0R/'A0P -?o42 ^0S0 S/'A0S(0S @-0@ / (A00C0/0 P R   //A-`P pPP@d+@PpD+@P P4ppʢ0 P`000꠬e(A@-@@PG-@" @`TPp P* ᬢ ᩢ0 SS 000 0! 0 0!@$0  ᓢ @@p@-P@@ၢPӢpp@-PP T0R'p@P@p,00$000P00 0(A2>l6>G-`0@S,Q0SᣢG P@ᖢP PP 00 0 /pP  00C 0|P l@sP0 03/P  0R 1#oP}A8(As@-P@ T R o`,ЍpADAP`@ 0 0eP@00C0@@꠬eA-` pPo@P W @` !? @`o@-0`SP@p0]S @0 @+P  Ѝ P 000$ FP ,0SX:>NA0 /p@-P0@Q  0 Q000pPpp@-P@Ph 0 0 0p@跡onA-@P x0R@ Q`PP` ᡡ@ 0q] 0q`0V:000(A@-P000p@-@P ,0R@P%@yp(Ap@-@P ,0R@P@gp(Ap@-@P L0R@P`0S@#*@Mp(Ap@-@Pp@?pp@-@P000p@0p@-@PӠ@@@%pp@-@P @0R@ P`㿠0S 0@Ap(AA-@P `0 R@pP㧠0@0S@ 0 0a000 @(Ap@-@P <0R@ P`}@Πp(AA-`pVP @P 00{ 0S]0,S00 AA-@P 0RPpD0 0a A蒠 0!1 0S0C0000僠AE (A0P -?o42 ^0S0 S /(A0Sp@-P`@P (0S p@:p/8(A0-!00!!1Q100 000000 0#0, 0# 00!R0Q000 00 0 00R0000!00p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0r!000p@i000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG-P`0pX@S\@ @!  A@@ @H :/0P ?! Q@ \  !    A@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!0000\ !0000000T   " 0S`   T" qW qW2 8 T&aa..1000T0\00RqaaT  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-3@`0P pE UWpp-UPp` +UP`00U400XS 0 A B0C QRP@`T@@i^ 00E \a0ESW0EA0ES70ET P  S  R 0 PT@ @  X`FXRT(ATB  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/M  0RR! R/P/0@ 0A0S@*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//6A-M Wp @00S 3/P0`;P V 6/0p cPލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0 `` Q-0 @0  4/@P T p0  P$ 00 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@I@`p@-@ PQ `Pp0< 0 Ppp@-P@AQpPpA-0@APS`B DaDqDQ? <Q? >QC &QC: TT0DS$q>q>,q>p>p>q>f@\P /T \T "T T0 ' P Ѝr@t@b@n@@TPȠB͠BҠBBp@-@P 0Sp sPpPQ@-@@ g|Pp@-0`SQ p0p<@PSPpaP U>D @P QPp@-0PSQ E0p<@)Pp/!P 2P >p@-0PS`Q@p@P QQ p@P<P@P /P >A-`PPQPP0p 0SPU_@P  _P_<WP0 Pp 0 03/P P 0S PP|P_P_T T6P P(VP P\(AؠB(Ap@-@P` Ppp@-@P Ppp@-@P`E Pp@-((B011/A-@pP`P -_Pp` P102 P @-@\& P QRS  T00 _LQ R S "  T  00 A- % M222d7W U돮~ y!)x뮔r`L<4a\bjgfؤ 51sWd*^C0Xw X뛩@fia]0V!냎cM48< H3Q% 30S#* :3#Q% 53#Q% 5Q *cWV&:낾is~J d뇣Ce'qe~0  z08S(N%b5 S빭ZQ 3R @00@0%LU p2pJ0뀪7@8d}xdfLDs(0\"  000 P@P8<4ih't h`ebβ{bBrjShP'XSJ1)Jh1@T(h@⟺U Z$ 1 @10dx1T P. l&$0 000rs/h!( A0( ?A3c01|pWLh@W 0Xq0AD 0TPXg00@,h@vcd@cDcEcl?eEc N'0De6BcJdH26Bcl]e6B@ceMbc`@0B27B7B5:7Bd@ 0A @ 0H @ P `@ p @ p@ @ zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846C(.}TccF F F G $G ?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_>0> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    Am B$i $j k k Xl T5Hm X6m ,5lsllsrasrror ;4A?4AC4AAM4AAW4AA@]4Aa4APd4Aa4A`h4AA_Ml4Ap4AP v4Az4A~4AB@ 4A4AP 4A4A4A4A 4A4A4A4A 4A4A4A4A4A4A4A4A4A4A4A4A4A4ApP4A4A4A4Ap4A4ApP4A4ARAqARAqAp 4A4Ap 04A4Ap `4A4Ap p4A4AP Z4B4AP 5A4AP @5A4AP P 5A4A- Ab4A5Ab4A 5A5A5A5A5A5A5A5A E9AE9A $5AE9A'5AA4A+5AA4A45AA4A0 85AA00>5AA00D5AA00K5AAR5AAW5AA\5AAa5AAg5AAl5AA r5AA v5AA |5AA 5AA 5AA 5A5A5A4A5AA4A 5A5A 5A5A/5At4Ao5A5A0/~4At4Ap 5A.9A5A5A@5A5A5A5A@5A5A5AA5AA5AA5AA5A5A5A5A5A5A5A5A A5A 7A5A @[7A5A `c5A5A 4B5A 6A5A 6A5A 6A5A V7A6A 06A6A PjA6A p6A6A 7A5A 6A 6A A5A $6A 6AhB(6A -6A16A76A=6AC6A=6AI6A=6AO6A=6AU6AY6A_6AY6A c6AY6A0g6AY6A@k6AY6APo6AY6A`s6AY6Apw6AY6A{6AY6A6AY6A6AY6A6AY6A6AY6A6AY6A6A6A6A6A 6A6A06A6A@6A6APykB6A`6A6Ap:.B6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A 6A6A 6A6A6A6A6A6A 6A5A0B5A@6A5AP6A5A6A6AwA6A6A6A7A6A 7A87A7A87A 7A87A07A87A7A87A"7A87A '7A87A0,7A87A17A67A=7A67AC7A67AI7A67AP7A77AU7A77AZ7A77AeqnecsccmiplvsvchilsgeltgtlenvAA4A#4AAA'4A-4AAA14A74AAAeBg}A0.01.02.03.04.05.00.510.0daiadbibedeafdfafafdeaedsdeppmzpw xw 7_bus_dma_busaddr_to_paddr_bus_dmamap_syncr>A>A>A>A>A>A>A>A>A>A?A?A>A?A6?AK?AVAd?A>2PVAt?A>2VA?A>2AVAR@A>3VAY@A>3 VA`@A>3pAg@A>3qAn@A>3qAu@A>3qA}@A>3qA@A>3A@A>4D @Ad>4D @A$>4i @A>4`Rf@A>4 i @A>4qA@A>4TrA@A>4TtA@A>4TtA@A>4TA@A>4T A@A>4TAAA>4TPT AA>4T`A AA>5TE`A "AA>5TE`A "AA>5TE%V ,AA>5TEWV ;AA>5TE iMAAd>5TE $iTAA$>5TE0$ibAA$>5TE ,iTAA$>5TE0,ibAA$>5TE .ipAA>5TE0.i~AA>5TEAiAA$>5TE!iAA>5TE !iAA>5TE)iAA>5TE )iAA>5TE-iAAd>5TE -iAA>5TEAiAA>5TEAiAA>5TEAiAA>5TEA AA>5TE A AA>5TE`A AA>5TEJ`A AA>5TEJ`ABA>6J`ABA>6J`A BA>6ZK A/BA>6KPA7ApAIBA>7AAVBA>7A/AcBA>7A?ApBA>7AA}BA>7A/ABA>7A?ABA>7AOABA>7AABA>7A/ABA>7A?ABA>7AOABA>7AABA>7A@ABA>8A0A CA>8ApACA>8ApA&CA>8AA4CA>8AXVBCA>`ABCA>XVBCA>?ABCA>@XVRCA> ARCA>@X/VRCA>}Bd?A`?Ai?Ap?A?A{?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A@A@A@A%@A/@A6@AA@AI@AbCAiCAoCAuCA{CACACACACACACACACACACACACACACACACACACACACACACACACACACACACAiCAoCACA{CACACACACACACACACACACACACACACACACACACACACACACACACACACACACAiCAoCAuCA{CACACACACACACACACACACACACACAoCAuCA{CACACACACACACACACACACACACACACACADACACACACACACACACACACACADADAoCA0DAADARDAhDAyDACACACACACACACACACAiCAoCAuCACACACADADADACACACACACACACADADAuCA{CACACACADADADACACACACACADADADADACACACACACACACACACACACADADADADADADAEAEA EAEAEAEAEA!EA&EA+EACAiCAoCAuCA{CACACACACACACACACACACACA HAt *HA ^A$^AC^AT^AY^A-^A>^AY^Ab^As^AY^Ab^Ax^A}^A^AA^A^A^A^A^A^A^A^AA^A^AA]A^AA_A _AA_A_AA._A7_AH_AM_AV_Aa_A@M_Af_AAa#\Ao_AA_A_A_A!_A_A_Aq\A_AA_A_AA^A_AA_A_AA^A_AA^A_AA^A_AA^A_AAA_AA`AAA `A`AA'`A0`AAA`AJ`AAA`A[`AAA`Al`AAA`A}`AAA`A`AAA`A`AAA`A`AAA`A`AA`A`AA@_A`AA`A`AA]A`AaAaAaAA.aA7aAA.aAHaAA.aAYaAA.aAjaAA.aA{aAA.aAaAaA aAaAAaAaAAaAaAAaAaAAaAaAAaAbAAaAbAAaA)bAAaA:bAAaAKbAAaA\bAAaAmbAA@aAubAAaA~bAA@aAbAA}^AbAbA_AbAAbAbAAbAbAAaAbAAaAbAAbAbAAbAcA cAcAcAA'cAcA+cA_A0cAAAcAJcAA[cAdcAA]AucAA]AcAcA]AcAcA]AcAcAcAcAAcAcAAcAcAdAcA dAAdA%dAAdA1dAAdA=dAAEdANdA_dAEdAddAudAEdAzdAdA$^AdAAdAdAdAdAdAdAdAdAAdAdAeAdAeAeAeA%eAA6eA>eAAKeAAASeA\eAA]AmeAA ~eAeAA~eAeAAP!!,5,5!T5@8X60i3,5AH!eA|~!Y!~!!|~!Y!~!!!|~!Y!~!!!|~!Y!~!!\!fAA.fA4fAA>fA@CfAASfA@YfAA`fA@dfAAnfAsfAAfA@fAAfAfAA>^AfAAfA@fAAfAfAAfAfAAfAfAA gAgAA gA%gAA5gA !!!!!!,5 !!!!!T5@8X60i3,5!! !!H!!!!L!!!AAAAAAghAAA !!!!`!!!df6 c !!P!!!T5@8X60i3!df6 cAAAAAAAAAAAAAAAAAA!! !!"\!\"!!d "!!!!ERROR TIMEOU DFwd_flushcachewd_trimnAnA6nAFnA]nAjnAxnAnA nA$nA6nAFnA]nAjnAxnAnA"p"!",1"4"D0"/"df6cwd_setcachenAnA oA!"""p""" "`""t("wd_standby"p"0"0",1"T5@8X60i3/"df6c:"E"9"XC"09"8"%%@%`"8"8"S"atastartata_thread_runatabus_threadY"d^",5,5V"T5@8X60i3,5 #(-27<FP d'SpectecSDIO WLAN CardSDW-820e @ |Aa|AP|A|A ,|A@P d' #(-27<FPAX"}A~A!$ #< #H #` #x # # # #pxa2x0_i2c_intr_subg#e#AAAe#f#,5,5o#T5g#X6`g#,55|>p>5>>=|>p>=>>V>>V >>AA>>ƐAA>A8>,>Pĸ>>ʐA]AP>D>ܵ>д>%  8  @!!@! ! #/ ''w0 g'' c0c AA>AHTAǑAzБAݑAzAA AA A AAAAA'A1A@7AAAAAƒAےA@IeIIAAI0I0EAAAA@&II  IAAAA@"I0A'AyA-/,A8A,ATA,AgA,A{A,AA,AA,AAғAٓA,AA,AA,AA$A");A?AuE o@o @o @AXAaAdAAƐAA>A@& 3BI@tA}A @(#0AATB A-2A.cAOA2'EYA`AgAjAAAAA+AAAÕAAA`AA̕A;AA%A/Aa`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~}BAAAeAA˜AP#8####,54#T5#X6\#,5usb_desc_iter_peek6AHATAeAqAwA}AAAAAAAĜA̜AۜAAAABusbd_fill_iface_data@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@eaQ@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@o7@O@R@T@a@c@q@}@@(@v@&@A@N@j@o7@gO@%@+@4@>@0@`1l703% cU cU c9 : %mZmw`%  2 @@A"$םA   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u     u ;u )%u&5Fu 3 4u&6F  0 1  2 5  :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F Y$,Y$a$ta$`$_$\^$4Z$T5Y$X6X$,5X6cPPPM@o$o$Tf$e$e$5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;< =>?@ABCDEOMPJQNRK Ȁ$P$؁$$0$؈$AAA8dAӥA٥AݥAA $ ،$  % L $Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ fc !!!!F  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |$@$4$$<$$$,$ܓ$A$AםAL$8$2VZP~" `"'`{%1A$AםA# # 8$ $\$$@$$A$AםA@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0t$$Ĭ$$dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^dAP$AםA P@9WPurl_uno_mii_read_reg$ļ$L$$$L$$$url_uno_mii_write_regA$EAםA B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn $$@$$$$$|$H$A4$AםA$u$u$x$x$Pxmue_csr_readmue_uno_tx_preparemue_uno_rx_loopmue_csr_writemue_read_otp_rawmue_eeprom_getbyte$8$$$$$$x$$$mue_chip_initmue_uno_mii_read_regmue_uno_mii_write_regmue_dataport_writeA$AםAF hF $$$$$T$$P$A$AםA,$$$p$%$@%4%H%$p$,$p$$x$$$p$$T$p$T5@8X60i3$A$~A Asysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrAA*AGA]AAAرAA#A #A رA PA PA PAqAqAqAAAAAA!ײA"ײATHIS is A memory TEST pattern !)%%$%%%%x%%X638,5 ##$|%,%x%%%X%%@ X%%@%%   @ @ @  0        @*  ) 2\%(%<%8%h%l%t%L% &% &% &&&8&%& &,%D&&%%(&H &%%t&&&&T& &%& &,& %$&$&%%      &,&%T%D%&%%%A0&fA@@@,&@@@@n@ v@@@@Jڧo]@@ @@aJ@@ @@Q?}-6@@ @@@ZC˔!@@I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 d@@ @@ @T@  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./Apx&`Aexpand 32-byte kAy&&&l&y&&&@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&ܬ,@d,@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q,@+@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHl,@d,@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHl,@d,@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@l,@+@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decapA`&T&&&&&&0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize_A&&t&&&& &ieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update\A\A\A\AjA\AjAieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupAH!c̚(@(,(h(H!cC`r(i(i(E@tm(H!c@)i(i(|G@)H!cp(i(i(tF@F)X)\W)H!c<(i(i(E@H!cCd<=i(i(E@<=H!c)Cd<=i(i(E@<=H!csCd<=i(i(E@<=H!cC(i(i(E@8(h(,(H!cC<(i(i(E@(     }E#(D(@AAA==A*ip_output(((((P(( (\((((((((((`(tcp_outputsyn_cache_respond @@@@@@@})))d))))))4))p)ܻ)h))))))\)ح))))ܾ))@))<)ܾ)d) ))T))d)0)H)""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwww)D))\)T)))l)))@)\) )<)d)l)$* ))@BH* A|*A*^B *&AP *1A*icmp6_reflecticmp6_redirect_input_icmp6_inputicmp6_errorin6_get_llsol_addrin6_update_ifa1in6_join_mcastgroupsin6_if_link_upin6_if_link_downin6_ifattachin6_ifattach_loopbackget_ifidin6_ifattach_linklocald&c)*t***d&c:Cx[***L@0N*d&c+**M@d+d&c(!)**tF@*X)\W)d&c+**L@d&c<*d&c++d&c,*d&cCL?=**L@<=d&c)CL?=**L@<=d&csCL?=**L@<=d&cgC++*L@+d&cC+*L@+ip6_inputip6_get_prevhdrip6_nexthdr(@AAA==(A*ip6_outputnd6_initnd6_optionsnd6_resolvend6_rtrequestnd6_na_inputnd6_ns_outputnd6_dad_timernd6_na_outputnd6_ns_inputnd6_dad_startnd6_rtr_cache++0+x+++ +8++p+$++++++d+++sa6_recoverscopein6_setscopeBB}B}BA}B}BA}B}B}B}B}BAudp6_output0+@++++P+P++++++++ ++H+p++c@t`@O|b@t`@~`@f`@7c@t`@O_@ _@Z[@t`@!DZ@AY@vT@tT@FP]@@]@uR@R@J.Y@PX@t`@ ]@ \@ "\@\@ ]@ \@ v\@ NW@HbW@XV@ V@ V@ V@[S@S@UR@o&Q@ 9P@ t`@ ~U@aAcCeElLBAnNDCoOsS[ZuUxXzyzZ|{"5% mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0), --_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\5$#"12< 3>!(4[")5]#@6^$+7%-8&/9'*0-=.%`bB|_pP&oO`!vV  dDlLjJ/zZ0wWaAuUiI eE ,;' cC' tTsSrR3nN4mM2\yY{xX}.:kK~'?qQ 6gG7hH8fF(, _d/^ q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ 5 12 3l#!4>"5<#6$$7%8"" &9""/'0""*----.' xX.vV_lL[cC]wW^kK!hH<7 gG>8fF=9qQ&+/f-0uU\iI/aA{ eE} oO* sS? nN(4rR)5tT-63dD:,4yY@.#$ |pP~ zZ`bB+:mM%16,-"27..'38jJ;;2 9 d .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>|  9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm A,.A$B+t+,5,5,T5@8X60i3,5A,ABAx ,8BA ,SB     !A  !@@@@BBB B0BSB vB B B B; B.-BPBsBBBB4B'BJB5mB6B B B B <B ?6B ,SB -sB B B B =B :%B BB eB"B6B$BB  B8? BPc B##   1 @C, .,3,C,t=,3,C,x?,3,C,@,3, 22     * #hhu hhh BM,lI,?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!BBBBBBBBBBB BBB#BBB#B)B/BBBBBBBBBBBBBBBwsevent_copyout_events,,,,,,5,T5,X6P,,5ABCDEFGHIJKLMNOPQRSTUVWXYZ -H,,,5-T5,X64,,5rasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?0c&1c&1c&@@o@w@                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@I@a[@)@2@@@ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠPX]-\a-TF^-^-PNl]-RR\-CE(]-ST]-NM`-c-CLP^-0PLP^-0RE\-@RR\-CE(]-ST]-SLLd-RR\-CE(]-ST]-ERLf-CE(]-ST]-0?;@@@Ar-B e@T@9@l<;@:@:\@:4@:P@:0@:L@:h@:@:@:@:@:,@:H@:d@:@:@:@:@:@: @:(@:@:$@:@@:x@l<;@:l@:@-@(H;@d-@8~-@:@:@X<;@:D@W-`@X-|@(>;@>;@:@Ѕ-@>;@9 e@T@9@l<;@U;@l<;\@l<;4@l<;P@];0@<;L@W;h@(\;@f;@tg;@|=;@\;,@|<;H@l<;d@l<;@l<;@l<;@l<;@l<;@l<; @l<;(@l<;@U;@g;$@,X;@@X;x@ ;@$;l@4Y;@-@(H;@d-@8~-@a;@d;@X<;@tW;D@W-`@X-|@(>;@>;@Ѕ-@>;@9 e@T@9@;;@;@|<;,@<<;H@<;d@<;@<;@<;@<;@<;@x- @-(@P<;D@W-`@X-|@(>;@>;@O-@-@Ѕ-@>;$@-@@<;@9x@ ;@$;???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ-ؚ-0?;t-$;|-$;updatefatsX-----|-p---p-U<@Ah-B. ..  eD@T@9@;;@`-@-4@<;P@|<;l@0.@-@(H;@.@-@T-@-0@<;L@<;@X<;h@t=;@0<;@h?;@|=;@>;@|.,@<<;H@-d@<;@-@.@-@<;@- @<;(@P<;D@-`@@-|@(>;@>;@-@-@-@>;$@D-@@,-@9x@ ;@$;AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zpd.c.pd.Lc.nfs_sillyworker|g.g.4h.$; @ԭ@ȭ@@@@|@h@N@2@@@ܬ@Ƭ@@@^@J@4@(@@@@ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  @@@AԵ.BX.e@T@9@l<;@:@:\@:4@:P@:0@:L@:h@:@:@:@:@:,@:H@:d@:@:@:@:@:@: @:(@:@:$@:@@:x@l<;@:l@.@.@(H;@.@/@T.@.@X<;@/D@j.`@k.|@(>;@.@:@@.@>;@l<;\.e @T@9@l<;@U;@l<;\@l<;4@l<;P@];0@<;L@W;h@(\;@f;@tg;@|=;@\;,@|<;H@l<;d@l<;@l<;@l<;@l<;@l<;@l<; @l<;(@l<;@U;@g;$@,X;@@X;x@ ;@$;l@.@.@(H;@.@/@.@.@X<;@tW;D@j.`@k.|@(>;@.@@.@>;@9`.e@T@9@;;@8.@l/4@\l/P@`.l@/@.@(H;@.@/@.@.0@<;L@<;@X<;h@t=;@0<;@e.@|=;@>;@/,@<<;H@/d@$.@4/@/@T.@/@. @.(@P<;D@j.`@k.|@(>;@.@.@.@@.@>;$@,.@@,.@l<;x@).@$;ffs_mapsearchffs_nodealloccgffs_freefile_commonffs_blkfree_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snapffs_isblockffs_isfreeblockffs_clrblockffs_setblock@@@@        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?040$;80$;ffs_newvnodeffs_reload*0H,0.0/lH00 0 ffs_sync|@@ܶ@Ad_0A&B@'Bt.e@T@9@l<;@:@:\@:4@:P@:0@:L@:h@:@:@:@:@:,@:H@:d@:@:@:@:@:@: @:(@:@:$@:@@:x@l<;@:l@D0@ H;@l0@0@0@0@0@X<;@<0D@0`@0|@(>;@>;@0@t0@$0@>;$@0@9X@0@0 @T0@ 0<@<"0t@\#0@<;@<;@<;x.e@T@9@l<;@U;@l<;\@l<;4@l<;P@];0@<;L@W;h@(\;@f;@tg;@|=;@\;,@|<;H@l<;d@l<;@l<;@l<;@l<;@l<;@l<; @l<;(@l<;@U;@g;$@,X;@@X;x@ ;@$;l@t0@ H;@l0@0@0@0@40@X<;@ؕ0D@0`@0|@(>;@>;@$0@>;@9X@0@0 @T0@ 0<@<"0t@\#0@<;@<;@<;|.e@T@9@;;@0@L0\@04@0P@0l@(0@ H;@l0@0@0@0@400@<;L@<;h@t=;@X<;@0<;@h?;@|=;@>;@<0,@<<;H@P0d@0@ 0@0@0@L0@`0 @0(@P<;D@0`@0|@(>;@>;@0@0@$0@>;$@0@@h0@9x@ ;@$;X@0@0 @T0@ 0<@<"0t@\#0@<;@<;@<;`@A0KBA&B.eh@T@9@;;@l<;@l<;4@l<;P@0l@|0@l<;@l<;@l<;@l<;@l<;@l<;0@<;L@<;h@t=;@l<;@|=;@l<;@tW;,@l<;H@l<;d@l<;@l<;@l<;@l<;@l<;@l<; @l<;(@l<;D@80`@0|@(>;@>;@0@p0@0@>;$@l<;@@l<;@9@>;ufs_inactiveufs_dircompactufs_dirgrowX000X0|0l000\00A0@'B ... 1"111uao_put-1 716146171uvm_km_suballocpg1r1$s1uvm_unmap_removevmmapbsy<@@@`@uvm_page_physloaduvm_physseg_unplugswap_offswstrategyuvm_swap_initswap_onX5X5 A2@2,5T5@8X60i3,5<2,5C2,5,5,5 ^2^2 ]2]2\2A\g2p5BAh2~5BNetBSDA@x25BAp25B6BX7Bd7Bs7BA,@A#7$wx@g`8@O@cv@2445deadcvA29BX5X5X5X53X5@8X60i3,503,5,5,5,5T5@8X60i3,5<<<d*3)3J3filt_timertouchOB4545\a3;@|:@:@:@>;@|<;x@@:@(:T:::T;e@T@9@;;@:@l<;4@l<;P@;l@;@l=;@(H;@l=;@l=;@;@:0@<;L@<;h@:@:@:@|=;@l<;@|<;,@l<;H@l<;d@l<;@l<;@l<;@l<;@l<;@l<; @l<;(@l<;D@:`@|<;|@(>;@>;@:@l<;@;@>;$@8:@@<;@|<;@>;genfs_suspendctl;;D;;;;:;;;l:;genfs_can_access_acl_posix1e@ @@ @ @AH;Blayer_bypasse@T@9@;;@U;@l<;4@l<;P@];l@4Y;@l=;@l=;@l=;@l=;@a;@d;0@<;L@W;@X<;h@(\;@f;@tg;@|=;@\;@tW;,@|<;H@l<;d@l<;@l<;@l<;@l<;@l<;@l<; @l<;(@l<;D@U;`@W;|@(>;@>;@U;@g;@W;@>;$@,X;@@X;@9x@ ;@$;devclsdeviocdevoutdevindevwaitdeviodevopnAs; A;X;,;;D;܋;h;;X6Dc;X;,;<;;D;T5@8X60i3;X6Dcdkdump`BBpBBEFI PART(s*K>;B2IчH&UB|nQn- q+&UBZIчHA&B|nQn- q+A&BSFU0eCA&BIчH(BIчHˉB-чH>B-чHՉBSFH0eCBS'@ )ѸBB*1@ )ѸJB1x )ѸOB3Dh&WB=rGy=iG}\B|nQn- q+cB,;d&4D;P;;; ;T5@8X60i3,5D;P;,; ;,5;,5;X5L;L;(;T5@8;0i3,5;;;;\;T5 ;X6;,5@;;;,5,5,5,5T5@8X60i3,5B0;;0;'3;;T;;'3_bpf_mtap_softint_initA;B%BA;%Bifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timer-Bȑ<BБ< B<)B<ȑ<rt_initrt_timer_initrt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0`<<<jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGݟB&UBBBBBBA&BB(BBBBABBB\BWBˉB>B B;'BBBB"B&BՉB,BBBJBOBcB  gntsD===4=$=ٙAtAtAe 5BCB==rbmn==D===Цe(KBstrtoullstrtollNA;>B/>B/>A,>7A4$>CBx=ٙA8=tcid >>>0#>>>>>> CSAtAtA7A3A3A.cAyekd>>>e BeBe<BȨe,Batad&>H%>$>AABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/eBloob.>.>$.> (A (A(A(Atruefalseyara4>0>2>01>1>NAuBxB.cAe Bstrtoul wBCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025, 2026 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALLsrc@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 NetBSD 11.0_STABLE (INSTALL) #0: Sun Sep 13 13:58:42 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL @(#)NetBSD 11.0_STABLE (INSTALL) #0: Sun Sep 13 13:58:42 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL 11.0_STABLENetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopunable to acquire bus. error=%d output write failed. error=%d : GPIO controller ioexp%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDzlcdstdw100lcd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctlcouldn't register event handler zkbd: pseudo power management module zapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn und%s %08x , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)scsiverboseperiphtapeprinterprocessorwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typescxsplunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer %02x DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter %s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA command abortedATA volume overflowATA illegal length indicationunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 %s:%d:%d: %s error (0x%x) wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out atapiscsibusdetscsinitq: SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info target %d lun %d: <%s, %s, %s> %s %s%sLUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307PiSCSI SCSI CD-ROM QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA Virtual CDROM scsibusscsibus at %s channel %dscsi_subr drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %sALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibusread_cd_capacity: extra large block size %u found - limiting to 2kByte optical mediacd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectors (%lu bytes/physsect; first aligned sector %udrive offlineunformatted media%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASrecalsetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %swd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer error%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %d "couldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d lcd_free on active screen Stray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacunable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciausbevtusbrhxfer: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hcusbtask-drunable to create task thread: %s usb_create_event_thread taskusb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usb at %spre 1.01.13.03.1usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach %s: bad descriptor %s: descriptor length too small %s: descriptor length too large hub-addresshub-portsubclassprotovendor-idproduct-idvendor-stringproduct-stringserialnumberusbififusbdevifusbverbose port %d configuration %d interface %dvendor %4.4xproduct %4.4x%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %dusbdly%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDwatchdog timeout open rx/tx pipes failed: %s tx list init failed rx list init failed usb error on intr: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) usb error on tx: %s Ethernet address %s usbnethub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %s reportid %duhidev%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lock: input=%d, output=%d, feature=%d uhidreauhid%s: was console keyboard bad modifier sizemultiple key code arrayskey codes not on byte boundarykey code size != 8too many Variable keysattach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). ukbdusing %s over %s quirk init failed endpoint not found %u/%u/%u %s: Get Max Lun failed: %s unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=%#x not supported bus attach failed %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s ATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumassumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cb%s: reset failed failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out if_aueno union descriptor no data interface setting alternate interface failed unexpected endpoint could not find data bulk in could not find data bulk out faking address if_cdcecouldn't get ep %d %s: read MAC address failed if_cue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed could not read Ethernet descriptor if_kue%s: %s: bad register %04x failed to get interface, err=%s couldn't get endpoint %d if_urlmedia change failed read PHY failed can't read rxmodefailed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axe%s: reg = %#x: %s %s: packet length %d too long%s: packet length %u too short %s: rx_cmd_a: %#x %s: invalid packet length %d %s: not ready %s: timed out LAN7500LAN7800failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints %s: PHY not ready failed to initialize chip %s id %#x rev %#x mac-addressfailed to read MAC address if_mueif_udavunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration %s: NIC memory corrupt - invalid packet length %d device enable failed %s: remote transmit DMA failed to complete ne2000_write_mbuf: negative lenwhere did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1timeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardlRoot hubOHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted ohci_setintr: 0 interval ohciabt2ohci_device_isoc_abort: early return WARNING: addr 0x%08lx not found , legacy supportohciabtohcixferOHCI version %llu.%llu%s unsupported OHCI revision SMM does not respond, resetting reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d[29~[28~OAOBODOCOoOnOmOlOkOjOMOI[2~[1~[8~[7~[6~[5~[4~[3~OpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using NUMA allocation scheme UVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleteextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %d%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%d.%d/modulesBuilt-in `%s' failed: %d moduleautounload_unsafeautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'Loading plist from %snoautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings:%s first in package: %s GAVE UPureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectordisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uaioworkaiodoneaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group found only zombie processes load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultfstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... filedelaydirdelaymetadelayvflushbuf: not dirty, bp %pinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hashvnfull%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d The multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqgpiobus at %sis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempviocongpioirqumcpmioemcfancttyphysconptcqmsofconsvndtunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseulptraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuswskbddevuhidbususbuspcmciabuswsemuldisplaydevapmdevifi2cbusreportiddriveconfigurationproductchannellungpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3propstng%lliintegerpropnmbr%s: invalid base %d?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesspaceuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraecbetbdchfesprrcdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noatimenodevnodevmtimenosuidnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 11.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionendavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: N, (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease11.0_STABLEzaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]tmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'entropy-file/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX /netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700modulesbasegamesgpufwmanmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sFATNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD11/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%lliStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1181: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnusedPri GPT tableSec GPT tableSec GPT headergpt resizedisk %sv6v7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmfsvmwresvzfswindowsefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD dataVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646tolowertoupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d MՓϞkŤH19Q55Ei}}se) me#  !!#(0%9A%)BY+F4K4Q4X 6^ 6d8Y:h>@pCzGT.E UU@@Da  @@ % km  y   @@p & @@,%unblock and -DNO_CONV?hdh@hnm4hT̴gg100 0Usage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directory/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerunknownPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xmalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %skeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not found%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink' ' '''''?''?)((0(EA(ZU(j(((#( (_(^(F(<(>(?((PATH= 22t,f2d22s2,c22m22l3 3r 33p$3,3n832v @3Fb    EOF reading here (<<) documentk8w888888888886f888888888888889DF8L8Q8V8Y8_8 +{f8/c0 T0}-+?=///////,;,;0;@6;@;F;L;R;X;_;i;@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'C0 >B0>$B0>IG>>>> >!D$O/</ho Pl1 ('H> > > l >                  ??????,?&r;ՙX=/?Y@??b@??@5Y41&?)@@@@!@@@@@Y9&@9(@0@J5@r8@r>/с@@]F@u|uL@M T@Z@(EJ>Et3@b@7Mh@Yo@u@IX ~@rGhCnCtC|C CCCWCF@CCC C CZ C 2C:DDDDiD DDD!CDDeD=DePDD{D5DDiDDe'HFFLFH TF@ZF@^F/H8HfFEE,EC$0EC7EC$6EC>EGEDE E EEEE$EH F@@REXEaEG%GhEpEzE-GE@E@E E GERGE@bGE rGGEGEGG E@EEE,!EEGG FF FFF#F3$F#*F33F22F38F3>F#S'S7ShSySSSSSSST~;"TP>UBUHUPUVU\UbUhUnUvUT~UUUTTUUUUHTPTZTdTnTvTTTTPTTTTTTTTTTTTTTTTUUU*U:UP>UBUHUPUVU\UbUhUnUvUT~UUUTTUUUUHTPTZTdTnTvTTTTPTTTTTTTTTTTTTTTTUUU*U:U5)$7^   ) E gw$4H]s !#$&1234568 99:1;K<i=@ABC D3EIF^G^H^JtLMNOPQRS TUV3WM\Warc|defghipqstuvw#x7Sd1Mm7Ol|& 0Sfu )CSn1Ig 'Bx1a*[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]RW,YYWHTPTZTdTnTvTTTTPTTTTTTTTTTTTTTTTUUU*U:Ureturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?in_addr_flagsin_statuscommit_address setifprefixlensetifdstormasksetifbroadaddrclone_commandusagestatusP̝printallmain(zipyi??? \?? 8*]K:A< < @@Q< Q< ֋ (@4@LT ]0f@ox}  @̝init_current_mediaCGNCY`hPmedia_statusmedia_constructor"+.4+.++:+:"9+d+dNh Ch`ow@owNhY`paddr_matchN!WaR!WR;WSwWCM!WL!WLsettunnelY z`print_link_addressessetvlansetvlanif`ΐ_setifssidsetifnwkeysetifbssidTWZ]h hh s* %Qh 8Ms* Trr1rAbinvalid major numberinvalid minor numbertoo many fields for formatffs@ly M@ m >&<Mo @@Q%*3:?CKOUbnorripbgensbextattbnojolietbnocasetransbrrcaseinsșWz&2ԙ?r&ؙ  @%/38? șWz&2ԙ?r&ؙ  B K0;@WX&f&@^dl@ptCbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorșWz&2ԙ?r&ؙ  0;@@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsgșWz&2ԙ?r&ؙ  ^@@CV0 @ÞɞΞҞ֞ @X^dܞmw @recvrpcrpc_getportrpc_callsendrecv%s: can't read disk label; disk type must be specified%s partition type is not `%s'Guxئ0P .Nܨ!WTWTbSS "'DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY[nGg-UuMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbhw.disknamesSW[_cg***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]aQQ: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data ,Qm\ ȗЗܗX""",""(2"CK"mx ""B"˰"ʱ"Ę2"͘՘"^"@""W" ȗ"("4#"B#"S\ "k4 "z " "B "™'"˙&"ՙ\4"43"2" 4"B1")O"5N"collectZV@BNAME=YY,jRHTPTZTdTnTvTTTTPTTTTTTTTTTTTTTTTUUU*U:U>    "#$%   "#$%    "#$%&'()*+.   05eMg1Lcs HTPTZTdTnTvTTTTPTTTTTTTTTTTTTTTTUUU*U:UghxHPQ%SO1SEMJRKaMJuJ[OXmNL!G-L_SUWGXK}KKJJHTPTZTdTnTvTTTTPTTTTTTTTTTTTTTTTUUU*U:UhI----------------------------------- - --------------------   "#$%@//tmp/usr/var""," "x Details for index GPT part - HTW,Y!'T,15Y>TDIj>RVT\Uflt}9U[wy# 5Aq9WY TTf t!SFH0eC쬠YSFU0eCcTHah!IdontNeedEFIn(s*K>;x|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+t:U=rGy=iG};Mt?mWC 3KOO yD<#*=(",3Dh&ǂ6\ M}-IZ@Mjy֬k|-чHT-чHTZIчHWIчHYIчH2IчHL6 %?aS'@ )Ѹ*1@ )ѸfU1x )Ѹ.h ' u     [ Y[ u  Y  ] e aQ  9!  #+8TAHRZdt  <<<<<<***************************************************************************************************************************************************************************************************************************************JDJJJJcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2<WWdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_config'Nb^cEdeyXf^g&YhLYij^k^lCdm^n6o^p8q3er^s^^tYu^^-Vv^wTx^z^y_A _B_CWD_E}DF(_G2_HZI<_JF_KM_LMV_N\_Oe_Pr_Qz_S_T_U_V_W_X_ZK1_4_6__^|_~_}`_``*`8`6`?`=`D`L`Q`W`]`c`z2\r`{`d\```````````[la````a] a^a!a4aAaOa[a e e rt_new0 rt_buildrt_deleteQ Q [`0dDT7dAdJdUdUY~^]dH_`O_%d`(dmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_osmftfzf~ffffif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfdhcp_initread_leaselog_dhcpoooppdhcp_boundpdn&p.p:fm6pi >pdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa/ / / / / / VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B>eG D}G JG PG VG \G bG hH n-H (EH t]H zuH BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~i|'|#'>DJPV\bhn (@tz<84cs_pathX bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_max>DJP(V\@bhXn(ptz-o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::1epa$b  (,KlO9O\SWĖ\U < <  <        ȝ؝|hd`tS 0S ,gntsQ S R e c rbmn`b Xa ` a Ha tcid L Ȕ D l ԇ ` T yekdȗ ( x<@patad x loob < \\ddyara   @ X \X̪ 8D\h ث  , DD P\Ԭ( (08@HLTP0X`dl $,<DLT\ܒdlp|0P̲ܲȳ̳гԳij`lpt|Ĵ̴Դܴ8 (048<@DHLPTX\dlt|ĵ̵Եܵ`  4DP\xȶԶ (<Td|ȷܷ 4H\pԸ$8L`tĹع(<PdxT  x, p,@<(T(@\ؾ,L T(T(T(t-|l)t|$ | $@HX\pt|     L  $48@DX`tx,0<@`d !"#$% 0& '08)TX*\\+`d,x-./0123$78<cTXpx$#<$T% d&pt'0()T04<@H $,8LTdl    (,<@LX\txt|tttlC|ؾ(  (4<DLT\hp|  ,<Th(@LXl(8P`x ,Ll ,\t <Xp(<Pdt4Hd(8Ld| ` h p| xԣ Hs ,D_ t5|(t6|)T |in%c&@%d\n%n%w%n%`n%8 Wl\d &  _0s%fx jc%]|&Hs 4[]pn%Ljin%Jn%n%! &;hhw%$l\Tn%xn%&Z [ljn%bia& &0hd%&|c%ԣ 8L w% fD_ n%%[|c%w% & tn%Dnln%fxO%P\dn%DjEdc%00gf&4n%Xn%Ln%! c%VG Hn%$[In%ci T%[fH &w%p&Pn%Ii &Hj L~& `HfP.~ v abjj(cf/h;kJlZmloxopppqru%tvRwwxJxFzQzB)CJOP STV&V,X;Z9ZDKZav   h(}5](iae!}5/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin6}-+?=###%%%}<<5a5$5EV*5eF25IRi<5LJ5lP5mX5Cb5ni5fp5v5p}5b5u5&55q@s55hv5VV5x>@=d <YY ... ...]jopo 0---04y phAabCdhlNsuvW:w:z@HPX`(ي| D :DH9uH ?l ӊhDHD_(4(\\(l(|0Ɗ0;|x06  <01; 0h|0 0̊(  Dh| H@99 U8 8% K;E KK0݊8@8 U8ċ 7 8]  ]8i7:  :817*  *86  00@5H @G: :@eG9 8H.  .@F 0z`XWǎ ǎ0` _ 8y_֐  0` (L0rx@d @Uc 8cT  T@b 8s * 8Ms * 8h  0 %tKxxyxyNJxx1w-xy x$Yy,x2x7Yy<xbb  '@@șWz&2ԙ?r&ؙ  0;@@X&......dA..##.I4| hC K ! J -?2EP5*": +!2"9#$B%F&N'Q(Z)_*$+h,l-p/z1123456|#! *4@LV^fh9phrh-whY]hu\zhyf|hQ\hv hx@h1jh-}heu hvhqEhxhiihUk h%mhvhfha{hzh-{r;hvhhdh\BhqhIhJhbk5h1i0@hflhuh vhQ\hjXh hYhrHh%mhq~hkrhnhchIshn7h%mhdh\hi^h he^hche^ h)h%mhuyhyhqh $h9z,h%m2h%m6h%mhMiphgVh-hhwhY]hrChv<htL h}hBhbHhbNhUVhl]hch}khUvqhswhh{hY]hg?hՃh!uhhCheh%]hu{4h=~h\h}hfb@hQ[o@hu5h=huIhiqhghzyhu@$!3J5r   b0 z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJx~~~ee$+2=FQ\cnt|& '.'5ALW\ejrre~t!$\n>|b'AW'/eK&bvr\\\ppp\""p    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ is a directory is not a regular file (use -f to see it) (s6"  DfM   $ 9".":>EKQ^"m;x +7   #28  (8!&98B$L&DfW)cm5ve: %6-74 +,-.* ?&Eo-/9/G'SF` WmkRkRkYcWbkCkc kG ky wb YMYrWcaP"N'o''bH@")''B@"'(c8"D(o(o(d0"((0A"((D(((e "))3)f"S)k)F"))g"))*h"Q*j*i"A***jY**J!"+&+kHH9K">+c+L"++m"+++n""++,o]&,O1,pHEP<,q"E,m,,r"",,-sx!"D-\-Sp!"y--th]-T`-uX"---VPMwH"".).Z.x@(!..X8A"..y0"./z("$/9/" X/~!"a//?#Q//A"//|"/ 0",0N0x"j00(M0l"0 1h"-1@1\1d"11`"11$\"522$X"a22H2T"h22!P"22!L"22!H"23(G3!<"V3j3x8"33p4"33h 4`,"4A4P"b4v4X("44H4@!"4 58$"!5P50 "y555("56+6 "<6s666666686467#727D7rV7b7l7v7777777777777$8 838 8(8-8;8M8V8f8z888+9888888888999,9:9M92Y9^9k9(x98" (press RETURN)Wtags643{}abcdDgGhHilnNpPqrs tw xy !:#=;";"[[%]<<!lg2< !A>'ABt@Ap[B|s7$E;Cq<+q<c4.44??sQ>?%]O#6Y?lJ"\E,!FFPccajlDsohzJ" !"$'(+-.03569: OH d$Q L"T $` <e am P"r a{ P"CaP"\\~ aP"^V do P"a@P" aL"V` I dya P" aP" Ȋ   Q LaP"E d xP" d tP"!dlpP" !Do!!>Fa !P"$!Y/bin/sh)v=vQvssaaadistivvbsYl_t^IlatbAlVtXtWtYtas%at%1ax%=aWIa#Ua\#`n#`{#`#`#a# aH#`R#`"#`*#`2#`;#`Qlotut}tQeKvLeMkNRuec=effIfJyfK%fL3fMWfNOePkvq`w`w`<Qt=Yt>_t?gtR5`"I`"]`mbUb1bkjuu`QItbbbbQkijbf_R `|%_%_%_R_"_"_%!t%)t &1t0&9t!AtmcUc=c%ctcccauyuutct1uIujtktcuut,}_W_ sssu_ssdcuvutsdddqdYd5dkjdftsgggghuhehUhGh9h+hh]_e_m_O_sU_hhhhss^_&+i'i(i)iQiif{iqi%Aiiiiaiil1^0;I^V&_^^&w^d&^b5^p&^x&^KH*)9i x)t% 8))^(u ( _(( _{(I_ 'g 'aF &QgqpFh&5gq 8& &%F%arF8%mgirF$grFx$f s  ($# #& #F (#J}aoF "Lqao$ h"; ("!Qw2$x!o%f2$X!o%2$ o%   h  H   UHT]sFdMsFh`5qF(daas&&&'#''t{8'''%'dN-'@'H'()+,4.T...///Q//00 0 00@1%2345"5v/5N5a55555556W6637i77777t8z8~888 899'979C9999(:U:::::;G<<===1>? ABC EE.E>FFkGGH&H5H{HHI(JuJJKKZKjKyKKKKKKKLLLMMMM NWNlNNNFN*P@PPQQQRcR"T UUUV~I~j~~~~==Ik@{hahƂނ ?ht%(JZpyφ*7?INXarχz3*07BIPYctʉՉ *v;EZk}Ae̊ +:NZdinӋiv;#+?Whp{Ռp $3DR]jv{ˏ%-R;В 3n $=OEaaejntw{Gbbf^[3sA/ ftp°@nZʰRհݰ@ -:DL RX^bƊjrx0} 10&'()*+.1/B4<%C#C=uC5>!BOA??@?A?B # AC ?D T?E (?F ?G;?S1??d7hg1]1s=]1cuks=][Z[EZ.dAWfm0  C   w8       RUs "%),037( :!K"Z#f$r%&'()*+,--..// 012345(6 789:;%<4=@>R?`@n[\\]^^__`{{ |}'};~A    @@`###Ć#Ȇ#І$܆$$$$%%%l%%&$&0&8'D'P'X(d(p(x)))***+ȇ+ԇ+܇,,,,- ---$.0.<.D/P/\/d6p;;00011Ĉ<̈<؈==>>?22$2,383D3L9X7d8t:44455 ȉ! ؉" # $ % & '  ( ,) 8* D. P+ \, h- p/ |0 1 2 3 4 5 ̊6 ؊7 8 9 : ; <  = ,> 8? D @P!@\"@h#@t$@%@&@'@)@*@+@ȋ&`ԋ'`,@-@.@/@$0@0(`@1@L2@\3@l)`|4@5@6@7@8@Ȍ9@،:@*`;@<@=@(>@8?@H `X!`h+`x,`"`#`-`$`ȍ.`؍/`%`CCDD(E0E<FDFPcXcddhdteĆex##&&0̎ЎԎ؎܎ (08DP\lx|ďȏ̏Џԏ܏  @@`ȅЅ܅   @@@ @0@8@D`L`X\dlt| @ 33333333 (8Tl3333`dhlpUTC33. / y* + . * 7. * 33&339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž\]\t] 33UU33UU33UUa08]@b08_ b08`bah%PX`hēptxx   @ 333333333333333333333333333333333333 33 33f  0000000000000000 X &3333T333333ggg (root)`33 lC|ؾ( 48<@i $p@lppHService unavailabledA*aeabi 5TE  1\7xܭoAYrV`.T`0 AP:D"MP(onѽ Kٝ7k/וRv֠r5NeoW])Ky}툼''r3Ea {|L?w0j[1VoG݉Xm5K9_k.rø_\|p-.{s>XχOr_"-gw>/;A>q8.ϳJw"_:[y㵌|kyV^}Tp)k*bL ׽3z;o.\4}iqa~ć| c(Sk\#Z??ۼfsmG"ȯEzډ|Z?ݮF>GiREQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+`g.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /B8H88\^PV$bgt\y  (HjHHjHp&HpH+t+MSGTXTS621 4984 5009 5026 5048 5051 5056 5064 5071 5079 5087 5090 5093 5096 5100 5112 5121 5134 5163 5178 5725 5759 6442 6730 7438 7494 7568 7664 7839 7862 7885 7891 7900 7922 7926 7930 7933 7936 8041 8244 8483 8924 9362 9397 9412 9424 9430 9442 9491 9511 9551 9568 9585 9600 9647 9685 9733 9815 9939 10075 10116 10154 10191 10226 10236 10285 10435 10441 10446 10450 10470 10580 10600 10606 10620 10632 10643 10680 10714 10738 10840 10877 10899 10998 11053 11111 11122 11138 11190 11358 11565 11736 11800 11852 12127 12680 13212 13647 13985 14318 14431 14446 14455 14615 14786 14936 15100 15123 15147 15162 15237 15377 15554 15709 15721 15801 15902 15948 15974 16044 16055 16064 16077 16103 16118 16134 16147 16202 16213 16228 16432 16665 16694 16709 16778 16852 16925 16955 16993 17047 17466 17492 17521 17625 17731 17916 18028 18143 18247 18934 19193 19333 19369 19539 19580 19716 19739 19776 19821 20072 20168 20222 20321 20332 20369 20406 20433 20442 20476 20483 20508 20535 20570 20584 20598 20627 20641 20658 20667 20689 20707 20724 20735 20754 20780 20798 20821 20838 20853 20868 20886 20913 20940 20962 21001 21019 21051 21279 21353 21396 21442 21589 21745 21789 22068 22095 22454 22638 22790 22971 23118 23276 23297 23345 23355 23363 23374 23385 23395 23402 23417 23429 23470 23500 23539 23592 23650 23671 23678 23697 23718 23725 23751 23773 23793 23815 23846 23883 23905 23919 23965 23994 24028 24068 24103 24131 24179 24188 24197 24202 24211 24220 24237 24241 24246 24252 24256 24269 24278 24305 24325 24348 24367 24394 24416 24448 24464 24469 24479 24502 24524 24541 24558 24571 24580 24589 24595 24622 24629 24653 24674 24698 24711 24730 24755 24778 24794 24800 24812 24842 24850 24890 24901 24912 24923 24940 24957 24971 24988 25436 25652 25916 26188 26240 26276 26312 26363 26380 26418 26432 26439 26456 26459 26464 26473 26485 26496 26505 26526 26568 26606 26622 26653 26678 26713 26769 26809 26830 26850 26891 26920 26968 27201 27236 27443 27462 27499 27560 27598 27637 27793 27808 27854 27902 27925 27961 27971 27981 27992 27997 28060 28108 28152 28213 28246 28347 28365 28504 28526 28649 28663 28673 28696 28801 28857 28973 29004 29009 29035 29074 29084 29127 29137 29153 29168 29186 29209 29239 29260 29286 29483 29526 29530 29536 29542 29547 29558 29572 29601 29633 29645 29692 29742 29782 29809 29825 29834 29877 29883 29891 29895 29915 29932 29944 29975 30231 30280 30856 30883 30915 30943 30995 31001 31007 31012 31033 31049 31071 31100 31241 31375 31388 31524 31526 31528 31530 31547 31560 31578 31605 31609 31615 31620 31628 31634 31674 31676 31686 31701 31718 31752 31784 31822 31851 31880 31902 31945 31971 32015 32151 32225 32227 32229 32268 32335 32352 32366 32370 32377 32499 32568 32856 32994 33135 33216 33263 33269 33292 33338 33341 33367 33410 33475 33537 33607 33675 33768 33987 34012 34016 34052 34070 34098 34140 34184 34248 34298 34374 34396 34448 34492 34531 34565 34595 34626 34651 34660 34672 34680 34691 34703 34722 34746 34795 34812 34836 34879 35201 35204 35218 35231 35243 35250 35261 35268 35275 35284 35294 35311 35327 35377 35385 35393 35403 35414 35432 35449 35470 35492 35501 35511 35538 35544 35554 35573 35589 35607 35627 35636 35647 35654 35671 35690 35711 35721 35738 35744 35760 35775 35790 35811 35833 35852 35862 35867 35872 35890 35909 35928 35934 35953 35973 35993 36011 36016 36022 36039 36055 36076 36089 36097 36117 36141 36158 36166 36177 36198 36204 36216 36238 36252 36261 36282 36300 36309 36343 36366 36393 36425 36448 36468 36479 36511 36527 36538 36551 36574 36596 37104 37134 37165 37193 37207 37408 37630 37797 37884 37901 37919 37936 37965 38012 38023 38042 38064 38143 38335 38363 38481 38503 38644 38663 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_STABLE. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_STABLE ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_STABLE ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_STABLE InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_STABLE ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVDDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzSendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): Kernel (GENERIC)Kernel (C700)TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.e a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.m running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS621 4984 5022 5039 5054 5057 5060 5065 5073 5081 5089 5092 5095 5104 5116 5128 5137 5146 5172 5183 5722 5749 6315 6615 7256 7303 7416 7509 7543 7562 7580 7588 7597 7622 7626 7630 7633 7636 7758 7943 8171 8691 9042 9071 9084 9097 9102 9122 9141 9162 9221 9238 9252 9274 9319 9345 9386 9464 9582 9696 9750 9779 9811 9850 9856 9889 10012 10019 10023 10031 10055 10137 10143 10150 10162 10176 10185 10218 10237 10249 10359 10421 10440 10559 10610 10662 10674 10693 10745 10949 11157 11348 11408 11457 11727 12189 12858 13284 13606 14031 14163 14195 14207 14385 14582 14743 14877 14897 14930 14944 15013 15126 15298 15433 15453 15565 15657 15680 15703 15762 15777 15798 15813 15834 15854 15879 15893 15917 15929 15947 16157 16407 16428 16444 16497 16565 16638 16675 16701 16777 17234 17260 17282 17389 17496 17697 17770 17854 17954 18449 18687 18838 18872 19007 19051 19190 19231 19276 19323 19567 19700 19762 19856 19861 19895 19929 19944 19972 20005 20012 20037 20055 20081 20088 20103 20118 20138 20178 20195 20215 20236 20258 20273 20293 20315 20330 20343 20357 20369 20381 20395 20418 20441 20459 20502 20553 20590 20775 20838 20874 20923 21014 21144 21197 21457 21504 21865 22015 22184 22324 22444 22576 22616 22663 22673 22681 22691 22699 22710 22721 22735 22760 22805 22838 22871 22906 22960 22985 23004 23026 23031 23037 23070 23087 23114 23132 23153 23175 23194 23204 23234 23260 23287 23336 23364 23391 23444 23454 23464 23470 23480 23489 23509 23513 23518 23524 23528 23541 23550 23581 23598 23625 23646 23666 23685 23711 23724 23732 23748 23779 23810 23831 23857 23870 23878 23889 23895 23919 23929 23941 23959 23970 23990 24006 24032 24054 24070 24082 24102 24128 24134 24164 24178 24192 24215 24234 24253 24271 24289 24707 24908 25148 25332 25410 25465 25532 25572 25595 25629 25640 25648 25671 25674 25677 25683 25694 25706 25719 25749 25793 25806 25819 25856 25870 25881 25892 25903 25920 25931 25978 26001 26050 26291 26324 26579 26600 26633 26686 26712 26739 26895 26901 26944 26964 26983 27012 27019 27026 27033 27038 27087 27125 27159 27216 27244 27289 27306 27407 27412 27489 27503 27513 27537 27660 27741 27851 27879 27884 27900 27929 27937 27978 27985 27999 28012 28020 28039 28072 28092 28112 28328 28359 28364 28371 28378 28382 28396 28408 28423 28456 28469 28524 28582 28618 28636 28654 28672 28709 28715 28723 28727 28748 28765 28776 28798 28976 29020 29722 29746 29780 29799 29844 29851 29858 29862 29886 29897 29902 29965 30086 30209 30222 30356 30358 30360 30362 30372 30381 30394 30421 30425 30431 30436 30445 30450 30477 30479 30492 30504 30519 30547 30591 30638 30654 30676 30687 30720 30740 30789 30889 30943 30945 30947 30988 31079 31096 31110 31115 31121 31230 31289 31540 31681 31808 31876 31913 31920 31947 31993 31996 32017 32062 32113 32172 32241 32288 32393 32536 32561 32565 32599 32616 32640 32692 32743 32815 32881 32979 32996 33027 33063 33097 33121 33145 33178 33198 33208 33216 33224 33234 33245 33259 33285 33333 33356 33376 33417 33716 33719 33733 33745 33752 33771 33785 33792 33799 33808 33818 33835 33851 33899 33907 33915 33925 33936 33954 33971 33990 34010 34017 34034 34051 34058 34071 34106 34123 34142 34162 34172 34188 34201 34219 34239 34260 34270 34290 34310 34323 34342 34355 34379 34402 34415 34426 34431 34438 34456 34475 34494 34502 34521 34541 34566 34584 34591 34598 34611 34620 34641 34654 34662 34682 34710 34727 34733 34744 34775 34783 34796 34818 34840 34849 34870 34888 34895 34918 34937 34964 34982 35002 35015 35030 35051 35065 35072 35086 35101 35120 35665 35698 35726 35755 35763 35800 36112 36289 36366 36383 36401 36416 36438 36488 36498 36515 36537 36596 36754 36778 36908 36933 37059 37077 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_STABLE. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_STABLE ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_STABLE ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_STABLE completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_STABLE. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_STABLESalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_STABLEEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVDDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroSendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): Ncleo (GENERIC)Ncleo (C700)TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can creatMSGTXTS621 4984 5020 5037 5052 5056 5060 5065 5076 5082 5088 5091 5094 5097 5101 5113 5125 5135 5165 5177 5610 5637 6213 6573 7258 7319 7397 7492 7532 7554 7572 7578 7587 7613 7617 7621 7624 7627 7749 7934 8162 8691 9109 9138 9151 9164 9171 9191 9210 9233 9276 9296 9315 9338 9382 9411 9452 9518 9630 9744 9798 9827 9859 9898 9904 9937 10015 10021 10025 10030 10071 10208 10218 10226 10245 10259 10268 10300 10341 10354 10479 10537 10556 10675 10731 10783 10794 10810 10849 11099 11271 11443 11498 11533 11786 12193 12495 12766 13127 13307 13626 13646 13659 13848 13992 14188 14322 14342 14375 14394 14495 14650 14838 15025 15045 15124 15222 15260 15283 15373 15394 15417 15436 15460 15490 15534 15567 15590 15602 15620 15888 16207 16238 16273 16337 16412 16482 16513 16543 16635 17126 17156 17173 17313 17454 17651 17770 17917 18084 18642 18938 19119 19164 19327 19381 19516 19552 19612 19662 19953 20062 20119 20216 20221 20256 20291 20306 20330 20363 20368 20393 20409 20432 20439 20456 20471 20490 20522 20526 20546 20564 20576 20589 20607 20631 20649 20668 20695 20722 20734 20755 20785 20815 20840 20873 20908 20946 21199 21268 21323 21384 21502 21661 21715 21976 22027 22403 22558 22702 22842 22950 23135 23165 23208 23218 23226 23236 23248 23269 23278 23284 23316 23360 23396 23434 23471 23519 23543 23555 23569 23577 23585 23616 23633 23662 23683 23706 23715 23734 23746 23790 23828 23855 23899 23927 23954 24007 24018 24029 24036 24046 24055 24089 24093 24098 24104 24108 24121 24131 24161 24184 24213 24235 24257 24279 24306 24318 24330 24349 24383 24416 24437 24461 24474 24486 24499 24505 24531 24541 24552 24576 24586 24606 24626 24643 24669 24693 24706 24726 24760 24767 24796 24819 24842 24858 24873 24888 24903 24917 25348 25539 25774 25962 26004 26054 26108 26156 26178 26219 26230 26238 26262 26266 26270 26279 26290 26301 26316 26347 26393 26406 26419 26449 26463 26475 26487 26499 26517 26540 26585 26608 26668 26920 26947 27209 27227 27254 27303 27333 27364 27496 27503 27552 27575 27599 27628 27636 27646 27654 27659 27712 27761 27801 27867 27900 27944 27967 28068 28073 28150 28164 28174 28198 28321 28402 28512 28540 28545 28561 28590 28598 28639 28647 28661 28674 28682 28701 28734 28754 28774 28990 29021 29041 29047 29054 29058 29073 29092 29118 29127 29139 29193 29251 29286 29305 29322 29334 29369 29375 29383 29387 29408 29425 29436 29461 29639 29693 30384 30403 30438 30468 30514 30520 30527 30531 30555 30571 30577 30652 30802 30921 30934 31002 31004 31006 31008 31018 31031 31048 31075 31079 31085 31090 31099 31104 31131 31133 31146 31158 31173 31201 31245 31292 31308 31330 31341 31374 31394 31443 31543 31597 31599 31601 31649 31739 31756 31770 31775 31781 31884 31936 32182 32343 32498 32569 32622 32629 32656 32706 32709 32730 32776 32831 32890 32959 33006 33111 33254 33279 33283 33317 33334 33372 33425 33465 33541 33606 33700 33721 33759 33799 33835 33859 33882 33921 33951 33958 33967 33975 33983 33997 34013 34041 34093 34110 34131 34175 34517 34521 34536 34547 34555 34574 34586 34593 34600 34609 34619 34636 34652 34706 34714 34722 34732 34743 34761 34778 34794 34812 34819 34837 34854 34861 34871 34902 34921 34940 34960 34970 34989 35002 35022 35042 35063 35073 35092 35111 35121 35138 35152 35175 35199 35212 35222 35227 35231 35249 35268 35287 35292 35311 35331 35356 35371 35375 35382 35392 35401 35422 35436 35444 35464 35490 35507 35515 35526 35557 35562 35575 35597 35612 35621 35642 35660 35669 35713 35737 35764 35779 35796 35810 35841 35865 35896 35903 35917 35932 35951 36496 36529 36557 36586 36594 36631 36943 37120 37197 37214 37232 37247 37269 37319 37329 37346 37368 37427 37585 37609 37739 37764 37890 37908 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_STABLE. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_STABLE est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_STABLE est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_STABLE Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_STABLEExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVDDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : Kernel (GENERIC)Kernel (C700)TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output froMSGTXTS621 4984 5025 5041 5059 5063 5067 5077 5086 5092 5098 5101 5104 5113 5123 5136 5144 5155 5180 5192 5704 5736 6228 6517 7062 7108 7212 7298 7334 7349 7367 7375 7383 7410 7414 7418 7421 7424 7535 7720 7948 8424 8758 8787 8802 8817 8825 8839 8857 8878 8929 8945 8955 8975 9021 9051 9104 9161 9272 9393 9437 9470 9509 9543 9550 9583 9660 9666 9673 9680 9709 9821 9827 9838 9855 9872 9881 9910 9922 9932 10033 10095 10115 10235 10272 10328 10342 10363 10400 10610 10785 10934 10969 11021 11241 11558 12085 12450 12740 13133 13268 13281 13292 13438 13617 13748 13882 13902 13935 13954 14037 14152 14293 14418 14432 14540 14633 14662 14682 14758 14775 14793 14809 14828 14848 14865 14877 14903 14915 14933 15134 15373 15400 15417 15473 15535 15595 15626 15650 15709 16055 16085 16102 16210 16320 16460 16534 16610 16688 17180 17400 17511 17542 17669 17705 17833 17860 17900 17946 18162 18286 18354 18454 18459 18495 18531 18545 18568 18601 18605 18630 18649 18675 18680 18695 18710 18729 18754 18766 18788 18805 18818 18830 18848 18872 18887 18904 18917 18928 18939 18959 18988 19017 19041 19076 19111 19138 19325 19374 19406 19454 19551 19684 19730 19922 19952 20274 20403 20543 20683 20800 20935 20979 21022 21030 21040 21052 21064 21072 21083 21110 21144 21183 21214 21249 21285 21332 21352 21369 21387 21392 21399 21428 21444 21465 21482 21499 21517 21534 21547 21578 21603 21634 21665 21700 21727 21780 21790 21800 21806 21815 21823 21838 21842 21847 21853 21857 21870 21880 21909 21925 21951 21968 21987 22008 22024 22037 22042 22050 22065 22091 22110 22138 22156 22167 22173 22179 22200 22210 22221 22239 22261 22278 22291 22312 22332 22352 22363 22376 22398 22405 22430 22445 22465 22477 22494 22511 22531 22550 22860 23040 23251 23439 23505 23552 23607 23651 23671 23700 23712 23718 23734 23738 23742 23750 23760 23772 23787 23806 23842 23853 23864 23903 23915 23925 23935 23945 23961 23979 24028 24049 24094 24338 24364 24618 24633 24659 24716 24750 24785 24927 24944 24993 25014 25030 25059 25064 25069 25075 25080 25119 25154 25184 25239 25272 25318 25332 25411 25416 25470 25484 25494 25518 25604 25652 25758 25792 25799 25814 25841 25850 25889 25896 25918 25937 25953 25971 26003 26022 26039 26196 26227 26234 26243 26251 26258 26272 26290 26309 26319 26331 26372 26417 26446 26467 26490 26509 26547 26553 26561 26565 26586 26603 26612 26631 26777 26819 27329 27337 27361 27379 27423 27428 27433 27437 27468 27481 27490 27536 27662 27753 27765 27829 27831 27833 27835 27845 27859 27874 27901 27905 27911 27916 27925 27930 27957 27959 27974 27985 28000 28028 28072 28119 28135 28157 28168 28201 28221 28270 28370 28424 28426 28428 28463 28539 28556 28570 28577 28583 28682 28738 29014 29138 29249 29311 29349 29357 29379 29428 29431 29452 29497 29552 29611 29680 29727 29832 29975 30000 30004 30038 30054 30079 30127 30163 30224 30278 30359 30381 30420 30457 30489 30513 30540 30566 30580 30588 30598 30606 30620 30633 30645 30669 30710 30736 30753 30782 31106 31109 31123 31135 31141 31157 31169 31176 31183 31192 31202 31219 31235 31278 31286 31294 31304 31315 31333 31350 31363 31389 31396 31404 31421 31429 31446 31470 31489 31508 31527 31537 31548 31562 31580 31600 31620 31629 31652 31672 31683 31698 31710 31729 31748 31759 31769 31774 31780 31798 31817 31836 31843 31862 31882 31907 31924 31930 31938 31948 31960 31981 31997 32005 32025 32045 32067 32075 32086 32109 32116 32130 32152 32169 32178 32199 32217 32226 32257 32273 32300 32319 32339 32357 32378 32392 32412 32419 32438 32453 32472 33017 33050 33078 33107 33115 33152 33464 33641 33718 33735 33753 33768 33790 33840 33850 33867 33889 33948 34106 34130 34260 34285 34411 34429 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_STABLE. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_STABLE zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_STABLE zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_STABLE zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_STABLE zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_STABLEWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_STABLEUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVDDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymSendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Instalowanie bootblokow na %s.... Twoje partycje NetBSD na %s wygladaja nastepujaco (Rozmiar i offset w %s): Kernel (GENERIC)Kernel (C700)RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm sh stty sync# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  . ..zero wsmuxctl3 wsmuxctl2 wsmuxctl1 wsmuxctl0wsmux3wsmux2wsmux1wsmux0wsmouse3wsmouse2 wsmouse1!wsmouse0"wsmouse#wskbd3$wskbd2%wskbd1&wskbd0'wskbd(wsfont)wd3p*wd3o+wd3n,wd3m-wd3l.wd3k/wd3j0wd3i1wd3h2wd3g3wd3f4wd3e5wd3d6wd3c7wd3b8wd3a9 wd3:wd2p;wd2o<wd2n=wd2m>wd2l?wd2k@wd2jAwd2iBwd2hCwd2gDwd2fEwd2eFwd2dGwd2cHwd2bIwd2aJ wd2Kwd1pLwd1oMwd1nNwd1mOwd1lPwd1kQwd1jRwd1iSwd1hTwd1gUwd1fVwd1eWwd1dXwd1cYwd1bZwd1a[ wd1\wd0p]wd0o^wd0n_wd0m`wd0lawd0kbwd0jcwd0idwd0hewd0gfwd0fgwd0ehwd0diwd0cjwd0bkwd0al wd0murandomnttypfottypepttypdqttypcrttypbsttypatttyp9uttyp8vttyp7wttyp6xttyp5yttyp4zttyp3{ttyp2|ttyp1}ttyp0~ttyHstatttyHcfgttyH7ttyH6ttyH5ttyH4ttyH3ttyH2ttyH1ttyH0ttyGstatttyGcfgttyG7ttyG6ttyG5ttyG4ttyG3ttyG2ttyG1ttyG0ttyFstatttyFcfgttyF7ttyF6ttyF5ttyF4ttyF3ttyF2ttyF1ttyF0ttyEstatttyEcfgttyE7ttyE6ttyE5ttyE4ttyE3ttyE2ttyE1ttyE0tty01tty00 ttystdoutstdinstderr st1 st0sd3psd3osd3nsd3msd3lsd3ksd3jsd3isd3hsd3gsd3fsd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2asd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2k rwd2j rwd2i rwd2h rwd2g rwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1e rwd1d!rwd1c"rwd1b#rwd1a$rwd1%rwd0p&rwd0o'rwd0n(rwd0m)rwd0l*rwd0k+rwd0j,rwd0i-rwd0h.rwd0g/rwd0f0rwd0e1rwd0d2rwd0c3rwd0b4rwd0a5rwd06rst17rst08rsd3p9rsd3o:rsd3n;rsd3m<rsd3l=rsd3k>rsd3j?rsd3i@rsd3hArsd3gBrsd3fCrsd3eDrsd3dErsd3cFrsd3bGrsd3aHrsd3Irsd2pJrsd2oKrsd2nLrsd2mMrsd2lNrsd2kOrsd2jPrsd2iQrsd2hRrsd2gSrsd2fTrsd2eUrsd2dVrsd2cWrsd2bXrsd2aYrsd2Zrsd1p[rsd1o\rsd1n]rsd1m^rsd1l_rsd1k`rsd1jarsd1ibrsd1hcrsd1gdrsd1fersd1efrsd1dgrsd1chrsd1birsd1ajrsd1krsd0plrsd0omrsd0nnrsd0morsd0lprsd0kqrsd0jrrsd0isrsd0htrsd0gursd0fvrsd0ewrsd0dxrsd0cyrsd0bzrsd0a{rsd0|rmd1d}rmd1a~rmd1rmd0drmd0armd0rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rcd1drcd1arcd1rcd0drcd0arcd0randomptypfptypeptypdptypcptypbptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0memmd1dmd1a md1md0dmd0a md0ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullest1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drumconsttyconsolecd1dcd1a cd1cd0dcd0a cd0 bpf0bpf . .. dhcpcd.confgroup master.passwd netconfig protocolsserviceswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  ... . .. dhcpcd-hooksdhcpcd-run-hooks fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dmesg fdisk fsck fsck_ffs halt ifconfig init mknod mount  mount_cd9660  mount_ffs  mount_mfs  mount_msdos  mount_nfs newfs ping ping6 reboot restore route rrestore swapctl 0umount ... ... . .. binmdecsbinshare . .. ftp gunzip gzcat gzip less more progress sed tar `tip ... . .. chroot . ..misc ... . .. db log runspool ... ... ... . ..lock ...4-A%KccccccPccccc"#'(),-h"#'(),-@.ATL  .A ! + - - `( , , g/A|X( ( `/AP. p/ Q0A82 3 < #d#D#< 0Aز>0A(< ? cA L J TK @ 0AT~>0A(@ C xcH1A`L tM >p>X T P P P p1ApP xQ X X X ` a DZ @Z X 1AX (^ 1AXd d J2Ae e c)3As t u u u lv |v u u v v v  t v 4 L d | v v v ` v w   ċ ܋ $ < T l Ȍ ܌ %3Aw dw @vc earmzaurus7A7A7A7A7A7A7A 0 ̪ ( l , t t  Ԭ T T         |   A !!ʏ,L!dL!eA !!!h!t!:gA!h!8!!?Bl!!!@BX! "!V,Axd5")"\6"prA E"X"$K"G"xF"}A@w" q"y"}A8`""x"\c~ATc~ALcADcAA""""h"l"|"" |" ܄  0 X  t |  ( `  <  ԇ X ܋ $ < @ ܌  \ x d p $ 8 @ A4"" \mnop0123789quv./*+01236789 ./"'*+MA-0""AH#$#""h"l"|"" |"##,# L#T# 4 L d | t###` ##  ċ ܋ $ < T l Ȍ ܌ @8 #CAdOA##x{x{$A###bAd1#4.#-#!&!&h6#1#2#1#5#1#1#2#2#,2#4#82#8#A@Q#P#X#xU#T#\U#@U#$U#\W#0X#T#Y#Y#T#Aq#s#ٕA@,t#Xu#Ht#lt#u#A`##`#k%A#Բ##ՕAص###`A"###S%c1A(0#d###d#??&?-? A4h8$@$9$P9$8$)A4h8$@$9$P9$8$FAdH$ I$G$tG$WAX$Hd$c$A4Li$i$g$g$g$*Ah~$v$t$Ht$0t$A\$$$6$7$AHܣ$П$$6$7$A$$$6$7$A`D$d$`$7$HAH$$$6$7$ATD$$$6$7$AH$$$6$7$AH$,$$6$7$<%؃%d%A2&H&H&5&;& A&H&x?&D&3&8&@6&zټ|Ff梂 &Sk@5 5\-gӿ6C* fFq{ Ց ^)>ttmk%Czټ|Ff梂&Sk@5&x&&AX&&Ļ&EAAAAAAAAAAAABANA@ALAYAcAAAnAuAzAAAAAAuAAAAAAAAAAAAA AA"A*ASB>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy((((((())((((((())SZZys[zzRTAL9CEINCOUYrUal:ceinDouyAa L= S` Td Z} l> sa te z~ C  E D NG RX c  e d nH rY'S^'s_'C'Tb'c'tcAIOaioAEOUaeouZ{z| OP Up oQ uq(A(a(E(e Un uo7LA7lBT,,-,p-H2c@@@Љ@@@@x@h@X@H@8@(Bp2c">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||B{-l-Hr-s-L5Pn-l-\s-n-r-m-W-W-W-4z-L5::;9;:;L5@Bx---8-L5----,-----\-L5::;9;:;L5@@BH\.4...L5.T.,.|i.̴.<.x...L5::;9;:;L5t@A&B|00Љ0 00b0<0X0|e0f0Do0 r0p0j0q0(0dH0j0:;9;:;l0@KBx0̤0Љ0 000<0X0|e0f0Do0 r0400d0L5::;9;:;L5D@V1U1 1B#1B1B1B1B1BD5D5c ('du5Be25Bh2 4{22|ucdz2$42l225B5B5B5B5B5B Notice: this software is protected by copyright/var/crash/%n.core $`43,3 Ԭ7 7 Xb:7,5,59 ,54,5,5,5 99E9:95 ,5,5,5,5,5 ,5 ,55,5,5|F95 7 $7,5 x:(w:,5؃44܁:,5,57l: pV9HE9>9x::,55,5 ,5,5,5,5,5,5,}4,5,5 ,55555,5,5,5,555,5,5,5,5B!\77 L7,5,5,55 tp: Tq:,55(8+8)85H4p44 ,5 ,5,5,5,5,5,5 =Bv?B>=B>B>=BRA>=B?B>=B?B>=B?B>=B?B>=B}?B?B@?B@@B@B@ @B@,@B@:@B@G@B0@Q@B@]@B @y3|y3@BKc@44( h 81 vclBB3@c@c?@@ycBBJexcxc xcL5'LB4'LB4,ycJe|c(VeIePMe Ne|ucsystem{cearm|ctCQB4QBQBL4RBRB4SBSB4%SB5SB\4PSB\SB4xSBSB4q (root)`%n.coreXcXcc@cccHcccPcccXcc[5@B[B0ucc5ccȅcЅc؅cX5cc@cPc666666 66@66666666666666 66@666666xc BJABB.AFBLBPBTB\BcBlBpBuBT}BUBVBWBXBYBZB[BbBcBdGkAeBfBgĝBh˝BiϝBjZAkٝBlBmBnBozB&UBBBBykBBUyBkBB 4B B BV,AbsBAB>BՉB@BeB?B`BzzBABB B!1A@WAAjBBeAFoBGGtBHBIyBJ~BMBNBTBUBVBWBXBYBZB[~A\\B]B^ƞB_ΞB`ҞBa؞BcޞBdQAeBfAgBhBiBkBlBmpcT@@>@,@L@@@>@Į>>@H@@l@q@?t?<>s@4@-@0>@L>@ @e@\c@>(@>d>@@.A.Ax@~A}Ad@ B B@c|@ B BDc|@9 B9 BHc|@` B` BLc|@ B BPc|@" B" BTc|@ B BXc|@ B B\c|@ B B`c|@( B( Bdc|@ B Bhc|@$B$Blc|@zBzBpc|@55A`Atc@6:BAxc@BAȰc@BAذc@BAc@BA|c@ BՕAc@prAprAc @XB]BcH@XB]Bc<@2B2BcT@2B2B c@eAbAc@)3A)3A8B%3Ac@eAeAc@:gA:gA@?B?B(c@?B?Bc@@B@B0c@V,AV,Ac@}A}Ap@AAc@AAc@MAMAc@OAOA(c@0A0A8c@$A$AHc@Bg/AXc@AAhc@BJ2Axc@,A.Ac@.A.Ac@.A.Ac@/A/Ac`@Q0AQ0Ac@0A0Aȱc@H1AH1A0@p1Ap1Aرc@AAl@1A1Ac@1A1Ac@ٕAٕA8c$@1A1A@)A A@)A)Ac@FAFAدc@WAWAc@AAc@AAc@AAc@AA c@AA8c@AAPc@HAHAhc@AAc@AAc@AAc@@ @p@L@ @@AHA@A@A@HA@AAAA@A@A@WAFA@)A@1A@ٕA@1A1A @Ap1A@H1A0A@Q0A$@/A.A,A,@B4@AB<@$A0AD@OAMAL@AAT@}A\@V,A@B?B:gAd@eAl@8Bt@)3A|@AeA@2BXBprA@ B@B@6:B@55AzB$B B( B B B B" B B` B9 B B B~A.A@A=A@c@PBBpB,@NetBSDAA(aeabi5TE  $NetBSD: locore.S,v 1.44 2022/04/02 11:16:07 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/locore.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: md_root.c,v 1.19 2015/08/30 05:24:03 uebayasi Exp $$NetBSD: /usr/src/sys/dev/md_root.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: autoconf.c,v 1.18 2025/05/19 06:16:24 andvar Exp $$NetBSD: /usr/src/sys/arch/zaurus/zaurus/autoconf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: machdep.c,v 1.55 2024/05/13 00:08:06 msaitoh Exp $$NetBSD: /usr/src/sys/arch/zaurus/zaurus/machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_disk_mbr.c,v 1.59 2025/02/08 10:49:45 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_disk_mbr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ziic.c,v 1.6 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/ziic.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scoop.c,v 1.13 2014/09/23 14:49:46 nonaka Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/scoop.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scoop_pcic.c,v 1.4 2011/06/19 16:20:09 nonaka Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/scoop_pcic.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ioexp.c,v 1.2 2018/06/16 21:22:13 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/ioexp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: zssp.c,v 1.15 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zssp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: zlcd.c,v 1.21 2022/05/28 10:36:23 andvar Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zlcd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: w100lcd.c,v 1.6 2022/05/28 10:36:23 andvar Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/w100lcd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: w100.c,v 1.4 2021/11/20 00:17:10 rin Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/w100.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: lcdctl.c,v 1.3 2012/01/29 10:12:41 tsutsui Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/lcdctl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: zkbd.c,v 1.22 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zkbd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: zapm.c,v 1.14 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zapm.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: zusb.c,v 1.6 2011/07/19 15:11:49 dyoung Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zusb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: zmci.c,v 1.5 2012/01/29 10:12:42 tsutsui Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zmci.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfp_init.c,v 1.78 2022/08/20 11:34:08 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/vfp/vfp_init.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cons.c,v 1.95 2023/09/02 17:44:59 riastradh Exp $$NetBSD: /usr/src/sys/dev/cons.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: fiq.c,v 1.10 2020/02/24 12:08:08 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/fiq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mainbus.c,v 1.24 2022/09/27 06:36:42 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/mainbus.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mainbus_io.c,v 1.24 2018/03/16 17:56:32 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/mainbus_io.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cpu_mainbus.c,v 1.19 2024/05/09 12:41:08 pho Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/cpu_mainbus.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: disassem.c,v 1.42 2020/12/01 02:48:28 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/disassem.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bus_stubs.c,v 1.3 2021/09/18 09:49:57 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bus_stubs.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: arm_cpu_topology.c,v 1.9 2024/12/10 11:27:29 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm/arm_cpu_topology.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: arm_machdep.c,v 1.68 2023/10/04 20:28:05 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/arm_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ast.c,v 1.32 2021/02/01 19:31:34 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/ast.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bcopyinout_xscale.S,v 1.12 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bcopyinout_xscale.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: blockio.S,v 1.9 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/blockio.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bootconfig.c,v 1.13 2020/10/18 16:28:57 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bootconfig.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: copystr.S,v 1.14 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/copystr.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: core_machdep.c,v 1.10 2020/11/10 21:38:03 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/core_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cpufunc.c,v 1.185 2022/12/22 06:58:07 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpufunc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cpu_exec.c,v 1.13 2020/12/01 02:43:13 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_exec.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cpu_in_cksum.S,v 1.13 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_in_cksum.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cpu_subr.c,v 1.5.12.1 2025/10/19 10:29:21 martin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: idle_machdep.c,v 1.6 2021/02/17 06:54:23 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/idle_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: process_machdep.c,v 1.35 2021/02/01 19:31:34 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/process_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sig_machdep.c,v 1.53 2024/04/14 07:56:13 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/sig_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sigcode.S,v 1.8 2005/12/11 12:16:41 christos Exp $$NetBSD: /usr/src/sys/arch/arm/arm/sigcode.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: syscall.c,v 1.69 2023/10/05 19:41:03 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/syscall.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: trap.c,v 1.1 2022/04/02 11:16:06 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/trap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: undefined.c,v 1.75 2023/10/05 19:41:03 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/undefined.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: arm32_machdep.c,v 1.147 2024/03/05 14:15:29 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/arm32_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bus_dma.c,v 1.149.2.1 2025/10/01 16:41:13 martin Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/bus_dma.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cpu.c,v 1.154 2024/05/09 12:41:08 pho Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/cpu.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cpuswitch.S,v 1.107 2023/03/01 08:17:53 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/cpuswitch.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: exception.S,v 1.26 2020/11/21 19:46:13 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/exception.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: fault.c,v 1.119 2024/02/02 22:00:32 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/fault.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pmap.c,v 1.443 2024/04/13 12:28:01 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/pmap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: setstack.S,v 1.6 2013/08/18 06:29:29 matt Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/setstack.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: stubs.c,v 1.27 2020/07/03 15:31:25 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/stubs.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_machdep.c,v 1.26 2020/06/20 15:45:22 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/sys_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vm_machdep.c,v 1.79 2024/01/15 20:35:22 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/vm_machdep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pmap_devmap.c,v 1.2 2023/04/27 06:23:31 skrll Exp $$NetBSD: /usr/src/sys/uvm/pmap/pmap_devmap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pmap_pvt.c,v 1.15 2022/05/08 22:03:02 rin Exp $$NetBSD: /usr/src/sys/uvm/pmap/pmap_pvt.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scsipiconf.c,v 1.45 2019/03/28 10:44:29 kardel Exp $$NetBSD: /usr/src/sys/dev/scsipi/scsipiconf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scsipi_base.c,v 1.193 2024/10/29 15:50:07 nat Exp $$NetBSD: /usr/src/sys/dev/scsipi/scsipi_base.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scsipi_ioctl.c,v 1.73 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: /usr/src/sys/dev/scsipi/scsipi_ioctl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scsi_base.c,v 1.93 2019/05/03 16:06:56 mlelstv Exp $$NetBSD: /usr/src/sys/dev/scsipi/scsi_base.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: atapi_base.c,v 1.30 2019/02/03 03:19:28 mrg Exp $$NetBSD: /usr/src/sys/dev/scsipi/atapi_base.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: atapi_wdc.c,v 1.141 2021/10/05 08:01:05 rin Exp $$NetBSD: /usr/src/sys/dev/scsipi/atapi_wdc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scsiconf.c,v 1.306 2024/11/22 06:52:57 mlelstv Exp $$NetBSD: /usr/src/sys/dev/scsipi/scsiconf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scsi_subr.c,v 1.1 2022/04/14 16:50:26 pgoyette Exp $$NetBSD: /usr/src/sys/dev/scsipi/scsi_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: atapiconf.c,v 1.95 2022/04/09 23:38:32 riastradh Exp $$NetBSD: /usr/src/sys/dev/scsipi/atapiconf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd.c,v 1.356 2024/12/01 20:23:45 andvar Exp $$NetBSD: /usr/src/sys/dev/scsipi/cd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sd.c,v 1.345.2.1 2026/06/27 14:15:12 martin Exp $$NetBSD: /usr/src/sys/dev/scsipi/sd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wd.c,v 1.474 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ata/wd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ata_wdc.c,v 1.120 2021/10/05 08:01:05 rin Exp $$NetBSD: /usr/src/sys/dev/ata/ata_wdc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ata.c,v 1.171 2025/02/17 19:01:04 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ata/ata.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ata_subr.c,v 1.13 2020/12/23 08:17:01 skrll Exp $$NetBSD: /usr/src/sys/dev/ata/ata_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ata_recovery.c,v 1.4 2020/04/13 10:49:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/ata/ata_recovery.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sdmmc.c,v 1.44 2025/06/24 03:02:00 gutteridge Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sdmmc_cis.c,v 1.10 2025/01/17 11:54:50 jmcneill Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_cis.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sdmmc_io.c,v 1.21.28.2 2025/12/18 18:26:52 martin Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_io.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sdmmc_mem.c,v 1.77 2024/10/24 10:50:31 skrll Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_mem.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ld_sdmmc.c,v 1.45 2025/04/13 02:34:03 rin Exp $$NetBSD: /usr/src/sys/dev/sdmmc/ld_sdmmc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: config_hook.c,v 1.12 2020/11/21 21:08:32 thorpej Exp $$NetBSD: /usr/src/sys/arch/hpc/hpc/config_hook.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: platid.c,v 1.11 2006/05/10 06:24:02 skrll Exp $$NetBSD: /usr/src/sys/arch/hpc/hpc/platid.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0.c,v 1.24 2021/08/07 16:18:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_space.c,v 1.14 2023/04/21 15:00:48 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_space.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_dma.c,v 1.7 2022/09/27 06:36:43 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_dma.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_intr.c,v 1.26 2023/07/13 19:42:24 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_intr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_gpio.c,v 1.21 2021/08/07 16:18:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_gpio.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_com.c,v 1.14 2018/12/08 17:46:10 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_com.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_a4x_space.c,v 1.6 2018/03/16 17:56:32 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_a4x_space.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bus_space_a4x.S,v 1.4 2013/10/28 22:50:25 matt Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bus_space_a4x.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sa11x0_ost.c,v 1.33 2019/11/13 17:52:12 tsutsui Exp $$NetBSD: /usr/src/sys/arch/arm/sa11x0/sa11x0_ost.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_lcd.c,v 1.39 2021/11/20 00:15:04 rin Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_lcd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_pcic.c,v 1.15 2022/09/27 06:36:43 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_pcic.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_i2c.c,v 1.9 2021/12/12 08:49:57 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_i2c.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_rtc.c,v 1.8 2024/02/24 12:04:16 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_rtc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pxa2x0_mci.c,v 1.14 2023/03/28 20:01:57 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_mci.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: apmdev.c,v 1.34 2021/09/26 01:16:08 thorpej Exp $$NetBSD: /usr/src/sys/dev/hpc/apm/apmdev.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pcmcia.c,v 1.96 2021/08/07 16:19:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pcmcia_cis.c,v 1.57 2019/11/10 21:16:36 chs Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia_cis.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pcmcia_cis_quirks.c,v 1.36 2019/11/10 21:16:36 chs Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia_cis_quirks.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_ne_pcmcia.c,v 1.161 2019/12/27 08:01:58 msaitoh Exp $$NetBSD: /usr/src/sys/dev/pcmcia/if_ne_pcmcia.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: com_pcmcia.c,v 1.62 2018/12/08 17:46:14 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/com_pcmcia.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wdc_pcmcia.c,v 1.130 2022/09/25 21:53:54 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/wdc_pcmcia.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_wi_pcmcia.c,v 1.93 2019/01/08 08:47:21 msaitoh Exp $$NetBSD: /usr/src/sys/dev/pcmcia/if_wi_pcmcia.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usb.c,v 1.203 2024/02/04 05:43:06 mrg Exp $$NetBSD: /usr/src/sys/dev/usb/usb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usbdi.c,v 1.253 2024/04/05 18:57:10 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/usbdi.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usbdi_util.c,v 1.88 2024/02/04 05:43:06 mrg Exp $$NetBSD: /usr/src/sys/dev/usb/usbdi_util.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usb_subr.c,v 1.279.4.1 2025/10/19 10:08:32 martin Exp $$NetBSD: /usr/src/sys/dev/usb/usb_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usb_quirks.c,v 1.108 2024/02/28 21:52:40 dholland Exp $$NetBSD: /usr/src/sys/dev/usb/usb_quirks.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usb_mem.c,v 1.84 2021/12/21 09:51:22 skrll Exp $$NetBSD: /usr/src/sys/dev/usb/usb_mem.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usbnet.c,v 1.121 2024/11/10 11:53:04 mlelstv Exp $$NetBSD: /usr/src/sys/dev/usb/usbnet.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uhub.c,v 1.162 2024/05/04 12:49:15 mlelstv Exp $$NetBSD: /usr/src/sys/dev/usb/uhub.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uhidev.c,v 1.95.4.2 2025/12/14 11:18:31 martin Exp $$NetBSD: /usr/src/sys/dev/usb/uhidev.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uhid.c,v 1.129.4.2 2025/12/14 11:18:31 martin Exp $$NetBSD: /usr/src/sys/dev/usb/uhid.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ukbd.c,v 1.165 2024/12/10 11:21:30 mlelstv Exp $$NetBSD: /usr/src/sys/dev/usb/ukbd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: umass.c,v 1.189 2022/09/22 14:27:52 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/umass.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: umass_quirks.c,v 1.102 2020/06/19 11:52:42 flxd Exp $$NetBSD: /usr/src/sys/dev/usb/umass_quirks.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: umass_scsipi.c,v 1.70 2021/12/31 14:24:16 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/umass_scsipi.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_aue.c,v 1.191 2022/08/20 14:08:59 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/if_aue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_cdce.c,v 1.83 2025/01/18 18:35:47 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/if_cdce.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_cue.c,v 1.109 2024/06/29 12:11:12 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/if_cue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_kue.c,v 1.119 2022/08/20 14:08:59 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/if_kue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_url.c,v 1.98 2024/06/30 16:35:19 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/if_url.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_axe.c,v 1.151 2022/08/20 14:08:59 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/if_axe.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_mue.c,v 1.83 2022/10/31 21:22:06 andvar Exp $$NetBSD: /usr/src/sys/dev/usb/if_mue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_udav.c,v 1.99 2022/08/20 14:09:20 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/if_udav.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dev_verbose.c,v 1.4 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: /usr/src/sys/dev/dev_verbose.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ld.c,v 1.117 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ld.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wi.c,v 1.258 2023/08/01 07:04:15 mrg Exp $$NetBSD: /usr/src/sys/dev/ic/wi.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dp8390.c,v 1.101 2024/06/29 12:11:11 riastradh Exp $$NetBSD: /usr/src/sys/dev/ic/dp8390.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ne2000.c,v 1.79 2024/05/21 08:04:20 andvar Exp $$NetBSD: /usr/src/sys/dev/ic/ne2000.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: com.c,v 1.388 2025/02/12 05:15:39 imil Exp $$NetBSD: /usr/src/sys/dev/ic/com.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rtl80x9.c,v 1.19 2023/12/31 03:19:22 isaki Exp $$NetBSD: /usr/src/sys/dev/ic/rtl80x9.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wdc.c,v 1.310.12.2 2026/08/25 19:13:46 martin Exp $$NetBSD: /usr/src/sys/dev/ic/wdc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dl10019.c,v 1.17 2021/07/01 20:39:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/ic/dl10019.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ax88190.c,v 1.18 2021/07/01 20:39:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/ic/ax88190.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: usbroothub.c,v 1.16 2024/02/04 05:43:06 mrg Exp $$NetBSD: /usr/src/sys/dev/usb/usbroothub.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ohci.c,v 1.330 2025/03/31 14:46:42 riastradh Exp $$NetBSD: /usr/src/sys/dev/usb/ohci.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: compat_exec.c,v 1.18 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: /usr/src/sys/compat/common/compat_exec.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: compat_util.c,v 1.47 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: /usr/src/sys/compat/common/compat_util.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_bear.c,v 1.4 2020/07/25 22:28:27 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_bear.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_ccm.c,v 1.6 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ccm.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_ccm_mbuf.c,v 1.1 2020/07/25 22:15:55 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ccm_mbuf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_ct.c,v 1.3 2020/06/30 20:32:11 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_ct_dec.c,v 1.2 2020/06/29 23:36:59 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct_dec.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_ct_enc.c,v 1.1 2020/06/29 23:27:52 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct_enc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_impl.c,v 1.10 2022/11/05 17:36:33 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_impl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: aes_selftest.c,v 1.7 2021/12/05 04:48:35 msaitoh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_selftest.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nist_hash_drbg.c,v 1.3 2019/09/19 18:29:55 riastradh Exp $$NetBSD: /usr/src/sys/crypto/nist_hash_drbg/nist_hash_drbg.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cprng_fast.c,v 1.20 2024/10/15 17:34:06 riastradh Exp $$NetBSD: /usr/src/sys/crypto/cprng_fast/cprng_fast.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: blake2s.c,v 1.2 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/blake2/blake2s.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sysmon.c,v 1.32 2022/03/28 12:33:21 riastradh Exp $$NetBSD: /usr/src/sys/dev/sysmon/sysmon.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sysmon_wdog.c,v 1.30 2021/12/31 11:05:41 riastradh Exp $$NetBSD: /usr/src/sys/dev/sysmon/sysmon_wdog.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: swwdog.c,v 1.24 2024/11/07 09:47:40 rin Exp $$NetBSD: /usr/src/sys/dev/sysmon/swwdog.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211.c,v 1.61 2021/08/21 11:55:25 andvar Exp $$NetBSD: /usr/src/sys/net80211/ieee80211.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_amrr.c,v 1.3 2015/08/24 20:58:47 pooka Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_amrr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_crypto.c,v 1.23 2018/05/08 07:02:07 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_crypto_ccmp.c,v 1.20 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_ccmp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_crypto_none.c,v 1.8 2018/01/19 07:53:46 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_none.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_crypto_tkip.c,v 1.18 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_tkip.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_crypto_wep.c,v 1.14 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_wep.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_input.c,v 1.117 2022/11/19 07:57:51 yamt Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_input.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_ioctl.c,v 1.69 2021/09/21 15:00:34 christos Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_ioctl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_netbsd.c,v 1.34 2018/12/22 14:28:56 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_netbsd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_node.c,v 1.84 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_node.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_output.c,v 1.68 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_output.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_proto.c,v 1.37 2021/07/24 21:31:38 andvar Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_proto.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_rssadapt.c,v 1.21 2016/09/27 20:20:06 christos Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_rssadapt.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ieee80211_xauth.c,v 1.5 2006/02/27 01:08:28 dyoung Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_xauth.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: at_print.c,v 1.2 2021/07/21 06:35:45 skrll Exp $$NetBSD: /usr/src/sys/netatalk/at_print.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: igmp.c,v 1.70 2020/05/15 06:34:34 maxv Exp $$NetBSD: /usr/src/sys/netinet/igmp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in.c,v 1.248 2024/08/20 08:22:35 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/in.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in_offload.c,v 1.15 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet/in_offload.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in_pcb.c,v 1.202 2022/11/04 09:05:41 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/in_pcb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in_print.c,v 1.1 2014/12/02 19:35:27 christos Exp $$NetBSD: /usr/src/sys/netinet/in_print.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in_proto.c,v 1.131 2022/09/03 02:53:18 thorpej Exp $$NetBSD: /usr/src/sys/netinet/in_proto.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip_icmp.c,v 1.180 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/ip_icmp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip_input.c,v 1.406 2025/07/17 06:49:43 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/ip_input.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip_output.c,v 1.330 2025/07/17 06:48:39 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/ip_output.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip_reass.c,v 1.23 2022/05/31 08:43:16 andvar Exp $$NetBSD: /usr/src/sys/netinet/ip_reass.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: raw_ip.c,v 1.187 2025/06/20 15:15:35 roy Exp $$NetBSD: /usr/src/sys/netinet/raw_ip.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_input.c,v 1.441 2024/10/08 06:17:14 rin Exp $$NetBSD: /usr/src/sys/netinet/tcp_input.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_output.c,v 1.222 2024/09/08 09:36:52 rillig Exp $$NetBSD: /usr/src/sys/netinet/tcp_output.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_sack.c,v 1.36 2018/05/18 18:58:51 maxv Exp $$NetBSD: /usr/src/sys/netinet/tcp_sack.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_subr.c,v 1.298.2.1 2026/07/19 15:51:03 martin Exp $$NetBSD: /usr/src/sys/netinet/tcp_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_syncache.c,v 1.7.4.1 2026/07/30 10:50:15 martin Exp $$NetBSD: /usr/src/sys/netinet/tcp_syncache.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_timer.c,v 1.99 2022/11/04 09:00:58 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/tcp_timer.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_usrreq.c,v 1.238 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/tcp_usrreq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_congctl.c,v 1.29 2024/05/14 19:00:44 andvar Exp $$NetBSD: /usr/src/sys/netinet/tcp_congctl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tcp_vtw.c,v 1.25 2024/10/07 23:17:00 jakllsch Exp $$NetBSD: /usr/src/sys/netinet/tcp_vtw.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: udp_usrreq.c,v 1.266 2024/10/08 02:30:04 riastradh Exp $$NetBSD: /usr/src/sys/netinet/udp_usrreq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: portalgo.c,v 1.15 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/portalgo.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dest6.c,v 1.22 2018/04/13 11:01:14 maxv Exp $$NetBSD: /usr/src/sys/netinet6/dest6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: frag6.c,v 1.78 2024/04/19 05:04:06 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/frag6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: icmp6.c,v 1.258 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/icmp6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6.c,v 1.293 2025/06/05 06:30:10 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/in6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6_cksum.c,v 1.28 2011/04/25 22:05:05 yamt Exp $$NetBSD: /usr/src/sys/netinet6/in6_cksum.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6_ifattach.c,v 1.122 2024/04/11 07:34:37 knakahara Exp $$NetBSD: /usr/src/sys/netinet6/in6_ifattach.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6_offload.c,v 1.13 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/in6_offload.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6_pcb.c,v 1.177 2022/11/04 09:04:27 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/in6_pcb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6_print.c,v 1.1 2014/12/02 19:36:58 christos Exp $$NetBSD: /usr/src/sys/netinet6/in6_print.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6_proto.c,v 1.131 2024/02/09 22:08:37 andvar Exp $$NetBSD: /usr/src/sys/netinet6/in6_proto.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in6_src.c,v 1.92 2023/08/03 04:24:55 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/in6_src.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip6_forward.c,v 1.103 2024/06/29 13:00:44 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_forward.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip6_input.c,v 1.228 2024/06/29 13:00:44 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_input.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip6_mroute.c,v 1.133 2025/01/02 16:10:22 andvar Exp $$NetBSD: /usr/src/sys/netinet6/ip6_mroute.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip6_output.c,v 1.235 2024/04/19 00:55:35 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_output.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mld6.c,v 1.102 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/mld6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nd6.c,v 1.284.2.1 2026/06/03 18:41:36 martin Exp $$NetBSD: /usr/src/sys/netinet6/nd6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nd6_nbr.c,v 1.186 2025/04/28 11:39:10 joe Exp $$NetBSD: /usr/src/sys/netinet6/nd6_nbr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nd6_rtr.c,v 1.149 2020/06/12 11:04:45 roy Exp $$NetBSD: /usr/src/sys/netinet6/nd6_rtr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: raw_ip6.c,v 1.185 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/raw_ip6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: route6.c,v 1.25 2018/02/01 16:23:28 maxv Exp $$NetBSD: /usr/src/sys/netinet6/route6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: scope6.c,v 1.23 2020/06/16 17:12:18 maxv Exp $$NetBSD: /usr/src/sys/netinet6/scope6.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: udp6_usrreq.c,v 1.156 2024/10/08 02:30:05 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/udp6_usrreq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: hid.c,v 1.8 2024/12/19 00:50:47 jmcneill Exp $$NetBSD: /usr/src/sys/dev/hid/hid.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: hidkbdmap.c,v 1.16 2025/05/24 16:50:54 nia Exp $$NetBSD: /usr/src/sys/dev/hid/hidkbdmap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: i2c.c,v 1.92 2025/01/27 17:01:53 riastradh Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: i2c_exec.c,v 1.18 2022/10/24 10:17:27 riastradh Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_exec.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: i2c_subr.c,v 1.2 2022/04/01 15:49:12 pgoyette Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: i2c_bitbang.c,v 1.14 2016/06/07 01:06:27 pgoyette Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_bitbang.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mii.c,v 1.59 2024/02/08 20:11:55 andvar Exp $$NetBSD: /usr/src/sys/dev/mii/mii.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mii_bitbang.c,v 1.14 2019/01/22 03:42:27 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/mii_bitbang.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mii_physubr.c,v 1.103 2023/05/22 02:12:13 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/mii_physubr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mii_ethersubr.c,v 1.3 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/mii_ethersubr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ukphy_subr.c,v 1.17 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/ukphy_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: brgphy.c,v 1.91 2023/02/22 08:09:09 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/brgphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nsphy.c,v 1.66 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/nsphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nsphyter.c,v 1.46 2020/03/28 18:37:18 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/nsphyter.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: qsphy.c,v 1.55 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/qsphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: inphy.c,v 1.60 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/inphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: iophy.c,v 1.43 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/iophy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: exphy.c,v 1.58 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/exphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: lxtphy.c,v 1.56 2021/08/20 20:25:28 andvar Exp $$NetBSD: /usr/src/sys/dev/mii/lxtphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: icsphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/icsphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sqphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/sqphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dmphy.c,v 1.47 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/dmphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pnaphy.c,v 1.26 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/pnaphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ukphy.c,v 1.55 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: /usr/src/sys/dev/mii/ukphy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dmover_backend.c,v 1.9 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_backend.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dmover_process.c,v 1.5 2011/05/14 14:49:19 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_process.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dmover_request.c,v 1.8 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_request.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dmover_session.c,v 1.6 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_session.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dmover_util.c,v 1.5 2005/12/11 12:21:20 christos Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_util.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: drm_stub.c,v 1.1 2019/11/16 04:10:33 christos Exp $$NetBSD: /usr/src/sys/external/bsd/drm2/drm/drm_stub.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsdisplay.c,v 1.166 2023/03/01 08:42:33 riastradh Exp $$NetBSD: /usr/src/sys/dev/wscons/wsdisplay.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsemulconf.c,v 1.8 2010/02/02 16:18:29 drochner Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemulconf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsemul_dumb.c,v 1.18 2018/09/03 16:29:34 riastradh Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_dumb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsemul_vt100.c,v 1.52 2023/08/02 22:37:02 uwe Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsemul_vt100_subr.c,v 1.34.8.1 2025/11/14 13:12:27 martin Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsemul_vt100_chars.c,v 1.15 2017/11/03 19:20:27 maya Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_chars.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsemul_vt100_keys.c,v 1.11 2010/02/10 19:39:39 drochner Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_keys.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsevent.c,v 1.47 2021/09/26 01:16:10 thorpej Exp $$NetBSD: /usr/src/sys/dev/wscons/wsevent.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wskbd.c,v 1.146 2025/04/07 11:25:42 hans Exp $$NetBSD: /usr/src/sys/dev/wscons/wskbd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wskbdutil.c,v 1.19 2017/11/03 19:20:27 maya Exp $$NetBSD: /usr/src/sys/dev/wscons/wskbdutil.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsmux.c,v 1.68.2.1 2025/11/24 16:50:18 martin Exp $$NetBSD: /usr/src/sys/dev/wscons/wsmux.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsbellmux.c,v 1.1 2017/06/11 03:55:56 nat Exp $$NetBSD: /usr/src/sys/dev/wscons/wsbellmux.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rasops.c,v 1.128.12.1 2025/11/14 13:12:27 martin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rasops_masks.c,v 1.10 2019/08/10 01:24:17 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops_masks.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rasops4.c,v 1.28 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops4.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rasops8.c,v 1.51 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops8.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rasops15.c,v 1.39 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops15.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: wsfont.c,v 1.83 2025/03/25 10:50:12 macallan Exp $$NetBSD: /usr/src/sys/dev/wsfont/wsfont.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd9660_bmap.c,v 1.5 2014/06/14 07:39:28 hannken Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_bmap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd9660_lookup.c,v 1.33 2024/09/08 09:36:51 rillig Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_lookup.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd9660_node.c,v 1.38 2017/05/26 14:34:19 riastradh Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_node.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd9660_rrip.c,v 1.18.56.1 2026/05/07 18:14:51 martin Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_rrip.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd9660_util.c,v 1.16 2024/05/25 06:27:57 tsutsui Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_util.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd9660_vfsops.c,v 1.105 2025/02/16 18:38:58 joe Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cd9660_vnops.c,v 1.63 2024/02/02 20:27:26 christos Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: msdosfs_conv.c,v 1.20 2023/06/02 08:51:47 andvar Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_conv.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: msdosfs_denode.c,v 1.60 2021/10/23 16:58:17 thorpej Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_denode.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: msdosfs_fat.c,v 1.37 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_fat.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: msdosfs_lookup.c,v 1.41 2022/08/06 18:26:42 andvar Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_lookup.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: msdosfs_rename.c,v 1.4 2024/05/04 05:49:39 mlelstv Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_rename.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: msdosfs_vfsops.c,v 1.138 2022/04/16 07:58:21 hannken Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: msdosfs_vnops.c,v 1.113 2024/09/11 00:27:54 perseant Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: krpc_subr.c,v 1.44 2024/10/20 14:01:52 mlelstv Exp $$NetBSD: /usr/src/sys/nfs/krpc_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_bio.c,v 1.202 2024/02/13 21:40:02 andvar Exp $$NetBSD: /usr/src/sys/nfs/nfs_bio.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_boot.c,v 1.90 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/nfs/nfs_boot.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_clntsocket.c,v 1.7 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/nfs/nfs_clntsocket.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_clntsubs.c,v 1.7.8.1 2026/06/03 18:46:36 martin Exp $$NetBSD: /usr/src/sys/nfs/nfs_clntsubs.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_iod.c,v 1.9 2023/03/21 15:47:46 christos Exp $$NetBSD: /usr/src/sys/nfs/nfs_iod.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_kq.c,v 1.32 2021/10/20 03:08:18 thorpej Exp $$NetBSD: /usr/src/sys/nfs/nfs_kq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_node.c,v 1.126 2020/05/01 08:43:00 hannken Exp $$NetBSD: /usr/src/sys/nfs/nfs_node.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_socket.c,v 1.203 2025/02/22 09:27:05 mlelstv Exp $$NetBSD: /usr/src/sys/nfs/nfs_socket.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_subs.c,v 1.242 2022/02/09 21:50:24 andvar Exp $$NetBSD: /usr/src/sys/nfs/nfs_subs.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_vfsops.c,v 1.246 2024/05/13 00:11:22 msaitoh Exp $$NetBSD: /usr/src/sys/nfs/nfs_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nfs_vnops.c,v 1.325.4.1 2026/02/02 17:38:30 martin Exp $$NetBSD: /usr/src/sys/nfs/nfs_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_alloc.c,v 1.174 2025/06/27 19:55:38 andvar Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_alloc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_balloc.c,v 1.66 2022/11/17 06:40:40 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_balloc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_extattr.c,v 1.10 2022/11/28 04:52:04 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_extattr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_inode.c,v 1.131 2020/07/31 04:07:30 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_inode.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_snapshot.c,v 1.155 2023/05/11 23:11:25 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_snapshot.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_subr.c,v 1.54 2023/01/07 19:41:30 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_tables.c,v 1.9 2005/12/11 12:25:25 christos Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_tables.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_vfsops.c,v 1.384 2024/12/30 09:03:07 hannken Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ffs_vnops.c,v 1.138 2021/12/14 11:06:12 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_readwrite.c,v 1.129 2024/10/19 14:13:44 jakllsch Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_readwrite.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mfs_vfsops.c,v 1.117 2025/02/16 18:38:59 joe Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mfs_vnops.c,v 1.64 2022/03/19 13:48:42 hannken Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mfs_miniroot.c,v 1.1 2010/03/02 17:20:02 pooka Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_miniroot.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_acl.c,v 1.5 2023/02/22 21:49:45 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_acl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_bmap.c,v 1.54 2022/11/17 06:40:40 chs Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_bmap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_inode.c,v 1.112 2020/09/05 16:30:13 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_inode.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_lookup.c,v 1.159 2024/09/08 09:36:52 rillig Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_lookup.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_rename.c,v 1.14 2021/10/20 03:08:19 thorpej Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_rename.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_vfsops.c,v 1.61 2023/02/22 21:49:45 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ufs_vnops.c,v 1.262 2022/03/27 16:24:59 christos Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_amap.c,v 1.129 2023/09/10 14:54:34 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_amap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_anon.c,v 1.80 2020/10/25 00:05:26 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_anon.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_aobj.c,v 1.157 2023/02/24 11:03:13 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_aobj.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_bio.c,v 1.128 2023/04/09 09:00:56 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_bio.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_coredump.c,v 1.8 2020/02/23 15:46:43 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_coredump.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_device.c,v 1.80 2022/07/07 13:27:02 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_device.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_fault.c,v 1.237 2024/03/15 07:09:37 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_fault.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_glue.c,v 1.182 2023/10/04 20:34:19 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_glue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_init.c,v 1.59 2023/09/23 18:21:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_init.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_io.c,v 1.30 2024/05/03 07:09:20 skrll Exp $$NetBSD: /usr/src/sys/uvm/uvm_io.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_km.c,v 1.166.2.2 2026/06/28 09:29:56 martin Exp $$NetBSD: /usr/src/sys/uvm/uvm_km.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_loan.c,v 1.104 2020/06/11 22:21:05 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_loan.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_map.c,v 1.427 2025/04/27 17:40:55 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_map.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_meter.c,v 1.80 2020/06/14 21:41:42 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_meter.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_mmap.c,v 1.186.2.2 2026/04/03 12:10:19 martin Exp $$NetBSD: /usr/src/sys/uvm/uvm_mmap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_mremap.c,v 1.22 2025/02/24 21:32:26 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_mremap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_object.c,v 1.25 2020/08/15 07:24:09 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_object.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_page.c,v 1.256 2024/03/05 14:33:50 thorpej Exp $$NetBSD: /usr/src/sys/uvm/uvm_page.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_page_array.c,v 1.9 2020/05/26 21:52:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_page_array.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_page_status.c,v 1.6 2020/08/14 09:06:15 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_page_status.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_pager.c,v 1.131.4.1 2026/04/03 12:38:34 martin Exp $$NetBSD: /usr/src/sys/uvm/uvm_pager.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_pdaemon.c,v 1.134.8.1 2026/04/03 12:22:23 martin Exp $$NetBSD: /usr/src/sys/uvm/uvm_pdaemon.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_pdpolicy_clock.c,v 1.42.2.1 2026/09/13 10:28:53 martin Exp $$NetBSD: /usr/src/sys/uvm/uvm_pdpolicy_clock.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_pgflcache.c,v 1.6 2020/10/18 18:31:31 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_pgflcache.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_pglist.c,v 1.92 2024/01/14 10:38:47 tnn Exp $$NetBSD: /usr/src/sys/uvm/uvm_pglist.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_readahead.c,v 1.16 2023/09/23 18:21:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_readahead.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_stat.c,v 1.46 2020/06/14 21:41:42 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_stat.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_swap.c,v 1.209.2.2 2026/04/03 12:38:34 martin Exp $$NetBSD: /usr/src/sys/uvm/uvm_swap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_unix.c,v 1.51 2022/01/10 18:04:20 christos Exp $$NetBSD: /usr/src/sys/uvm/uvm_unix.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_user.c,v 1.14 2011/02/02 15:13:34 chuck Exp $$NetBSD: /usr/src/sys/uvm/uvm_user.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uvm_vnode.c,v 1.121 2024/04/05 13:05:41 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_vnode.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: debugsyms.c,v 1.4 2015/10/06 22:13:39 christos Exp $$NetBSD: /usr/src/sys/conf/debugsyms.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: param.c,v 1.70 2022/07/23 19:15:29 mrg Exp $$NetBSD: /usr/src/sys/conf/param.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bufq_disksort.c,v 1.14 2017/05/04 11:03:27 kamil Exp $$NetBSD: /usr/src/sys/kern/bufq_disksort.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bufq_fcfs.c,v 1.13 2017/05/04 11:03:27 kamil Exp $$NetBSD: /usr/src/sys/kern/bufq_fcfs.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: core_elf32.c,v 1.67 2021/01/02 02:13:42 rin Exp $$NetBSD: /usr/src/sys/kern/core_elf32.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: core_netbsd.c,v 1.24 2019/11/20 19:37:53 pgoyette Exp $$NetBSD: /usr/src/sys/kern/core_netbsd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: cnmagic.c,v 1.14 2017/05/04 11:01:16 kamil Exp $$NetBSD: /usr/src/sys/kern/cnmagic.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: exec_elf32.c,v 1.144 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_elf32.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: exec_elf.c,v 1.107 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_elf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: exec_script.c,v 1.85 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_script.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: exec_subr.c,v 1.91 2024/12/06 16:48:13 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: init_main.c,v 1.552 2025/05/08 05:31:16 imil Exp $$NetBSD: /usr/src/sys/kern/init_main.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: init_sysctl.c,v 1.228 2023/09/09 16:01:09 christos Exp $$NetBSD: /usr/src/sys/kern/init_sysctl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: init_sysctl_base.c,v 1.9 2023/12/20 20:35:37 andvar Exp $$NetBSD: /usr/src/sys/kern/init_sysctl_base.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: init_sysent.c,v 1.346.2.1 2026/08/25 20:04:58 martin Exp $$NetBSD: /usr/src/sys/kern/init_sysent.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_acct.c,v 1.99 2021/12/05 04:35:38 msaitoh Exp $$NetBSD: /usr/src/sys/kern/kern_acct.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_auth.c,v 1.84 2023/10/04 22:17:09 ad Exp $$NetBSD: /usr/src/sys/kern/kern_auth.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_cfglock.c,v 1.1 2010/08/21 13:17:31 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_cfglock.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_clock.c,v 1.151 2023/09/02 17:44:59 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_clock.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_condvar.c,v 1.63 2023/11/02 10:31:55 martin Exp $$NetBSD: /usr/src/sys/kern/kern_condvar.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_core.c,v 1.39 2023/10/04 22:17:09 ad Exp $$NetBSD: /usr/src/sys/kern/kern_core.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_cpu.c,v 1.98.2.1 2026/04/02 18:24:34 martin Exp $$NetBSD: /usr/src/sys/kern/kern_cpu.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_descrip.c,v 1.266 2025/07/16 19:14:13 kre Exp $$NetBSD: /usr/src/sys/kern/kern_descrip.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_entropy.c,v 1.73 2025/03/11 14:30:28 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_entropy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_event.c,v 1.150.8.1 2026/07/19 15:47:32 martin Exp $$NetBSD: /usr/src/sys/kern/kern_event.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_exec.c,v 1.531.2.1 2026/06/27 09:50:57 martin Exp $$NetBSD: /usr/src/sys/kern/kern_exec.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_exit.c,v 1.300 2025/03/16 15:52:18 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_exit.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_fork.c,v 1.232 2025/07/16 19:14:13 kre Exp $$NetBSD: /usr/src/sys/kern/kern_fork.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_idle.c,v 1.36 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_idle.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_hook.c,v 1.15 2024/01/17 10:18:41 hannken Exp $$NetBSD: /usr/src/sys/kern/kern_hook.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_kthread.c,v 1.49 2023/09/23 14:40:42 ad Exp $$NetBSD: /usr/src/sys/kern/kern_kthread.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_lock.c,v 1.188 2024/01/14 11:46:05 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_lock.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_lwp.c,v 1.270 2025/04/11 16:04:43 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_lwp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_malloc.c,v 1.158 2019/11/14 16:23:52 maxv Exp $$NetBSD: /usr/src/sys/kern/kern_malloc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_module.c,v 1.173 2025/05/05 00:31:48 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_module.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_module_hook.c,v 1.4 2019/12/13 08:02:53 skrll Exp $$NetBSD: /usr/src/sys/kern/kern_module_hook.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_module_vfs.c,v 1.19 2025/03/20 13:26:54 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_module_vfs.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_mutex.c,v 1.112 2023/10/15 10:28:23 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_mutex.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_mutex_obj.c,v 1.15 2023/10/02 21:03:55 ad Exp $$NetBSD: /usr/src/sys/kern/kern_mutex_obj.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_ntptime.c,v 1.64 2022/10/26 23:23:52 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_ntptime.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_physio.c,v 1.102 2022/07/10 23:11:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_physio.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_pmf.c,v 1.51 2022/08/24 11:41:39 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_pmf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_proc.c,v 1.280.2.1 2026/04/03 11:53:14 martin Exp $$NetBSD: /usr/src/sys/kern/kern_proc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_prot.c,v 1.122 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/kern_prot.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_ras.c,v 1.42 2022/08/08 22:31:45 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_ras.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_rate.c,v 1.2 2012/12/12 11:10:56 pooka Exp $$NetBSD: /usr/src/sys/kern/kern_rate.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_reboot.c,v 1.5 2024/03/05 14:15:36 thorpej Exp $$NetBSD: /usr/src/sys/kern/kern_reboot.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_resource.c,v 1.195 2023/10/04 20:28:06 ad Exp $$NetBSD: /usr/src/sys/kern/kern_resource.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_runq.c,v 1.71.2.1 2026/04/02 18:24:34 martin Exp $$NetBSD: /usr/src/sys/kern/kern_runq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_rwlock.c,v 1.76 2023/10/15 10:28:48 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_rwlock.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_rwlock_obj.c,v 1.13 2023/10/02 21:03:55 ad Exp $$NetBSD: /usr/src/sys/kern/kern_rwlock_obj.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_scdebug.c,v 1.2 2019/03/14 19:51:49 palle Exp $$NetBSD: /usr/src/sys/kern/kern_scdebug.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_syscall.c,v 1.16 2025/06/01 23:30:36 bad Exp $$NetBSD: /usr/src/sys/kern/sys_syscall.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_sig.c,v 1.410 2025/03/13 12:48:21 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_sig.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_sleepq.c,v 1.87 2023/11/02 10:31:55 martin Exp $$NetBSD: /usr/src/sys/kern/kern_sleepq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_softint.c,v 1.76 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_softint.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_ssp.c,v 1.7 2016/12/06 02:55:42 christos Exp $$NetBSD: /usr/src/sys/kern/kern_ssp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_stub.c,v 1.50 2020/08/01 02:04:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_stub.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_subr.c,v 1.231 2023/01/19 07:40:58 mlelstv Exp $$NetBSD: /usr/src/sys/kern/kern_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_synch.c,v 1.366 2023/11/22 13:18:48 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_synch.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_syscall.c,v 1.21 2020/08/31 19:51:30 christos Exp $$NetBSD: /usr/src/sys/kern/kern_syscall.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_sysctl.c,v 1.271 2024/09/08 09:36:51 rillig Exp $$NetBSD: /usr/src/sys/kern/kern_sysctl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_tc.c,v 1.78 2025/07/15 22:15:03 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_tc.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_threadpool.c,v 1.23 2021/01/23 16:33:49 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_threadpool.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_time.c,v 1.228.2.3 2026/04/03 11:55:28 martin Exp $$NetBSD: /usr/src/sys/kern/kern_time.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_timeout.c,v 1.79 2023/10/08 13:23:05 ad Exp $$NetBSD: /usr/src/sys/kern/kern_timeout.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_turnstile.c,v 1.56 2025/06/27 21:36:24 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_turnstile.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_todr.c,v 1.47 2021/04/03 12:06:53 simonb Exp $$NetBSD: /usr/src/sys/kern/kern_todr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_uidinfo.c,v 1.13 2021/12/28 13:28:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_uidinfo.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: kern_uuid.c,v 1.20 2014/10/05 10:00:03 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_uuid.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sched_4bsd.c,v 1.47.2.1 2026/04/03 11:45:13 martin Exp $$NetBSD: /usr/src/sys/kern/sched_4bsd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_acl_posix1e.c,v 1.1 2020/05/16 18:31:50 christos Exp $$NetBSD: /usr/src/sys/kern/subr_acl_posix1e.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_acl_nfs4.c,v 1.2 2024/01/19 19:07:38 christos Exp $$NetBSD: /usr/src/sys/kern/subr_acl_nfs4.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_autoconf.c,v 1.314 2023/07/18 11:57:37 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_autoconf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_blist.c,v 1.16 2024/09/08 17:28:36 rillig Exp $$NetBSD: /usr/src/sys/kern/subr_blist.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_bufq.c,v 1.27 2019/02/17 23:17:41 bad Exp $$NetBSD: /usr/src/sys/kern/subr_bufq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_callback.c,v 1.7 2009/11/24 20:11:50 rmind Exp $$NetBSD: /usr/src/sys/kern/subr_callback.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_cprng.c,v 1.44 2023/08/05 11:21:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_cprng.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_cpu.c,v 1.23 2025/06/23 22:50:23 ad Exp $$NetBSD: /usr/src/sys/kern/subr_cpu.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_cpufreq.c,v 1.10 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_cpufreq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_copy.c,v 1.19 2023/05/22 14:07:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_copy.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_device.c,v 1.14 2024/08/27 13:44:55 thorpej Exp $$NetBSD: /usr/src/sys/kern/subr_device.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_devsw.c,v 1.53 2024/10/13 22:25:38 chs Exp $$NetBSD: /usr/src/sys/kern/subr_devsw.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_disk.c,v 1.138 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: /usr/src/sys/kern/subr_disk.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_disklabel.c,v 1.3 2019/04/07 02:58:02 rin Exp $$NetBSD: /usr/src/sys/kern/subr_disklabel.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_disk_open.c,v 1.15 2020/02/29 14:44:44 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_disk_open.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_emul.c,v 1.2 2019/01/27 02:08:43 pgoyette Exp $$NetBSD: /usr/src/sys/kern/subr_emul.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_evcnt.c,v 1.17 2021/04/17 00:05:31 mrg Exp $$NetBSD: /usr/src/sys/kern/subr_evcnt.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_exec_fd.c,v 1.12 2021/06/29 22:40:53 dholland Exp $$NetBSD: /usr/src/sys/kern/subr_exec_fd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_extent.c,v 1.89 2019/08/15 09:04:22 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_extent.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_hash.c,v 1.12 2021/06/13 14:58:49 simonb Exp $$NetBSD: /usr/src/sys/kern/subr_hash.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_humanize.c,v 1.2 2019/03/12 00:25:44 kre Exp $$NetBSD: /usr/src/sys/kern/subr_humanize.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_interrupt.c,v 1.5 2021/12/10 20:36:04 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_interrupt.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_iostat.c,v 1.26 2024/05/04 13:33:18 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_iostat.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_ipi.c,v 1.11 2023/02/24 11:02:27 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_ipi.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_kcpuset.c,v 1.20 2023/09/23 18:21:11 ad Exp $$NetBSD: /usr/src/sys/kern/subr_kcpuset.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_kmem.c,v 1.89 2023/09/10 14:29:13 ad Exp $$NetBSD: /usr/src/sys/kern/subr_kmem.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_kobj.c,v 1.78 2023/04/28 07:33:57 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_kobj.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_localcount.c,v 1.8 2024/08/16 21:54:17 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_localcount.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_lockdebug.c,v 1.83 2022/09/02 06:01:38 nakayama Exp $$NetBSD: /usr/src/sys/kern/subr_lockdebug.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_log.c,v 1.66 2025/04/09 05:38:01 rin Exp $$NetBSD: /usr/src/sys/kern/subr_log.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_lwp_specificdata.c,v 1.5 2024/09/01 19:56:18 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_lwp_specificdata.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_once.c,v 1.7 2019/03/19 08:16:51 ryo Exp $$NetBSD: /usr/src/sys/kern/subr_once.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_optstr.c,v 1.8 2023/04/20 09:04:45 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_optstr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_pcq.c,v 1.20 2023/02/24 11:02:27 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_pcq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_pcu.c,v 1.28 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_pcu.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_percpu.c,v 1.25 2020/05/11 21:37:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_percpu.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_pool.c,v 1.295 2025/05/26 08:32:11 bouyer Exp $$NetBSD: /usr/src/sys/kern/subr_pool.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_prf.c,v 1.203 2023/08/29 21:23:14 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_prf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_prof.c,v 1.50 2021/08/14 17:51:20 ryo Exp $$NetBSD: /usr/src/sys/kern/subr_prof.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_pserialize.c,v 1.24 2023/10/04 20:28:06 ad Exp $$NetBSD: /usr/src/sys/kern/subr_pserialize.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_psref.c,v 1.18 2022/02/12 16:31:06 macallan Exp $$NetBSD: /usr/src/sys/kern/subr_psref.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_specificdata.c,v 1.14 2017/06/01 02:45:13 chs Exp $$NetBSD: /usr/src/sys/kern/subr_specificdata.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_time.c,v 1.41.2.1 2025/10/19 09:41:04 martin Exp $$NetBSD: /usr/src/sys/kern/subr_time.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_time_arith.c,v 1.3.2.2 2026/02/02 19:37:17 martin Exp $$NetBSD: /usr/src/sys/kern/subr_time_arith.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_thmap.c,v 1.15 2023/10/17 11:57:20 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_thmap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_vmem.c,v 1.118 2024/12/06 19:17:59 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_vmem.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_workqueue.c,v 1.48 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/subr_workqueue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: subr_xcall.c,v 1.39 2025/04/01 03:16:41 ozaki-r Exp $$NetBSD: /usr/src/sys/kern/subr_xcall.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_aio.c,v 1.50 2024/12/07 02:38:51 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_aio.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_descrip.c,v 1.52 2025/07/16 19:14:13 kre Exp $$NetBSD: /usr/src/sys/kern/sys_descrip.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_epoll.c,v 1.4 2023/07/30 18:31:13 christos Exp $$NetBSD: /usr/src/sys/kern/sys_epoll.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_eventfd.c,v 1.11 2023/11/19 17:16:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_eventfd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_futex.c,v 1.26 2025/03/05 14:01:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_futex.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_generic.c,v 1.134 2022/07/10 23:12:12 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_generic.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_getrandom.c,v 1.2 2021/12/28 13:22:43 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_getrandom.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_memfd.c,v 1.11.8.1 2025/11/20 19:27:15 martin Exp $$NetBSD: /usr/src/sys/kern/sys_memfd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_module.c,v 1.30 2022/05/24 06:20:05 andvar Exp $$NetBSD: /usr/src/sys/kern/sys_module.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_mqueue.c,v 1.49 2024/07/01 01:35:53 christos Exp $$NetBSD: /usr/src/sys/kern/sys_mqueue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_lwp.c,v 1.89 2023/10/15 10:29:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_lwp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_process.c,v 1.180 2020/05/26 00:50:53 kamil Exp $$NetBSD: /usr/src/sys/kern/sys_process.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_process_lwpstatus.c,v 1.5 2025/01/11 19:42:04 christos Exp $$NetBSD: /usr/src/sys/kern/sys_process_lwpstatus.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_pset.c,v 1.24 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/sys_pset.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_select.c,v 1.68 2024/11/26 23:10:15 khorben Exp $$NetBSD: /usr/src/sys/kern/sys_select.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_sig.c,v 1.58.2.1 2026/02/02 19:41:51 martin Exp $$NetBSD: /usr/src/sys/kern/sys_sig.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_sched.c,v 1.50 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_sched.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_socket.c,v 1.84 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_socket.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sys_timerfd.c,v 1.11 2024/12/19 23:50:22 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_timerfd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tty.c,v 1.313 2024/07/14 05:10:40 kre Exp $$NetBSD: /usr/src/sys/kern/tty.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tty_conf.c,v 1.57 2021/08/09 20:49:10 andvar Exp $$NetBSD: /usr/src/sys/kern/tty_conf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tty_bsdpty.c,v 1.20 2014/04/04 18:11:58 christos Exp $$NetBSD: /usr/src/sys/kern/tty_bsdpty.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tty_pty.c,v 1.149 2021/10/11 01:07:36 thorpej Exp $$NetBSD: /usr/src/sys/kern/tty_pty.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tty_ptm.c,v 1.46.8.1 2025/08/08 16:37:02 martin Exp $$NetBSD: /usr/src/sys/kern/tty_ptm.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tty_subr.c,v 1.43 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: /usr/src/sys/kern/tty_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: tty_tty.c,v 1.41 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/tty_tty.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_accf.c,v 1.16 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_accf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_domain.c,v 1.112 2024/12/07 02:31:14 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_domain.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_mbuf.c,v 1.255 2024/12/15 11:07:10 skrll Exp $$NetBSD: /usr/src/sys/kern/uipc_mbuf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: link_proto.c,v 1.41 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: /usr/src/sys/net/link_proto.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_proto.c,v 1.24 2024/12/06 18:36:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_proto.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_sem.c,v 1.62 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_sem.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_socket.c,v 1.314 2025/07/16 19:14:13 kre Exp $$NetBSD: /usr/src/sys/kern/uipc_socket.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_socket2.c,v 1.147 2024/12/07 02:31:14 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_socket2.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_syscalls.c,v 1.215 2025/07/16 19:14:13 kre Exp $$NetBSD: /usr/src/sys/kern/uipc_syscalls.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: uipc_usrreq.c,v 1.209 2025/07/16 19:14:13 kre Exp $$NetBSD: /usr/src/sys/kern/uipc_usrreq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_acl.c,v 1.3 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_acl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_bio.c,v 1.306 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_bio.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_cache.c,v 1.159 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_cache.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_cwd.c,v 1.12 2024/12/07 02:11:42 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_cwd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_dirhash.c,v 1.16 2024/12/07 02:11:42 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_dirhash.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_getcwd.c,v 1.63 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_getcwd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_hooks.c,v 1.9 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_hooks.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_init.c,v 1.67 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_init.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_lockf.c,v 1.83 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_lockf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_lookup.c,v 1.238 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_lookup.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_mount.c,v 1.110.2.1 2026/04/03 12:53:54 martin Exp $$NetBSD: /usr/src/sys/kern/vfs_mount.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_quotactl.c,v 1.40 2014/06/28 22:27:50 dholland Exp $$$NetBSD: /usr/src/sys/kern/vfs_quotactl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_subr.c,v 1.502.2.2 2026/08/17 15:47:55 martin Exp $$NetBSD: /usr/src/sys/kern/vfs_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_syscalls.c,v 1.571 2025/07/16 19:14:13 kre Exp $$NetBSD: /usr/src/sys/kern/vfs_syscalls.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_trans.c,v 1.73 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_trans.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_vnode.c,v 1.156 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_vnode.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_vnops.c,v 1.246 2025/07/09 07:39:39 bad Exp $$NetBSD: /usr/src/sys/kern/vfs_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vfs_xattr.c,v 1.41 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_xattr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: vnode_if.c,v 1.119 2023/06/15 09:15:13 hannken Exp $$NetBSD: /usr/src/sys/kern/vnode_if.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dead_vfsops.c,v 1.13 2022/10/26 23:39:43 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/deadfs/dead_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dead_vnops.c,v 1.67 2022/10/26 23:39:43 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/deadfs/dead_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: fifo_vnops.c,v 1.91 2021/10/11 01:07:36 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/fifofs/fifo_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: genfs_io.c,v 1.104 2024/04/05 13:05:40 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_io.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: genfs_rename.c,v 1.7 2021/10/20 13:29:06 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_rename.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: genfs_vfsops.c,v 1.11 2022/07/08 07:42:06 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: genfs_vnops.c,v 1.220 2023/03/03 10:02:51 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: layer_subr.c,v 1.39 2022/04/10 09:50:46 andvar Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: layer_vfsops.c,v 1.56 2022/12/09 10:33:18 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_vfsops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: layer_vnops.c,v 1.72 2021/10/20 03:08:18 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: spec_vnops.c,v 1.219 2025/01/06 09:45:49 mlelstv Exp $$NetBSD: /usr/src/sys/miscfs/specfs/spec_vnops.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: clock_subr.c,v 1.27 2016/08/15 15:51:39 jakllsch Exp $$NetBSD: /usr/src/sys/dev/clock_subr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dksubr.c,v 1.118 2025/02/18 17:09:34 mlelstv Exp $$NetBSD: /usr/src/sys/dev/dksubr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dk.c,v 1.173 2025/04/13 14:01:00 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dk.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dkwedge_apple.c,v 1.6 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dkwedge_apple.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dkwedge_gpt.c,v 1.26 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dkwedge_gpt.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: md.c,v 1.87 2023/01/13 15:46:40 hannken Exp $$NetBSD: /usr/src/sys/dev/md.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: mm.c,v 1.25.2.1 2026/06/29 20:08:40 martin Exp $$NetBSD: /usr/src/sys/dev/mm.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: random.c,v 1.12 2024/08/27 00:56:47 riastradh Exp $$NetBSD: /usr/src/sys/dev/random.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bpf.c,v 1.258.2.1 2026/09/13 13:37:14 martin Exp $$NetBSD: /usr/src/sys/net/bpf.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bpf_filter.c,v 1.73.2.1 2026/09/13 13:37:14 martin Exp $$NetBSD: /usr/src/sys/net/bpf_filter.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: bpf_stub.c,v 1.8 2018/06/25 03:22:14 msaitoh Exp $$NetBSD: /usr/src/sys/net/bpf_stub.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dl_print.c,v 1.8 2021/05/27 13:40:38 christos Exp $$NetBSD: /usr/src/sys/net/dl_print.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if.c,v 1.535.2.2 2026/05/15 09:26:56 martin Exp $$NetBSD: /usr/src/sys/net/if.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_ethersubr.c,v 1.330.2.1 2026/07/03 18:22:08 martin Exp $$NetBSD: /usr/src/sys/net/if_ethersubr.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_loop.c,v 1.118 2022/09/04 23:34:51 thorpej Exp $$NetBSD: /usr/src/sys/net/if_loop.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_media.c,v 1.54.12.1 2026/08/02 13:33:27 martin Exp $$NetBSD: /usr/src/sys/net/if_media.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_stats.c,v 1.5 2024/06/29 02:18:35 riastradh Exp $$NetBSD: /usr/src/sys/net/if_stats.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: nd.c,v 1.7.4.2 2026/06/03 18:41:36 martin Exp $$NetBSD: /usr/src/sys/net/nd.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pfil.c,v 1.42 2022/08/16 04:35:57 knakahara Exp $$NetBSD: /usr/src/sys/net/pfil.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: pktqueue.c,v 1.22 2023/05/28 08:09:34 andvar Exp $$NetBSD: /usr/src/sys/net/pktqueue.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: net_stats.c,v 1.6 2020/02/07 12:35:33 thorpej Exp $$NetBSD: /usr/src/sys/net/net_stats.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: radix.c,v 1.49 2020/10/18 13:07:31 gson Exp $$NetBSD: /usr/src/sys/net/radix.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: raw_cb.c,v 1.24 2017/09/25 01:56:22 ozaki-r Exp $$NetBSD: /usr/src/sys/net/raw_cb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: raw_usrreq.c,v 1.66 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net/raw_usrreq.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: route.c,v 1.239 2025/06/12 08:27:40 ozaki-r Exp $$NetBSD: /usr/src/sys/net/route.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rss_config.c,v 1.3 2021/09/24 04:11:02 knakahara Exp $$NetBSD: /usr/src/sys/net/rss_config.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rtbl.c,v 1.7 2017/06/01 02:45:14 chs Exp $$NetBSD: /usr/src/sys/net/rtbl.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rtsock.c,v 1.256 2022/08/27 08:36:41 skrll Exp $$NetBSD: /usr/src/sys/net/rtsock.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rtsock_shared.c,v 1.23 2022/10/04 07:06:31 msaitoh Exp $$NetBSD: /usr/src/sys/net/rtsock_shared.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: if_arp.c,v 1.317.2.2 2026/06/03 18:41:36 martin Exp $$NetBSD: /usr/src/sys/netinet/if_arp.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in4_cksum.c,v 1.20 2014/11/30 18:15:41 christos Exp $$NetBSD: /usr/src/sys/netinet/in4_cksum.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: in_cksum.c,v 1.22 2008/01/25 21:12:15 joerg Exp $$NetBSD: /usr/src/sys/netinet/in_cksum.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: ip_encap.c,v 1.78 2025/02/26 04:49:45 andvar Exp $$NetBSD: /usr/src/sys/netinet/ip_encap.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: gpiolib.c,v 1.1 2024/12/17 12:44:33 martin Exp $$NetBSD: /usr/src/sys/dev/gpio/gpiolib.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: secmodel_suser.c,v 1.58 2024/03/01 22:01:03 andvar Exp $$NetBSD: /usr/src/sys/secmodel/suser/secmodel_suser.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: secmodel_securelevel.c,v 1.37 2020/12/05 17:33:53 thorpej Exp $$NetBSD: /usr/src/sys/secmodel/securelevel/secmodel_securelevel.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: secmodel_extensions.c,v 1.16 2023/04/22 13:54:19 riastradh Exp $$NetBSD: /usr/src/sys/secmodel/extensions/secmodel_extensions.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: secmodel_extensions_vfs.c,v 1.1 2023/04/22 13:54:19 riastradh Exp $$NetBSD: /usr/src/sys/secmodel/extensions/secmodel_extensions_vfs.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: secmodel_bsd44.c,v 1.17 2020/03/16 21:20:12 pgoyette Exp $$NetBSD: /usr/src/sys/secmodel/bsd44/secmodel_bsd44.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: dkcksum.c,v 1.1 2021/05/17 08:50:36 mrg Exp $$NetBSD: /usr/src/sys/lib/libkern/dkcksum.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: entpool.c,v 1.1 2020/04/30 03:28:19 riastradh Exp $$NetBSD: /usr/src/sys/lib/libkern/entpool.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: hexdump.c,v 1.4 2017/12/09 00:51:52 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/hexdump.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: radixtree.c,v 1.34 2024/05/04 17:58:24 chs Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/gen/radixtree.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: xlat_mbr_fstype.c,v 1.10 2025/03/02 22:04:07 jakllsch Exp $$NetBSD: /usr/src/sys/lib/libkern/xlat_mbr_fstype.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strcpy_arm.S,v 1.7 2024/02/08 20:51:24 andvar Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strcpy_arm.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: popcount32.c,v 1.5 2015/05/29 19:39:41 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/string/popcount32.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strrchr_arm.S,v 1.6 2013/08/25 06:15:06 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strrchr_arm.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strlcat_arm.S,v 1.6 2014/05/06 16:02:11 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strlcat_arm.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: murmurhash.c,v 1.8 2019/08/20 15:17:02 para Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/murmurhash/murmurhash.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sha2.c,v 1.26 2024/01/20 14:55:02 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha2/sha2.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: sha1.c,v 1.7 2021/10/28 15:09:08 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha1/sha1.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: getfstypename.c,v 1.11 2021/07/22 13:54:38 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/getfstypename.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: proc_compare.c,v 1.3 2020/01/06 13:21:18 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/proc_compare.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: snprintb.c,v 1.49.4.1 2026/04/02 19:09:50 martin Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/snprintb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strlen_arm.S,v 1.11 2023/01/15 08:43:03 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strlen_arm.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: keccak.c,v 1.1 2017/11/30 05:47:24 riastradh Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha3/keccak.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strtoull.c,v 1.6 2013/04/16 21:44:06 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoull.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strtoll.c,v 1.7 2013/04/16 21:44:06 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoll.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strncmp.S,v 1.2 2013/08/19 00:57:25 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strncmp.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: rb.c,v 1.16 2021/09/16 21:29:41 andvar Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/gen/rb.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strtoul.c,v 1.3 2008/08/20 19:58:34 oster Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoul.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strchr_arm.S,v 1.8 2013/08/19 17:50:04 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strchr_arm.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: strcmp.S,v 1.2 2013/08/19 00:56:12 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strcmp.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: memcmp.S,v 1.5 2015/03/26 13:34:51 justin Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/memcmp.S src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $$NetBSD: __aeabi_idiv0.c,v 1.3 2014/01/29 22:29:43 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/gen/__aeabi_idiv0.c src@cvs:netbsd-11:20260913135842-xsrc@cvs:netbsd-11:20260817153453 $GCC: (NetBSD nb3 20260326) 12.5.06T7Zx ]Uu?~^̝3Z VZ :%*" : LԿhEI QAP 4P- bE`+*9{>?|g}^{^aG-{3rzZHKk AT͎]Apw\Z;!}ܕw[ZnWiqZ1-O߱)mAR'-iy3~ߦܮ x3_ioUOTt ԳGͥSWŪ'´o,?/QvV~v9栾ב~Gjꎤח\c3?%Ə|ܜ^Q<-m5ڴͯp&o*7Nqy+ge.Ysۜgr*tLsu]8{ς~s d?d%]^ziٷ]wR]׫wo -6N:?CwWlQyaA%ƏNH??ѭ.=ǻ/xo\Ryơ(+<ڳg$&={Wo`Hm8IB}z?j/|r0QKB0SC)ݜ?IǏoA_oQ^VeA<>8.7q]Y1>IU_K8[gk$}-/&IrIZO\οϥeCZ>MiْϦ喴\ri~jlT>kŴ|%-rj\/jؓ}g^3.6ޞ/+}OI?|iA]T0wޑO2b*D?%;4OiEop@)+ԻL3?f>UgԾY hݪ] / ӶN'-eQZSǯRtPM+Ǫ+s ՚} ‰-so㿿uiz>krǗOa먡ףMh?{eiRZE}ܩɕ|T{߉ 2h*>&y'ےK}b=tj3W1`vOOO:RpwWhi/T*鵾$[ҹ:=*>w%z#+I(́3~309UڲooP1ϩvg\fUWDWg0o enwݥVge>Gj94rNT a+NQ = iOq۽gꝗ`UE_VS<މO"~5+I0%S(/LƉ7שJe?NejA~J١ y#٘]Erάp+h> eCӊ7ӱSozoL779m([8\&#=_RWC1XeCv'CNQ ipAzlNR{9UU W(Zzt,5`͛wowSWa%cṧpV[~kjgi%v9ļ߽]6m}rZ+&}tCg:%=Yl߇c \{}I'sy}i>xˣcFߑ~pHw==|u(9tC=x]Yk[q}$>j'u"ȏw~}0k@3ӺgHaueՏ*h[m9FN'3 ~t*iYmʓ _ʅKB_.|6Ͽ_v林zC1Ң=ͻ'kTg.uv>ԗ2Gge }ro]ⴣZit}/+mQgP}zU=ٗ>Im?+|]{/?]Qme:zt#HٻzgY>O3}MMӁڍ64P2#䧭Ch뢮hLF8_gojR=o0c\4e5~\5yX9;5|Pjn|߉OEpåc_d)Dz2-tG͢Դî}!Z{⽁Mq=[ا| pC]~x#p>ފhFsc-67] .{έ߯ԥǎ>œMI{~9 1u@gG{}~4W}ISas3o87㼅f[ y֧}\#͵8/~O`=]9̱|w]|>ٯ>{,xKwE oBdkAV"oS8d|;|zj__7|4\>ƿm]&p5 ;jlu_+(V? ̘u]mBASHdW8`]vp9<m&<,6j~n]0%y7vE=]baz~T Cn:Tw;9`_ĩzѷ6}$/qfy Apă+ zފ +8ue $I%pβ璞Zӷ] t2pH!*V8_rW=.1R1/g0_Z=<^*YpNnkFnrJa9|V7ȾcWjb^zqs!]+E6''~Yv?It%ko킵]{ N~}4f3p5i]p-H9] : }kkHYF*m :dR5 δ_)UޕtK 9=EHneq=zOWV8eOHc;wȾqhAߧǪ694ޥъ3dBxNNժ=wRgu#*TSϹ7/u}/C>FԗzZx7:oNw#(oMcٗ?Zbޘ6IM_\C?s3/0~Mf M>06<ԩ΁z ;Zyj׻ÇZ9=_϶hxc8p:? :[mk4cE2Nf o3"iyuZU-aUݣ8l:{ו~/y:T] Ujnb뺆ɰBduW|&`}y!~>ΑշW<5H%{X$\ޢqƇY})+Uo_W ^YC.WlוGw?l/^D=L?loyڈxr:l|V[pv`}_lR3pr5+^d0|}ciLZk}%Ι8u뚄<볼G&֣+ޝ% C6տ/cgb q3f}9j$o[>m>K>ԅnfnVt>kqZ:.#e>p r,~ל5#GqٽF?botX|5/=ioڷKZ %yk {ss>1V>`T/hp9]gz|lyz8V2fבfZ>38Oݬ=t>'jfAs~|`Fm6_VSw8PrK G]QA띑9|>- ӠƲW^?L>er{Fם}o+uqC>ޖ~dFt~ea]ly/IХ(@K =<1af>w_hW1WY;گ; f^T bauwnw5}и !.Y]3rv|KvwJL5>Q03~]wY%f,,ydqx,Uy}GJZ|[8;fuNj:sM>&:kk=|.4?.mq署Fy亴DZﾴkv.linzl3*x8v m;i؟;NŲnX -=xn>qG m|u IlՕ90L}Yךo'Gof-|~ XМ,d2(ue_3>~M%)MZHq_7!Mh=I$zג!skU\w.#*ٯ wuwNymPx0~"i >񛚑M*8`OI=y@|;S#8nf][;{n'g͡6! u|~RWԥeɕFLdNC=#-~NrǸ=!oL/n/0ppI:66bƗt"h.s_:._o{4‚FrF>>d*3t}RȮm3ɠ궪{'ߺu} XM[N2y>Nyt)׬e"q iDмOgo"} OKo A;6{̮D6~{Ӟr6mG}o}f׶LSlk'hq3v{T7NjLj~L৳g1gyq}1:zncs]m3V=> açsTؕ ^kVł@|W"],2e"gF( xvuØ [~7^v]n`Ko|GbC8zu_O㔛?~!h1yf5v>SDVU廒igl)d}X{g%7^$?٬ qҟ-E~XF.7mLבbu*x[@~U'#Ӯݙǔ+>,puPwalN5wޤqחE}G0z=o.OO_C#:;yCYW맫{Rz5Oui=at>*븦#moO)Y/7;9_ޢ^iM"fv6q|R[xroy~f!t::W !t%;:^ԩ%{li?,QLϗꭈ5 >%SGt5fo-dӵωD5{f3}+ EoԻk<ڤR̾bՠ`h 0ۗsDϟZ{1 zWؤ_zC_&A/-Ҽ?Wj][$bNګ+mMyzS1s%3&ΎȞYpN3Jk`ub:ttMN| (ԟ .jL_ǾW1\/=湆" pW b|.n|sK>Jv/z 8V.d{ԁ{G +1&p~x!+_eC#Weǻ*?tQߧo=E0{^+2? b אq FxY#gȅ%x,t4.uI3 y8vӉd#'$)/33 t.lX G$sr&o9q9}eIK兢m"Cȣc\/r㉠OՉΆN xoc<<|C@n RSk5Y_hsh}4XOoT'DuRҗmR#BN%le'>O.;'1e4$nK㓕$rP^\@tg:^}]/Յ*WP6ތB߲tegܺC`7) \θc*GEt-9> Q|{+ 0vP.\tԻG~e.y=?Ӛ{JBz{Zֈ$wcEӶX3F\7<6=Xܒڐ ycN6~}0WmK~#1WfF>fi=w}ShcIltNǿUl/;҃[bw K>rM_gX#no6{?98Mohԧfۜͷ!ꛯ~c?Ѧ{t6Y9gG+>n#ġKL;g;!;F>]q\]oo\o^a|q,\20o)19ݟ +'muȫ4?f0R뷀A8_jeEL(rbK_Z]c:|rȎmljqvqr,t~?2s?{7ݠ7Q >~?e±jsqE}qJMޛm? >ؠfc~AsG38͛3/=Ӌ>Gw&~:K[<:G}kgߦ䷁PI+.,fdO/Kl_Ej9xn3sdžF}> BY~jx ๷~sk/Ukߋ&ߧt5\g\$x:eĹ*nOM$]{s?lF~j,553qw9R -F`@#Z#KmrO_f{- d7=HokHmiB;n+ 2ikovYG6F&/quk *0ۮ5A5O yሾ^WSңRl:('tZ ] 9#}sfi]:y .ܡ/v^WRN/F .vzwvb}ub3l8?`Ќk8mMy};UF@D.v"x{71Fޡlྼw(?6!!SW}S#W kla:>pD)9rV{o(:'ѪoqaR49[9\تb W^9}+Fx"<߽ø't:29A O^ GA^=|{33=Y׷IO';<@t@hצunڒ}L/[xqL -v#Is,%A$ o-nQ'۳}L }>3+mߋ uOܩfdu^:v~wyW%;)G)\vwdJA3Zϒn5o?rq@|s:tdRCpmw~_UJ1w=pi~~˖}w7wcZIǵaV4ѻ{"8P 樭7$ysaҽ5Ac Mf޲/uǍd@Acjp?jʷKfuN;kvynx,|]I7{Zi;O?!rq|mh' {Th^py}+~GoJ]n(ۜ[GYsѶfLEd lgLɎtleղݷ:`?|moRZu<`P;A>lz03T07i3ŦvLx6Oֆ;d޵F]r.|msdLՠn ?Z~#jO2T)N]o m۱밮i0ȷD;2|sT`8Nf^_K s_s];rZK(q^s7ߛ^s9Kq#J6/eՠ=x{Iח nb)\{G)a#ݥמ <-"1ccnoJƊ>Ov|tOرeδtW#  {lVv8~MG2qk͊?{M~btGkyFKG8R^[0H4J;[xyqaI/ '%fEPeϸ_rMs/bOo [{xA0'yV<Ǐa O籾xCg~{x_-m_GG+ZdQWSLM'Y;qdʭ<+t_Cx`Z_է/"@w6^:/vt* *1+8O }t̗J89>rD%+Gppe"6:x՟b}+NyxD3uߟBU|z7)]0JmEO>!+_k=(.q+<14zNѲf?|}M59߁E6stxyD|>X4ps:췱kxU#} x[u{|y-1uG&`8&w\!*x5~88?rw{UXj\az3zG*> [L[-yͦ|l&1N L)8&PozY:?Fw6% \CE "M>z_nm9[8x>Wpi2#w>nMsJ{W=u]2dn:i"qc.dplCi: =iE(lb:&/+KQ/D"l)4Q~:ewŚlVo]} ơ䚔=HŌ1F;x;m:j8SMҸ -H]Gq?lc2P+qy#e}sOi_Kg%x,s0MF]xU?|`_y-ׂʁ'6.e8q)YOT{ll4XE>\(W| #hw.e^Մ:G"O1,-vL/zM=GsU}W(upЈ֗6㟨1L`UZVfrG3."Qq**ܘ#^φι`%X'&-벰ŘIWW58PKt?ycɥszdy2t~QgVυpa {#f%Ɖ@<~哮~g}7S%H>>lxq\ )'pbG\)sS pa-&sP *[=G2|{3*}|<YK4gn_?\u\qЯE/[ s~NşM<5\dkR>_쎹?)mWۻu\<¥*ٱ`y^%[`bgٜus_/p! u<r 1Ef $|Bs$^%752n ==qao?hV7gUF1_6f.% ~ wWb;||{_PŴdN%H[Uu]ܳll7: { ue-͌6ǥͱ.oqGS͏S9>%{5?+F7rD{bE:b{zx7g٥ &.{~Z c$^x{?Q;6G9<3<}ksCܧ1o^}M>EJ#Pyլ?\ cMǟiu`0o$mVsU&7nӇG  '&v{^Iv? !X+b7oT:z|gl]uνCcOgtӛdžL8O;Wx\mUl G=oiBʛ˙,ǔp)xѪVs]<=hl7xc ?39gQXWY x﷼fxn]i:lm+e\`i3!)Mˏ{llӽu|W(z;_m|'O{\|w'ގxqgS=bqٟOEOLZx|W=oC$@&B;}糉F-y^sE~Ho;hmoo7kFz6`:rƵڷBe_vzv^;8Ot=3?0p9 mz:3+4TYSW_"vd.lb_a|1}&,.4]H:{.qgQU6gaf׫1 2_ߧx}\>qk9}|݇f>m8 FKa`]c~l?Fm͵o~cs|/][)f"f2 `/[bSs(fz-:+D{W▊}CS?7@rBز`֙=æ?9>{?+oM8r^IړXӴaWץشo8=W+fK=1V䴎]rGr|4zyCNswUbkj;&s|rҲ?{⩪i3n>YH',/1bγO(Im1Ib:!煚zma,rLOvkކ8J>ǪnT5ϘĢN6n3€Wܳ5o9-X(#`w 0c*iG f2D@]d[vY[azјxaLȫzkn懄ۯ,ز>9.9K<#F|Hm'?<;}VnrgG.G77cۦXBsB@0Zm3xе?iÌukhLhmWaڷ:Hϱd܄vgd1 ҄hI<١sך?\.";F"' zs!.>P٣~Yra AI[VbsaWN2 >yv }ud۹VI۔vG<0ιagb0Y} >wůA4 ypͳ-;z 8]-fegi0sLM{C9vAq tbQi_Os~{;?6@ ƽwyƟ}74QQ#_ՕgXl`Ly"}Qszܞg_S#H`Foc<܇,hՉ[ Dpc{9؎3Z%wQFb_YKְsIڎ>m? r^Ч;2?Zsq^KY [ԸtUi;1`S>b^NAxJ`~۳riַ^}T^'wemɱMLyi r=ȜOG+yt *܀p931?K{Hlaq@1.<@H}n WB/F&ux;Ox,*i;]/|*ONá-H JgE_j5e!?1bGf\c󻋦^[ת;53bأOs۪z_M^2ccxa #n󷠌 ۥJ^sPBW;:q#ЊT枵M`2E'Ki"W\LlS?_|TYʵޮJL.*Rzr""e9֙sU!b_# >Q];Kfa]ٿՉk [r5?cSOb$Lw./L{L1߿p9,+#源{gV;dN.|=? zO<. ARVF5a!moҙvy~`|]K#SRnt D7K=&hk_̡kM9?-B@$^K-Il9æ6k-Ki Xǂ}+L6yO߄F f<sȤZ 1ϯ-y m3?{A^.1'4;ozvrtzsKpAi.6ELl}M݌\M q<2_r!a1QK,v8oH.,[s@ H N(P`O4{ _}/ -X9+>-qLnns'5.š>c4 4KrΗ|]2΢o|t`eUFz.Ţݡq 硹}g{9=!A7֞æŜ/(tȶGML|ʶn7qn߬:,owA}f@z:%I; Y,'{䟁67J[0]#x8Nڟg"%˺UúgEoV>[$mOHtŞ{!y.H@D.J4Qnya:;zzWy`q.{%;mL|CiJROtݗzM>~`eHȟnq sOf]8yJir;1N?.K}/`Ɯ;ŴaZW4| 8saa:uEI&YhUNW2#56v[vALg̽B#k9(go' 'pB4)@g|*uhž>laMO*&rF;o)o!i %$-7Qk 6ב:d+)tm.ǬCޢ;Q<$E&*G S6#m}`q5D"X2X>P߲ϣ/={ڏ~ wCL<0jSWoXLڲ}:/K<ua֩ϙC>c\>FL`,w~; FmYwun]w&)4%Jjt.v8- _A 5t ;헷;?4g8d '>Җ b~RW :ItTMsa!̞s XW+"t6lxOȴ-6m &f}hukKN')B"8tX+LI1Lm=vcwҗĕཆ`^#rGL9w"vTO/r!tn|p9#8h_𠹇_k~1pű<. }u)STL=}dDXwhm?6֡#OǎĶ|Ic]*V焐 }췱c cWS1[rymSs؃Do,[% _xK]KT_2.A\c!#9#?[֤:/ݤm}B f&?i2|1$6k$ ^٥G{-zGY頖 y)~_g}epE_.Ğf}FtGUeO 툵l7m Cf+ż*g?Ԁ @O>? ۲2~wˎ"h[$xV~ޓ|GȎ$u'cFq6d:mDZ-`]&;}b?Sz:.e#d$σX+SJ0!ɷ !s ϝpװ4ui;i5@;#<ĵ94/{]X+of˔~cg$􊘿t\gKoŅ$L]ȍo] L˚_6@sAs?, >Ɓg<|ꋒc:s[9jY'= ʯyi6to0ݟ_)uA.XTLѪqkK}+~{6|@l*v3[%lW\9Ē"ϙ8XE/sK@i!>[{V\_v1XPJWk?tЎ-uk| o*DhaO+m[?rïG/Jc#&f2u$e۝y''V615e%OmqKɖ ?f!ho6;bsܧ "; a;5g_Xhϸ~|Z{"ǁ(yc(cT>6I~ӯ.{K22+NJJ@&NDZoƌޡqv|cTsb;Q-N#-EeymUSHe㐌FCΚ+Z^o&|1ǹ$yb-<]UX0a|y}tBeǞzLȸx7x\g3߈VN YyxXQ2>+a>j lŸ8΋Ahcp\,h#@ۊ#$'Xͳ+:8i+=e'I˖M 1G"^O>YA7ĉ˜TW˘ |dUy%dNc3VǺVsJ@z9fG&̞Ip|s U4BQDSELK {!dPxB]4g^Pjs?U2BĜ<7<Ee[md%gji1x}}KOwJq's0zOcs5/]Y6zCC_l,'f2qt|O<3-&>~ÊFn"0hW\qhx<1t%4;Oz\ئx.؛:؈-wYq\1k>`xg2&1uGL^æ=0xW]@v3rHęss'h44r|ncy sPRa{"aٮ?E)W ȦìxݒKM-Xu)\>5keL}e`/f 焿K@_е=*󯼆}ʓjg\s}cLuJłOn9hwć>5j:=O{-D.JWy|c@lSb7 (zg_c\myAicڣn7(Qv/%Dft֖@(;8х![[CiEEO2G|+py宅:Y$xH>q7yuwI9]kcl|k c?CWA3W%ڿ/9`d-Z͍}.ӣ,U8O^6| `To5svA:$?)i2XgnʳxC9W1W{#}|p$ŴC?R#[4>R?pA]&^p6lpFՑ/ApqD'"[NcsĘyU/l}86t~Q3SG>ݦ}BiC;v6K[Us^ /4M=&=lNޛƀ@hLj|R44P5{8kg?,W9FkY>/y06u#RZV<^-,sO zl^m:|Ȋ<q0cwۮ8uჅ<fyE cя;vl\BdW'v5" 7m^*[Lʿq yH9X ]Bմ)ɝ6~е.0=?F}A9s}X2s|,nq\[_tdžE1=R^7;:5y, ğ+_ixkuCw^QvǏqMY$&b): .m쥭+f0V/L}G;2{@#̳CN-n)vgM;+KBes8hZO * y c) l!w4#V6=sc&(pg޾٭]\1c[Un~Xblxi"vF;F:ա#@"bmf̻8QUƘq1rv>&t~C10(&\x|o2!):U[E]y\4'NsjuL>&W)#ƻMCQƵ8}A]M}Mb[ג63y;ZX+rl -ZʂϓO'e~{mcۂG~Ad4e2'\@cm<0匴ΚC \M_]^uǥw# 4A-DM9.ѼѠ4[[<!SU=}OpX}uKpIO%st6b_\6vgIIgٳiW w\D2~ω5q1溔>"}w2livz @H0\.?b%@_0W~{M˗jLė#1_ws aj΋[)cSE5 1'gud\[F`._4*J4smx،1xxW =y1޳UiC8e[]cHmqBnP%,턥M߫"ӇF9 Ձ_VhӄRwE}eYY Ily NT`.R['o'coB u.}zlHfC~TK`Ӭ.?\VZ:jm5K_!ч~g> 09bFmB*9j#٫U|Q @qWzlp>+QbR(cPSt68,M VƏdJROZG=y Ys/mf)V{XԏXYR4戩v?aD?rpĨc \geNZRw֕±5C͇AN1[lߥs]]o)hE-?oԋw_Z~|zsQkgC;( &/n7svhl=1:wP|/5cMuD 73O*ECe*"FJ!m9!ہ=up]SVaJ٘o j~l溜Wg/u 5_/g\~p3p; u}:e?~0q}/ʕ%xyIIvgLhP oL!ȬKQ6Scp۹{=O"<}R}uLDJ Ȓo-cX+߹ȇw)pK^V3=œn7">R]9biYk#d2Wjߊ-*Х!TMۊ1| VƱ J՛0&ՕldLra6-Se 'ɝV(\WFGϧӱv=|N煶0LN67j38c؎ &튮 ܀+",5j'v;r\!Q/}1=Nl}H,gmA5ۦ=HɓŰM됁6/T*Y&!a>IOTm{Iu踭5- C0-v,txiɱ~_+m2(=y]a_VZ\4r_;9+=\:a1 ;"|~IuQ[~ݏv솾!'Nt;'sL~뫡m3ةƌ㘔zm>.Ǒ.2%O~&y73G 9"F|H9B_6Ý=淣 ˟T%m~e\/N9#/E) P{s a-1-gtm~yN$n'YU~;?Ӈ\S탏,':% ׾sPc'2O&2> ֟ϋ2P^?-y{R*Irauʭ&8c<".=5$(syqeΜ|T;D#2vLUq훸t{XR5桋 M`j2ءٱ[^j?}xW8dYѴ)g{=kYuxӁv-FkRzpՌϵ: K~]<[`zMOإ/g?*tI{"=׼Q.ȑ}A_]wp,[ͣN՛ֶV'ߢmvkkh:^Vqɜj8'>xUsjuJw;&7\#Up^DỺ 1eUC;p^7ɗ`,#V̥6ڇ2^|B ضl=' \):-f\Tg(|o3eHEI>Sܶ|rx';42SZg˦_c]~Dɮ(qIOZcJns9s+o#M1׫={ `-jWai ?|~fn[?l>E3Usֆ={Wu!x;}w~_&$syQۋR}΀HV;)\q}ܵ^r:b,،@%qD(‍oKDCVm}z:?׶:K7>찱G"!Df^UӢM*op5b %]z:mQPۚqU:r|(Y8yж^EO3敹Sr_<^ Nl1>)l_+] 򶊝 fL-=`˭$M3؎u'cd w ;ƾ Ur+@>.hڎ\N %͹Q|zwM2.kyo,[~>c*j2?ܝNu'79{ϧx83׍:MDmWĦ'Q~Sޛ.ČMnp𼝶|*[9DX^W5ց>1ہB@cؗ 0!xǚ ;J=p© `'D ԣq{2K+8;>GS~ ×zč `Kpؗ !YȻ,xdLv->? _v|T0n.>ϗH27Ȩ 'y+a]'f3ך@-s\]fN+~E7nltSξ{gx}#Vr8嗱&Nlzh@1ՎGpwcG~^ru%eh먄fÚͥ<&˶4̀ i?--0-ƹ`؝CQ[fxi}0u!y M -Ec#6]1 ?jY9U"ʉev2kU3V&G^ri? ŚE< &h[ղ/ M:عW\y+y$wgUd5$!! UH^B"BtD^"k;رZе\EW]{Yյ39w?t?xsܹs9sj݀@=#w9{0A|!q׭/(?.gñE-k3䴷ef LJe F輱Kr8{g3#Dd^S D~0c(ڢ̞t^YfxP/y\4=[Sa{r}A-mH?ޅu6CS `˘ɶ5JD<&w,웳ӱ͉4o `Fm7ή΍Si~ZOҞ}sTvhNaǙs|Oa9K}:}Z9ڳFX쟄O3G7Fd-ݝE܏=k7b"{/7hRC]Ԍ_륏yxnҜJa)atǫFG|-FTr'co'暸؜Y] mb^ \VTJ 9m52:a;aJ!+08?#s yZ.p&>v$y>PzkX΋0|BȹٔeWY[}~oIlRJs+6j#UG[?},pN3q \L'dG[qO?hw̏X3 ?׮Nm97k3i?_ylnz<P4Lr&~Z#+ty-^e7ػ]#M1?_; ˅Qܼm'f톝X6kjR4>E{k7W (Oh%L|հ=^/x¦!'U,=rb~lC+gZۈY<Q9y*{>gߜj[nrtqx:|ϿA_w^paϷor٧"F?y˸C+Hm˚؀,_Fy_nN-O߁oٳiʵ21.8P|[u4>/ؙ<mɝ=?/nxeEv(OM7%n+ Vxϭ͢Ay5sIʴlH$=հ=~hzN_Wam8 ߺ(W*o:LrG01A93esc8ξ܏GأW{ )n!lwoeFnR1$/sK#~̃QC:sOo cmԥ~d۶as14:Z;-Esǭ|%0_~S1jhp[<,|ғFi/Fm`^0>io֟ 6i6ϓugM9 yky SK\f-.7Hϫ?>ӳp[3Vd/9T9i'5;'\n`x\]}߭ŀ LnƆ_o5nOi4 ˂.vM M3`nѵ [Ӹ&U.>SG%bek?QGx^̓Z!?glJ].dw&ig ]Nh2.b/x$OvcZLە4#~) BOcVzv-}ƙq 4<F}2N,[J}Ճs2r6\/+;>_־渶>eo~=@}t=ǃ4O<wY}1*MbɺsϬϡ{~[a<Tx*7}[_whsw~\ɔ]j-Z]s]4s%bZ8'l"{?.%Ω89>eX'?a^ 6~;~>}yA9=BlyMF4o?α块 [nō=rmx27â3|V O;շ 1|^]Ava7g:g=TdylMX5it=~p8y#,+ ~[?^YV(_8(32Tӏj{3魞*ycmn[Yͱ2.j›#6eE4OGǂ9?=Go/{L .8/̊ėyw.gyo"{Y]f/#1'=9ACY*L`e6NMAe\1qk}Fx0wKg)+(n  mvx'+3ЎM w0 { FoyM֗7gPEstD@{y<=)~&yGdگ!9y|ۓ)[!>Gd[o%X.=c #BnsƭťBkrm[b]xz^D?L.{(-szsקJ;z6d{m hkvW'2,X;΅67@Gϟ6;unc獼^LĂ;oM;朙92rX«cɶQlJ8I1c^gʕ?EsU~Ge灼&x8unnoُqf\Z{>wq p4q aiNȴaV<<[XP/3/d{`a!v {6N#,,^ɍu.Н!lNTQ.6_"ṽݜ|;9n|lّ0/km\2o6< ##-y9"bZ9oGw㝭WE"꺫nޝ%M#iyBBcL'#:Wne}ĩ)TL6ۃ%UJ|@Y}y[gvW4L9lO|^ 6y.з|cAgC4&oHx戧)]* ʸ*>-szf㤂p9ܷ>c{|=xxz:ЪmVgS-.WD \OwAn 7!NG[W6iGMOKo2M='dx~ð|l6T+~ B7v0}8O3 r[s6.D~Gc$!} gy=asVfk{Qi^^>O$v?:nku..Թdz6#/aju~fH$o<:351ny_jY_k_/B=tF91:Z~seѠ H, qʂzEy?&jO,j9'Q_oG%iMogwA聝[+8^:$Y`79EӢ`|ӣų]*-k/y>68NX7r(fۛ~5j.1wGOcc6;]&_< Ϳ̟qA.*vX>hGkWy ]/X;XXWoW1߷QnMtBgy/JCL_U Ƙ-xٞ>'N&|V,w1C7m9;%[QzJ=yO//GXye| gЏ1ӂ Ϩ? Pnfۥ?1{~;Ϸ6[U?nnxxX[CcRs 7fOY3Rr1ެ{Ls /7msb! mnKG5_ٻW_G?9w^nP>j㰷 72-|n0,箳݌y9b&Zw3Nv@rNT31Z4' iƆc7쵆sd7j~s>!v>=C{a!ZyuG.f{vg0}L.X):^E3u!a!_ʶW'<62q|g1+ϗM<~nd9 Ǵ;ƶnj-b긘&Q%L./-g;'[6l{@f˝}g]R_{F׾|++$o;$sqlmoV(gE̹uMIndhSÛ~~^} P*f@a st3ƛŗ_`^\Ccă**r1ϙݯqw4 iʐ "="Z~ll'ڜW&}*NSo\n*-2 ke?9sc۶;jcH}}ژ,I3.7J|[|Srtx\m d-\0l,jî|{4ϷmËWA{v{֐LdUqkq )Z,rC.*e+6E)voay6݋ˏLGl9/JL$*Cǫ_2 F/6<qlښvi*sem6R6;k֗1~~v+F0プ!HHMb c:swC韎rmbD2Ǚ2I9k"sژ!s0V2h,ϴl?*$aIYI_!ߎ>gK}O[#1&d< @&: 7V9еkv_1R2ϔ8 A\ݍcoT.+]_ 9vc{O׵x-@k+ׯqvS8IyO/})UD:~;ygw} еu~76/+[l5axȺn ȏz殌|m'ig,L@-a FM[ #a~!G)4Ȁp OrG9E~s]Q rW?#\87 ]?ߴmg<2Ii>F<)8o Z`/c-`,X˅Fc Z*k`K8^0# w |=&̜#KL߬;3ԁ |,S-K%Zϳto)>e!o>AwGx ~N`nf Ry>6rѾʮqw@ ;C?faM&Nȷ{zՑo'<˰-<S0ϴl§I6 ^=gy ;[g5~|#|&3fgYSg鹳;2,+=:^ܖϧyrI_JཿIÝL]`u!>T-!s5 u9 KGMK]|vܓyM湊OBf9 Uo\2Y{KWz| ?tdLʜD\-N'|GCcyqvm̈ȕrC۲]D&ga!y: ^&|]'Iy;G9zEҋrxg)v+_n1|D+5W+*Fxr=9 7ڼBcf=",Mɭp.յ2Wy}s[Z/r`oỦ Ƽ+eSV~Tր뇿myI.d_jb?qչ<Λs;rݛ|P0(ᇤv>+r(ao#&wG.Oem?*y|tqᳲeLɡ32o1j\HJCx|{Bwu|o%yBĈBvt9r}Au %|+uמ')ԉۚ6w>SD %x!|`Y7o}Թ~O"~E0w% IWAp}PM@1Sg%)eVXzl~n=֛d wm=Z '=o,d*ewʳ(L=@G^2z*}f,Pm2_7`,;d)e(#ufI\t N=#+?"uK藓\-QXKerߵ'Dw6 _e{xdn%|{c|.Vd D;<|1_fRv~|3Qߤg>uO(i~,ե'y񘕬k_o̿#D_crًo'PYW^A̬ t}\mMQf,]/e,x^%J Ծik؁~iz |*oGdğsQ?=;J=W/qQ~7ҷJSyXÞ-|ˏ2CCNn+/Әh:ucM΋=r1\I3=wF"ҟذ S:-Ա,T۱ߛ:_+p!҂>'"ʼlmkJ]yu~=O?NW1/#K@E!eOFK/7 _ڬa*Ӣz4nNpW٫VjV4L<,7c#T3H{FN>HCϓ]ZՄG5 ߪ-涽'9cw)[G({W~ Hok )~eYE~cQ^0; |O0X]+Lx]טg <ƍ}OEtx,W %&x2۪s4ʟ¶Gԝs2[wYquR~\1S ka7@(3>e_وc {[#C(:7G׏D$| l@qw~@Hۅ!iĺ Y=*zOŷnX*4~~+e֠BC3ٞ#[睮{~WrߦRS*y4_r] O!|fT);h]rN/cyj6^X(u$ :8X{mk\0>hJ35yu O0hp 5fl[ڸJ0h1 !tr`kNW?O:xcc_ :B'?l} :-N,2'<_d)B'[ hc2=*e"%8GнIe~нYe;m~IG ID+%A J׶lݚ/ 2ՠII{CUse*mޚ1S:¿LG"Df/!Ŀ!|B+w`G 1ZN˥x3߻q:OxU9Nǖ/ H=СS47-r}+3Мb Iai'C.}kۀ*gfR~6a+=Lw]Ks*c(M}6~B_bpGIA*8BUw^C(W~}Qf]V [+8N}K_ixׄMUfG$hInnE 7(o z?S_# B0XYMV6a:[ބmli"Ewi"ㅹNZ4QZ:s.nM$-ѽ-,^)&ECx[<zz9bHh79MR,T7HWYcwա~-mF$T)?ʞ% 84쿷fػ!{fCƽyS-Ӿʎ7vY,hw'{sWs?Vʷ_[mHk٭վ;rSnښY0hi܆~~ھ3G`~#5jZ]<{4mx;׾eY?2&e=xDk>8Zm hgZ[E՞+ȷMZ)2=BOlW?\ym8=T9*q&zRMV3ѿ\qux!_iDYTFemT޵ރ6KJol#g/S>O0-oo H ?,?Fl .ڈ>gmsۨhf۬qGC]?xET-$86m~'h_Žu!]efʼ&<-~&U8Җ,-Y781S,r>Eopk{[!ζ"c DE'S*[^>g[ _<h2c[md^)\Oň7H[o23x.nݗV6OKi2e:ٗ}PE{t~2vW H~+{5u6Hc ~{E$n.7jh5{Me^1rJOTbX::s`+ƾri;}W}ʷ,3ID0΂ i/Cxj{3=R00gx'|%~ˮ~ijw'͵&muG>v"lpNjدa y5G̫tϭߥ{L=z6ȳ/t>)~Rڳ,yTvs'c_~';Ŵ)b'ՍIl нGAg/oYmb Y'<@09 V3:Y׫!1Zbɺ m[Z?XQYK;+mZYm\yĠ<˧q'pfg:l\ڙ<~|kg0;0xmx4o} ?gO?v+op廆+Hlo3wϝ}6+s=#ʣ=;~e5Ox+b[^ewsqt}mk/uNў2Ry33 ?^'#w?i"pˑ2>V>OɲΔgA?>UQA? |[)c~睄ϓQ"d|%~9Gp, .#\ Ӥ\ţ/[RH9؅.| u_ApQ$ydyv<{N7U~C"2\Jn1Ecʻr]\~..vk:+qXM1=;_UR[*-UN确[9<{vgQ]ybFX'+Ft1w)wY7vӳvn_햾w~!|?3^o3c鸜M};.q9z? *kvw{9Ow |+<ŵ>0?v}^wF9rsĂY1KӼ;ϾUEgFrciv 7]`}HzCXО qې~厘Ʊ=e2YvMŶ69GL,8ʺHawsl/$7HriIw6ug6O~ m}U| |׌ zrw ?1$QCwNPͦ=\,b`|<< gOG`{+N{$wz~.qq!XPcs޹/y͛ʼ >AG#W)~:]0fH;y|^C7.]n:O˘Cm3}(ᗥ/% .{9]+!z7{j,N=͘~Oӯ')Wmz2D&X53{9}=/={ŷSgL/\ݓ{2M~댼3g>UvB.ezs/؋^~,^g^y[/^\/ۋUo66Yۧ7Ӆѽ9Ҝ޼1Oqu}Sopo^͹8>6? }Fùz12}8.>ׇ_߇pn0' 뛲'z}9@uߔ(!2/˿Q# {GQ}՗%sŸ/E0Go9z__V_Ăm'_&侥A4!?xg۶=䞵җQ|{)}Ck˟/M_~)}M+wB*cV F;#TqNTz)sˡszW?ᓤ }wT_ _]|RR;& ^8kE!z,Wż"*] eR_a jB8NmY=Dm zNَ?ydnt~]^O'0O)w`Oi'M۞gݳiI.R?{_{O0]56T׼Cumu\_ax 56l2s2Q?<{iS:W7d7k gymn'\'6&7E8gG#ӄ|p8>ܟ &ߛ~&?'_J~nM:Aw5w A`3l,tt%q57txqX}uV_u}`#S+u`%H߬%Op`c7cp`̓s`gK=FfX8 Tzh0F=w=`7/>!^?<`2i?ݩfOB۷>\ޕ#1{n4D4# QKmeĴ#νBxwi   cZ#y2pL}|\GLf `Ĭ*гPbwq)Ep8%|u>4 g`}5ANy 9u+l?9@_g߬:|~;U'שp@K@8=u.CP?'|jgߴ'§ٿg<ͽ-!'AnwW#_ #yYqEpgÙ!?@lO8i9s@!N9N?9|F#x FCpm$<4qt!|QuWqWBv2U_]]5=nx׻ _/e>6ߍИPm!2qJ:(u%#UʃG=kHݳj!<ͦ_xVkG1#y^E-Nn椑sn>L~hmqn#55#>͏ڛtgx;iX=_9`ΝFr?t#%^ 0V7]jٶZeM}]qS+<|W6gy+~L?=Hxyo!?C27lW)dVlf:YD9=Z^ m:F:8YʣM~Bt ǥM֨Lͧtow֨Lb ˟!6d տkG0l1~xuGltҌւ w DŽ֘Fk|Y56!oEA7g|~2: X+7wѠNKAz8͉t]^fM{Fv'gG3;WF+?`̟P??*HQ@ߖ`~巺a$Ͼc;kڼ|qջ'9{ȋcgטhʜM`|z/$co #5VU-Sy143x"ϭ6&Cr:})'!Aٲ}D⇄/e/c=y. F$&XևZ&8[dn B|t}%N :A h&n9sGvH -`@\a4;eJ$cpguR9? 'e.$Խ}%=AՋ?Kk-'.2Wq~wrbPVhW3Q0h`9pw۽o׬^S'X/mXEwNI}fW1 AO&tg&sx`̉,]0=-02?$#ޘ(k{&N+~ ]@$*/M$uk~t$>/]'8Lc'Oⶁ5I]K&i t]l$?Ix~ n&v`ȳvLҹ)`k_oOb+bGxG_"lB[ĹIz?x|3'\!]GwggAH찚p 'O5s`Nf{9f/›4C?Е )$2#WFtq6Bm${dՏGLG: gɺ=pf¹ ]E8Oq7|ߝ0}A0m}yJ0^ޛSc_#<:b1 6#<>܆ˊHSSX°):  纩S?D߄?O9¿lp1Th3.ۮllyeJPc3<~lfSؾ4!.GSX8Ÿ>ˮ)Lk0 X|&8eK+8eK+c5{R0r`.L jS~O66V{gwhbn5;לV ~~` "׆LUQ2-LٔxTkc)s0Yfky[Bxef?LʙStdMevIxS]^".{ϧj~6 -;$6-eS}r4g4^qg4A,눉l?#<]ig>Phf3]&}wჄmwavFcM0='Zz]0 ƺ|Wún¿%Tr:c ltP:Zu{Lx^s"0Ogz5eӡxtS3{h^Epa|zm6ɜ%7m<'LW>lS"My':<3`v2n7}Y[x:le3K"ئCڴѫxO@*r5t槱^ I GO '_NW]叄׸oAgjX0l-ul gd3\#g %U܍3N5}rws/>t[!et g71Cv`^z?Pk3Ԗ*3Y??Hhgdp.O,ԗ՞Gb3yMy5@LK᧥`ዤ-=gξLUc4wSXE4G>[hᦙ2U'pgʙoCvLIm's?O{ߑv  hW(g&QwKL8ϗ 6ig.,-RϰJE-~L .yFOg/˳q ｘB@=>+.Sχ<0o:@O O z `_%si++q<5W]y_s3s 7Kn&Y0-fr viAq ŕ'+OEWdz4/4klQ0C~1^0f+OxlS7;!:vֱ>[:vOֱ{sݗu~cW]9:vѱ݄9:vحc9:v];G9:vcZ >_{ C`7fQs09DzY2em]7ɾ s\_V5[2WlӹfU}t}/ʻQkg\ !]BD^'m[T ՞8WcK^o߾Lދ>>i~+y++ z7u\ v?({ׄh"Yc֙yc޶v"橝'2Oqy`=Ouygc9W~Bp?=4_nTOzk|'<32Nz _#k2g|v6#|Ӿ9?s&bl>ew,`Ȁg3mu_ 8Ol!i^}&-d_5 9Ϲ v,dڳ*%s|>3]r0Yq09`}^<:<}Y"3uσcq|+q_?|4:<a? 0x!C8LJp|C9OC9Ogǭ'T yX^H=eghp~ZB#qeW aߋeŶCwv6>~Ic~HN&|=eoAu/fGSgO.D= g}sSO&33>T~i泻g5}b;m"wo޹8ES {r+ebc ~Gu6|k#O0Ӝ6:޾waÄx#q=r]Lm?7M  GO+m9<օ;bmp%'}.Q+:{"ߠ>G=Y]Dm<}%J^sm#_j_e|%*ؼD⫖^¿7޿DKR{hW{]_F >yrD?eK~MC8u{ݚli>f}"\w9tt [G0_Xw}uTy0z$WpbL LGt g~B}\X۾Y۾_p/+GJT޲>ၲo5Z)Eĕ龗-VrvSWJs_z!1WR攕6Zk߹`!fm 5ŮdẕjK{JC= Kr?CsZls7ّе w~T5+yFܶRsVs+N&eQ3}+kx?΋jsw'>^/ר5jYKXTZ٧q_&:\y;^dݾW =YĒvKpxY9ߪdP6d(SG{Xy9PnGڶLJo&S2& emMٓBONmTj)F |7Z> .N#Yk>E䥄Oj)&gWgy$yM >3y6%Kt!x> w?]if}ֱlr:&}} m^*]?Fx=׃Ex똦Y_(@bgÎv:9{1*w:=.0S|vѓN}.6A=7q(sK%|gֱ"xEK~>|{Ҵ/֩uJ~#|̟:#d 3..?LLПEV7ujw^r0LX֫?\W$5NJAݼZ^>ׯOyטsK/{*'n&!77&`AA!6D "bA)AHZ;;HG@z3sO{8/{:;;3;;YX+mwqO1M~O?6vt&<4Яr9 }/h)h1l:FN:y§ j[Ӳ?¢۶3?N! t@ |6LTGˮ?CۜϧsP9OChk_޽ukidƍf~nE9+Asf=+fg|7M6X{CJZ Jw=r1Yj ˢ>hZ>h4Yz׀WWC域^&Y漆fR` Eqsy0v^ ^z3 qc{ d f;;y-i<4SFt#a#k58^->qa9dlĐhA7h$10u)&7һܶD+o IئyްtٲNkp&n+Ϟg9Bo}_eZ_7U4~;>?>9*3B_cL>170CN'\c9Xտ<"hmM{]+'AƛSR8A3O:~8 w^.Arbs|`/4&: w810˝풠>}ԧ|hCr`/ϢϾyE 3<ž\ 3CRp?W46\i C.놕f2u{'LkuAoFiES,A۔a{T7Aw^\5 }3zK]4;-o["Eyx,7>Ic,o>}[&ӌ'L».qXOx/tMdoq8L8O_#| Og"|I>—'|g=^l0w2됯?'| Dl/K%M L8Wd3zWжuŋLW,^7=g,0GN\ޠ5Movu<%8_>m^]{{p҂Am Y^Sڅ$ "elJ{:QyB{~+Wp/|~+ׁ#^(;io!06[@{i~&SxցI{ʅїcMe5;7<̈́q4~Lcj&rofl囩=fXmض^_I ye}un&so3^_i .ʼft'%2M]i\6"ZhqBrf3L(1n@'9D=[{2Q[O[)UN쪢|W3Dĩa'(Ӿ=hi=ޠ#mu4IԾwHX?!_OEG~["Omko{E~;&Nrow+$wF2'K$3p)$wFKWw$ѵ+'Ob$L$>1$$3&ItM~Irg$5IXG'?-IO;#˒?M;#`L;#ȩ$3r1I$?ci3g/o%<?>Ix J5_TՎNs՟?hs?\5.Jm|;տסez\hL,y<%v7ٜW~+y.+ĺ؆~Ox ow盃3l2Wd ZZrPH E[h\g[S 憿K#~#<޲eldϷ }dh)ϗQoy.uѽaQH+=FrmKY5?oR~Hh)n)NKm֤-n)m@KmZ*mzš'ض^·rN3K+x]Co[^Ew[P67!7bo@xoi 6}VEV7V{~&)U͢ u$:7ֲ.mZߝֲ2Vm`mԇ6W:0 %Y14l#6;.'muy-ii|dvNm#\^@{̽o[?n=<ڞbmϣ)h{0Ę6Y^Fw?<<>!}o36*Xgn|8wH[9ߵ{iV5 mt[m+`o???j+SpM:^[z|R6hS}͎5g8X[5|Z!Uǵ{ܟǣyaVU^mWn+sü209,`gy/z\v^i 1DI/K;'nf3R`nkvoR ͠>v,F^=58o7̭j7 fAtȿqF~Tf;]3ib.;E{ nyᦐ-o/~lA9d ^d'6TP;%X>__Xyaθv{ & ;g[Lm;­v!+o$v#v45³ڋ{^mxoq^'ZW{v+^J};r;XfyZ}0O^^ ګ=co{9oq|y ypy~oW+< -gpZuYz,̺O6꠱@; 5>e'<єOx)<[;9aS>)uS>ᨎ(p|G؁f`݊n%{^ʄ6}uK.[ޙ}ޙQ̚F٬}#uv壎  =;cɏ= Yw_psA+Nk=S:wԻu:)1FDWl<^^LgK:j5ն#b~s,͎Xy=tv 8ao'yi.S'a¹;!8ob4ON_'O'b*K`z7v {W}=#f'+o;Of}!2­:ԵI:^ܿC;ոNjImB ;nO fpo 8&g7|$+!`ޫ?멛ʇ?wS!^KKo߰Ic?½^89H+qn:cV]i:fx&OnjcMúiq~:JʙC0Œnzβt[i`W7=g9 RX?Fo>u8uN~W[|]ZÌikz=LGs0{[P=-֖=-=-=4*O6Pε=aG}P9_a40}z樞_|e#zC=e9]z9ǽ"%|+wZ+~iLz].?! =A[#=p"~' 2~SNL{!󐕄/35u/=A,hlOnT[t/^3RZKhLKr;:z^‹{/9KTU,x/9-K#>簺9#@_s(Wl[?_׽9+󷻯9+9G?sx9T'~??6$6~ⳲgOVYy:M{s%2ƭ Gܵ+{zovu0K>;٭u){<&]dg~K$+.uOV"|r<_& ?J~%|:OBi<]鑬@0`i%dcY~,ֲ%YXv%d瓕IV|ox/w]$|J\t3wֽ)ƥ-w#6wF#|çW_.;3O 9W'򁦲VwweMQE~*Z HѻRT}#ETMx?& G]_NI-R^wc5f]]RDcx58EN"R4>l118Iy<*CwGKQrkH?o)E/o٘,<cD]H㕎Y49&Tg0i3<>^sDz~=GI8 [Ycd :{{y*A8~svAiiڿeY\ʉouou<3Pm'o T߂/oAbC羷~Ñn3}c@mj9fm[no T{NAdq9 CAڇ):H$ni*;a\0D(3v{?D$6.5uàss_c@ O2Qz(XSO~$V?;Xjg ·oǬ58776ڃ?~%\5 @w,|NŶ{gxߕwF#Ƀs#b^mV ֘8V`Ӟ{qxB߸!=D7;60O“&=}/xW>/PeS0GϛCŋ?3CXAwmrQ<&4q.y,>c3}a z?(oˣP>MuS>U7DeʨT>O}BOJeRVH7>Jf~yTs~IU=Tw !!UeAcǰyʂmSuO윪{brUSTj j Ŧ|~0>J{-_Rem^b;/q;*kWcN1g2 ~Z jLYaO-Ss/c^v:\?ȡ?~p۠snY?.tUs`:>lt7.C8G7pO Bn}tp3^k|bC?0zp}sp]1#gp> _| ˎY}ʏP ؜sP7#d-8g#k&d#~}\Gj|Gj |ٰ)6H糒"٦KL97v6$)EN1N%9^[S`>(7.>e9jʧF|:aʧsJRR}e(m4^)mWD{zI¤WciL3{Y=sE׬}v_'i!$ĸc6X=_ʆFi&{qwMt;A߀uu⸶qˋ{<Mu=/]߶tqˇ-9SoY]bZbqKX4L<&vLaѣچVcxuc}409o~a1n_'ӟA0cmߟY8Ze҄[b v8nc"ԏ;Bpg BoC;t{BO&|*d @Cx tǸ߳B qJq9?Z?,2<Ѽb@kb&Hyf7)sg󨘐wr1ml TE!9*sLJÏPcDvd^) `x|'r29#|zJo0&46Ly1YLJn0ScV1zwvMcqOqL2\cQۦa3^6~b|m6w/q siL2l" l?Y{*gMYcJsF\|='0Vω33<?@x(ZNEzAy/ck)7C=41G Ox:>FuFLP[7g|St癍hKvCKLиqe ogl$3<\4oBrMPX J#]'(m mR'N4q3&Ƨ>bv~?Ahdl2o:vwHOؔuv7@U{`sN3S{\|gQd K֜_&D}DO=<DA ?_!W 7(MtqlK'qHM3}'*t1DD9ovLZvL$Ig^7IҙgE:Ff[4aӴZoWX|WH3`&ͷ s_qmf/YE"|nH_h 5aS% dɒؕ7>|e!'}GT2p*>Y/'+:Ye{̝'[=폦㒍-@,3}͢)ʇ2E$ * D8Oݓ>>Ew<$n[&)*Uz^/nS 0۸OQ:cuvQW bJ{E+CNcʟe󼋴!9|'/rc6}3a܎>wnAۮLѻ QS,00UulSe<،<ڞ4=fl7RWxLLSe} -S?'/G wZwyJE;Cǻeq1s'4ne5I4;D="'orj+:W^_Lӽtki,)n8y~l߬;MdFyzaWJgi.g4n/== ooQrGwؙL <\\iz~ۘy⹀ sucZ=_E= 5)ߓi,e}.tY_U|kt1 .|ltgrӅW;]x~g2C|! T8g]oY2ZCljAeۿ}fXP[ Oh_X"\ ,$A_!o`uи/gof'ƞn#t/{gKv#0)cq|a o~?$&9G|]=3E3៰٧r4I{%H~{܆Fg*v t1)s0s˾Ëd;ѧ^N)a8dę:Gf*,ve>(/w!vK?ķgNx>d#)ƥ'G~f2?@BwD)p軞I:Yuk2[)Iiq2;<3[(`^{g+.mB5%g{p+~wWQѶst#\sǽ8GVyֹ{=$g$`/0;GƧ<:V[`ߌ??b`n#rE 6<2;Z|%D2.V{Zt#\jUCԃ}s9h:WVsE*=WTU?sOu\S]@-;>[pggKly}<,uj߇$&5gwx;5&pWpk`vfly[+|iQ?̞a<]OSz5O9|<~XעbUzp?|'Wd? rU_ti5j};(-jeoW,օ OG;zڧ^|gɢoÃh[~I|90>b><`n quYGsŶex,.yz,}O,=u ў҄SцJ dLxV÷|w^ 'x!sؖe01X׆,=4s7{1nK輭]2j;ط@^2{|u@g.yZv!<&YFk AŅzꣅ2>< ?1nBxShycg“{#?2/g-z0+ [1 '7;J^QW؞\(z c{m<iog"'`x`)'19n ?(̩eSf{-="e^ ԖQeΰhoHgwQQorF]s jV;Xe?ʜoyZxQ"u _>B䙾Hy_dy_f̻y՗eډc`ҷ{\c7vVU>%5g\ؔ묱^yYib?l  igtU[XEb2/VyjK-Xb!ywgWc$0isv"K›} !26k~{2}BG.d]v{|vRыVv^X`bkCx/m=ye7MCMfmXϤ{':Zж[EԜZ~ș ?KqGd~A,%\gYx}b=e7yD'C9?U%zw1T//ј LOe_c۟BOKdl&K4V] :.bz/QH*rikτ99cYܿ]w܁ '/f09wcY;_h/_Ds3 VwW)%ztsEPKOcݯcloG KZշ,sDŽ4ueةbK.G"i΢&dP~#6T2iOeub˃_/4ozP)?s)c RYg> |fO1_D_!;hly=J蒄ź걡zgam_ *J}ŸRMN =C2i|T+Qn.VהV]W/RwƒPFC5xih pw`S \l_2^Lx "Ix 6$M1Gx  i^ƺϮ{™VK?:vGV]ϯV(X}:TnƷx/jD99Z)%KvXަ0m={<>u͞Zm6_/'t-qwomjލpVoe-g$g8<Iz(1$1 9a4  eM!'_`=xc< ܖp஄ `|`4ucAs^\z*wnm#|>G0fΜ?x X~~p)CE '@@/潄K!6XGTE:#>#"Vn+P&##?he'ÔOx"=#¼5+u*XOTvmNe6B 2dzWXnD;Ǫ?a:>4%="K:!z OlgHyJ \mٿkqk^ǭz{źU{]ׇ6 Y;^lF~ҿ7}z7'3}s˩פT]Y/qWXWGgX'A{PN=.ns*ی3nбͻA :lб}&0Me`n,1SC 2s C3sl#S>ᱦ|SMi6 S>CO _6kʏCeO803G)`$4ZlδП d$)~єI)p{`G|'pҝ7Lg2)RS&L»MۥM 2m&#7]L(Ǵ,t>ic%Fۄ1#Bp#^$s| L׍o9cdoExSNވXτE' ޿GFy+a 'G 6fD &.~~[r{@xۃ4 Dx!'/"n%b Ex,C^Zh-'> cKQ<#7 ǿC8pŀk=! -5¯mF !|K/6 m& X6>ΛNV_ ݬńK'"<wf82 gx&C/,|w3YC,oA{&B"t* h[-"[\"O.y/z5[?>z i:s[q ]ٛl߶͊3gfcv:[Xn/w~:]`ջC0V/MKvhrK6Vs |8':a8?ٍu pVQ_F|zuƒKllDߔC۸[LVT۪6:[OVUwU,:YeK14:4:4֢u[u^^t5 @MƘtjkl7nmү,nH7^&e> wgޭ{%LwaMA6{sE[o|UAasce>k{~1v1c߶ڡvȹ1^}TO%X:f7P;7xw(NX۔EŽa]~V"pz<Ἐ; w$0_ ~o5pE`;uکw-NSBm wM۟Sw;*sU&2N2}i;gC)ԛLx@2] ~wʺ`BqRɝ_7(#q=.y+6^Qx#$6>] O]] Ǭ "rHr嫽Khf%Ip+KL]jgE8)EM2|?-%c^e2]&.'RWwL;Xϰڳjφ]< kc_E{cK 5~YZ^ڦuxx'v}{׾oOKle؞+|ݪnK;eXm6Է~ٸ^x;pK4d cvNߍ7X߭xWV_mx0C5&iDry7lq\{p'Þ\{{t.#O$Z%=J]b8gi{[;TN89xeMs.2xUBq#Kֽ"{Ewy}^]ݥ^]e^"+un5ܪ>xK$\i>]ӵ`ݤ}:~ѻymv٧>7`OާoA.ۧoAn٧3{}d~Oؿ_̶_hϷ_hl^|~}~}~[iwO)c@ o'~}߮~}߮~iaƴe+S>Q|3L m3+S>æ|§M/ʔO8O80ef~ ϻG}o)w|Z4 i'̔O)ߝ2o'<”Ox)4S>ǔ2^n'ޔOx)?|MϘi_7: 00=Fww_9pmʳot$i/ D>K%XmcV_UU7oᾳMnzXy"G9v@`s?}9}xXkCqI$Gw`VQs`~Ϩ={F] +Ge zk~ټ{{Qàq[ 22 [~ P ?>۔p5Ȓmw,ЅߑO}b8.'&S=~1Yλ d9)zФ}iaƚcX>6wO8*|Jx:S8}VfŹe7n,m.jeJz4MU0tԢ;uow Dx!oGxq[]D_,/yw8.˭A:ڸнӤ޹ fP«gJ'x^@=x0VkcҘz9&ͪaڹjzi7 %ǞôaSMɒ]n%=z֓:yO{pތ)vRu oLp[6pmq!o6*MT 4 ]튻?]튻?]jYCcFd)j[?E߿qRN5dzIygܚָ=oߜT[/'? $| st1|6줞{hgƞtt<]Y}=0V>'m$m+> ~ O]Iu{z)g&% rX \p!2:;Ȅ_8%rBۨ>'z;DŽ;5 NZ&9)YGRzwš+OiN4JSuvع}HfY2g{O8ŔOx)N/SǞһE;oY\O4}Fz g"|#7|Q#kN||Qw8>x yOyF%`ց?1&!>W!('bnb1Y $O:bh?$ݛ6&23>wphiƜQ`֙/;:i9x`~;/OƘgxJ!\8{W7iA~goN4 w6IL1 6 0 /7Idޏ6L_78oiSc%~MCτsA!"fpX~+O٬}rr ڲuvJgoH !2yk y)_"|@2Ψ! c\WBW-䵤3"Gp=`o/ Ƹ:wXq{u s*ʘL63捄7nߋW㹋9> jgf`fϼ1 xKHgoz>+6IoT,΃N8/ߜEu]5&H^Bɞ9?T3iyn9LӛۜUXK _>+?s:G^1fzR[G1m`ŴaYqzACg#7Vh^oXm8'-!ei|[|L3Cuxy@o-Y/Y|UܿSd/󄳠׀o9S9s*'5^gCmvwbYsz\)7>g-v2Rz.5*ǴL3pn[|j1ilK Zbɴ:*'<'pN|Ꙟ=9L3' f|N"ϫRyx \1Jde?|PO֞%0~OVE_Y鼾y};g;nP~j~X|4 x0εΫ5&D[ysӁy.=orlfQS>ዦ|‘P~,&S]z1"~}:}ys~ϯ}nmoha1qz ,[yct'<{K8E УC>)tֵxvY߲>E}&yS[%›zbIn%MJۧg 3!ﳗdOaZ+sIU><5KngKngK?_ }o56K3wIK.ǨKpK/i|5tl* 2'&%5غ%: ̒A/czYWui0/}5_݁fKp'y؎5y؎5~cM,˲&x'\/k+yĄw]᎕Lu2l0GG%•콢~ș>~y#W$^">A{Se=}GsE%;gU{_!Q2M+wm/{~0ۿ~fzC`fF-@.& xD!4ߒ3,5Jo?n3O\A — m0^b\0IMOMK 4_cP*rK=AWADDμ}WCDͫb3d{lc2-1> 97S4T[٦F__fIkZ2aWş 4g7^}cU^w x8rUχ>~ iw7˷75Nos"zۧvb hpk2޼U#~Ϙ?ykzf}iq 8|5zW9=ܙd?E^xt] ?FM֋!סk~9o㟼2ym]*Þn:왿՞Y/6Anl f9m+n?{S| 8FYw#ZìmQK]kjՌpKȗ7ס9 (ANifGx?m]ׅ3}ڏz!C ; z]ϽzzѶץ,쿮iG :{[ߌݵ< VӶ 7doj+I"6~^o蝰*7Ď'?fƭceGfּ6ﺄ -5&/ =4wcd7 ݬ6tF:8o{ko,).y7iOYҲ߲ 5+l$۬!koHnb 3t2ϣ0߼6,J~e!~<߅byo*?Mx%^$<ﲉbyj 6+1(}SƓ 7ukXֻ̤25>q;0 v~3Gmn?a ޠ7E6' 3P&ń++c,̿Vb X<={}lb{`2mf_'ᛣ`~ޔ9ІiV:/3Lk^fR:yIa³jGpyӷO򲬴B[TᖖW1zKt{,-Gst FdkKi#{w4AUep8=KLK1cϠe\ˁ^[,5cu*kW궎cOy'akxsgM8_Ǫ[㌸o@ 'Fx=l|[ݖ#N`[fdw.!g#I-Dx6u0Dgm9e-o8 os`\ C_-#]-vGh?@Au5-(Hx'^;zmw6c_!莎HQnn`Ꭳ=lnoeZCPO]\wjJ9'X~b_=]iߧw+p]ǡ.ὰ6&_w}z]d4`=2N왃ЗA}9Wz]#&)w5>l‡1V*yZ3h6&3=y9|WyÙ;]ҍC6'_ A|W4rU=d73ϳk;gy߳ AEk-zS즕j%_\\$6ksLӜu g }pN OYaasƱG2RN6BLOEhJFh^fZzi0Yp_oOCa9%07pJDc uPtɦ 6^c@x7b)IoE=s3?) |p `^3v0&l{Z\k,0C#66>bqFF#'G'.ǯ3zИ &fHpx(]㹢tMeˑ aC?PW(݇6W&lWH׾>tt$6?q8LJ68u}vb̖ya5D}ڄt.(Lu8/CD{V4 Z{pޠy)!"M@8'(^ | znyY'ƶlƿ͔ޗ:ԧ9lZN<% Lj :_3(m%̗82Y2/ gm 3 p|]0er/?᪘\oF0HCvZc7>G|):e1{G4o[دc<6'[F+wV[C\}`@ևm+Q׺tUףtw:z̪{U oqH[OXuNHba~K;<)O!…A? z^ l_h}?Lܿv{g7DG} ?pnQagʩGղxԋAGdž'Fy}N5uCK2g|k v^nsΈPLw3xuBTN>潕y$i1+n*a^g᷄ \N@ oQ 6N%`O Yfiy#bf$aבe1(x#Kޘ-pEC1ßH])v Z"&"-ҏ1"0OhHxy+O$l #Q9|S;cT?x}i]Y >:&Ycو Ҟ%\Ÿ}oW%\ʷ!&c[/VxdX<Ή_ ܎[n''v@|(#Wy8ύ;wt5*-Xϻcf·W@;Y\oUom` C$Fev¼O@cTHQ0Ǩ|p̀~_;g,#[?ˀϾϼ)^ײ7~|{Ol5["?Ӽn 101!pm/ 7 #$?3 =p@t{8)5m9:9gqv%^ Ķqa|fu/Nu;r;.g-,~+~׌O4}RHH5~Ư)Mr1 V pz ¦ 8ysJ)=t_m0JGψs7l/kO5œәg佽 Gۤr8m\9pb1qۖn g`ދ_7n*6=? E8ad|U2V{'~+;1I =(9 >Z$vjg*P;Syҍ^ j'%&%2kEǼSzmov>򑐷=1~:Rh['}ScO!/!l|W3=l$gk{ w=!%Gە>7yɘQ$'=Tnʷma^y("F;#΂fT(0g4v|N9^¿@tdu$ i08cDZ솵,;lfmM y_:lt$Z|~=l<ұHǞ2Ī+LF-#`ǓT 0;Bg*+1y(}DCJąe;~M>_>=-?N x qJvV6>"MY#^_}z͉x~I.B !{!{-B;)QA"EDP"RDQQl;> /}oo}N۩d~Kxo܄cSU"F-ؙ`5hcNznsgtwx< 0^`QWͪg7A9Yo&Yz7Svo1>65㡷Fs7ΣIk>ĘXM>f?'}̽ظ 㥏n И4Wå+00>|vL|RTЗ<ڜ6FѾgK|QYǾgS^g0Ed1T^;F44i xzt<}=l ٜS`_%~6ûWQ[lNlٜ~Z]瞖G-_{3;~yofCXܦZ95":9yo?|{Z \Α?ߞim/fŲ>`d^G zC!*<+<a:5C{nͪsxShxti<ҾozSx=; e930Ҷyέ#㳑[Qմ{;M nim}+y?\1a=k<4GmS͐xOoq;w}ã`/³Mxe]g*>'s^;?K>੹2ۋ[xH| =i2rndcx?nU@k&Ms3?әyrAڜ㳲:+c9?+1~+1nm|/ogk>*O |#OUevSʏ}-`W_^ֲxZcT߿~{)}eZ8O!@|} I0oY y˾V8keӳX-5~aeF毇I~;sVr~_AQk{Y㚯sh~K}NOXzZ>d }a~p[4h^^_-a\ԗߚ{OŴ1%cl6#4 Jf{OBZ|SyH{{z=ޣyg}iv HuضQt, :} `Ƹ* zܦ>: BuIҮRU ߧ.γ\xMKxCW D/ ؜C(NsӋl9YǐB 2]aZ} S>PdN;(lZvʞ>İIͭ8Q2 oֱjHp(yy(pv@+en yx@ 9(:ӪL~yE}~ 3^O9c۪|mN۪b[UV9|S+(4:!M{iݬ^¸(فsD`LATjebYX]Q#h`_t\daVuva SMHS =Bt =I>0/Z~LsC _ ʹϝYcZ9tUlr9ZP>R ?hf4'DlCO?JbXxoyY މθS/P6tWK&yWH^sioɬRY{6*?x;T#A˔M6.l&øK7#k!սL>;q&mZ  P:Y^嚀.&(tB61tAz T{ѝT9Ν6ꍀWz{<lhšT7 û1|[P_UHdCppc3x~76! )Lz1O(cUbp[5.e|K=o{+?:挱3hw3czR03̿2X`w f6'r*X`[H>CZqoQ5 ,R{M=c|V_c}΋  x3=JW|0n_ff?/lsapMV ,,8_䫦Ed8Hk'kwRmć6y2ه%KBbibCnr{^c憷VqY9 XW 1D6>mL|۸ܮw8nb59a1fʌU~\7|Gqط>mN 'N|pҷMSo_ΟZ5Q扇&k6ڻˈV[?~%>JCztq9OM,.2,wcW_z+9{^9x\3Ņ&]pDK|/l..:ۊT1M纾}su{DyHc.N'jBGΒ1QfTgcF|( 7 ;L}OvCK}ӵ$@Cs9WQ6W\+fkw*AmTmcJйmF :%sdF %V s|T)AvdX˗$;c߶$[$YȈ6g%EuU|IYsh~/hӭ%e`SAy:tCz-ul`s/qYK'١E:^R-kTJE;߅w#6j!Z|\߲?'8 = {MKN??~7. 9*)dX}.R׿K5a_ j؜?L|nvc3i=N{B{Y'tcqO8ClѨMdOk4䵲Swܔo)%e/\[d,esq/}s0 *9w8ErLÍ(nmG~B"B}{_KNb(-EJFQg.-K0XI|Q^G?dU>ƙR]*UcLrU>t/|Yp3FВQF_1߶b^Q^ ӹNx*iU>UT(壿2c$ #]111FYEo(b |[V|YSTw_֣eŗ*|T&?ce-}Y+2F`=e019ʇH8Ex*QU> |TS\1#Ubc5vfpc;Nfr$Ƹ*7|6) }Az2F_!$VU>% RtW{jUF_sk5+5wo]nV[_C qg|Rxo+[⵲UWepv߃v 2Ģ[_tE 8n |~v^Eeh[洷XRń>S,:??>4e@Z_.|cܼ*O(+ex<"5a 8 v\ShާE>ME>all'lλ].o'WWDs(͡hDs(̷u~f+9ZxKw]IBrl٠T~ʒUeӟLɌg;+bJnh}ZZkdl4:Ҋս5[۬naLOWjeyt:ҾB"Ze*}[U.1] Mu` Vn<g}Gh<||Rش*s$UN&nte%clf8fc;Onk'^BUڬֳif~oN[3:/:SQ{fek+kU"=q!x;ى) xىix}v^iҒ{V]al5c1g\)?Nsl cMowUK穏~-Qj^5'9}ǍA_DNyy5权 N5޿Z<'{u~?c36`uz\l8q:k?c?P$ ؗq% \#תIt5psw|$ހ\1gO $ƨ؟]_gxz/C&|p |w+lF7jQ!K0\q7cD<~<k1O x3c`ZW!a|kѼ}-g./Ujs-b&`w.pݱ?;A0WmE,a=Q~9֜1 S 2GP( EEŁ_7~`VmtGmOBmOo2F>q ,uDSGdjLDU#2u8ct#!uD^SGeꈼ,y:"/;ZGe눼z}WGeyY"/+uE^V˪e^ Yۺ"#]WddꊌlJ]ͯ+2uEFު+23uEFi]ݫ+2?E֓pYyGWsKֳ9cFU'19 }ޢaۓ1 3Y9zDq|g16HQSds=Cog3~ROnqQvџ3s|Ld|p\B݇RQqRDPUE9W~v?v8ӯ&L3lG}ܽH̽ $^B_@]glS3vh 6W*GCrb\1ϊ~ihs޷d;O8޷ SW8'axЦ!d&_MwcN )$aS4;~\E c 㓀#74UbN\Ξ~ڜy20g#~L΃Egqyڜwhcy5pѳ6R_iY]{%}}C:zPC xg2_CThø@tIDG]? L=SuA#thevn@{UNK_աmr{* S5ͺϧ{؁t>_KWn&}qӂ''8~Pּx*S3.P@cAm0'b? Ù ?aB  ;&g3F,@O*hpۊжݦ5H ~5!t+,M[{`hu"7!<IDZ^L;ofz 1HD7HdQc0yٔ1q]ukD6wbhD:D\8dDA|E&lIlJ#xں'V7$Ƅb΃*w]<:H}>s_)cdL61(E~jN_4Z|xX›M}7;鯌q=|j3qbq쪇RӖ^6ڢu3>^hwXk2+\/[/g`q"CE3:T8kJ;WKChu?m_=?[˼fOm{]Mv*~+׭k,u;:<3*{yc>ϴO./VTטXc'4z1+Uca[Vc ?l*EքO`r~IK^|%.n[KȚ~ԞYڌ\'͛ =DVpFOG{M\hLVګxq%L.<`Mv\=nNo+M@]^.)ZpSrTڔdk횒lmPSkJ6 MSyQV{qu y:es||x-S&9􉿷s{[Y;ߡ ʂ;/ǧPf-ΗP**>7|ޚ'h ;A4n#EF)ooL@Yni7G%:Ǣ .zӌHx֛1 3ôrB6E5Py\l.Ͽ qDG-띖t9QK}R:m)vZ]:Ҋy{0LNy{x+1L8L/׊| c8?_5e4y6oEiS+MZld`{X!V2g쟅eYcl-.JZJ1zx͌=\PZ;3\}1;\檻cvUwwDjs5G$ԝSXՎu4,p5#5I8Sb93@[f[m3$Þ)c->v"~Jdw[˺6_kӷٴ-Zd[Wbձb51ƌ_qcS7ؔ0u16 c2dkK]{Z=a}鏵'u<e;،Fp,FxRm(0ֹ?[6[ǾFbKD;b~'FhŚ66jcg33ƹq 9&c8\4OEWSTPw@fj{s2z:k|Vu==\cO1^ ۋ^y{!:2q^28m.hnn V~/muu{]n[vLvygrڛ1ư+{x+ַ} yw$y 5!,m{+v);?ړ/z_#q>{ 3 x0\qw`pIpIW{Bw|`0 ^<@x*ט8p70x?㓀32ۀo1~>c#sw<paN~)*~p}Ʒbl*p_UH3N#?>cu:i''jm< I;pg7ux+:NڝdZIݝXXwX vlީc=,m `c}?pQ4%qr*YZ%;Yb>:s\}Oc_,<.^_\ .g@vyN,g6g_:s:`<.cBg:wa{:8~igU@+;/Yx;_y3aO}߯j9=x[ ?|4V?vz6v7OٽL-qP~L"b]d"sUo (ic/mXk}-Okok;nćM.t>"~㺈hZ9-%5Üi)اzۀ^1Y/7vχ=gWGJbnTʶ]⵮t26owŶ *m2I])"e$[+ل`[V~mUS*q:wY౮D+b2_jE;?~Y+ΓiwӮBҢC&}\!] /QPܞMy0Y pNOׯ_cI&}m'ur~Z< [/4ZJs~'yzo&yc'* 3\\"얰޳ٴ:gg|KospCHܤD[n7\vsJzSݥ>E9$cOn6'64.a5=t)ɞSKi|g"DHO0=Q"D{Aia9ûzCz:ڝ&ĒD7P?ƙwyw<Bu/V-XN_އuIwG:!W⃱=H4A}!wA}݃lze=v cnV?{%KO{]+֥hOp-Sdz_MhO۵)z.cIXrJ)g=̵'3WA(kCO3)ܪmVZNiuSn_Ώu'Ucflruz܊:$gŞؤHr'زPj4~@\éj/Mro|WO;W7ŊW?UFvVևWwۛd>Jo¸?m= z$};-}Ї<>|>"GC^UkQշ$?ax#qF8# H1>C>{>I ;G>3 <.{ԳK={G9O>lgӝr;o޶Axۆ>3E!4Sڏ 2A'yAs ؈5F+'ξy-hEsS"wRHo}.#9 'h}{ΑS6]KG}*WFWcvB5r/k9}Fӷ/ks8}2#vmخ@x΅uO={|_ٳii{Wi]{ʰG&,Q.ߓ}Ӗ=2߮X7ʽJJN֏b;b}Iǀ~_/ xM[~;Ot#;o׏ދ1`z3XI ~Ckj?Obo'1xZ'I<$֧;yR\oQܬt$?{Ԝc_;oYN`}Mb_ӲU} _5q9ˠhǑw%~ۣD ~/bOm/sr-x?{3rfimjm@لWل~,o@rbB N@Ӿ>Է7}"o=@SmXwY=@f4@lCk iW4l|u7T|?;}Gwq+p4@>F!0὘ Qp(}g@a>iߡI@o{>?2x9P1Pƶ@2ʀY^k ƈ cqNM(sj@SʜJ}̣77uyRa-H_; ;_~A1ߋJArw0c}ܵ}M!~ˈ4uO9ba {̣I A3»hUQ~!G?3Yl x.c4(7HI}]h0~Ad6([(@0w$w$||a'Yw~{?f~Vk$'5? 62`Yc0(}u%c a_yeИL>XVK\mʫ ~5f1b_.MSe,p`Ew16hMi J`̙*yF{2ƹ1bCޓV:1VBt2VC"c(Y!r2Ľ\M7/rt2!W:c"3n $}>!'_|p{ >=a8m8B *r~#MPk Q*m<+͆ӘP*OVn{fX|:Txء y|5 F mڏعLiHn20A Zod\vۃ3ӧL&:#a ,7=*"4F1R30!پ$̐aU}?DU ڳn0L|6qt?ƭX6EؖmO*\yadbʼg7y09O<0!b8C A-3.W߃BnJ0Z#0Ox&jp2}0RhE: XK#% y.tY|Ī\E3f~B3Zi]QOZ[Q&׾%zgR~ b{c !~E8#~=:ddˈu1r?Bx#$[{c=Ѹ5"}KWY3}IkO_!c4o >=Hen<As?{t_~+CyLbDp$tċl;R`בb:l.G:yU‘mhe)[#wG4/u:2̇<,@ԉEHǀ_p?s]6-nE돑DsMhEx#BmU{8໬+-J]SjS7'\;M g@@G˸([ M+]GC?<-mZ9ņ8~g u8M.9J|>[dľ8J f^&bWH=*m=Ӵ;n7sG8Gϰ<q(lWc5.C~-!Ga~E<:?3Jd/t.G y4Ҝ_G(AbV Yv0~֭CjxC^-wb1;mcI5'zy>CCCgw:%:?O偂TTbD{Pk/64bG!Fδ|#9~#k)WF{FupxQCemEkK@Mm{j;Y9]ޡُxo.\{s='L?`__e}< pn_a3w!F3`hj{}_Mh[6jD>j/ɟי(^]+vぱK_T)Ξub$@?+%9g0c(6}Y} ?k_<bi='h&'W7}@ϓPWbź#^7lX %{w!V1Ċ=g׹+~%V?¿f#7/9{k?e?e?kYq1rΫ2F) ?!}U1U1t6M`KknI3ЖhK-U7#c_-gҁchq#gc 4odz}un"s#%]=VMǻm{r9123%_wrS-NcIVƸK{gZ.Q>aq/V6SV'2q"Cj'2CGr\HΎ{T$ƽMm9'HFgǑAaTڱBg9ƆT끱b9;8=o{Xq{,,Oϒs,Ƒ87's8w'zqO'{q⏼dآ'k8Y_G:݄dF;jKɾ8PxFx .tfg8jga=M: \9y_<}9=A7=o_s&_b>yd`y&irn޷C|Н2_kaZ? \cn7r<pFb(3>L<>Ig#x`:_Ktc?^"W'"m/^Gqwoo,=1^xM'^+6 irݬ͖xWs/ŧ/KB+xbw)3d)Sq1D'כ,YqUQr'֙,grn3Y'XҥڳCg$z]:;@{!q@~UX׳ (mЇ1+JB+ΞՌ1ZzxJHfX«ܺFwĆ^«ϵ23TM.;8 ŦVa7܁cjJ("TGL:5bī0Ui%|*lJr`O|y[֮pMv?k=[`|흂oOMۖoj[OnAg@~t(3y?N\4q,l=Aޜ_9%2&SZigQ:Y43aU?pG#GN( gX;b1c3ikX&Gmجۦzy#}S Zz G7ox4 k $·1b4Y'\b c !Ɛc \c{3Pu\|1̹o"#C>Fv'ߙm=\\J&/?=;rky;mˑWdZ rcbNgqLt8]zL^t0|^=]6˟e'sTP|ۧ1Àe~qHNKK[i?tQ^3hn>Zx=?2k;xަ3ۧv>n{}Vca 3:op3ҟ{f-wm܁c{rb.H;xS͎tg3Sp.Cz_?;r/e'VM*Yjζ9p6㫱ؼ00p60Y=G!U,4GdEHL5]Uz鋊[ʉc[sܯsܟD9tQh=h퓦p>36m7TR戾d=:#9{|ĎzĎ8c~+g}g{#iژ>cs٬s 㳾]s%Z`t/(}*eX[j>sǻ\+>SU~/r+*?U~T~9ob~U Lfk]JY| E}LE{yz7ջs8K_^IK^QOG͓y6Ў$egCn#z(2Odj{b훌|z1_vG77帨_c9YG 2WItl5.xiB=aYg l}&,$[-gA-y(N?Xm: ^anfjuPrƋ]]SsBgaZq<\Fd.eOT?uy_ơqLkϞέ$jZ2"ge':->~U7 3>bvZ^N2xn\ı3QǰHd/KIl5dm\$7v-^"ѿ 1|X0>^_-J>?w=2}αdO,M'WX._n:]M%|qvz=}b:sTø=e.g|uZ,糓)/ηK=x>XgwTxOb0?39Q|d_>h{>O=򤵦ZC'̱D_ '۝b8$?ɌQ1ծD+؟oM$7(1yD;a09z/lK.\P6W\1^Zw,n̸+6Ko,;kyKdL"3;$-Ua^|V]Kd<ϪaՑ͇~ϼ$}dlr8Y+=D˳%2H[IC1ȝ$6HZT1I;܀}]0pZIB'W$$gAI6~zT{b}]_.rcuNsHr?2R ugiLm.PErνs9_3e{MY,²|WQ^\ Z?C̾WZ*"t#ϊ_Rw*h3?ܯ7 ꭖJ?TSJ?,Z*bӕb_ 56.5e7s^_G^:kR cﺶTn-o#Rۉ)?q(SpHuȟx]Xs01ʤ u\10^Xȷ4b*pƌi ~+-2_:1'8Ts Uc O^\[&Wgd9c9ժ0^x/8? #1+1UmmrʱQnepQ+/!x=֌O6qSYFݹ6mwo﨓hxg]p-.^&<ŒM"+^LOiwN6zmq8Sx_]LheД/\%aG(V~‡b]C~y3ڳoxȼLǀ⼿k|Lu8L}>|B{.>>1f~U6aH}GGPIUtO i?WUL ,7*ڏp̊8]fs:16,yuԛ1HHGXs8$H7]Urx75-:8o>[Es>|ItrGQzY/ϗWRVYg wWN$l9[}9tgĝ|mu]|j߃﹞grH.˫r9}Iqf<_4Vl*j;6maAϵsP:<x?V)Vsj+~\c3~~1ߢq_#rwnKJ辆5D>@y:F}-=w?^#uml_glk_5~O{{7\{w(k!ky| 3f(=;@ÊF+\JYSZ'Ҵ}]+w[+qQkr{YtL{wnSJ7!ۀ_2}m+ǸI\,?:x(ZY @'yX'rqS9i`5 =zv!wr:CO6x:6x9,r|sA}jN32tXo]e\'k`_.w 5 NB[ ؏ݶNBScGCGʤ<үﺳhs9gF|/}g;_AE~ùR'z4 K=i a;O:cc}^H[lty6ח tl8 YB.GN€{ov<~ BVma+jڵ85o?}o+seQ=A⨪<rJ;RSɖw+O嚯C|/\_/]*-|wyA66c|$}e4~\<)gmFe3;g9<Y#΃,qGpXHW)z|σٟ=Ϟ6Jͧ†3/ /-Kemd6|8um%r#)b* } z;r;z*՟ P~iʦ-Mr1|&@ -2*_bZT Bv_9g"v!F6o;p0F;#i6J> =܌m\:R~l`5PZLm ]Bע-xbe_hVL2\x)oKGkI]3];.x1Xm9"CٷꇫއO%u%땭K'9Xxm&|qmtl=ym&zmMj]WI]1_u-O`j2)W-Frc\+TZ'uQk j6裤ȑmdx9ϵmr TO6ѫg.zu?ƨWfzJQހ1N.EAz(xxU>|Ig8(ƸPvmvo I+Y4+m-s֋4ԋZ^;^5ܖu^[\|/w<`?hl x^29=v>dZ'P0IVz ov}x%9J.f$2̿Se面S;emS{;6؝"SeNѽQc|{}{^{k;eA'G2Ӻy/q]y]0/2X):VmcVx.w8S| EcTw.ңEzmHvpE]GLY ,.3P\^!@.1~J݂5\Jjڵ#Zi[y؋~;&_ y]< Mw_-wEgn{^ 'F*~_\%6ݦд xy1n#.y}ͯ^`ͧen*> &^s3&A4={#o4=/Y ^pe_yts:Dkx9k5 }ggLx=,vth8ra0:}7kUu.t~ƏnJV}*5;!t..]]@wy#As4^8X;z]]k:?<(> uɷK( mmޏW̍Jն{%jr7)gąObLK}3p\,jHtX:[3Fcf綽Xsws׸Ζ;H؋klw qgFYȯtWVr" vn3z gJ>j~*({isMS%[NU^1 c?o +*caזr4eN6{3,-%6_qw+<15(ß}V(;i \߶9gs1:I"ӂ3_o̱Msp1x鰩]+ 5' so@wf,抎A<᛼FK0xV&|ϭxtgWN7mbq[Yl/1JS~A~EME^&Ŵi\7+<ֹsN.S5Εa\CԚMSrbiJriB',kLdž~:}]}%M*Nz僶HYi"5Mh;V4NV)V3 c0;diYzX/M#M|#cl5&}vĪNJx#v<%,-1ˡ*7OΔ# CV!kL顱O} bk}7o͓n>Oރ;Ot'׹_ބOU}k`~ Gp? n?ןSi3*nFk k>B=PybU?'4nSXwȓ/6?_n\H7uoZF8r:m=Os'>7޻){/.K~zqzuk/Cgo"W/2/q}jWge8[m[o5_dRe22me~G;JBP]#X~xd?7ΰ!4ƳlA+l vky/"T%(k.o{W8]%\mj|Gs_'98yn1<_bs~>>~ϕg bz:L 5y 0ֿC3 X[V1ƮT;t+vA3-s[/PV:nsqӷ=8.q@yx_ _-t3].ޟ?oƷߺXJ Kgl>Gx 4eBs7`Ckڰ;]a=̆}ԐF|utuW)N%is`gh]8z=|\x [n݅-ButYre\h] [ >X*Yo Eb6i"X(1ٍI_(,&\#6N<&֩%[(z7Yv5pXUXaO*~1|G\cJGQ>Xw*k7/FEEG]$4ֱv-|r,i؃"Omݎ~n/0u支#A#w,)ܶqk 1t,Rk|{S "͸H]E3Ū ]6J+z|K z[Jpz8?ƹbgb':irJwgX]v?oo>w\zh_e#^xˈ: rgĄrN!!mM3+kz}\,g͑r\$܀ #BXt[`t0/ 'Z0= 44Zp~8O;.2u_J}ݦ?(lyFq(eCiC b^Qzo+}#܏Kԙpo+ܽDڿXK&uc{r'ܟԛLs<;f쵸lP <]ƥ9߃H65*} Ķi@5>Nf_]Wcwq!zOI?Cu3|Md,x[Z˧K M#~R= yUY*q\&~QFm{}$@$T|k 3z',S7E/"<&Ÿ:@s%u8=ic6 r*CxrM`^frOZx~/qgoqp9ϑgoڟ]y.WmqЍ_y$<:>k94ډ|˖ gܩ/V(krbK|Yo+ͦ]5]򌍵Ƕ+zEWXSbx w &3[nW6[!6+D _\ {SϱWBTbĆ`w.¿`:⓱oUɪ+4QNՊ.&qBk_Xi!۸E߲3yǯ/co>V~Z#3_9䲫8vŸ%Nhw MEܡV[|{b1bj]e܎+EG</FRj}Fkdl[2ƾ֨~c;1x׍k2>}1ކ09 vc c*eyK Ur]ߌ1l>s4(}s_ьͷƬi㹏g}uayC޸m o|w>s9?,[hs_l^+~ޢX\+q{[ _/;dWkkw?:ɕN|Vr!7S|{:_4^'k~l/pBD{yzK@y5hMcuƒ ^'~?gl:t^7,{$>mg:>+Z_8=`:q|{qPZ3")fWZ$ ;iƩe^xuCSsKG1vU=UIsz*"\p{.j4e~7x %h7Gx6b|8_9b`` cthgSb._?!/Ss"q K̷,t|\2݀~S:I[!?)=&NnJW'Ss[x3A7>m}rOs7_ K'ޘg/Z(^醜ׅ !: EK;Q^e^Z!A$eXi߾.gmez^Зe}γyOusAy yǜ{iVmd_Lg>;|ujZ,/Jh-70+Qd,Wu_s7(o7~]L~FWoTV9. X-cUݘN+Wxm(2QK[k1c ԍϺ0dO.ߨye<8Qbd Z%]΃a8|aaK>BT1*q6 N=>u8w}`(agxxjⳭ8gm|g+ߧ3T^⭬e"A2-4Tr^2VW }'qEݭjQu6oYmʮb(cQ1jM㭢3cf A~rSBGmSrYmv^Stb7mSE=ǐ&rZ2M^6ՎmSW&t ?U}Uv_n,]Ȳۅ]t?3Ƽ` Z~}]IG{.p~jԫۙbC#=(N:E]{zI,n,ц 7c;.(cWljuy{x)In;z93ݗ깼=g:/λCVv:w(-*st};z\P3}*yn㲿w]9/WO҃r9o=S. c 4wΏ8O^f3..0>-^xإmAL&MmѽidnP0K{$x.K?NˈNjVo֖ ܣrL][<<ߞ.H`[rrZ t+2տ6od5\ Y}^g@=[`|pn'3~j܆nx8My“vq]Fݖ]egw`mn#Gww;8<3kqn73ƍyɺ M-~R.?)͐a?Kn_uyq:gm[AۦƩz&?GSRe=v{?Ƌ{d<ؚqWf{R$oxs};k{~=N̠QnDcl=r޾G#O1{0t/N22RX'p=N~c&gcb0?ckLL~W&o^jPӏk͝[a^[W<+w{%P&cTrO×>Nǃ9>,IbY1aUC?!GirDu9s~낯}?8_'S!y>㹞1|GB9ypī>Oٞzn85+{T_W(Amj/G;G%MY~ "Ol؃ ?s J[z\*Ƨ~_'(ήgYlK??gii~a|w2dN>+Wd_Щ9YAx0o `4c O`:;JNLx6`_U9BSVC_& ;=I~ѱ?_Qaǂ{J&{Mr_L$JNQN\< o`^>X>*^}@bhrx[m slWPsЯC:Knt@nP> {+YWA>Ow{qlJMo3k8~mQ>^/2im#|f߃r3sH-_ AՊk/7:pP'{r8Xq<8k0N!yD\g`e1_t%K`:2 o#|4>sG!wG^<|b"ܒﻡ cn0>M`9.cZ8;U0hJCc+a Ώ9!Q ɰ ڂ2,CVmc ~<-C4# Us'Cc'2{MU+-}d\Dòv찬Vev8zG>DZ8?AqE;,raY˺[ΟNgFgVsqQ}N#Ev vs23wv&ŵD+ uoZ]ݔu~ob\ƻ-ǻ56h/{{߳/fW|27=/kͣ]WyEgE^7y?f}G]& ow(CY_:aw8 uporDuD Z1-G6>xk}Wa[0ب .mr?"2GߟuDd*x1/nZnvhXc GĆwKKo Ws=%XQTf>'W]Fƫ*/ʹj丫o86r4>zs>K P\ ^0uo-8*vS٣ ӎ'?ǡoMUoQ,' d;Q_ÏJdy _ze Y;<*;?b3Igm/5`̵ P;#eQ[9d'ЄB6hg1c[%<&*;l1bw4y~KXݏ]xtعl1bb~`dvݮEzL pxUc"zm6%.9}eX6;Ԟ^sp%ncr>< q$Ŏg!hVz*ϹՓݛi߼9tF5h._\<k0E֡>@uqy_z\h '%>M>~XDmo#w>Bߕ~}8M}vn{1 :`#syfCϡ^N8ӟR_{P<̓t'DAZw.c;aۼ1'آOqdY'gCfRŰiF}Zx"j`Ye& uv-WOKI ;)D­)p mOkWd6@=IGКsH#8)o|'4oN5r>᤺K1];6wN*gc]2uOϖqq‡NA9 J; x!}-- h -.g:X>?;N9?IcO=% [Sn1rJ ;$:I9duRs.n3N;٩9>s_:;98;Wf³iG!:Ex3k<_2u8X: *./<(OWN;~J7Q[}Nc~ՂrvmeV6<9m"v?g]3}AcU3">S `tT]ּXogņeYavVb1-cVϪx+?WA_+7 gYc{Lsr6$S< hqsJ~8Uɘ='c$cysחx%7{p' ;XF1^Cx9MDtN a9_D87=uۀrϫPN~ᄋ09:N7 aNþ? mI[W+?e+~sy~<Ckf c f:> ;NxyOlų>񏠏y!yYJaɺ3?FD8c.<1Ft/]vykR'\a 3: 8DZE[7 |Q}wQl]7#}E+qƣo3/ r?y6.6f;.J\}=E{= <8_P6}ە]hqO fk}q4m࿌8lfBvQ|_SyNO]jLm;Ƥ>cɓgkIٛcz51_36W)K CKJnճ.Y~Ix޲ݞKB_˼K` 9wp7͘s;S']OU+vNv*h_$>DLf> a5|š`J 3%6NNv <}*S$f.s˘Bdmm~&\~|wd?>%06nf_ Tܷ/6 !2_f03< 067ےW߶vJ.du I^6gS~z^3֧e3 ͙OeWv"SlT x/&.~֬7|s>;rucY8!+B5U d-ϔw̘ˢUqDuT,owcߕ/۝ݡ٭#0~meK3:c-[|@x;Ӫ.+aԻ3~%v'y,wqwsBf\.{@F\xY*.=qs!u\}baW CQ=lⶕceUq8ߩuhiS'"|ZQǹROt%;vf%up<`~GDu> 0ָMEnyEֽzA_b {w!Ux=.繏)Ec{$_G[f|;/H+i+r_J!cȬ]Qegc 촮5DKeĞɸg"șW$+w`CYW$^*ⴽ2-[}[UeeRnXu{LU˻8c/ oPYďUyѶw[WEgF}3WE {*UY}Wl{}!\v?)EF. |UY\W# j7Y򜆊֙m\{ϯNx9U9/M}y&bLT]S& fk]>Zo bw59}O=< *ɫvY7 5[;+`5+7G8N3uSNfw4cM{F:pkJo;ߒ4݈zJF 㼬[8ET1mfSV _"Ut5틶&\M?Ekj | 6~q'][ɿkb[xl2^=\պſׄvMxːb](z蘋WL Ik_[G wT0Bk#f@7y^BXXEM'nt"ƞ]%.:C wg~8mOz06R̖S/^{hK//+kнR.touy[@ ,'\ki{e _=} F9W&!,_KFNg^.U2XoHn V> =F{y1.k{(qCe=g_-5,蕌wa~Zݐs y~#c>بccd Ya]o~Tc=yRr7ܦ?@G@(> ?ˆ8[cݐ9+n(Q=s}oa?'u,' c7;tۄdzS^8ܔ7*7־ɾ1r?'{y4P:x^{yC#1g?{c'88݌ak~~Z+myC(%N1dd-tme䶊A8v[ {[ }cQ1M{s;*q;*;*wT wT wԺ;rGŏU1U]?wU wU #*wU "sZn+{z?{BWr%K9^~xWt]{M][mM{16cXSr|OtѮ п̷]~ּ'_dOT v1>Yf)`NK'wtNi^p֒|Oƭ1noSw CQVi=ёxO粦4f5O<>۹O=ߓ[e'x1Ì2޸'~Q` y4f_y%F*Rn3pTwr9in^u;zssqG[{UD;e~S1}f}`0 D*peN# S9$jC.s19d6VZ?یј1F `,m,v&~ K6Qd?tI'u%CGt L8]>ቺ|@w\b`"[ [xZ#Ɛkav{=aqVNp2w1]q8n5wyx]'$nDm+AW8ƩrFAn}'<Ɉ5ëэ>Nx.$-]&ro0e!B84C 3N%8IrឪM< -ҎqΌQS ]N_LG/f|F–.:/>%|mp.wt]ÂG8/c(8#c≯bٮ6}6o rV<ԞJxx:{~yoB5sQ=c'ӫLa xgcF/ƠiԘ!:0t |`En3 (T8Dt:^v̪2ƹdz}ԛ^yZ6+>2Yxd빮`"A+gi(Cvqc~m2>[iXΩ_-FVfkEi\c/%fp:3BwӨ6t6]l(?&֋hQվҷ~}]e$<>~*B F@u]_w^~{s!{:|HʿVb WXf+ӫya3$Fp>AgNG˼ϡ\v3KʄOquݝ з9xsG _ kF?/s?=ن6[#e5*}ӎ1v^߻Xtc?™^is`oxM _ h>]oV31&o Xǩsh?Zn6īKP;0OƒGxkL{(a 5Ot8Lf<<溦8AKeu[p1B81Ĝ.JR2S¿S6TAICJmJ8q+ь_ l)xE/y=4Ϧ'2\N0E'`0a2ҲHh)ioo o@9>_vڨ@⸜0_籶͌iחV|vJuC9 M $q;'E YNJ^;Y8@;|3(؏#ƛ#/0LpV[wtdWޔ9nvu4huߨ+2BS {bdoWZ>Ӌ*V޲TW=އ 6~AVЬ!2xʡܖG"ywfo1xKy;Q_N)JDŽ]:O@_k~`d ~*pMK'\ۧt+Sw?]w ڌ|1YqGTw|,{!\q/`J3is 8?x]9x UVF1AlM;E ]mQTe=d >_'j}dKc.Z Zgsv++8"b4>4 N:~lOj{iC.L qܞ.~Zc[5fVR+hLOS}ٖ"}1<[aӃ0;oByǨy/;Ұ$k2_C-ʡ].B?օ68Gɹ ߴ(fl"+/ip&ߧ\WR^չ¥[6a}S1E~*Jx6oS}msyl2V=1z.w9;:z/}Ϡs9CT{3\jgK r'`~ a#a-TG;>01ȗon>eDٯ8l'?|[sy A=c<1*0z1V[ƦF_aƘ~}cͰ14n~@XI5ve0h?ZVig29p"yQ~_ 1X#{rc I|bv8벟SvS9Y?C}#r5˭=aZ|}f}k<_s{zcwFqb?seog}~ǻxц In9ZsO.?}}䖳i- [ mc 4{H_d/2׀&r:ɻ3 Y|t&^ơӟl7i9-Qؘ`CZw'N |1F>-?̝ x1/?Sh6r{~G[!~Gs:w>c S,z{la v.a=k?wYzWʭi>,wl #\I}oMG,AbeAȯ k"Nr+zeߛˣk+q/+F, 0Nz'&3~ 0)n#zG)G0J<'L%|:;ꘘGp1\4^ram/@xO̯}S:2Y̚mYs}ޕί2וwCyz'EϨFlǮΫ{na1ڄd]/t#=|È%eLEy%-3yc.LF1IEG;h۬uIkt#Z6r:??cw5L|>SXWKxˀ|擌1.oT[Mki;וO v'ǪaˏۄwS5㌹Yc?/[A< HxK't='.ZSkѴY __"(ߦ|'=aJmG{5<Ÿ/R$>s}HMr:t.w Z6c:,U.t=i<:9cW/oZ0ƷmuzoG`|;G22cSy<Іٌ+<\ɚY7Wg oɯMǞALSgNw-G쟐X?t>'X^IRE!\?V!6HX_cߎOXu^A~ s7=mҟ('$'e;iy0c:P A6u/JtW˲ql1nt]qM>kt?ǻ;mНTʿ}J6+OQd\͆Ki grkA2sBx988dgaoC@Ń=,%'ԁ:!nquc3>^x*mw}6C?W$c{cq^$峗=[2݄:: |th]EfۨL.q K{]~xm+/rlB՗DNF0 ^ޘ6E>x]x^SKM7R1C|h\| <|1I&}5V%HqK;1,X)Sy_3z_KNM{/j7f;QN)N'NS:t=t:-KYj뇌}ګxa[-xgطD§_4Ы^9 1댵BcӘlW4u`݇ >|ʵ Vk1Rvr?6od!cJ_33414mkeO~<}^o9g}jŵtp c_)]>o<,Oƚhn]ηjU/[oo8n3OA朶Üg;s%]#^ҽ9v:Է)9A Jx9Pehă M 9}hLvDڞ=i?f8.;Wdߓmj,Atަ<9e>e4hNo(]G!ܶZDHPOa Kc[?cl&q]v(Z.6w_.׆K݁ӄu̢L&Bn%~ޅ=F,!\eq~Vd ـpE?~"AϖLP$(ٕpE?$*^U0-V1xƐ cV3PKd{/%ʽn[@oC (|pn­Ԣn~[  4m2XC{F' x>*$':}Jj:;v\yL0ࣴ^sN rA/%d`Z%:lOA iWAӴocDl/'|Nh#/SeJ3FV3 /~T狙'q>!SM>: cۋZzs>POvYD_ˇ Xϣ z$΃^P(牂ϓ` Zޒn[fCAJyS Wg9ӗո"qFuqA3#9~)(OyR2|ǜ,3=4`1*XezcY=>q>cU>߰Jx㏋S3L3FO)c=RkSc."!4H A0홬Xz.Naֺ6!)7<$hC'"O@8My"y=߫n~ y꼌$ _(D!,*ٔ1mqNt\gt.$ebaƲxG£Q// ܷ"+tJW^nUOߝ]_^H=s u~!=J./maRӶQ; oW`Yvn,` nu4Lo.cUH {ecLFlVS>]ȸ'uYqI2?(Gv nP sbs"~]X޶$|T=8c2hԇ1FR]4{m v2F’d%I]E<8ɌLRuHZJ"%I{O|$&In*9=ɐN5h9Ö'յI? )eR!3=-fJM3kpū-[㯷j"ˆg3ڔ^-Ei4N76j?NpOsE. ړb.?a< g/y^pXz%4NmJ'>W?ԅ_f후A.:A=_uƏ*l` I41,1[xO?o_"|y,_Ic?°#M%\{.ET2NX^h_1?NYJ1zv1Gzu1?[1ӊ_PLj]>t9tYLHj?-reƽjk?íwF]+&&g&f5v[@z~*fUǒ^g"}oHog迶s[nhlqa40 e/.kJqY3u˚yg˚P\+e..k̰ftȷ2'0.tȷ0F_1[tJpao%ԹVyNǢ2ƌ!z1dZmtxe͇1dZC.&k]>t ^'C!`2m -| }- oLP9t<ޔt<(lЂk· %ŷXЩ}$ZR}ŸX.<]ᵌln?úLoNP~npzFnYxgξ_Sʢs_hfXX뿃y+/Ncx2cg!QJrG /:iXt X1ƚkkP C/֤S dUVZkU\4^qzMzC k~kk{vWzϞ^hYeç^)<EچO9/S{\;N8/[\luϓ3.RJ]X1a,pg(\ x6 w”p1\ťFo0ƚ1 X+coc_a z>% /| "T~WVg1Z텉E5W0jtf+[ڥ,zi*ǧ~?}[w]Ơ!1q8ٷ4ʏV}Ǚ5EW,=軞SY Rw1ԋ5 .|oRbԶ8,%RK .%ħzP9qr,uh^ߕR<>OdKŠ_h:i3Y c;1AxCx7A>wæ˔ sue)96b/:NJu#^*NdiK{:YSi+7(#4%Z5I;ދ0nGYHG;B/w[wC^Y)3c1Osgr~(z]$ P'Q#B#0Ɛ#b!<rZie _yS;C1xXτr%9"|5XeX@8W.pư-vwYB5fp2jm V1 Zp Y?T£u]'_3g^JsR8K(a/Q3mвJFA8/c($5D#E '3N%ܐ1/Oe'׷%"࣎0\ߧ%TNa .׷\$eVV qzkߜJq/2 g2 GyyJ8ℋS2Te˩yYBPE31h|88PNqτ2͇~R9 ]G1]"ܲQҀK.[*^x6}T0Լ)YXj3x# C[)Z7<)CQr\^N1շW:cۄfRC :3~N]*_y%+IWXTt_[Xyz13 c g_xwBS62M w2n;`BowEO(-O߬uqb' ·x\rwa~.pvawNCVuqڈ]=7Z7:򢗹I-/pP]Ntu[ ݺRWX,UA!rܒRzo~]A |1})*(fi͑Ƽ?Fm^AWWuV}9ȃ A*(d&lWwZgWyCeOu~0^Zz-+zا$E~Sޥh;/V%jTdTpEqƖcՎ1uugeK8>Q՝Yn 7|t>: ᆏpGg3щhᆏGg3JdsdEv<` v:oi5$;:9Gy_Cw.;X/p1nZE/tY`9cuf;\n­C6F /]t&4=O:VQ-!TQVE+ MGYȂͿ$>.1*eT犄Tz0lTc z5t;?Gc{*F̚UJ6ۏ&>tGV}L>4xOEI{o䌚yhO}M Yhm]%oȌ-Z[IC? 5f}uK_1=҂ 1TqpVVuq ~#v?0`2ߌ=Ģs?^?n7fsi"m՘qKXW>#+w1(e ǛC]՛Gte grMը|ā\K:Ѯ'3UQ4qΟ"<6HRĽ6ꡣaǑm *:A| VQwÑ!1s:cUە\tws_QamoCꃧ]7;.,Ǻ9M.X]sK\/u:;RJVU2JU'}W|^=g]7Aߦ$}hU?>L8<8uYL\.;W>o;~EsDUCUٳTϪ,0o_Ws0'ڳA!ÚYigwSzz}'&/{xUŃ-: qHT|bn꽪Rk 쑩eܮC_ =s E96/t9W5y֐^F 1ڃ |L3|2y&g3ՄWiWb5&r;gD~:ZVM| + #j"WUm:~SMTΰd-ڛLV{mqd&1}a k%u2qOd97'˸>,9?;&˽[~\u!-©jo!p&;NLVĐ?lpg`nF3Qbv]8]!̓NM6t o:y$|Ysv\cgz8fp>I=OGU} /%X%_~g겟VT[=V]OWM0iJu?V+E7o/@E3^]E^QoV]ޕT}팱wTw3\٪@vd1loc?zDCOUI!"u+{1j cy$Xck*Z<(?Ԛ?)o-56ioM;qW ӯ j؜%5nFRA՟؎Հ q-cBPKwFCt-Ɍ{%c MjQoZ㛅҆ε]Ka}hϠZb3}-Gj?%\fs:h"Í32hts4ۘ}@h1n'9dk9JGVSvTmSז10)31F_tЗgjmx1/~ e~` c㼜x1V^2 j+헕,R[˾2n'qR[^m:2nX{߲(Lx2Ӣʄ0Gx*f1nK㮄w44-6oձ`B|RG\L3#E9ږ:b˹`o\DORox]|uU[*sx>Bs.U3|Ix6''<7Q=yoy]u1=.V3C?r!,q0;tՕ3]% Vk^cM1ZSf~?He"N3w9t]cc|c컶=\~ gs>WWP=]~=(Cc[1u~!f'|^'|Uf}BO)pKp[6aGu~׸/ {Ώ:?ouњ^ެӺG5Vf`"1uypMC:?:? :?[:? 1wQVBRH($!h-\I2$L2ׄ" (PDH-ZD,KQT`酥`o,T-x>]w{~q>'#f=ɬg?O/f4Au]TLc d6OCMyj.2Y21N)nSdS3_M jM&SϠqW1^ W>P=_Oa=9z~t{1?Cv\..c31 % ]-<";y#/v x˘ pGd]>cck2G׌1JX~&6ef>Tv Nq;Zo)M)Nס.YcCUR4w$9%S d-h.,N$H&即m38Br??~Ms ,0 sկ 9~ޢt+$Y%G93I3Uw`s#;\{£;L͸ǫ8"(8I]IJL`=_#z[#bl#€@ѮcPP(9niR[+q)0ˣUpk:Ͻ@]tueylxGde1O0w,BLnୱf`` 'R6EĔৠ- A>sY'=38C>Ohba~᢯<Hew&'Ե4˩wʳp& ʯ͢e y%MG4d|w<5K,I.)8'D>x:mr&Ɨ},re|ϧSr;L)ߩ~PƸ&?fbyё %ؤlv_6q=j^ŀϤ8c&|hf1yZWgFǩcwϦW^ēXgWDfs?<'-3=wEНeNvZ1S%NK{ tsQf+z.Kh`53[Pxlg*љ{ﴬ9L3a#5ƶ8?;AO6u9y;=g\3XbY׏N'|9}ez 8K0D//a빌LXYsZQީ1SwI\.ԉy[Ty.pcsG+M7c_UWh[\Ǟj':o<0rexù3qxg_T{1_tN_KUQgj'Xz/\r%.OͬK{Ϩyk:W}x3r9=+͹bB{fk ,]3^ʏO~œhy@?N7sW>r?XAkH6=C3:y?Lb]N>K?TOL]yId|e"sU>\8_F(s.yN (0 R9Zj ?G['1r牝K{^bh G|Qx`|il+#Z#Y A{qzufT}*/vOp Z/PTF섽tUߺZ~mkVߍ}QםbC~m;% OEy} C R𱐏06OhTО:hӡ^TM"5w^s}w9:X;+}svv[ֽ㾌Rs:]Wj sX-26y첰7v;(ƳE z'|?ys~VK76޹*]u k1=pp9PF$Fܟ|dD";ʴf~LKLkvȴdOP~NӇed50ǹD<'8x~6_kR|xmy}mdWEkhbZ^Vao h<}U@n߻o1lwa/`C[k\ac3#z&YM\i!ch`k:B#~(zSFwC|x\y5Oa~Q/{teP32Fy<ݛBgr2[(~6(zo]Z//Q|S i^3g:(=Pg{hFշ'T]j_U@kz3zxwG.$Zw;pRmny/4g‹{1f5VZ`ry}Z]0̸ Y^*iv-tމ.Ew1JM@<;JXh߶'|q5Rp w|"4Sp/jKV4nS %=ov[^֚ %VځBvPb}aP$u^v+9 j_d+zxY )|zwzPåjmB]$RgE5m<3[[$}" SƝ_X{hEMKv-yhI [L$ئֈbϋmY5b)&ȫŶj.|]mWa.s[Fkfmk/h m}TR%Nact(x&u P|xӍ13 1{3qn p*\7qg緇1<ƸK V$n言XجXtRc軵Zsgh}d_aPW4Gj^z~BգgN_[ΉJO~H+ 4 ps+.~ m>?Pu_狀9el9+1N搠3}r"EU9WMPucք藧^1qc޵,om[ŕlG[ (2 ՘2zL2}L7f2ovĆ=ab]guVjHb_XCC87$BxtHbOI\5²gOѧn }#3V#k{8w s5+՞:%,:exKPetYa[Rg70va9Ɔůް.YAgmG%uM'r#v~?^}7c^^/~N _R/zV/[voui-Y (x*L<mk$K܎~d0Yn_лַ4'V\9ʉ[N.UGXNy~9ˉ罪xޛ+l +Vփ*=Wqq7>0W7e;W3;T{Rm}6I_ũ2L )F5itz~;̒ _k+\vbe@S~P!qۚy_Wq }'*Z04 %:r2xT-w_Od"MDN3٭ 7A]1dS0OaJjs?AƻmD۽2J ܩ2+/Wbxay.oJ}o +XV)U6r 5>m+%ۥ?T}ֳdߩ1E=Q=ti7q{\jo~u ^?<&XL@S뵨ov:_/_r;]*;ݍUrVE`6sG7Mt<56.)#.+z (Uf**Lޯ6ƌqPyldlE`}}1bOa#~nGi4U4Ŋ#La@/@SjGA7#2zm[v*Q`/:AEyYU1:JV{&RykN5UﰡxԖBVyW4_4oy==>at=&~Q-1@dwD%EFy8^}#KxlS&jC"N}яx#4}=g}/H6Q6"K9~M6>Br;˕jhCfGcMD16GcGD4E$呈-88G$9h]D|9jJqO$wmĄپe}|igcfM2:Ics}poSknb腂5Fy_{з<^mֺ5WNÉbe^W:Y&p%foު48 g7Ԉ|o*5͛BEwES;"N]wh!ɮ5 ,*iK&MSK1A7qieoY S;ul6{KXY>&ӱcd(Q;JMC5PYbCO׮'nN\];#ja4jG`ͣD[-ȓ/V\f­gL4k ӼMprg/k:ʟ610d_dt>j)P&iD4@i6V{暠1[32XbjNC:xL[+C47K_P͐AFo-q|2 se'Ŵok$}ǢOB'ڲKƪ)|]e] 6E2~YVRbS/_ ? T32ό>K>ZR?EW3q$G2ލXa"X /mDJAPN}1VsRVd'dxkѤ1elI E w]LE$qt cL0%K<-/Tjb@1 G&71|M:xTE 4QPf]7 mnhqZ3vAEĶk[$e b@!c urR*íS_3̮$KAΑGLw{;d?SC PWS2[6 ^d"ʤ[t.Z:e0TcaU,:Ң~ZD]E0=;ӡP'W]-rM pCJ[>&^QtiEN4d)өn6 $"}C&i59IPi۵0R08(@2A،FM{I,6yn"+O\1 hi@N D$",ly1Eb"jM:jҼzҷݶ6["-F&tLRHgC1#aZgch֬(V֫ڔ6Z)@`. : [*e[Hi:tk%ӠvW + 1dj1 jJbjMQCLƘ0 wYL @Fma[$B*Jk:[8i#n<}fl66RۆNΆأdH <詊hdkP'Wmĩi9tN'Ll a/MM.XjNW>I?:qlҮV˥])?۩ILFat&zF!Xl`E/ +geﶪ4;^f*0$cf/12H,Cz 4N ,$2. YKM˹u%@-,\ߔ_L !Ƞ%>$hJi>}4*E8ix?VY4Êä;{rjR=-ݺ5 J{ ܳaa:RZݓjCo,^7Mhk°T {3~'+AnIwmS&|.?oPXy+>I)`:!g|stsZ_P0m1 $3Nc'3L3Y1.}Z$D# G:0mb771M,< p{HG?Ⱥ&s3@ZW'"%"xS@~Pa,Z0jVL#6`|3qz*\tB8!LS6jE\ C۾WFI$qnIQf͡LV&@z!MoɵX:oQED-!Fxzl@P`Jק\ڲwLNpr\~Ŭh@Y4p@))ShVB%؟-O)Zטz,7TϭQڿea(d5k6GOWm[˒d)O8I3YŒ&l+*z,e!]XP8ns$;+%fIIXYʵڶ`ph4b՟tņ8x^Qr3E}4\K6ŦY"HYg[ {#zdbN{eXOƭ;9vВx$} Z=Զփm Ȅ,uj:? +˷(y:,Q&pLϋ^*9 qЦ"4$*)ad1.ְdϐx;Hk3 EQZO'L7Ňngdf%b_ndq TS~,u@2a?v=ѵCA}1lUQc 5ZCa$BFFL biLCLdn=Ĥb8pY*<{ Ӟk'iRͅ :ZDz.B2[!5sHj(8_J/z`L!]Ӫ'EC4w!VRd}٦h5t]?X4+'~YKwb@}ƂėȄ*UaV)fwYK Klc F=L{ajϦ!LNzd7.3V]@]ֳ4qb o,/ k>!eN),bkXn̢#NCz[ԛK 7Az%+ g9/,]eišacopU+Ҁ+ ʃ3`O3 0-&e޴zJ_ִߝ]wcei ^3RH:e3鰳yO/HlgZ.,|̗0 `GaFiâ = HE̴ =IQ긧")EOgJd"&w ci.ɟA4<ҩg4ΩQ K:&7GnRZ\$_ $_*+%_bǕ!N*^9{d0Ul} ;@T䉳 Ё:x)Җ& g`iˬZpB)빥*¡ s\-{@V8}qƀ9hXm΃Ӣ`ƌVZڶ!U?`OAqĺ_` _A'kou|,I-v@=V oy ',p6W X"OٜlI6΁6  F6|_}@cLAe!hj"MP(c7;2 V 3zYN$(&cx|̮s\t2ц W橌r#n I~)`J X e(7@OO'M@뀄%),䄁8T9kP˜Z~ZCQ26g;;Fg}CU45NE_i4ؘkc΍su=,샅}>X `a{޾}{ogꜩkbl0 >1>#i`ea]?.EV== Z6=^J/?>j@ "q6Z: le9 A*S[:ǒ EC!i>E'$ 5=}Ą!D))>1C276@m YJw9W [#y":-jughdE]b|E!r4ubHiـ`V|f¬N6}Q9'=eksoemp+ROԊa)X^u5UQ - {8t#Zn iNW/M/ 1р̻P!wI_}?1_,M$K->$,)u hCpTg&CZ6x]=5=9f/ĞBa`@UGCהJsCL5`|J `>1??*~{o=A1z~}7AV}%~i'wO og7 ÷#$\=.CuϷϏ?~Y~y.w]>VR^ ^n>~z?޽>OR%@$H:]NjGasߑd*}Gw? xvdzVOIw~u쇂cnnWjAWϷqz~:{Ozx:ǯA}5h^ku=y{ޜ *6'@F 42 Cxy:`CExH|4Yq&/[\RcT8_;p`4J,0&h;;ӦbR: ʰPzĦg QP$7-w+I}>[XW2c=۬$y*e.\LRQ[|&X7)ν`KŶcKYbݳ!IZG,!5 D NYvM_I#?\W&}4yȻk/+0E0?K⧞ }4EҰQ'6KHCJԦKf,TXYvK JPTcYa`2S!ר1a(U1 ȟms#yX)v{,cA^.CNeF{QY0őfQgd?yGB"|at!!|^|гzTm@qb1"J@* !Ɔ E#k 3t[/ISQo{}jS.]k60ܨ,\ tmIvD0Thb_mk23KVf  ϱՃ{ƃe >n8gaX{$ pò'Eۋ{~n]_]'_]@_~{zOVa"ۡĴJP8ʕ.q`X;K:PTT& g~wҡv y hag*Ov4| L&D<.`R!LͲj` 2B˺ZbR衁`$"qAn($ԬP.*^ܡ G7]?xm'3IMI#70\sc̵̡R1Y甉eN3PbN/je,ѪF,Ef"PZ|% B#O;g7`Ӈ'w:¥ 9M|H?Bh9VMt:\|H2 Hwb-ZR@lh&BJGͭgRP'H>kAC~ ]27)N11?5FWa×Zߚjh<'T] 0 EEZp|x[6f.ⵇ~ǛLH 9 ݾ İ{Toרdڔ7n#,,nXb $s; [kyeG~d]o€xqZS (BJ+KrM_|SC@qCv^ Kr2o kJ[BD^f3 ؾ(KJ^We1/ch%ĺ*;Z7BtV Ҁg$'*+,SW\È~]WyKTȏKX Z}u3[N<h?CXXۊR*; -ma,㙒mw+iyK8zqK $ mBvU16j ;qIO233s] ְ^9v.,sYge i=֋,]kԆWGlxӘ lڹ쪿, aLo^XxU<%=7~Y9$IHb|T؈d0،)-&!ieM9MUYt4UToaOwzwwvOwv ӟ8~~^?tqS˟]^]4o?sǟ?\4̇O~G~pwO?u{˫gz{WO˳󕃌~?a<4GOrU' c{8?}\~~pwsC߻\8WOO_OϷ?svwoioj7 Wg?K?nnFǛz_>lr^ BR}7H\?gJFc*`>2Sv m^l"|i* LPHȔNjO0;_DB²[BD1UP(fz3h:J ym܂!;&t Hb)kbPimEaԸKbaxm{{4YNZM&tRxxqUNŧb1L#E8cVrBdE̯ו~acUŇ|ɤުAwfm>c?x/~ڑtcz@q#) iqvoW2߅% 3eɈ q[V=WlgH˛<^w3}۫P׽ՋSp ب.j~ٶ7U/$U:Ds|$_d?(ݵ@guٞ6%[]TCUۋ_V vt#[ѹnpSGāCBR;Хe%ERp~W .sn)^ _HEV \_{j+Jmη3xе\o4?Y-iYRjR\=%a'o-^<wu:eZŧ`/ 77=d8$*@..PCPJޡ.yF7k܉G{$)R(A @^]6z8 "d8 \_ZϢfÊus' 6M+J*eq7;0[dI՝?+qt|]8v8^{cx*ΪB % AK{hq*W֏ g\g`|^Ę}Wx80Q5P5M bςu@[2@>Z>0)_uqXJb3=l`)- -VZ- }bdͭ !%'l=nC&c7)"9酊<*J!ϺrNUĿ/[2b4X2)0a%bpE[qۥA|`X >K{6K MDZ[J3.MBjTz}eSU;vˡkm5ޭДa[!7A׷{tv)OuBLa J)&SSGƗZ%eU#- ۇky(zO(xMi8BxߛHcJ^>DIw5bjjܕKP)XK6R_Bk,0PB- evdzTjx1TK$&1{q-vzt_@n+1"Bd6,T6`շeQ{EU,VCگkwfsj G^]%5 dMLr _|gGu 1h7IYou-RB|m2d8֬Hx7@j0@+Z*")*j~i];n!Kٲ [!CB>+-;as[R2k? B5F![PT烓L]a9Rp_}3OhYoU5vuvIQbՄBp˪Hnx׼|'o`<"UKSWb_]S>_]gi^Z H"6_ՙ<1eCˢ<jۉ+ݣZ/7tm~,u/M{1v&S|*-g9*vQ5Ԇɢ6~I*o,Y+d7*;DmIKfOzc{ /mhzVNr+uvlylϿMm.tO? bD912\e[ZXl5pLu\8p)N]Tmd-sb@ ka5/ Q; Fjz0WoL-Vbl'Up?ipo_ #tL@X6;9CҖf-c&u-Ԛd"pXw!뙼Aq° օKXQwL qBS7Y{TsӑpcLVKAR~MZoT2 >M܃8?Ȝ#k{@Q"i1 ,$K[m}jفq#nn2i<}7l;OhB5xT,zk, h֫w<=8ErIPA'P Zh\TpID}KeG}$,=QzeIH#bS  AZjR33`\\&eZʲ0bQP<1Gy}0 c\ SZm9Xvf!hu(p'N 3"܊ʺMz ܠn_>K-XC*(eCCwOz *ZԆ&cj,;kizW `yaIHB"A4 xdYBTmc7C)ߨ<,^AO=p7i (8 jc-J<A5IKVZ4R<Ɍ:_ODzzCDzGN?~|KFy/q'}2KGbp珮tN&MGDeuhPHOW7+I?`?{xx:|\,x?qr|tqۈ7gx7nﮯnSw ޹?~q7>|SE곅}'ϬcDx'+ubA̓ưmyu 14I6\0'[lD:Xe_OݺS,5[9 }|| g2&CZ!_İ=ΰ]|(O>$Uɞd .?irД=j(戀|;{殯= {E8JJmgģl -]X2 5tͬ+,aGOW-UuGy;imqޚXuy_ ߕ[I`aekVtJ29Ĩ*E꠳(@B[Y ÷>RqU]CԻ>,n!O!YQn;[, S.-G V)hCj#66CUQ䓙'f9ԨoMTEEMK!} |X66 Zѵ8a8Ŵuk\]Q*ü޺9G:j,V=3k6FuD[^]ǔB%D*5)a2o)(3jꝒŔ*3[E7J.q)DZK5WfȺ2-^ jGJM烪'e@< s8^,C>DS1ӖќQ ke(~cK)"L,b,<]pcNlH۝ɂGHnzɷOѽWrw8&uӓ98z8ٺyf'q+C.;ZJLl T)^+_өyʤ* ɀ4qjZSv0耷o֨L?B{2OiOG40tcK2B)`z^vwJ[0MYg.3CAIVG֦g+D^X̏N ?KYWUnY:CЄKe]95'#¨gT( ":̈p|K.⸫(xjSK>Z}J @a̴h0+S`e(ɰo_0rd>5D&(}8G$qa-b+^e V^nҚmdMXzb{7̞pRVy٩ЫzRvvV.,=A4)]Ŕ0^ 2.mG]LmB٧eI\ixA>("ѾFqNjxP.تA{cDoD o ͯ$waѫpD}$ꔯ)-'}h˘B.87zҰUƚr1)G ŖXa>5D` aFS+ܨvm)l^Y=Xd6Mx?]{? zKqM%7(!Èa!a5"AbXrpC'R K5a\P3WQ3F`|  )^T^&@: RoܵJ%5@\mty+0MY PuZHLnV ص I8ov" *=~l_uGI閰t䚐[$0]QQ7"f>vJv_61=ܣuʿ5 F3!Q MntW`ƒXj(8#ۤK{؄]IKB?u(Ac'rE?$g!CcxQ&ǚ2yPп-8H%K?'j ' AQyW<_ "p=Q2A@E[ Gݸ 1}S`z`&,tˏ^>}C K |Xv2'::zAGФHv)ol^&:!eH}(3p~Z?Ca|~1!k/}$( ,F@CŧդUC֣P+H(Cz H J~ăM-#W*n5VWg䠛|w$Xk$ɸf!}][~]-_lcvLJK3SN"2]C&eUia3cPua}g%;KD;{ŵ:iG|w_߇$yݢFӸuweʰ s3}ka!SD^*ouM@AG.+*7:RDZA'z@ҷi-—t2\B0ܵ[^de J?!w=K5HvZ/ YȒPtDV̵΀BQK1>ԯߌ8꧰>OooO{Ba&V,Fe<^,;׸+^9Xiá[3u2!D`+U@vWBKJ_ <{80-"E34m3܅?oR9`N0As>!O"l fشvJ1[ Ei*GGĥ!m뭙8bI$Ķƴ,Ȋ`Rgpf5 b-R/g,SY^ѹI_e W0y2D&pl0ftyLdǧfy߇7>)z?z$)*xu[;L_61CwWQ(2MS_u(ʛl|62Π_ Ut7zhiÂ.9%[l5LQ. 8B Մ {S$d&D%@Xfg=G+n :@&8tnphㅢXPYM cXIz />s#؎J~*w]3wdTpF@Z1qb<-o "`z`9vI[i=C }Hɪٺ5<`4bl9ij z f5VVŰm >\L\d0'[q @xSEB͚cK鎏Ц߾Zn^6Wg:e)A@ Hm7a~]jj}k}P H=m4uf%bjYhj,nn,x*Y]2X$9c=J'd·tPin<#nC#{\7?CAɏXd>1];11oK2_.ai yTQ,T(h.|E,$覗=~.:CBw!Z0aH`N"vjtS$jMUO Oq]BF}8z}5v)hSL׾Lł4 =5\'|X~NVmpZc9*lҊPgE7T`AF#ArG!8!:摶Sh)q 갵T]+"ZÍnIv$m@[\zƜ'=.LqEUj0U{YtgvP,V8)ϒB:mz` Pvڭ"HƧU*O>0szED3 fFܽI7EC)Kc?PXj-/35{2:sȘnn`b:*u4O]+Mێ;{x04nw-~=1áX" E{7kg(o _6[1பL=3{4"ʳ2ІK %\B"58LUH3%+1fQ_󵏬CTi)GЃ7̢9ADi!j}I2PT*eh/}`0_i $W6!5/H iO) J+Ma̪*NE)k:' -[" :N"}VeeJarD~^q>Q>T `2l #֛i,R5La6$d&zpn*xxíz L .f޵<SU|UFM&d3UbEܢw **<"Y˸l$B]EԦ%8|yF5 i"P]{ϼCeAOVMj{=vZ!$ƴT ˜!~<7Cd4TYc^Fs;\KP(}mr:ǻYgou OsYYfЈ]:OmdoZy Ӵn*' :Lv!zo3ߓB$sՇrޙ,TQe`n:^Y(6*i1FhPlSe5zV2y;?4v ÐiD(hiH R󒴠¿_fLh\LڂޑQU_ecde 3ɡSM* p?q@zU|{yT)c<όQ "(7 Uene=\Qx~?^BpZǻpaa 7ec GO 4\{_C@ Q=` q.K@ !eR:հ21k1U]؅ cڸ1NlIO)CNTm Ɂk_Eh5bTX[~ty8"4u89eo-%{wՅgO|fFҟWwPpwwMw+I{z{ $UnL h䇨~^[OU~Ғ|Uxo͏)/8lP JM @%Neʏ)6 *q1@AYtӔ7X&6vW \Q`Y쫊5.رӿkWBg`WބAG"~١.Tyeٞ!z3r^]j.蔸o>R2u]0i.^$P^1߸}(p?WIxoTˍ43Ma}L3CkJ#$\/l0`Fe рX,0Wx"/6 ZOL-̀۷0>x1OoUxXnٹ\x>_]n/Qw]^>\vtC:R~w|_߮Wp b 2_x% B6Ժ oPLRcӷ[ݞ} FL}׻#9ZRDTFxuÐEPlu7QѤTGグz~m<-p)v궝ŀ" q;G.T3([H{j?W17nq(entR2~#Xeab=SF `-DOe|Y8\> g1R v)e¹\?653Vpq"(*`iXM/pLZP. G0e0~oBϒuP"?>M^R>rN,[ct];4x  θ]l.fRN$_N-F ϔ>ߜޒc+5< /ßQYТǙ~fmfA^S RO)ɣTPd5$%jY&8Zi_Ԡ;}0.E r\HF}=d݁c@r/rɐÛذ> XY.ohR qaH")IUW#Ѷ 0A6vE=egRjݽ~~Oq44;&c]8E$T z.lܤ򍾠 >`R>u 3tE]I71E&ͪZP/W3lQ$ (R{J/ Eаq(RϋT9"<%,BTڏCP|#eThkD}P$9BEJjGpJ=*[=Kr+0 I0 i7O/z<^ Mfw3֓e.M3:-cq RwkY}挣a6q.@n\L0A?}_{r*{hP6RWd *w(!,.֍YմM@R=c aNBDblh[èph U/zTOI"9DhjwuOJb-ޙR K'k4w׷z-^ k'd=:㰑Cia@;wM NHFeCt} TmZs.;Gx .Ry"ĄC[!U 8|ä<#ˢY,ӴȽYq䏜'E0K.ވT[7-mPqBRijn l츦im *keYv? q }'o23վ4q0B`!ٿ!52Qzna7!:}X1ӯ_P(Z~ ."=pa2$.((f4PX~b}]~ITf؛Y碛8^{OXonR^f/ŷ.!W2DzT5?<*L7Mr$ȳɝx5gv G+Kc(,Q(|^[v}K]|I!TٴS<< :6 o@QZhl= ䷹ )DΈ௘џIZiib,=i@_0ttV]a|g1;{mcPNھ䛣XeuKnc0X/AaCW;%A[gl`e2)(Ϣ e츿e> ؒ_yFYr2;QLcJ€;V Ȯb,lD$,HvrJ+j 7`×ϖ{"6%$wXX x9M zѼi9^9Qwg6)cB(dP[Ŕw`fQ`S쟈b.G\jHl+9=ςz $x_,@+i+ƌX ',;*&c iE9c.TБ I S1UQ3Ϧ9M,E!ԍPKȖҖ4Z spI>U 5R  r*n"umZ?IُiNM\:3E,ɶ&b'E9ӘEQ rRR;@(lVYr=RYC[W o5~lhmMLNʛҀJo .AMNBxotv "nYR*!vͺͪnR":%P #^W dӵ%U7ɍ:i@]R: KL|j̚5uy@huT֔*/0JUeٓP0QẵQr]ee=|=[S,@\( η=P?AM*A2PCC}{do;߷?@ !&786\ebY1x9}%Z=bUW2jU-<"d.DvX|@&ZR RB'>rm mu>#.!1e]-~.ӯwm|YӓC$=R#+803Y>xc!@v<Ƅ/v; S=ˡ2iHUPiNRy/*:N4-V- r+<ڛosP2yjIdrzUʽ]j.2+x[hTl]1[h\|(Uy*w`-R׳, kša>)S; #| ,&p:*d l-1L(-sИtS7.K oPl@asR%9AVᆨ Y28#;ȻW7#n몷|lj >p'k>#nHsO:xR8Mp$,$&gz5P=V/((7xyda[@)KvG=NYnҺ'iH*8텎֮vzhkvvIy0ĉZjswSvXx󬯗W? 3n(xO޹ D,fe38[^e=(F6}8wU|,[ G*\νuʘ 1) \w1Л &:m(`b^cR0Q?+,9 13G =zv)y+Tb} ֬'dFD|\#ŪL[7WroP%MddU vūJF%a' }(%P*BO{O>`0g)u`@PVƞw4!>;= "dA(&K+gMZ  eJ3YbjF2&zHnJ!WhuT; :HZcݦ8S={ 4:=lHR0~[ݙ"lr|PQҬy$5W.Vz9H0+qKut)-S]s+ Y~10ʈ Qjp֌ "AD~=Ca2FC5 * pB$ /SY d:#I10!' 4Tuk#!hZR:`* ]-4 B XMO5UIG$Ql{͗ 'BM5ˢ:znsBT;ܔò/&XG>bI80 bvWw?"$j$+rs>8 ?ܝ M~ z/Yg|YHg|ǐpx.I|ܩۇ;U]R4pX'a`&|Ʈ>d{ӻvq~܋o w;UŃZ/Gߖyx^*۞EB d_O^%5>i-$~7ezVcRub))]ib~.ܒix?;Tډl e<%5PQhA;IQ[eq 5Nքf Q݇Uc֘0N`:.DX3(=&n;)jSkpLNBkL4đB?p HjwvT{\sOl{Gn$\txk=CKC$ㄆDmc:;ut1eYA>v~ZrFݟ"1,t@0cY^ə=oN)kM~BnF1e06:r)m/\Ve0ULҮ ,+k0ԁOS.O&{g)n8q(bsBj]Z[ 9S})I !D5mKʊ;ZZ&'/3d鿂[ uJ;?YR's%IUʘPwkuAVt~aF3҄]T|ÈP\8=`4@Hu6z1`4ۮuALOőS5-ȟI͟,tUH`=)LgT|5 ( I#; `8.t5e c;UR>=;P3]ݜ!j @_nο+x8:^Q&jJ.WImF"BB}Oa 5]*`ZǷn:v = G:@h՛vp2J!БZ4 "gԒ }^DV;u\ieͬ,!0q pYsQOo8KlFE %4J:}rBE0%gcؖ~_n~F=_lX$r[Iz&-[fMPikQ=ѵ5})n18d#EzuvdS5Fsio'~LpgZW+BMׄ9wU[JnSkpPa;C'k vVXr#)  ХKIH<- _*YO]f}X/~\ܥ_7׋^97^5%&,#(}ٽyB >+$w=<_ x=ULrv P}Ihr G{j{Sǃ`P-k,N+n-EІRŸTM@YZITģ#dAoAsTa  ^VKBRՅ+}nv4rcfF2 Oy}ȓ!/ y`(QBX=,fTeY q*a/_`PM׌aSDhg-[(}%䯆M0:*Ws<'-H4;rXhpCԌZz[ }8ol0㡗hmP*iWz<8*b"LxofGoT.^h|vh:} 87ne;:mV?R-/w^: כnO&B0UyB⛽F6g Oռ<2f1/_A nn.` +V"6`uZ"+pOIv2`iӦ pa p|Mp~\wpZ6%Q|7yy\Oγʼ0!oN/>ov-L|eȾ}=<|#QxN0 BXzR;6mp} 7:5PܐV0MbzU8ہyBMJ7 5"V(a^VW.S_=3z,MT%/7s_~e}Xe}ngY?nd(5 GOyP(컇{]V.{TJv7d8~&P4UŵJ<:?gg#6+(d]U# ӳЫ40r_dlN9Z%o7pT҆wă2v29|S7穭N7hPW}mps{ 0gTvߎhtEǰ-3O#}EkIe,jz5k Q e RkuBD=TVUebjN|]f`jcpS zA吲9d/bU9<8Z:tCT3D~%%jHSLI6>:s)dB^$5`FJOR!-2@X{cy|MrI#ڎ5ٮsVl]kP>OEun`" FiꨞmTvůhW:^doD2`O$2,c ~oz1G3nax 8 HzD|)mH}2iMkw؇vkʮn52JfAE$ '~S ޥ~.U9A#r(`ʠ9֍QAjKr K,T9!nLL.pRl pu?gY" f70ЯL]oedn$r[c2nk %"؜G Y"L bJgUH*05sF1obƻy#ivKKK5 mv89h#gMrO.ND`|iz݀zD2>rmSJZгbkQEݯ 2ϫtAz6e(ȡ0) CrGFTb (LЬP XCg`O laC $tuQHO߀WVPn $PVY l>hna5{m|; pL6MǏx9qO/4w~Y__^~,wz Ko|~s߫3e[V{˫w,`e36X]d/ޥ/֥/La']c(T8DP/U_ G}UX{t@'Hzu?Zz@1  ѥ/q"Dw,?PzM9˒"+~ #{/8sk(8Z=QbXڿRAԏŪzSuy_o|DSM>{2^9R*̰in`c@39ZtRϫzPȯ}603kLt M P p:bCxҖnT[ !wԱHR"dSj`)YPVvCTقm9ALR 4C $ c B \,UL'CAM]}CeoT?3%@4I'lNL .FYh샲$# ER'lAV"bBF7N<|]7j[Uۜy[wRm^P"۰q @?VF4WB-.!2h$OO)KЂ/p$ Yi3 G~: 2܄)YhfXiz^7g 1EQ@1'4QUdp夣 =]1٪@6WsQz C3+DF|NȢ 5w"NP aa1xDZ|/Sc.m^* S3A kM)&([8GLY0S \xֈ}Gnjf g QY)Ü4X1Kك ^: UqUU^qWj)oK:Q߰t<=&r52GXRurZ>,dҶFٰ_'F39ٲ{ӲʐRa3PI)4bbI0 ksd9=S"Ou9%̏ 0úZ=6 Uȸ;n Y˅)M;;>eGB3R]e^qH]0MW08p#miPQJ ӈ!i\;-r^ի%z7n}ɓ2-.G$sGVvrlc)PKmWjFUpltpOvyRd uXV|v@wS1J6yrxHs~8Íw-OY\6^>1й;ﮪmG~@:Zv85<ɏ:XeZasuɼY_fv5ӴeukӳAߕ!^p}\p X#b X_SC3fDP}g=gsHfjEE* t4IC">l'=o(~6cRG2>:NQ { l;-exnsXCv@^IT5<ٲ{ov leԳ!Nz`k~{CTЄ1m.)])=ՙ b''*'[ L;|'EȷJ'Ȕ9IaFK `h&aXʈPaq]v=}< l)+ە=~2QM޻^b#?.tГ=]3F^YBުrHݴtcBQؓBiL*c}-3.^Rϣ2қ藾qOlT6M$4[xV'È_="SX Uj4.؞Q4_&MV~C&D|"]krUI OW*;6y/=[],?( + mL1!?N&q>|z"2_mK0AXwdo?H=c8<ӥzg^T/lhKuu]jBs(cV(z_m Ȼ ak(O`]Pj '3GS_)h^yi˛VhՈh͘/ӊ1-z-j˯5H{V3fӈK1Tofje8x^wdX'S% *ΰWGtk }~aAѻMp($ҮtBپpN ݧ4#3PWh#e㩴=R9~"d>!.Js+zrSrT` ~A#V(NK2T?FDf~FxZv^#m}QH]*ϸe3L[_n/ 3B33v|/G L u)GbvRiJs ̕Q?g'C=`tL6 )g To1JdMX7!V]ي}ю~XG.YV:ĕw|kShZ(Fg&\PKI!SSBCS4V?kk>Ag^1Z0PT[mު`u=sNac!-^͹\Guj U= @ZMmGw. w iUg8?ᰶݼ@#F?EzY2 qePdUX 5Ā6#=M%V(]R$glC$}Dۡ=gߘmhި8fRg ,8(&۲y+S#oY9qFI!7,66ө&<`w~^fFP1AW)H&*eD̙ds2aFSW>uqd\n¥XQ<12&XMuLpTqR͗2MD!q|]G9Xtj-#XG*EJWRY8gTlB-MP^j۷)i$;5T U5 "pGajA= EÇ~G<:$\zdFh::vy<Fr:8Nm4wTNAoXo8Õ )۷5ȱ (8ǙGG,258 P&+FAL1Wǹ@ڞ:aՆ{i[ǝ*:B8_d7C fl?ᜊcOP`ʔU*AX/Cs=/H9_2K%+w7$2joE/;x ~&[\;L /U-:N#J” +8'nyBʗ6: <7PoTM״crlwH_NQv |pNm1~a'#D#2#I[#:UFM*MzMpe 2+.;$OX:;qtXm\DLQ3y:l% O +T":dRL u&OrY+*NϬ{MyNo.*YJK&j6}v>^:rss׏?,;x2."qf}?L-{j!RB0x8Lr%v\%?ޑv)*nE;.Ѩee1JͺRE+Q J)LTSkz.iCrحb\N/ u\̨fFB4yiݨ5(0R{WUw^&Ԗl͘H}{odg-tz\~dJ̞*6h|DTm LO>NEhA:Cq\mСUkrKO-mǤUyu0;;⻆ր8E9`'||v w?ή:ي`?50f'j1FOڎ/_GCHl%[aN̦QG x!g6{6T0 1 e0SCJ\9h,l} jɦ s1RVThCh&I5؍9 }>Ƒ[4v5ɔ!MnEiEG;iЧat`1{;ޱLXj[;cm Foeǂ-u%Ŗa7͏2l0Dd)Kɯn3h?MI[˿5VV8%-,XM㲗_eZIp v;̎9>Zs[ Bc~0g#A+NLÃܷajv>H9z&R uKlPjsH@j Y0GZv]#D*_ȺP$ [0Ywg6ˍXN4瞲: 7il( K[x^r .PX.eq3yAe!2߀hYџR!TLBMpUz5nZAQH-:P@( )ɲ#GRWxr`b@j ŷ/xN/BjEB)O,iH 8yc0&WڲקpJsy14cbhFmbi6}5N.ctf:EMtr6Ɏ݅ ӪJ4K<54zsJI l}tl3Fəu(PFX1Ue}+ :2+lɢ)$кSEa./>pU:}{ۗ!/c9c #TA&_YE>'ۄΧ $95sG9j(~BүM<0W7Y]6f!<ݜ1e.-Ê X7e}||1 7gmVH|ͶomN m+P9sn酔ur"'&}}ZȈUW^ ,I^׵dHϣ-+ߡM&-˖XsljC R` `&!RR_niI+8]̗vOX> 1/kܺT o< @7C[6N3WMN"5bc՗DơR|eWF^+Au8TR"'1Epd42< LXzA0BB=&04?Nfa%5$'=axSNP IR=w7hYP)BD8 YQ*ĎGE,^Z%%#dz$]3'I{n,]Y ;%˟+y)P<@JPiY$sIu6YZA8Jr8v3 RI.T)|%EQW黒Cj ȇ P;t V Tzz!i }G#{{~a7j.p@ J,~ ! o5,94+KB aVr\~OJ}WYexV7ޒy9Em c2"UJާ׏"0|g+~_|zͽe]iۭf\,us%^^-ojwgl9|?eWG-_⫷^ZXeֺXˏ?? ~7/s~$/ c:`QH<)68|NonjLk#OwDڰ56x!KذyKmٙ>/[?F/}_΅n;]_\-үg2.<544}Ѥqd'9ZQwnu=f˵hCUU=]FWGU},cHI Ɛ)#k={>]7֌lT- =$+]d!+Q%Rvʭ7\Peh]w1}O=IUk-B"4Qn*]Z"&ֺ(?!}(tTD :! ͵6yg=?3o.hrH? l 0wiM (o5Eu: 3F[iyspTSdgry#tBxY2KYVjB3I'wo΅Ԏ//XuTf .ӔpN^Szt~9&Q C ! Q~ MFl7< E ۼ5uo^Ou9]mJ͓W"U>6˰(sܳ-  h]@DÂ+4 uzmS|B]ɲ H 36G>cEڬ/M_3am@7ɧU<5J%\~`~ut5w x]]]At-r|aԂgM`Ok=.uBZ~C?>d>~#.A|UxP6{Hz/o/ρ>xN'Ki&^[ >Yo0V-۟ [ C:"qgYFn@ڍTNMr2ufm2(صx&$I^QY#p}O~ltvLSi&RV'c^i7.: K.m̨dl ܶ2+]|-X'iN5{ݢS*BGwKA@K{m d Ve|u6Tkln[NulzcRԙ]ahFshc7u;;z^f<vgJ"Bqաe*SWFla.|Eꁝ<~rN@xР1e9<:kEh8cNf鄁t$)iRd|17_/GuffmM_BSGƳw`8 ̥o~/[RáE37M~UM%ؿ VmG]v3AB z)ncxRu]σ-nd d!CŝBُd@bZԽJr Vxg^w+Z%t>zXjD)rQ_ArAB)7!g 2͘7cʚ4a*YUb8ެI͢ 5 H^h(}E\X 3$T[o5:qb py U ݐRp;yh@H~ÑhcK Gx/)0֮nO|diG ^32 {|y&P"Wڍzp\sU"p~swF-ny?ίH˓Mb$Iqֿ1_ I {x+%U4g#_]CVFJ?Hoo2CMdr@u)OԌtm)޵'gxbԫ|ry~Rҋ׳ǫ(zwwyg عfL>f@b ɞ8]kqF]5|!&cgj穬kێP#-U(ed/]QAx;JjX.}=X r*=E_hvrT1S@֢AQ~e8, о볫?H0TON+g_|-U HPŒnW0sr>I{fة}+KފF#jU _I_Dv);NN?9O/*M2l2 3gV\fd T)sPćP,PX"g;# 8۠ vZ/I{0"E6qCN|ɋ;R-L޶--m2~5L]uK]W{ŐHM2Iۨ DH O$p^;)1E?35zo(5 K px>"BNhF^+&HM ݰEQX0&P$};Ooknq5-߾=pOo̺ëT6g&Ga~%q([(AWzŋ36Ch87{x\m,pv(y[٩IY!G`,5Á:OHIjhlf*P@NƉ<60]BSHXq{jraR#A݃+{{%[:a__=혫A̔N7E1aƥw>Gv.:*ljdQQ}آ Ad˞'<].;y,&L]I+?vK@EU(H1Z o'@8EӅu UaVV\C)]~~`6{*O:K6 7ITAF#t8HF iDL HCMrhQwN;S?^]VKYaՋ+z##m[t,ۛKzSGy M5"8{&z`@ziN@3tǟ?̴;gw\/Lwj ت_)̰&j RU﫱 L@'-T"3SI_Wa\yOTR tB_گ7(!`R3]k[6SgY 1%8!mBd>@h_!:xJƎ$f9?9l\~\|rSxj cD%)ћ f$)#Ƌ^п4r.ȓo$ڌJ9oBA\(aD =T@etymFQւOɒ|IۛT[˾׉@eBy{Xq=(x\Y3.V. F|qҏ~}?KAu^ʸ6tHnT)?&|LBjU)1?;693?I l 5Y+a*ȭv҃UQ׿{sfZ1BzشlrOYA-˭W ?3eڱzdwuS-; ߭.\%H":tLu.>2D6aܸm+\6!Tft~zTg)v!ዂuax˫NNTi""NcL[<~"b[wAA4|IvK=!K 4[nma #4U'ƼذEҍދUZ;Kp6dVdZ%~\fV3Ϗ]n-epk1xF>E^hl! 'Q ^ŽNjO R1+dǓ!s&!L:rv/ovEV*šdCd٭k(_jW м1Ojv)8'Pݰ6ńb]PP[d2it%z{2po'p'#!=[$U I 60e5@N%R]M PMI/RRԎB6 hWV>!qnN; H;L)L]+lE&a!fv%cc#O*q kV).kٶdEEjX)4U̼]a*ҢJfC`!Bu3 Ҥoٺ)JAW ]IMKލ mx]CAcŲɨN<"M @ `'mWհ3 ~(k -N^>NGx6qR'2$itNm.swryB1j6a>^pBTYr+l,77)7«eNV]VjL1tO"K?ZIG/+*B款 n_8u~֛\0\Zz`U wڹ۬r<[QQ?/ItJ@ܵ2J۩&Թ'{&bU3 |[Np={A3 =E],iYѭ- 1! a`5TtK0:‽vO #M|*A@:Ou\Hp98gEOBq\*.Fk6Q r4oZL3рҁ~Pkp͡f{wk&d)ik#?0T]8 o _L@5{݆|ān(Rw:[%cVȇ~l `N?b'Ɏ|=nůB<2bUd>_.0?H^vcCw#Oʬ3t?Ȯ]AvA;-Ly tE]l4/{+0qr_ Qu;[㏡_a SP`2 B|3i7pe(%&HINd62Me>"q*ib(*we)Ӓl|LWKzF۬pFkQY^#NIlVN 6*d0X4)E-K:E晖!i,:jLYKc-vEݖ(.{K|Kχ1A,=⩰_2֥Cٽe0OYZ@B=`rDUh[n^ii-o`.cȯCfI` ?Zݟ-o4u}P0m2GF[aL֌?b}b6\0\xt&ôH_B4Vs~)pp6QEIλGMfbAcJ~ˁA*dlhZXWzo :(I|4i~'1r( 8`85Hy+q[H05skS1!=sc!庥uڑV-LP#Fg]v?4(U  ҠVd*!Ij|/28+gX9VADZrr9&5j + YzΚqss(ZXq5KONMmJ3Tp>S 봤nk$0?*#bQd-ilq+t6P\S:ڗƄQ a> `c 6MD77j4Sϟn;U{~>6)?u 1_jj+wG.B!G.*6$fj1CPѵ!ol0(G=]ގp!FA#ȿYW%`պZ`/.jԁ =~JIN#@nWɭiS(0 Q36VnUJʕ$%QnZ@u3]s i`#`;*KdQ@uzʂ5%hiEԺ!n?=ACaް!cB;cO{'\Ÿ|4؍ʗx Oi| }eRO8>*2t'@X1 F\~mP;=r ynlɓx_'ZyNa6wjg=pP\Ƴ P g3P ']9恱%K҇*V}"Ig ĨS^GR<5z>Ӫ{o\][[%-z Tx?qer&:ȯ)USU&i6ݥ*<9B1͔~ 0Ǐ#pJtޛrgy$v0>#B*p3)JWq+ KF,H㭏+9Rxg@WueЂ<.ٖ֭| d/&J>  c/E% Τf~U~fGW,zKqM oDztGM>y-I?P!̕@Vx *q+VSي: ?Hw"Ҿm,o]x |n*9 3Eadon9*{|Eo-y`JJ3%ˏ'cCc(*1i79~(q'0<Q^*K=X E4qƲ>Ӗn2>aV}:xR6ޑ,xMjpXH 3U@zrId%ū8?PwG斶-MkyC$Gbwžl[ev7/5aAӆ7#ict!$9>ӽ$05p f96Խ@먰q׸R&;n$}LӖa{bi"] *4=5AHs5":2,.!@:`J0DQ\§2Otșٽ4AРP jx4n!YδK2Yf[A *!˾1=+"({tf@V 3=:.eq9Ny#k~{OzqnP 3š1lR>z@^ߗ(*Q=*^Y" ⎫*5&S/hzفeZ&b4@UWayHʪܪf(c\1OtP bz3|r>a>Kz@+$֛U2)&)H2u ,@RLuE'&׍R[jDϑeiRt5V@O+=c//+ێɱ$KvyUece$WW b.)^\;D \$=JE% fN0A=y5)SʳR76 ,$tLtq:fkBe^d "Bbє9)\HNHcUVV($SXp C-6HRc*TKu:Y`B2L'Ahužy*j?p_\|sañNdew>X<(r­'L4a1^D(nh<ŎÄӇ"'SRX Qbzy>bpL SO7EǍOUJlWnU:B֏49@O͎y@ }u<Źv*E=$^3,yq{ȪxKR+Əu%[WnF1ls{R)RJcyz{_-Kal[]las9d5d< )Ꙙ'[8@tL8Dp(L,/NI :atQiK28Į WiBMgٔZEpo:R0m8߲H㎒Li'sSC9PV#\NUځ2wNzl L΃TZT3`5E18)6Eq 81_et_XmAƬ(r^Ql+*"\Rb<u-árF G[+PYၵ! 4:> h7D 5ǟ, v"$,^]l)VvmtjkSLSbujf}WŹKNI])fM[q`dZX\MZ||̧/< <=]1k" ׻FvT*F .x8 :uɇeK|" 's(ZqgqV A+<8BuN Ek e642 l$7IdtjFz ~ZgʁJ;#=sդ- Ʌ>ɱxd'7%Gy\?p{l5czdZ)! s-=EÙ2+9*,ｍs^rh ՁAd8U-,BZ6/bG/@t0ŸLsf_1{1"N-9!dRW ߤ"/p:,zc1mED`+"D(q6kh)̨5,̐J!b#!S4Z[^xdw=,ZQ3 Ʉ0e:C. wށb̲"Hۂ2*/ B)$xoRD[0/y BjCF)wc6eiB8T5D$n r"22%Lt.((i9:191;By C/j5myf˪-jۏ!_|FMf$Rڒ7Z !q_fbCY)* !׍&!sOddd}2%`4%,rJ7FD$Tz,r>_mzНnW5]%K@hBv 5>P`L<GVe8#&¸G -HqUt-TNa~k׶rz:rdW™-_tGh'%Eǧ+5sV/!N[cEoyb8u|'+X#|3K9Dߗ[-ƽ/q-c7Elo\ 1ʔ9ZW:&S+Sk7喬!=kO-UDd#IO' HVDI 8z[ٶU "a$WƲY{[qPI$R1U km(15M}$ٜkqjQ@ٮW7X]GTQW*1a7r? ݛ&v^ܡGp,zJo^?O#9;]J ?Gn~}IlE9BI._xs2$@6=ul͡\εyAeec% }_DFK‚򚸧ͧfjcnWjq } Z"ee]aoxQuuڳcI;UaKCoVݦBJ#Q2vjϧM1=LP '݇gyMoΑJ#Z=fdkI[Ae {f]2ӧ32`%j;IwWSZSGv@\mA~.Xsh@bPOdj9ϡ*qyHg+Ia{)KdIPDG%ʝq @S0v;Ss H5cxr}]Ze7ޖnDN(n9Y6\F>޽"PYtyY2Z:ϴbNDnbki7*#Xdڦ)]ASuv&eMg^6Y2'#T:/dHʄЫolVB wVYpX>gT3#QP9b/lꈲN$u-M(B((źFvƎm- i!eP4ft(Hf~ɺ}?+v M4yNɨeDLۋ]=y⛌%=aPa2ďꂙIv[*9q@:bވΩj1KTؖ(qB㰗'nG漲[o+ DŮ؎UF'ABLj @.@^ X<&S4m\KNI^[UO2 241y)'aaRIeJR^a40jp9,Ȗ"ڟOX<f]SFQ0LjEʞb,'+ SOjZ6ȁ* Ch$a=<e0doX0V~ Ĩ2¸=M3h!y lGsö{Wx=6Jwм[bm/9K}2êhQ/$xP{(ʺ$ܤEFtD/1|tBP | u - K bS? ǰ !houHAHbi'[A38*-Fd !m`!6b'I4.z;ܾgi+^lYpB+,.(3&ˢVV7*'qTH9Ҧؙ+fiY=&Nb8QoJq-t-)%G@Tx .@@jʟl/'Fv(M2bk}lUvKy M :xtISD??x&'xK*OSܞGȗNNKTP); 2WKƌOJI͇)zE=AA)0:5fWCAY0j 2@GqwhWDSISx@("A7VA}j$CAḾN]~N]~fڄZLEt|?Tg70}{Pg.9!OHؙ!3&Ok_jU9gogrKvp)^~lc ^}Lw+)Sox3-{ڢ"alUCTX9yf8NLLX헟>іء v29(:22O $ڀA ew:1^ѐ~cf|x8;O`8oNOgB.}a7,3{V<ɉorP uC$[2+$h ?(n݈N5.p&o`OOni Rsm7!%QaCB&C#Za _؆a.a #mUܯEЋ(ng]zB#:R* %&XK'ED*zאm Hiz4Vn^7BAí595sJb([>滆` '%jq @ƴqS AA"zEծRSj\Ժ!iHo9ڒJH<*!:7ݫjovm^(O?H2qe']2}4ܾ:Ѡ8_q\]/)^Jζ)@Qu*_M q+2R.<P~O^z,b=K`V6E;$Ԩj)'%!J_q[h6 r@iC&!XƮ`Fa\ s ɬ_΍$"Ԅ S@Ek9Bu5{l`@-cc4-9+֣fHjucm6,V#[4qt6'6¤]5^ !)LΝ)qr0R$ m9*jvMjYU,dIXf(LalR g }r~󕋿.t /9Ӡt؅ epTQ%r^!2-v!0dh#$f)<ѦXg'33G齄5Х焧95!ˬZI|9?7rQ1 J?rQҷ܉Ot7OL٢]?< el e~>,DW_.Pkʊ?|~X_=߿7Wssq7|_?#oWzsͷ7? ˻%^\ 7vpwux˼!wt*=s:Y . PguU"}7o'] N00vLK_ pfO`H2s˶)bGiH"@  1 E rd kK6)*UsO?d#'TÓ"G'҄z?(xr3 p*g{ 5gwt2"9v " Jx!/yN,N7{c0xr/Dq"`lW5cNt5;P ,4 &5"֝n8բѿ0m[8;nt NO7 XP}rSzУC㬬=`ٜp1-0ˀ/,Ǒ;KQ8[ۢȂM q&v)JYU. (-5*ꄻzvѬ7e@1oF?:dKYW6zlJ;!bK]uj]gY'9t{!Sۻ<ӭ7G<#pa"B e}֛o_^Heɺ$_d;+ay}qe[^W{8=W{q'әflΒ-h0>(3 IKhCht$"(KiEr@_Wش{K&X!&V݌S%gD`\JpC+s7DŽnP醸|jow&91I?E:IBsE߳fD_S}BM:l MSd;HE`q~jG2ݶ Bi4Aڢ" K–"s%pa. ZyM|Z{:HV6"A+!wW(4浦vk˞p#ZG)k4rK-Bi ~za>T+^:R%:NGG8;7#>+a PѴ kk" ,tjre!٤r۰pWZ|`Z @FmmHm^jBiԵ?Ї.Wo/[”vKOyD(Zl47r,Im!|c c  PcH <c c@  0   ', 8 8K Y< l8 4 0 , ( $ L @ 8 d( T&! D2c Fc X4md eX( v`( `( ) + p, , $@, d , t%- 6- K@c `P. Pl. @. p/ c 2 2 2 TL3 3 P6 x5 d 5 t}> }> }> }># ~>.8md :< H< ,\< j? yL@ h@ $<~>Tc c( 6@ $D@ ,XA fC uXD tD $L~>c xc( D F F F  G $G "THmd P  P P !P /P L:Q dExQ <QT H[T gX vT X (T X l~> ~>0>> >0> p> 5>J> Z0>|jc zc  c  c  Lmd X X X X X 0,Y D pY 6@Z DDZ HZ dRZ |](^ iX` 0uP` <` ` lb `  ha ta >>Pc  Xd  xd $2 d C d O e ^ e k e x e ` h  `g  Hg  0g  0h  j  k  m @" > c  Tmd B/ q PB s O s \ t `j t x w T dw  pw  xw  w  x H > >  >@# `>@: >@L >a > | > > >  L d   c  c  c  ̿   , * B [ c j B D  p#0>J> D  \>@ >@ d>@ $>@1 >@B >@T d>@e $>@v >@ $>@ >@ d>@ >@ >@ | h  t ` $>>#>  @# @6P LG Z  i \s @8 4l x dH!!!@!l\!5!(K8!4bl!rh!4! ! !( !<!@!0'!L+*!Cĝ>@#>R,c0 d`c xdc hc$ od qd sd sd sd sd sd sd td ud  wd 1$wd G(wd ^@wd( jhwd@  vc Bd d c  O!$O!LP!\ xP!'8u!@W!Oe!L_m!p>z ><\>x>(d d x!H`x!<d d $!Dh! |!/L!?!$X$!(jL!Py!!l!d !t`!x!x!p>>P!$ t!t!*!@7!$E!]!HjP!hv!!<!<h!!̞>ܞ>` c d d ćd H!Ax>*BS! a!|r8!!0!xh!8>h! ܮ!$!!!$!|4!h!!h!!0%!D,!@4D!>L!xQĵ!b!dj !q!l{!d|!l!4!@!!<!!x!!%!.L!H!pcL!z!!H!L!t!!̭>,>><D>Sd!<!$!,"!/!8$!TDx!O!(Z!Ta!@iD!sL!|!!d !!\!!!! !LX!4!h !l`!!@"P!<B!H)!`14"HD|" Q "Zd "8g"t\"x>xx>,>Ȧd "`"`"D"" ""," ""D,"D'p"d/"6"d@"J"Z!"e(""l$"z&"&"'"t(")"l8"X8"T/"hD0"l0"@0"<,1"4"d5"P5"\6"!>.Ư>ԯ>9ܯ> E> #H> QT> `t>,> klc ~pc 8"8"8"\09"9"h@:"p:"XC"<E"8(>9E",FE"`xF"uG"dH"dH"|DI"d I"t$K"V"\X"H \"DZ"f"X$> #-> <>c pd td $d 2pd =xd S q"LX"H`z"` w"st"4 w""C y"0L"́">@ȱ>ر>!"", " l"9"R"j"8("<"x"8"P<""x;"H\Ȫ""p" > ><D>L> l>@"d "H! X"1 `"@ x"P "x` "`n "p} H" "8 "8 "P H" l"h "T!> B("d "t!"+!"d7!"D!"`Q!d Z!d i!d x!",!4"0!d"|"$!"$!"!\"t!d d !d x!"<"0"<"l"8!""8,""T="0"XO""^" "\P"4!"4i""Tw"pd "td "$#$"H#"#"##d #t"#"# "#T" #"c #c # c( # #-#$ #?#< # R#H #e#` #y#x ## ## ## ##4#|#>#xc  #L#$ $p#($#@($#;$#F$d #DP$##_$&#'#d  (#tn$d y$-#$-#$4.#0$d1#H$1#$1#$$1#($1#$2#%2#$%,2# 9%82#4P%l2#^%2#n%<3#l%3#(%6#l%4#$%5#t%h6#0%8#%c8 #>&|P#8%&P#,9&P#G&S#a& S#{&Q#P4R#d R#t&T#&T#&T#&T#`&U#&$U#&@U# '\U#'xU#/'U#V#d V#tA'\W#R'0X#Tc'X#u'Y#D'HY#8'Y#D'Y#'Y#,']#'Tc@ 'e#$(g#0(g#)(h# Hi#t@(i#S(Xk#P^(k#q(Xo#\|(q#(s#@(>($> (d (d (l>(\#t(p>`(|>h(p> )>h+)> F)>h_)> }) >h)> )>h)> )8>h*,>  *ĸ>h:*> Y*P>hs*D> *ܵ>h*д> *8#*>@ *$>0+#4#+,#8E+d#^+#x+#L+ص#X+0#+#d+T>l+T#<+#L+ܺ#,#4#,Ľ#<,#M,#^,>0#q,8#,~,d#P,#$,#P,(#,,T#D d#0,H#h,$#,#,#,#D-P#4-#t1-L#?-#J-?U-?e- ?o-c {-c -c -c -d( -d -d -d@ -,d -0d -t#8.#.l#'.#P9.h#H.#$Y.<#hx.#d.d#.c #P?.#@.#`.0#8.h#.#/H#P/#5/$t@/$#$Q/#Dm/l$P/d?P#?/4d /?@/c /? /? /&?/-?/$ 0($0$c *0(c {-,c 804c J0"$X0"$xf0,#$<q0h#$}0|#$d0#$L0,$$\0$$00$0l&$00&$1&$1($$%1)$T11,+$@1H+$O1.$`1/$\m11$`~1,2$P1|2$P14?1B1h8$(18$1P9$819$,1:$H 2?$2@$2tG$\/2G$=2dH$<I2H$V2 I$d2O$p2P$x2H?2?u2^?2c 2Dd 2X$2X$ 3,Y$d3Y$0(3Y$t134Z$(;3\^$3_$E3`$O3ta$`Z3a$c3Tc$m3c$dy3Hd$,3`?x!te$<3e$D3e$`3Tf$3q$3f$3g$3g$(3g$4h$4Li$@#4i$94i$E4n$Ln$4U4o$|b4o$n4pp$hz4s$@4?4?4?4?4Hd 4Ld 4Pd 4s$(4t$050t$5Ht$$-5lt$95t$(F5v$TS5h~$_5~$h5P$5$5d$d5Ȁ$5؁$X50$6$6؈$'6? 16?;6c E6$$V6،$4i6 $ }6?H6@$6H$6L$6$H6$6$d6$( 7d$0#7$,<7$f0$<J7ܓ$PW7,$\g7$\z7$l7P$d7$7<$`7$7<$7$7$8$ 84$8$8'8@$580?t>8?0]8?F8Bl8${8П$|8L$8ܣ$\88$8?08(?B8l?8B8Ĥ$L8$9 $d9$`)9$839$d=9$J9@$Z9ܧ$,u9$9$P98$$9\$9 $09? 9?09?9 B9P$:`$d:Ĭ$":D$8,:|$@;:$,N:$|[:d$f:t$t:$:?:\?0:?:?:Z@:d@:B:$:$8:$\ ;L$  ;X$47;$dG;$O;$4^;$8m;$;$(;($(;P$(;x$;$;$L;L$;$ <ļ$p<x@#@#<@0@B<@+<BQ<4$_<D$8i<|$|<x$8<$d<$<$$<$<$@<$  ;$4<H$<$ =$ =@$L!=@*=@0I=0@2=BX=$f=$8p=$}=\$x=$ ;$4=$=$$=$=$=p$8=$t=$ >,$T>$ *>$?>$U>T$g>$`|>8$@>x$>$$>$$>D@#b@ >o@>@>@@ @>@0@>@.'@=@ ?P@>B?$+?$8f0$<6?P$G?$t[?T$hp?$p~?,$T?$P?$L?$?$?T$P?$X?$@$@d@$(@@0H@@1@ BX@$lj@$t@$h~@x$d@$@p$@,$D@p$d@$@T$@@$P@$<@$ @@%X@%@%`@ %( A4%AH%@ A%+AH%6A%CA@,eAp@NA$BpA$ %@~Ad %(A %A %4DD %AX %0A %A, %A %A%0A% A %f0%<BP%!B %H/BT%X=B%VB%P%deB% \%twB%BT%dB%BD%B %4BT% Bt%B%C%CD%C`%`&C%6C%?C%%HC&%WC'%nCd,%`C,%C/%@C/%C0%C`8%LC8%Cp9%<C;% >@ .@>@@ C@@  @@ #@C@8D<@Dc DXd (DBNDU%DZDTV%|jDV%{DxW%DX%DX%f0M @ WM @ _M( @(pM0&MP @M(B `2&Mx2&XM2&M|3& M3&M3&XM5&N5&$ N6&,N@6&#N8&84N;&@N;&WNx?& gN?&~N A& N,A&ND& ND&NH& NH&DNH&NH&Od @mH&,O I&@#OR&L$ @2O@7O@!@O@UOv@jO]@OJ@O6@O!@O@O@!O @# @O @O,B P0Y&DP@ P]&(%P]&hdQ\^&Pa&)PXb&h4Pc&BPc&Qd&PPe&pPe&\{P@0Pd@P@P@P@P@PT@PD@ PD@Pc Pc P0BPġB8Qh&$LQj&dQdn&<uQq&Qj@0Q@ Q@ QF@Q@Q@0Q`@ Q@ Q@QP@Q`@0Q$c  QDc  Rdc0 Rc Rc Rv&!Rw&DRpx&xR@RRc ^R c mR4BRȡBRy&My& My&Ry&R&R&R&Sl&tS&t&ST&>S@FS@  @`JSl@`US@ ]S@@jS,@ oSL@uS\@@S@ S@S@ St&S&S&x@@ S,@Sd,@S+@Sl,@T,+@T4+@jO$,@O+@O+@7UO,,@7@Ot,@7T&D,Tԡ&X&d &t@T0&UT0&eT$c wT(c Tȥ&T(&PT,@TT-@@T-@T8BT& T& U-@ [U-@Uc  %Uc  3U/@W( c Wd  W8&PW&W& X&X&,0@>10@.K0@>g0@5X0@0@ 0@0@#0@EX̍d MX8&XX@&DiX&PtX&pXD& XP&,X|& X&X&0@#0@ XTBXl&Xp&Xt&X|& Y&Y&P Y&P+YL&8/Y&0BY&UY|& [Y& dY&`wY&Y&Y&Y&`Y&tYT& Y`&,"Z& Y&Y&xY&l1@l3@Y3@7@ #7@  7@ ZXB0Zt&;Z&wY&hEZ&Y&\OZ&YZ& dZ&@Z& oZ &Y7@#;@yZ\BZ(&HZp&PZ&ZX'dY'`Zd'Z'df0X'<Z'@ ['$[h'|9['S['Tw[' ['#<@[xI'L[I'D[J'[K'[M'[N'\O'H \O'@\8P'B\@<@ L\`<@V\f<@b\~'{\'X\('\'\' l<@<@<@#<@\P c \d \<']D']'Aؒ'@A' .]$'H;]l']]D'|]']']'H]']'x]'8]' ^H'h'^<@3^<@ ?^<@K^ =@W^(=@c^==@o^R=@{^g=@^}=@^=@^=@>=@>=@!^=@.=@>>@^0>@^F>@^[>@^n>@>@>@>@^>@ >@#?@^?@^('_'@+_<'C_'X_'f_8?@ n_D?@^T?@{^d?@w_?@_?@_?@ >?@?@  @@"@@#9@@_'_'8_' _T@@_h@@>@@_@@_@@`_A@8HA@"_jA@ `rA@8`A@8,`A@8@`B@8Q`RB@8e`B@8v`B@8B@`X c @\ c `d `(`(#C@ ` !c `$!c ad =a((a4C@a`B[a(Tva(@a@c a@c ac ac a( a( a ( a@( b`(!bt(H5b(0Nb(@gb,( sb8(0bh(8b( b((b(b(bH!( ch!(Hc!(3ch#(Cc#(D]c#(wcd$(hc|0(c7(c(!c c,!c c(d c,d c0d c4d d8d d@d TP(alP( "dP(1d Q(hQ(d Q(t;d``(lj4!c KdDd ]dHd odi(di(di(di(di(di(ddBej(\(ej(t=e\k(TXek(}edl(edy(eE@e E@8e!c e!c e!c e!c e "c fTd fXd (fc 1ft(TJfȆ(ef(f`(f8(fČ(fld fc f c a( a( Nb$(@fd(|gb( f(lbX( fx(fP(dg(#E@ $g,(-g(?g<"c Mgpd Wgtd ggxd tg|d gpd gpd gtd gxd g|d gd g(g(g( h( h( 4h(Eh(Wh(ih(|h(h(hh((dh|(` (thP(h(Dh`(`h(0i(0(i (<?i\((Ti( (ei(Dxi(DN($i(`ix(,i(i(i(@(d x(ti( i ($i(tiD"c jX"c $jd 3jd Kjd !)!)d 0")ti") #F@ _j<)\oj<)jȓd B)jdD)jE),HE)d E)tj F)8jxQ)jZ)@j"c l"c  j$c kd kd kd d)0kd)=kle)PKke)T_knܻ)TSn)Xknܾ)dn@)n )n)dn)n) n<)(od)l1o)`Qo0)boH){o)<oT)DoHd oLd o0) oP)ol)Ho) o)Lp )$pD)|p)'p`)$0p)>p)|Pp)^p)op)|p)Xph)p)\pd) pp)p)p)p$) p0)p)px)\q)&qd)5qF@?qt%c Iq`d$ _qd$ uq̧d( |q)@qT)q\)qd)ql)qt)8q)Tq) r)r ) 3r@)ErD)iL)Xrd)drH)8or)xr))drd)$ )tr)`r\)Lr)<r)(r )0s<)0(sl)T?s$*Ps%c ^s%c ls%c xsh*ls*sd  sd  s*s*s|*sH*s*s*tP *0t *tt * 7tG@0=t%c Lt%c [t d` std }t*Ht*td td tdL td( td t@c *t* t*4t *\uh*t*u*Nu*XiD *ku\ *Tu"*xu(#*u %*u0%*u**u1*t G@H@H@ #(H@ u%c v%c (v%c XH@hH@wH@H@#H@TI@  aI@#wI@ I@x%c x%c a* x̳*)x*6x*Nx*ex*od*ox*x*x*x*x*xI@xhB y*!y*d1yT*TLy*[y\*< L@  L@#L@ cy +Tyd +,y +l +d `+ty+y+yL@ L@;|Xe @|`e #L@M|0+a|8+Hy|+|+|+|+T|+ | +|+ }+!}$+4}(+H@}p+S}+g}+}}+}+P}+} ++d}x+}d+}+ ~de ~@M@EM@#VM@ "~dM@8,~e@ a+ 8~+L~+^~ +p~+~+T~p+ ~+~+~+i+~+8 + +#+P8P+X+d +tL0+h`+0s+P+<++(@+$H+P#M@ `'c d'c c@$t`@ :|b@S~`@mf`@c@n_@_@[@рDZ@~Y@T@ tT@%P]@7@]@PR@bR@{.Y@X@]@2\@ʁ\@D܁\@ ]@ \@*v\@6W@HbW@ZV@lV@V@S@S@‚R@Ԃ&Q@P@r~U@ d+l+t+0#+l,+@=P+TH+TS+4]+nd+P+HP+$Nt+,x,@ރe@ǃHB,8,(,,e@LB<x ,cf@LPBt , ,h$f@TBÄ\, l|,D΄,,\؄8f@,p, H,$l,@7,<LHf@<\+,$h ,,@`,,@,,-,| .,ͅ0,8څ83,L3,| =,t t=,x?,X3@,GB,bC,|qf@yh@ h@Hh@ i@ i@ dž i@ چ,i@`i@i@8i@i@( HI,$lI,$\K,0,$(,dN,8],mT, P,tx,D*c *c le$ e ґe e ,D8,r@*c +*c: 7,@ET,$Tx,Dc,s,t-p-P,0c H0c \-t-Xђ-@ -LX -` -:x -T( -k -xH -x -P---ϓ-`ݓ-- <-(-Cx--d^Ds@lDt@{Xt@#lt@|w@ <%-t&-d 1-2-|ϔx9-@ߔ;-?-@TA-D-8$E-@0@0:0c E1c S1c _@r@Љ@@@@o@ŕw@ҕ8@@H@I@X@%[@a5h@F@)Vx@f@2u@@@@P0c0 H2c( ʖp2c W e ؖ e C e XW-(\-\-8]-M]- '(]-D8l]-K]-`\P^-Po^- ^-X`-X\a-,a-їc-Ld-Lf- @p@0@PFX@@X@@m-Mm- er-,ss-t-ؑ@@XBǘԡB-d-,-@1P-0E@N@R@[- cؚ-0v-@@ e e e e ΙT-יܦ-0 -,M8- [X- #@ H--@ ---O-xbp-0u-@-xX-ٚp-<- |-@@(6-X-p[X- Mx- Lh-,Y-z@c\BءBh-@@ .ț.lқ8Cc ؛l,. |3.3.,4.@5.d d5.t  K. W. 0W.`.8 (a.$+Lc.|9c.Fpd.@@UDCc ]( e h, e u0 e ~8 e |g.,g.g.4h.`#ԩ@@Ȝ e tl.לl.Lޜl.T@ (e( Pe  pe "xe  /e  Ae Re .cĊ.|̊.|x@0@Xԭ@ȭ@ Ý@ԝ@@ |@h@N@#2@3@B@Sܬ@bƬ@r@@(^@"J@4@Ş(@ ՞@ @ @ H@b,e ,e --e .5..,G(.`Ե.,@k`BܡB ..Ɵ.֟l.P.8/(/ / /D(P/x2ȿ/K/Lm//`8/`/̠(/ڠ/>@.@.@>B@>U@ b@ >n@|@ @ #@|0L0x0$0+T?003?0,*?0$2?0$=?0G@0V|A0_B0T@  @ȳ@ #ճ@ o^0xd_0_084`0c0j0Xl0h̡l0ڡXm0q0< P@#d@  q@ |@#@@ [ȶ@.d.e DdBgB80d0<0p0,L@ʢ@Dc Ԣ.e hBB0Dc 90<#@ J0#ͽ@ܽ@ e0@u@(00@Dc lBƣ00ԣ$@000D 0|0(0@T1`;.e E/e Tc c1q1e 1,11X@3eH H3e դL3e @c @c c %1X(1,)1B-1LP3e0 e 41W61,e461p71 y871H713e c @;1\;10y<1<̥@<1t<1x,>1 ?14-@1tQD1a@$kU1V1$Dc$ 3e #ľ@5e ɦP6eP 6eP 6e :e He1X!e10f1=pg1`yg1@EԾ@O$=e c@c ur1,$s1,s1s1ħs1ިHt1ا1l$u1v14Pv103v1STw1`4x1pnx1\y1\}1|@#@@=e ¨BT@111п1H%18Bdh1m1} 111D1Ω 1LX1d 1t1DEc T?e X?e \?e 5`?e Id?e [h?e oc( ~p?e t?e }?e 2 2ª 2|ԪEc ?e ?e c 2>H2Z2Pw$2Pt2p2d H2t?eX @c BBB=%2L.2L,@#>@c?e0 wc c ,92<2<2`<2 =2ά=2d\>2ܬ,@2\@2@2lC2  A2p|A2xA21B2d>HC2@L V2eF2<{V2 T@ ]@ h@v@0xEc |Ec Ce Ce $Ce (Ce ͭ@c B\2<]2' ]2/^2: ^2H$^2ULb2@fEc eEc eEc ,Ce e20D@ X@jl@@xc yc Ge Ge Ge Ge Ge He He THe 'BKc x!4<W44b4 n4 ~04HE4x4L#@XHe l 4 4T 4x!x&4<&4\'4'4 *40'4d\*4lE4*4L0D+4P,44>,4WP-4Hq-4l.4.4d44`44;4<@$ @@+@<P@$U,@$n,yc }4yc He xIe Ie( Ie  Ie Ie B >4t\?4`#?4BD@4$Uh@4(_@4|s C4C4C4|D4HX4H\n4x i4LH4t@$%@44@,D@U @e4@ v{c Ie Ie Ie Ie c @c c Dc Hc Lc Pc 48`We '4<4Q4X4til4 ~4<̯4T@ dWe t4hWe lWe pWe B4 4$Ļ4L#d@94L4 ^$4(wL4\44 44h>@#@ @@@ @|c |c u,|cx tWe xWe B,4t:|4HF4pY44Th4 u4p404,\4L4h404<d4\4$ 44H!(4+@F9b@8Ec( R@c _c mc |H44TX4dؖ|We 4d @4t4t5\We We We 5d$54X5 5 55"505>5xN85h5dn`&5 k@ p\}c |d}c h}c i}c d  @d  d  .5/5,/50X05|D15X.J5 #8@:}c JWe  V<[5pb[5 s[5 [5\5,0\5t\5P\5\c5D^5$`58؁c Xc( c )cX -c BcX F@cX JcX NcX RHcX VcX ZcX ^PcX bcX fZe lZe }Ze Ze ] Ze $Ze d @d d Bs5zs5t56Lu5(Ftu5|Yu5(pv5tw5w5dx5z5{5Lc (Ze %,Ze 8d Id ^B545L55<L5$5pȑ5h5H@0Ze #8Ze Bd M50Z45l55(@d  'd 5`*d  (d `5x@ #@ c @Ze DZe 5t5*@(/HZe 6LZe @PZe W 5_$50g585LuL55pB#@<54p5 5\"5015>50N5[D5p5p$5Dh5H5T5X5P50 5|#545xI5]5qd5<5(5P55H5d H5t55T5H\5-5E5h@>@\@ ac mc uc c c c c c c ȅc Ѕc ؅c 'XZe 8\Ze J`Ze( \Ze kZe  wZe 0[e 4[e 8[e x@[e  @Jd 66`66X!606H?6N6XX6`_H6{c `[e \d[e x! 6<X 6@!6HE4!6L!64"6%6(%6LJd &6\D'6dh[e )h]e 4Jd IJd _.64s.6@66,G$6TSx6a@q^e z_e _e _e( 8_e D_e H_e L_e P_e 66`64H6d 6t 66 664<6(BNd SOd eOd y66@<6@|6p666|6P|6P686d 6t#`626F6P6<b`6pl6D66XL66<6 h@ |@>@ .@ @@ #@@c Pc X_e &\_e 0d_e Dh_e Kfep ZXge jHhe k8ie y(je ke @Od Od (B6`78707p717tG7]$7t@c c $ke (ke ,ke 8N80Y8LZ8|4@H@Dc  e (e ,e "Tq8@ut@@9Xc G\c8 Tc8 ^u8l~84|~8408@@̉c Hԉc 8d 8tLe 8@T8@8L8|Ȗ8|D8l 8ל8L!؉c 2܉c LPe \Te _h8p8\@#@e De He lBĬ8<8,,84`8pЮ8+88d 8t6\8?8PP8d8t&@?e@  o@#@ @ ؍e e e 88888888 8 ,808+@8l58E8R8^8l8z88888<@LpBtB 8l8(8xC8Q8P_08Pk8,x8<8d8d8HL848888P@X@@r,@e @Sd Sd Sd +Td 5@Td ;Td ETd [B08<l88848ޜ888 88x88ל8LD8x 8l(8D&l8@58@D8Q848d 8t]T9o@@T@h@|@c e e $e ,e 4e 8e @e !98"98i%9iT%9@#@&De 3He >,79ޜD79לL79LG79hS894j@X9vHX9PX9(Y9ޜY9לY9L Z9@`Z9tZ9Z9PZ9\4[98l[9 [94\9$!H\9]9]9@ ^9H$h^9/l_9$9_9Dt`9HV`9`_a9@v\a9Xia9a9hb9f9g9hr9Xe `e de le pe te $xx93 y98EXy90Pz9x\9@k 9}89(`9tԃ9$99449d 9tX9(9@9P܍9t99 89LHc$ +xe 3|e =e Ke We a,e r0e ~UdH 9ȣ9ܣ9@9949 T99L09n9 '9h99,C@Q@be( ue Ud Vd @Vd kDVd L98lc pc e Șe e e e 9T"e 0999dH9`TD9]@9Di9,q9(~|c Vd x9X99@ 9|9l9 @@@ @:+:D9|:R:ce me Ěe Țe Кe Vd @Wd :0/:@@ c ؚe ,ܚe 8e Ie Pe We _ 8:q<8:Ty8:08:@9:9:p::,;:D;:\P<:<: =:>:44?:0Fd@:V|A:8lB:hF:TpG:`:$e e  :<H:X:@:|:4#:\6 :HIT:[܈:r܉:L(:e e e e e  e $e (e 'Wd 4Wd EP:XN:V:H:$dl:,w:T:lX:`:(::x:h:L,:L:0:Ȣ:l&:t2:=:xLԥ:Dd:PH@W@ ^@ h@#y@o,e y4e 8e @@ @#@@  @ V,@,\c lc zc c< Ԏc ؎c ܎c c c c  e e ;|e e  e '$e ,|B#X@ M8=@\9=jc ٤c |(e Zd  [d F=(F=G=G=Lb@#q@HL=\L=8Q=S=_@0e "4e 8e &@ F&@ N&@ V& @ ^&@ f&$@ n&0@ v&<@ ~&H@ &T@ &`@ &l@ &x@ &@ &@ &@&@&@&@&@&@&@ &,@'@!'@,'@ A'@N'@b'@ m'@P'@P'@'@'@'@' @'X@'@(@(T@ /($@:(0@K(,@V(@@i(4@v(t@(<@(@ (D@(L@(@(T@(@8(\@(D@ )d@)@1)l@?)@ S)t@])@m)|@{)l@P)@)@)@ )@)@)l@)@)@*@L(@ *@c "Tj=*@'*t=(5*8t=|I*t=,_*t=o*tu=@*v=|*~=*@ 1 =N4=*P=*@ *,=0*<=8*ܟ=*A +A+ A 8+!A@R+P!AW+#A@q+=Dx+$= +$A@ze +=+=,+=,+T$A=$+=T+ =\ ,h=`,=<),$A.,=DA,$=],4={,D=,=,=4,=\,=$,%A ,%A-%A-%A .-c E-e ]-e o-ԢB-D=-=8-=4-= -= .=0.=8.=V.=r.=.%A.%A. &A -/,&A .c .e .e /آB#8&A #A&AE/\>Lc/>/p>/ >$/L&A`/>0(>D00l>G0> _0>8u0L>40>0>0>x0>04>8 1l>xA1><a1>1>1 >1>h1 >1@ >2>x*2>$G2>0]2>(t20#>2&A 2&A2&A2&A2&A 3'A 3('A 34'A A4@'A 3c .3e K3e b3ܢB3B3B#4Bf4$>Dw4$>L4H%>4&><4,'>(4L'A 4l'A5|'AA15'A 5BG5.>W5$.>Li5p.>Lz5.>@5.>5'A 5'A5 (A5'A5(A5 c 6e  #6e  460>O6,0>Dw6p0>61>601>62>86@2>x6l6><72>\&74>774>hJ75>g7X:>75>x7(A 78(A7H(A 7B7L<>80=>t#T(A88\(AL8(A BBTBdBBȢBԢBC @[d e   ]817tk8|c  z8 {;8s:D"818nd 8n*8W$ 939(5:9"0K98`T9q)Xb9(`o9F(z9+98X7,9Mn9Mn9X59d}%49P:9j5 ;O6:\5:c +:c C:MnY:L"0j:`=:t-:(8p:':-`6:,:2,$9`:$7(:3 ;= ;d /;p6t<;D< TI;c U;Mnm;<5|X5t/>T;-;#H;|@;N+x;@;4l;D:;1x<t1l<1)<l:d5<G<|F9 V<Mnx<,@<c <D@<=<E9<=ܺ;L =, =@:4= e A=t?<M=PL4|^==(m=\j=${=R==T1=,e =Q/=,6=X3=1=M! =X5>l9| >#9P;u&c >9P> 1>MnD>D3XR>3$[>L De>1s>We |>2<>H&c > 2$>.$>H8>Mn>܃d ?ԃd !?26?3l?? d M?p0l"c V?\#0Ph?078v?,T? . ?3X??-<$?=$?Mn?|e0`?c, ?Mn@$=5@Tc 9@6O@Mnd@\6ps@x"4@D#P@@@5@h9@Mn@_)h@43 A(<AH8|(A,,=A̧ JA 8|RA,6\A0"8uATBA7$A\=6A`:tA11A'At#x.d Ac B؃d BȻ .BД* ?BDw=WB1bB̪@$mBS%,yB}"Bh14BMnBe5 B4BW;`BQ+AB3Bt,tCH:pCMn/C/>@C=)@NC8,^C(nd oCT#{C#xCd#Ci*,C+C60C;2\C0CMnCMnC"c Dh:8DMn0DI'hCD?>hYD8dD,~;7;>wD,,D<1lDc, DL>D:D|BF2 TFt3aF\-sF=LFԉ G4Ȩe Fȉ1F@c  F@Ft9F@F8-TF0`GMnE @6GP&c IG09SG6(aG4J oGc  yG.e GX6HGu2`">TJ='J$5 GJc fJH8c vJc JMnJ+lJ`.@u>0Je JH1 J L=(J܁0hu|2JX: KL&<Kt8<&K])2KX!DNq( N.e N=O'c O2$&Ow@3Od<HOV*hOh7vO I>|h(9OH4(O|#<O\8O6 O @O9ODx"`O@S6OX#< PMneGEc P21P <(=P(|HP:3 VPMnpP5PP<7hP3Pl@ P3P3PT4DP(T<P"Q[=QQ4NQ49HZQa&tQ>>QR6Heu>(Qvc Q@'3QI#8Q Q&5Q,9@QJd Q܍2RH2<R4`%R`,6h4R3AR4$NR=,_R-dG1*<sR:}RJd )5XRq>RRX6RMnRH9R,<RMn SMn!S%@3STw=RS-eSz#0{Sj<S'<S6S@SD@pS0[6 Sdf6$SEc Sv3pT$~6T$<<'Tc, -TX2CTc u>(WT<gTMn}Tx T5\6c T6$TMnT̪ `TW/T`340}s,<Tp=U5 #Us$1UMnJUDJd UU6 eU:D(rU\2x_ c U4v#$U4H00U< U8 U8,dU\"& U8U54U`,$VXd Vd 8V5<2V&?VЉ0lKV@R"dVLK&<pV.\}VF=(V+ Vp'V0(V)c, VMnVX5V=h Wc  WM<"W`*: =W c  GWd70XWMnpW`@W'W~*D4W04W<@W$ WT@W.X`1<X94\Yx9d,5,XK5 9X`<FX :QXȔd( ZXEc pX0{XMnX%c Xp%xX$v3<X`1X5 X Q3qlu>X9,YT97Y@9,Y3884Y؋:EYW'VY=`eY44(sYb%@YL><Y (Y= Y62Y`7Y`:8YxS;LYMnZ|"'Zt(GZ0 [ZdD-liZ 8{Z[|0TH[8PX[Lc, _[Mnu[X6s490[l=[18[<14[=0[>64[8F-l[d-|[<\@1x\L!$\t8!\i"\̪6 \@;\$(c, \@< ]T-h ~d ]6.]d4 8]@G]<@`]!w]w!T]<;]p2 ]@ ]\(]:]@<]%x]hc, ]MnX@8^!c $^/7^tY1@^=$P^T\6\^=~^Pq)H^h *(^ܘ8`^6^Tx=^h#D^)8^Mn_^"*_@c 3_R6@>_Q_Pe Y_p7@h_@W(w_2__e PH>_._@#_c  _#_ c _X90_H:2_@`$&(`Hd:;`&54J`MnZ`hEd`72Xd \6edt=ndK;{dL)<d0.HyD!c p$<34dd<=d@d3dd d82+d(,tdl' e,8eD+0e<,Ee`!`Xe3(ce|V!Pye38eHy,e51(e5$5 $e24e@e:ej;f@f$7$)f# 4f,wd @fw3PKf6 Yfp+3LcfWe qfN6f=`f%0f, @fH@fe fA8 f5:f|4pf c@ u>0gH2 gc ,g('jX>6`Dj.DQjw+H`jP6 nj4=zj,#j<sk<*(4kԫ7?838ky& kP9lkL'Dk90kc k@k8,k`8<k̴. l@c l8|*$!l3@1l1>l$2z=Sl@(luc alc pl3DylX4l<mI4mx)mn,("nMn2n$;An@c  Inx94YnMnln@yc rn <zn+Hnh/n8 n@,n70nd/n<4HnH_!|nc o,3,$!&po9d&o0T/oTo>Io>>T[o0 c roMnAYlf5$o( 7hoH%<o:ot3oP1Po54ohc oX6o 54oMn p 6p@3 .p*LBpMn\pH4<opL<,p40p@p8w7,p8c pMnpi6 p* pc p@qke %qD$70@qV1 Mq `qx1 mqc  wq$ dqd  q,[0q($q7,qP'qg<qa!$r]%r#<<$r2l.r2BrP,TVr2`rd sr:r(x8X"drP_6r21r,b2 rWe r(r%24rFc sn:sMn4sy%Bs'Xs@_s%ss>0sMns6Hs s<sF!sD36Ls'3s%t'64tX<!t@7 /tc, 7tl<FtlU;HUt98ux[*,jid bẗ3<tt:4~t4Pt4Lt8$tT6tH?7tp@tL48@tc t(!)t>0tu;Dt7u@u8 X3uF!Hu:]u:|gu4ke vuX5uT1 u$8 u\B)huc u$=@u5u1v3vh%%v(0 0!c 3vȘ"<Fvx" dTv 3\vdB60gv#ȭ!vvK6,vt($ v=Tv7v*>$v4\vd vMnv *wZ:0#wz48w7$JwI;8[w#Dnw4H9lw=wH=Hw`:wEc wi4w/ w,5xx x)x'36xĶ-dKx3cx%sx\6xDe x80x@@xMnx<5x3(x:hxn: xz4y98= y@w=#yn+<4y +$>yb:Ly%TUyMnpy4.zyq( yy%8y$c, yMny(O y,4z\,|zl:zt2(z42X5 ;z<=Cz82TVzMnoz05Tz\:$zMnzd%zHc z(0Dz5(zT.`z94z-<{tc {Ec {G4*{@c  3{h-T<{L`"DI{Mn]{<=w{g5d{Xh& {+{Gc {#4{$c {9{#(|,4!|y:X,|Mn>|X5"R|$,h|5 t|X0$|=4|:|m! |c  |4|%c |L@L| 3 }J6t}-@<(}Ge ;}J"8N}\'(k} ~}l }:}Mn}Mn}N=} =4}@~l T|=~ (~ .~08~^1H~ s5X~@n~8eX w~@~~0=T~5|~r5|~@5`~4~̻1t~C3~07t~5 ~i%Tj08<c #/64 Gnd YX7Tb yc ut2|MnL5P', <5 h' p<9<`#PMn#22XC@9%F'c< TN4c\md l!2(L6,\%c $#4ǀxg& πc 9:~9TMn*|od <d=D0;< o(e ^8 `du>(t @60(0=,|=(ˁl!l(&|U==6-j"P>D.tG@(Z%c s .,{s@<(78D8H781P‚@؂2,8 8T5"~*T264>@F7U4 +e 7sPT1+TG3Ԟ,T>ƒ#7`̓Mn6 .|@#,e ([)$8c R F84\b2pMn,<.03_2dʄMn݄L@`"*A 3`.%I@<-?aL@nT/z43@?!=R8<\4: %9kMn{1$=49hl@Ec Ž@ێxc &7`hÏ1 `lL9֏P:8.>@4H$/2ؿ5\6$?6X=2p9$Jd)Y0+< ec  k c  qMn}=42Mn̐T|7Րt2#$w#Mn=|x@8|d2!#H2MnP^(]@dp6`wc |ucd ")H%,G;HőP1:`֑P{4di<896p86P!:,-478 :JT7,YP5(jH%7`{" +<$ DP=5@/!h˒l;ܒ4h:LVd 'We *7@6@Q TcD~>{#hGe *̓l5le#|S)p1lw=#(+@c 3`@D"6HX+dŕx-pӕ|9xEc ޕ$ !$ƗP \ԗ c +Mn|,5p)Mn>l\(LN|5$]L$6j(9$rMnHVd T+, -0:4+,טp6 D(*<wd<e }3h  (c /HK6t>&`!c V|)!Dkxc {%<0@Dc d9$q:0`6 m4Př\',֙&:DS& 4H-8Y"d#= : :I7TU6ẽd v$+:P=pT3,?6,Ú5ҚMn08  a!!"41v;HCP.|V-`L e 2ul@6Pm:4Mna2@Û@2|ӛp;6ޛ00c yc ,*0$4! (H1968AhT4StH8 xu>0\Pd f{7Tn\7l 6p,44#X$i Ɯ,0!ל09H,5"&8-!H0l;_?sl"<87,$<ԢBם6h'(9@c@ sd ':X?.e Lh,bMn~#/<&3W-DL5$ @͞H=6ڞu6TB d$( *x=T3c ?`*8L|x:\^#|İ+ MnMnş0|4,ڟpHe 4 l= =/879@e F0$V4?6Hh$.q#$}68{2`'$x=ɠ%,ՠe J9e ;>\!+nKl:085Lj(,cF=dtԬ @5!L?6u>0hk;ҡMn0&c 75(=@<V$@Hc  N6,^Pd nBx14HL7c ,e ,:`ڢ=c  <D6|%<=@#$P%x]Y<<XMn(: @k>@MnMnݣx9&<< tu2#\*#@: =U5fMn^6Mn}4v äc ͤ3,:=7=\|48l6$5,3=$c #nd =e@<Hxu>0[w@awd l7~/.d3,d dld G0\ȥ5P`h5(ߥH;4d:9D=L6 ,<% B+8bDc L18e,&s4&L~|43v 3Mnɦq Ӧd @ <@!8L7 5-F!Hx;(W60bH7 t\Fe |j"`c  87/>Tȧd*(ӧ ,<MnD=H\=!-w3:d J`4dY=0v6p؛,\-H=6d=6>˨=,ިMn`De -:"1`-|He <<:,I`,DV3bhe #(qI6h e 4@(|:ϫI;߫* 4p$PdQ;p: "D4(D0h`96+xE4 [42$v1((4tܨ:$MnMnЬZ5$3T1$x#dH6*#p8-H(8|Q4#(f|4<=6q:=_:H}8. 4Y;|=,1<v>Ǯ6ڮ\&@5$(@T)>h-h=T*p=LA0ke J@4\[Pr9gT=l,}4, 047l390 6P $8ٯ` :|@ X2VMnp&9$||[6`J"<e 0@=0ٰ9xl>P$\ߵ0PP4Y4t}.D,t)|,d:'T<jMn\W)؋'<8/ D 8ڶH7>  Pd  =!q#(*8l=;T@`iLX54y=442(tz11ȷHA5@طL&|4%c Tw!(80H' 7dH0Dc  O4$>xl($6$ :TG!d42Mn˸0\p'c, xN+ظH.DH,]lL8@fc p=J)4źD5ͺTc ٺl:@,c0 2h,~=8=@ԩ/.46@LMng$(o+D=9H8v $ c Ȼ(6P߻O4{:D6$-3@M4\#)@4Z)TR7DľH#Ծ#ܾ{c 0|Mn,L!8H@<,T9>;/4E6 W|E8Pb |,e Mn8Ec 5!d(c, ɿ3 տ)إ9<W<0Pax.e c nd8|v c lH-u>0X3L-H $6@3@@080 = Mn/MnKe7 V!2(h{1X|؃4p|00#d^1&l\=M*<$@L: 3,t&.Xc, ? d WFc g7 w\4408Xd 8 (4Lc %c r:0($  :#:X%";7ID=8Xl"tg>D`$9-. P'c 04$Mnh@3,,8dH >Ccp Ic c1`rt.,~? !74 8 c8 9$8'@e \ 9TMnH$$ <></MnU*o,-&7$Z0-`3P29/Dt49 c Ģ8 . )80P:x<6Ju:XW  dl2yt60 40dC!9 8;9 =l3$4H10!8@%2Tt"f*0qxf;p2L.`[( &We 5@>Ud Jc Q: b54pMnc %c +P.LJd $c c < |8t:0 c 'Dn 88: G'(Zc dMnsc T@ ,=T$?>2 1 Mn;TT"z dX57:>X]'(wd 7:Q"Np6x[r-ij.Ps04@l0<d7MnMnX(&8/@@xY%(.8\"X@7<AC!O=5]H%c qs8@03`5"0w=3s+x(T5h5l7`V( \.9L)DDcp 43B,Zl>lMn",e Ȩ,X7(`|=8<c 8c Y =-P ,T[T=kw!<L=\ (C!<3`-@@64t=Jc  * c  5c J@=Ld c, m $|0!8X94@ Ec p.e Mnc  5: 4b9L4*-MnL6<U.c1Pp"c(qKc( xP(c, d; =4@8(T"0.8 GT7#4|?e c ^4  759,A &(\$&c m*c $6sd  c 5: x=8c, h5h|A<14.8 @"9,-8*MPk-Xo:4{}5;4(x+MnMn *78x =#d40;*\Mv#,.`5 xlW5Mn?6 ,(T=T%4,4:L:#6@2MnHHJd Sp()]3,g5?6 .e l;0f<02/.$,$l 8Xk96$t#<*DIc  R094j? w`4~į5@Ω3.$J"(h@g& MnX* L")A}( ;*`PX5ZD(e(4Xqe(  |5xD5\Mnd7>H:h6@Ec |68!43.2' x?8Q4aPVd nX5wMn+!pd |:f',:5354h|8hH;@:!$2e HMn`88n*h}05D$D@B<5DH;D7`c  4c @c @6#D($a282XOH1ZT)he,;u%c Bd $Mn@# X) 8>W1Od=]v<`u*4=@\t8Pd:49Ptc, :0MnP=4|c c *LU0?\ VTT4o }90_:p9MnG((yc  Tp6X3$8td2 u.D<%P-1@(M4YU;gP#|wd | q0Hdod w:pMnP7,'3Ec 1[6D #=/4@L;dh DDc Rc \u.hh:\|-(5ػ:$l".e 4=$Tg5PMn=,@ ,"Mn?V=4]x*n`F5 |c h5,8c c e X!H+<,("<<,Om;`a"q0,=@Mnc  :<{,P;̚(` ' < <  :%d*x-7,2#(IH8R Y:dddz,yD\6#܏5=(Mn+c ,5xu>0}.D 1*< 9,84Td Bl@W5fx-hx@=@1\u:$:856L-e D$ 0;l.e MMnc%,s:@440v $-xc, @h(E<4Mn Pc @@!c /tx,> +JT5U@\\c sDc E8Tq8 U2=H2( W1Ec  (,d =@ c ,e Kc 6F-8BL6L<^%pp xx,9M; S 2d41tMnl<8'+I9Mn?670̤&H816>85EDWd ][=xo+,hi<c 49p1 t : c *xU19LT3 ]=`q$4t|D$X7Hc, d9D?e 42ח0?;8I ZX%(s#c =(T=:8Mny(\\l/L4 @lt#J#p&( P=MnTS4de!\vMn #Mn7XV(g&g@w .d`*@2HL8Lh5,"p((, +@5$<4X $\P'.((@<Mn^|6Phl*@vxl< t8\x%41P1f= =`|d(T5"g5;>+>$N(2a"m4($~Mn Mn<42c4 X%c 4Pl.td603'@@772d Lm" %c , vc  =H3DN4eP R8(W7`p4/8|&8(\;Ԭ(TMnQ6P ,@9xMnXj=+=o8!p ,856I`\@ ud( ~Z*,Tt 1 c, h@X,L3H5845:T $(18,DIX}44Uf=Hs <,c P'X7!We :@|4,tL-|""le +HQ$B#,[@ic, td c @,c, @e( d+'xؕ00@*4` :%@ =@6$Mn>4$JX1|X:g1pH)p34#`LI&#(6tMn$1 8 @,(,;;EL6@YMns3}1,6\!4MnI@t@(=ܝ D@+8|"(c, ,T66,(D(5O@)]4z-n:w`g#hEc P;T42:,.l+x l:  5X 6 3`H f-0\ )p(@l 0X!<  2  H; P@ # :L Mn X7b:4  +\ d#H|24 8( \=66 T <O @\\ )(<h D8L} 1$ ,|= Mn f0 %2 Xl  l= @ 4 6l& ./, 4 tj"8C 28R 0^ 8k <@v m" h(` c Mn 0) \0 # Mn- H9A :I |<<U Mnh lv y ċc C -( |r( I!| S) h6  4( XH!0 *o%  (d4 (W9A e P 5hd Mn| "P  <=TIMnb-r1,L'(pY:.|l@<@ e )c :\(!!4[%B4X-|QMnnD%$(,: p>x}<i:l Dg5Pc $-=h&D13MnKm PVw: `xHe  r9{#D67,$:24,l̀5tMnԚe w|=H@&e /(w:L:L7TL0Y<;jDo0`u8:#`6d$ L((H78<0t@Fc f+l u%0-&'TP)$:x;LCL=0^H64kh5Pu8@6 T5}<0Lq8 ]7$<d$ @\Ld 4P+@*:T5<8P@P-QG2,_)4tl.MnY5dBI@@R4\d9/h3x51@.c  73$A#$Th'c ]m"nx*>d}0dz2D!&T #9 x<@Tx:(^)$ xč8P|= d L* %Mn;ԇ+pEMn[,<cLW4uMn# = 6};8I@@ZMnt$@x$8!40=67x:@9o:N8TC  Mn6TBcp D54O$+>td18yW1 %LMn<% Mn e <c, h&X @ ,0!Mn4 F|~!(VMnl|31vc   #$Qt:dX>#@u)7Mnxc %Mn x` : <53=4<\1,Lt=;[sd o?8x/>0(#D5X@c 5080,H0d<0@%">3tK,2Z%c pT:$~H=* Mnx6T/=(4 nd  042\0\\=6"m+`+<|=c Q#m@c u~"H04< 8(: 1< Hh84&Mn'c C|2U7,q|#,!9&`U:8\&7H1dTVd L9$ @ V@0 4duy 209 =6F ܋ Y 89;X~ !c Mn D*8 t< =4 ̤<   !=!4P&!Ĭ5$7! @xP!|:`! 9g!#tw!< !40!j@c  !<!Mn!ċ ! /2!8#" e "10+"L5"@"y=,W"=h"<#(y"$@"6 "=!"`c  "4/x"x+<<$c " 7,"\."d #<#4'#:4#c B#c U#ܔ.0a#),f5$r#L7T#<,# +@#X10#"@5#|*4#X)(#x <#@@ $ $$o64$,e K$H:/ Z$*f$P{1r$ e $Mn$819$=$&9$85$̶6$,($'@$V"X %g%0%5)%Hu&6%,PE%*S%d c%c, o%d:%c %70%(x%|c$ %w38k9%4<%Mn&P<;&Mn-&4 @&1S&h:8b&p5@o&6 x&D#&V)&Mn&x:Pa@c &Mn&"\&*P'h:d' c *'@c  1'xc0 E'F)N'.]'T76l'<{'4'd4'Mn'\:''3'"0'L-H(Cc (K8p(H,>X0(x6H(d X(Mnm(!(x(S&(@(D8D(Mn(8/9(u.("(@?e ({,x)"+)1h7)4@F)c  N)c j)4i;y)64e )1)T%):)h7l)e )\=6)Kc )l[&  *c **:9*P;@G*(:,Z*81l*4r:H|*<:x*8K4*'4*82 *S!* I>*+((*^e +,+t:D(+ 0+3<+0+m>+t<+Ze ,Mn",+A),Mn>,`i3 F,Xd ],$0pk,{*Hz,ح@\,"l,&P, z,X,X (,W;T,l#`,-52t--D.Mn-.Pi38.$"\G.4 0R.X&xe.,&c z.|9$.2.>,.(:8.7\.Բ#$.`. .q(/@e /24*/`c  3/5P/\{7V/]:c/X:ls/p:!T/O</$41/p;/L7/%</\\-T/0L800O<(0 9h/0,c ;0d5dG0;S0L=,m050(# 0m@(0<=0c 0pd 0c 0u+`0c f%c, 0}9$1-(1:"1Mn;1#tR1De Z1,Li1*c v1 19p1T1H1:1x"c, 1l=1L$10cH 2#d2N8 2:x<8;x-2@923&P31-3*A3x:TL3G( \3"t3#3|G@L3-t3(;l3|`8H3S2l303S=H3D(73l"43X;4G4h!4l.34-:t>4 e M4#(lXy& `4b"m4d`&424904(S64(u>04HH6d44j<48R;\49T5e 5p#)5h2 :5@y)H5%2X5Mnn57>H5005L0L5Mn5A85l'  5Mn|=45` 5F(  6P@(6$\06%DB6R!hW6?;i6(5\x6T ,T68>\6546@d 6 7064.6,.6#6,T6lO:\ 7L^.7@p07$E7Б"0V7#j7|#~7* 7 X757Mn7W1X7L3.07@c 7 6\ 8`@(8Jd 8I#x787:B8 :U82 `8c(k8,8 8h78Mn8=D8Hm \8t2 86$8c 9l',89Mn#9 $39(c, o =9wd I9c, P9Mnl9x7y9T <9,H9 He 9=Xxc 9$:09P(6X9#$95 :$I@*:$d?:8>8\:J n:-~:He@ :;a;H:g7l:Mn:<6:e :nd :X5$;ܶ@&;h-9;9@P;h@e;c s;`c  |;D}.@;h1;F(;#|;4&>"<> > W>De ^>2q>m5{> e >x6L><&>@5@>i;4>c >J4>Ec >,T>2 ?3?,@+? =?&R?)P]?3xi?*pu?L,?=,?$?l"?0K4?Mn?*H?6(@`5@5: @u>0/@5 H@@c D=6 \@4<h@Mn@@9<@5h@2L@8d@L,T@27@|" A@%hA/A<@A4MAT5"_A>6lA 6Axh& A@A=A`c  A'lA 42(AP@ B%Br5  B8&8?BMn[B;5DLj;MD0%$XD((6 eDL8vD&DP($ DMnD@D4(D=Dp"c DM@D4:,E(6EL4,E#L>Ex&tOE# TbE`}c vExy& E 8E@ELv:TE2HE=E 6E/4E98F6$Fc #F5D4F\2AFt-($4PRF20gF2wFBF`%|Ftc F+>XF38$FMnF$c F8/h  G@<G#(G=7G<4dݳ2T@G=(bG@ e pGX5zGt2 (4lGMnGp|74G0&c G@,G8GH("c H@,H ,6HMn\H: qH\;<{Hܸ H@HMnHT2Hu>(H@&c Hc H$7hI]'IMn'IL\63IYd KIc fIMnI7IX7XIc II !I,"c IMnI$S!JJ08J9|J .(\Jf#zC@4PJ8dx JEc KMnK|<)K4:P4K`1MKMnkKHj: zKT5LK32K)K+|KKMnKt K Ln>H#LX8|+L<@BL(@MLEc [L*xgLL#sLMnLHe L sc L/7VO6H_*AL9L#dL[0L\cD LHE9PLD&c M46M< hMMn?M4{"dSMV!( mM,4\}M(4M(8 M?e =M.5 My9|MF9Mx<MT (NtF@LN \'Nv>8NMnTN$4]N+jNDc vNR(N#Ṇ.xN|+lNX5N%x+5 N ,<NMnN:,N 8O@x*O XU < U:/DU<UK7DU 5pUxI;U Vh"c V %c +VT~>$8V&<DV.PV8L7L\V6iV2+c, {V>Vt8V0e V%hV 62x p]e VD"HVW0md WW{4`W@xW|5:WLc W3dX24X8:`-XH5\9X7IXt!$UXc kX|<X |XT.LX6HXd=lX 2Xc  X8Z5lXЅ-X|d0 XD: X84 Y$;6LY5$0Y<5d>Yg5PLY4c [Y4diYc qYxJ YXmd Y=TY&9Y7Y=,Y(:2 YX5YZ70Z3)Z=hBZ[Z#|::nZ5$ZMnZ4ZMnZ>;Z (ZP,[px<8[,,)[>6A[Mn_[~9hm[1x[TA1|[,e [[#$9d[c [6tW;d['$\[H-[@<\H6@#\|:D,\x: F\/7M\-`\' p\%,z\1@\8,`\c, \܄ \(L7\<6X\=\L+\ @7H ] h(]<7@2]%$E]0.hHZ"HS]c  []Mnx]$;]S6@̨=,]td ]Mn]<]&p]he( ]T.]^@^,4'^<5LF^d;<\X^(c o^'^$^l$|^,e ^T5L^ c  ^c  ^XZ2 =^P4H_T:T_Mn<_5DN_X8S_n)hb_ ke k_s w_h,_7@_5_Dz7_@<_\.e @8_He _#@_\<`5`(~*1`tp:;`7O`05DX`-f`'`5`4T`1H`|:0`/2`,/24`D9l`Mna܃2'ad#l5a2Iaxd  \a'Lkaa4'(a!c 7u: a@;a3ad@aX4aZd a@b 8tbn7*bBb8%Jb=,\b(:cb(4qbMnbMnb#b &c b,.b7TbDZ4b8%c bD4bMncMn%c0d/c8T c Bc 6Xc54cc:rc<"cj7\c 4c,nd, c7c8#<cMnct*> d& d(7+d+(8dȷ5hJd($ Yd\7ddd',mdMndDc d1dc  ddMndH07ld0"d 5 d$2eW&e(106eMnMe ae?6se|;{e0<@e6<el4e|:e`7,e8 e5|e,6`f,c fL&"f{,8e 6f4'\HfMnlfMnf7,fc, f,Tf^!f %lfMnfHU10f(# gM4g5gMn0gP=?g48Kgdg&1V9T\g5hg9@ugL4gc gZ5(gd=g5gPgX14 h=6 h'X!h@h"Sh ^hc  eht:48h h8Phnd h,F@4h#h Fc h|S4hh-,Y=,i#!,!ic  ,i0De Zi\42(ti$c ii{4i,+$iDV5(ind iČ9it:djT5"#j)7/jMnJj=aj$7yj`=jf=jx@j@"7\j=j&Tk`:4k0kMn7k400@kc Skk*`k$-$okc kT}c k60kk1ko5k%+<k0%;dk%c lL+`lq1P%ll%c 3l1Bll<;NlT5"^lH <jl\EXDnذ#0_n1\mn'lnz" năd H n2,n499`n$W7 n<4nx.Dn,= o9oL4@"or=L5o",Do46(Noԛ-4\o5 jo@ oMnoH =ho04o@c o#<o7o/&oo:|p99Lp+>%p@8p06Cp(t(m"$,tL54t&PLtd _t0c ntp7htl8t.t4@<tt8Pt-Xthe t|n9tWe tMntMn u:uT5"3und Du{@{ {m!|D5`'|lp8 7|O;E||T4P|@h|`i(tr|Mn|>h|-|9|*HUFc@ | %|N- }pw=P"}\e -}'I}Xe R}8]}<w}30}4%}$@9}3}М%h}tY&}Mn}H"0~@~p<~(c &~t:|4~LXx4,U;3pL090WF58c3pP:! D 058T Nc  <4e H `t'd5,@M;  00/Mn@Dj(HP0#Db=o,4uh.e :`t6n)TԊ S;D̀l4n5X 4n Q;TXld (3\1c E L5 Z.8d-s 6\q (48t*@T5"h9,Ł Ӂc T d<1t4PV* 1!|c )L<\:|6 I@'([J;h@,of6L|Mn@d "<Ă:P҂(3ނd( <18c, Mn &870&A&pU:ap3LtMn,09А8l=(\@,tƃS"׃#4=$8l#e +4d>`p8 N3Th*d7$nE1,m@(Fc $!@=܄Ф68,4\Mn @j$59lc (0p4Ԣ=LKMnbJe l06Pz1 Mn Pi"0ц$<܆Mn e t/pc, x4*;;\[8 BP·T5"7(><<-ldc (28+T52#hCT5"Q@i40@wL/>$cy8*ADMnl@++ˈ2Mn 6t(:h',e 5'c, >,(G[e Rwd `8= yMn * p\:@h<ʼn:,щ5MnP3h,e ,%c Mn15HX8lP@<\>2m`&P9</o9T0#0ЊDw30Q7|+ ~9$t -1MnQX; \\):h98|q>;~4@ x2lxu>0`'`@,ȋ@(ӋMn44=:Lu:\30%:8"@3e 4V!PMnt2|@D<:Y-~=0ˌs:ٌMn7, @.t6$ T5"/pV9d:=8J$c V :Dc),0u"P< Ne 'h7ō6 ԍc, ߍ=;gEc 01,pcT $)(H0,#34?Lg3O|((^H8hhﾭ{v!"8q8hT5$l@ՎP0428,2 h(54)h3=4$4AMnXXR6@f3x=D75e c ʱEc Mn7,ˏl ݏMnXk=v D631(ET"c TC!\U!j<8,uv;4%c 6 08 ;$c ̐l@@c, (f: 03l@4@kd r8 D/H;<:d; XRMnje xMn )4[d d ƑL3ԑT!>7<Mn,($h5$'c 1|@?Mn\$"c jMnT;$=D54Mn5͒od * lג$c ޒl@G->< 3-t.:9H9>JXndH ],hr=98L4<X=4D:R2HƓ3ғ+:3  1h3/T88CLO8$ R5h}*z|=;$ 4c, 4,c, ʔw:TՔ< ,<xu>0X)c, # d8'T0h0MnJC)V5|pT 4yp*(8=H,0d(,@.@<|,TGe ĕD+8ѕ-  4@$h9*", -@; @O%LcMn*8h5$\.Tl274Ζ-ٖ8`p1 _==(z! Tq: <&8c #MnQj0yTw>` 4 nD60><:h':%c 4T—dN(Lӗ%c #@ Xԟ,,wX@6%,,4#x9 (OMni2}3!F-L-, v>|˜0c Ҙ\%!,eH!c 4#<^X3HTz:1,: &`-5P9D>-Sd1Td#p'c |Љc  7x$ e T*x x4+>T05,ۙ7c  ,(% Mn$ +94@H09Q@*da\<mP=32̤0l ,'6;>TϚ4 ۚc =(?; :(0\p!J,!]l=;i\5$~&<=1|t@X56\6LΛZ<`HR:(:0 .L%c --:U;FI;@S h2{MnD{1 u ǜe Ҝ:ߜ@=43< 8c U$) @@<%c L26p\ (3\=iB!ut"lD.@=\c  Ɲ"ܝc @Yd X5" L&c 04$o: 1x'Q-(`'=4 =LD>LL1,Ξ)֞xI6h6@h(tm(<2$ M54- !49e5dC4=MX3pY[1H*<*mH.X47#4R"ʟMn' 7\38R:Թ6$c *X@3l;L}"Oj2dgc r6|"@|"85la1ĠMn{48xa)"3d)Hd74",-18,(@59I2UX3,_Tt.nMnq>0MnDI@ơk%,֡ ?6Zx6=$26T;<6<H=HSpM9` .| Mn`0hc Ģt7u>(٢ 8t,+ D$X (|6d($d :=Wc8 nTx P u9 0܍e k!0!x,,290=#Ep6U<_y!q&H5 Xxc 2$¤ c ݤMn$ܼ8@j=)h8 8$ Nx"\l=y|,@0#9X,D: T5"˥; <ޥPt8 4,D6HCc DO L&Mn@MnZ@,(lMnJ(<$nd 05$<4PӦ6P38:5Dl9ptd ȥ &.5MnS@c \4h@c w$c  e \2L=$t"Ч|01\٧Mn#D @c +c 9x5(Hnd YMns54} X(68D$D>MnѨ|,8@  0D7@O<\6Y@8f4D|l9L?7  6 MnN0ͩt c@ N;7lm" 68H,L)We :@ Q@#d!4k(:~Mn0:784Ul]e 1˪(&c ܪL?=Mn4L c ( 98c H|.e Vl5`jg6 s8x1H14 U6@ëx5ͫPJ ګ@De ,284H5dt:(4 & "7p1DE'V8`\3o(zX5@\0MnάD :4':4p),8Mn h& ,U(;Y0Hp,tU05pd\s-Tp6,5,9tMnhG!xǭ#4ڭhc  xd&c d;/P8tB<n1/:8<c 3܅ 8D6ͱ8>4 X! D T9@Mn>)6PH*c, b@$4x5(u>(<|9T(c, nd ԲD84LMn^e d (L@Od;0)̀#=d Mĭ'( @<> b=4u 5l#@%X|5e ų,Hг,=@س-x[%H9 J!8|ܡ $p!'Ec  =60>)(>@P#|`6 x:d؀p#V41d=0c }|<Mn"wE8y& ˵`3n;D8 10g-2p=6(EJ3`N4 WMnx\=}6Фdx 9MnζPj=,v<hd 2+%@51@89<&c L,@c $y5`c7p1@l 59e @ѷB(c @pMn2?<=38I|s: T,(]Mnw0W1T8(ȧ6D4,$ ̸Hld  ׸t9,@-dtW$h"L$=@g;N @fXX0u48|2:H5)<9,& ̹>D1c 7:,*`Q$6 @|<aMnL5"p4$ޱWe l XA=Pͺ*xܺx3T7;L#Mn9"9?D#HR&6,aD%Do$i:K4H"$|4`=0R<5 (Ĕ6X5.H@k>@ϻ 1.,D# -K8|4@t:$@4#<U >4n z>Ht:P. d c` z1P˼c 0M;69 *c  )T5"; 3G96OBU80d\78s \2|3x<=H3c @ǽ`@н G( <1#t|: RU6P^0<; iO",<3 L c D6ӿ1 h,؋=@ ;< ?6$ 'Mn>t,dLT ^07!\o, :0H,PD3(V68 |D==!c ت6`"3$9=BMn]s i+@vX'c Mn42,@_e l:x`#34 `C;@=.7=H;=HDMn]c m380P" x=L9@e 39T$H=y<)̂%114A;+ Q4&9487c:s5g& %H 2<d*@4Cc  Cc I6*04-=(5S$xA4@WF(He6DzA96|d2x%c =(945,54e h=Mn@*>4&Mn@{9$J1 [#lqL=sc 3MnS;x&`@c 80`<Mn`B3-<4;&c G",Yl4(nMn&c %,MnP(u>(E;s8p769]!\|?6$#`6L5"G)c  K=8@V#cgJd f|0pn7}(4T"9PT}64c  W1@R>,tz3,hUx:i(d<8$t (+X9l<Y=0[6gPZ)p}H9\Ec @K4W{#PD)5l7,@ H% <3 4S( 5: )8*t4MnKdr/@̔"Hn4@4*M@Li5h`ld  # R>,:3(5'c ?`&c Nc Z Y!tk D@(6D6l@{= h($ T2l  #(l4V60l6$x ,;4hG4&c Vt=Dd8i5$t8!2D49$ T|w! !|-<v,X1p Mnln:,)xc 5 e E\l<X .iL#}`I0@(dܡ0 Mnd+.@@">$]p=(z t6X$+X6 ė*8 'c $sc ..P+"T<21>=X<cԜ,vMn(D5" "L4/T;$9=Mn4ԥ'JXc  \u:Th;Hu>(wy:\<7l:\ld `.58h  c Mnc, md, B7\Ti.(,%7@; K@{9L_Y!(v#hH&H-:Tmd L5"W4#4"X#2P=B2W 2Ljc, st 8d @c, w%c V0bMnx(:\]`v3<-4<|c, B)057 \c $%c %\{c  }=`Tc$ d  %c MnȈc 04HMn5 (E49-DR%P^%@n:\x=!X&c !34, d z# 5h~!l < 0<8":71H 8X\#k"8{`#xT@&*c, <+d-8d@(` _e  eP x\:,x&l8H-lJc, U%(i(D<81+<vc:8ke <Mn@"c Ђ+D8Q7Ld p<$#\|*x><5P :_Mn\)!Ԭ7\*@9>2dN0>)^-9lmċ5 .Mn}9T;< (8!H7; `%c 30,TK (=5S"$h_<3i7:x46'hpx2 4=(c  |+<)7(ȹ'o>4 \@6 +HC'c Up6 cd3t(c 1` =e 3r<`5P`<$58P$> tr!_7`9H54  @(-Ec CP=S#c0=<~L;<P(<M,(c"h+$ LCLF4S|=aT.e pd8{dmd  4/@̫6 >!t5 lX!X%0!.Ph d. "c ?2I<QW4_P=ps>5p6c, v,de :<j6PO 4|j*t 1\~"D67:\GF>O%p]<8m54(6`j7:,g5\ XF)tMn%c \6T<x6l 4h3Xw68Gme ZX4Lf,x,H,,L9\+>!(:T69T#,&Dh0 (0@;5e D@: Kd.:XR*#li =<<MnXT$pe Mn'HMn Mn6@K|:,YV14d3tc w *92<[6@8tD#@38We 10,c BMnmh |.d6|`c  v+dئ6@D6\Mn0N*0`G+[5  Xs100)%c 0FMnYS(8n <,}L c t@00H6dk2"<<(4:4X86'0d848I8`R e _L4<k@ u c d%c xF=40;546d6c ":07X9@/ )<(dF@/0$O4 <5(H4DT0%c gMnMnH-  Я7<1,:: 9x@K0r7HZt$p-{PBc <=,(@HK4P L_"pĿc 4 :d>, e =:X,+97c, ?6 IȌ [$+nMn@c 038 Mn(d |4PT(m-X %(1t.c ;<.`F@<Q,6 k@Ht5,=@3T%7(\1`Tj%x%Y16,e T:Mn3e 8{.TD=(QH5]Mns: -6<8C3(dV$$MnMnx&  07|Mn3c G܌ Y;Lf(y:$sD>|V1@07 H=8}:`#0'PCc _)!=\1)Lo><D>dCЃd Wc gP6w%T"c 56\T&@܇'tc h6Q&,X6@@)Mn@k%`N,6Y,l88we t;0C<`<&<<+Xu#ta#A>xZ2hv87,H@|{1 1l: %434D6,Aй:Mx4c:l&5@qMn|c 04|+#04Mn(X6:# F)x&(p5381a( |Do!lX&6,gc w ,,<xm.Q;P@Mn:(0(Mn!tM"*S"P:<H`:<SMn`}%/Bcp 7t:<+c 6 l;:5NC<4XEc iMnC T"8ȢB<8T5"We e T<c *@9d9AW(XTMnk &c zD5e Mn/Q=D̿ {-0c  ./((@L7d  .X#yc  :c Uu j_1<zt +\Z-7c '6 Mn70\.l4O:8^!|@,6 <*J2La8q"Lh: ,(*&`-08Ec @c {9 <.$%x6č%H@%K"[ `)8m!c 0XP"ܨ*';0i" c܁c 4h8 h-d3p=7dc, =G <N+ Zإ,Hov6x~.,{9d)dMn9pX.5T;&$#45Kb=,0Dc X4peT0t^e }@$V$ 638x|4<90c `c  H#į:54)t6t6H5H8Q(H;@_8e h,# @I(c  'xho.^:\@Q:d c  (5(8hc qwP9@3I2$Bld R`C3_Mny#7,,@W6,L:1X`@L4< W6@ \g( 1- <0: 0tC <S 8/i?h7(c 2(t Mn |4 " $]: <:| Mn 4  45 Mn c ! d , '9n66  S<E $1N @c d \5d L6X'6L,060 T5"""$2=Ad P8X1]>,g~!dwP'(c $$TMn|"8S(8/4@l5/'G"2Wd3g1Tzx= 0c X! @|5`"h6T'c Ze >-H88`F@.F@>Mn^38qc$ T)<< 9X:x70.xMn O("/4Z2@1Hkd ?|#(U &w.8.tT5"Pg&؟5dd Mn6=47Tv<4u>0,p& MMnx4Pԇ (X,&`3=5,E-06&*@6Bd TC YA) lTG8 uh x.=6,Mn8:X5'9L0? ?'a"q6H5409$9 h D4"c [=4f5P!6J!4\S!Mnr!-!5,9!Jd !!5(d !Jd !d'\"h18"$c $"D*<>"o#J"Ⱥ0Z"X0,t"<""(<"0(@",7"'0v,#E0%"".l"@nc, "03/Цe #R9D#t$5#40(`:|(%7$(1@(5 )d2)=7) 9>)|;4I)Mn_):k)N-hy)c s܁:,)Xw+,)h3|)X32T)Mn)= )11*Mn*+@lmd +*Pn-t:*b@P* |74^*$0r*|,|*0H#*Wd * Q!p*Mn*Mn*$90|:<*?74*,)c, *Mn7L> +,0+L )+T.X3+MnO+6\+d p+Mn+6@+Mn+@+P)8~T + 1+tG;<+@7,̃6,L40",5\4,d D,'8V,lF5_L5d, 3Ll,9Tt,l1,Mn,Xi3,c, ,؝.,0@, .,?e -Mn -L0c --@X67- 6G- 6U-@xk-,3(w-4De -D/-+A -p L 6@-td -#0-1`-< =D.p+ .@<.Mn?.4o"S.(9Lb.,>r.1 .&." .=D.#<.8<.$ 74.2\/=(/56*/3DT0&,0%c 80MnN00&[0Mnx020k.0$j%0004D0L4050a700, :0: 08(p1Xw; 1Mn!1T 9(1h$-$;1@S1 9\1M&xh1T7{1]71